(data stored in SCRATCH zone)

EMBL: AM269955

ID   AM269955; SV 1; linear; genomic DNA; STD; FUN; 335637 BP.
XX
AC   AM269955;
XX
DT   28-JAN-2007 (Rel. 90, Created)
DT   14-MAR-2015 (Rel. 124, Last updated, Version 5)
XX
DE   Aspergillus niger contig An01c0080, genomic contig
XX
KW   .
XX
OS   Aspergillus niger
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
XX
RN   [1]
RP   1-335637
RA   Pel H.J.;
RT   ;
RL   Submitted (01-MAY-2006) to the INSDC.
RL   Pel H.J., DSM, 624-0295, P.O. Box 1, 2600 MA Delft, THE NETHERLANDS.
XX
RN   [2]
RX   DOI; 10.1038/nbt1282.
RX   PUBMED; 17259976.
RA   Pel H.J., de Winde J.H., Archer D.B., Dyer P.S., Hofmann G., Schaap P.J.,
RA   Turner G., de Vries R.P., Albang R., Albermann K., Andersen M.R.,
RA   Bendtsen J.D., Benen J.A., van den Berg M., Breestraat S., Caddick M.X.,
RA   Contreras R., Cornell M., Coutinho P.M., Danchin E.G., Debets A.J.,
RA   Dekker P., van Dijck P.W., van Dijk A., Dijkhuizen L., Driessen A.J.,
RA   d'Enfert C., Geysens S., Goosen C., Groot G.S., de Groot P.W.,
RA   Guillemette T., Henrissat B., Herweijer M., van den Hombergh J.P.,
RA   van den Hondel C.A., van der Heijden R.T., van der Kaaij R.M., Klis F.M.,
RA   Kools H.J., Kubicek C.P., van Kuyk P.A., Lauber J., Lu X.,
RA   van der Maarel M.J., Meulenberg R., Menke H., Mortimer M.A., Nielsen J.,
RA   Oliver S.G., Olsthoorn M., Pal K., van Peij N.N., Ram A.F., Rinas U.,
RA   Roubos J.A., Sagt C.M., Schmoll M., Sun J., Ussery D., Varga J.,
RA   Vervecken W., van de Vondervoort P.J., Wedler H., Wosten H.A., Zeng A.P.,
RA   van Ooyen A.J., Visser J., Stam H.;
RT   "Genome sequencing and analysis of the versatile cell factory Aspergillus
RT   niger CBS 513.88";
RL   Nat. Biotechnol. 25(2):221-231(2007).
XX
DR   MD5; 877d261ea2d4818df64ef4991cd41c07.
DR   ENA-CON; AM270980.
DR   BioSample; SAMEA3283178.
DR   EnsemblGenomes-Tr; CADANGAT00000188.
DR   EnsemblGenomes-Tr; CADANGAT00000189.
DR   EnsemblGenomes-Tr; CADANGAT00000190.
DR   EnsemblGenomes-Tr; CADANGAT00000191.
DR   EnsemblGenomes-Tr; CADANGAT00000192.
DR   EnsemblGenomes-Tr; CADANGAT00000193.
DR   EnsemblGenomes-Tr; CADANGAT00000194.
DR   EnsemblGenomes-Tr; CADANGAT00000195.
DR   EnsemblGenomes-Tr; CADANGAT00000196.
DR   EnsemblGenomes-Tr; CADANGAT00000197.
DR   EnsemblGenomes-Tr; CADANGAT00000198.
DR   EnsemblGenomes-Tr; CADANGAT00000199.
DR   EnsemblGenomes-Tr; CADANGAT00000200.
DR   EnsemblGenomes-Tr; CADANGAT00000201.
DR   EnsemblGenomes-Tr; CADANGAT00000202.
DR   EnsemblGenomes-Tr; CADANGAT00000203.
DR   EnsemblGenomes-Tr; CADANGAT00000204.
DR   EnsemblGenomes-Tr; CADANGAT00000205.
DR   EnsemblGenomes-Tr; CADANGAT00000206.
DR   EnsemblGenomes-Tr; CADANGAT00000207.
DR   EnsemblGenomes-Tr; CADANGAT00000208.
DR   EnsemblGenomes-Tr; CADANGAT00000209.
DR   EnsemblGenomes-Tr; CADANGAT00000210.
DR   EnsemblGenomes-Tr; CADANGAT00000211.
DR   EnsemblGenomes-Tr; CADANGAT00000212.
DR   EnsemblGenomes-Tr; CADANGAT00000213.
DR   EnsemblGenomes-Tr; CADANGAT00000214.
DR   EnsemblGenomes-Tr; CADANGAT00000215.
DR   EnsemblGenomes-Tr; CADANGAT00000216.
DR   EnsemblGenomes-Tr; CADANGAT00000217.
DR   EnsemblGenomes-Tr; CADANGAT00000218.
DR   EnsemblGenomes-Tr; CADANGAT00000219.
DR   EnsemblGenomes-Tr; CADANGAT00000220.
DR   EnsemblGenomes-Tr; CADANGAT00000221.
DR   EnsemblGenomes-Tr; CADANGAT00000222.
DR   EnsemblGenomes-Tr; CADANGAT00000223.
DR   EnsemblGenomes-Tr; CADANGAT00000224.
DR   EnsemblGenomes-Tr; CADANGAT00000225.
DR   EnsemblGenomes-Tr; CADANGAT00000226.
DR   EnsemblGenomes-Tr; CADANGAT00000227.
DR   EnsemblGenomes-Tr; CADANGAT00000228.
DR   EnsemblGenomes-Tr; CADANGAT00000229.
DR   EnsemblGenomes-Tr; CADANGAT00000230.
DR   EnsemblGenomes-Tr; CADANGAT00000231.
DR   EnsemblGenomes-Tr; CADANGAT00000232.
DR   EnsemblGenomes-Tr; CADANGAT00000233.
DR   EnsemblGenomes-Tr; CADANGAT00000234.
DR   EnsemblGenomes-Tr; CADANGAT00000235.
DR   EnsemblGenomes-Tr; CADANGAT00000236.
DR   EnsemblGenomes-Tr; CADANGAT00000237.
DR   EnsemblGenomes-Tr; CADANGAT00000238.
DR   EnsemblGenomes-Tr; CADANGAT00000239.
DR   EnsemblGenomes-Tr; CADANGAT00000240.
DR   EnsemblGenomes-Tr; CADANGAT00000241.
DR   EnsemblGenomes-Tr; CADANGAT00000242.
DR   EnsemblGenomes-Tr; CADANGAT00000243.
DR   EnsemblGenomes-Tr; CADANGAT00000244.
DR   EnsemblGenomes-Tr; CADANGAT00000245.
DR   EnsemblGenomes-Tr; CADANGAT00000246.
DR   EnsemblGenomes-Tr; CADANGAT00000247.
DR   EnsemblGenomes-Tr; CADANGAT00000248.
DR   EnsemblGenomes-Tr; CADANGAT00000249.
DR   EnsemblGenomes-Tr; CADANGAT00000250.
DR   EnsemblGenomes-Tr; CADANGAT00000251.
DR   EnsemblGenomes-Tr; CADANGAT00000252.
DR   EnsemblGenomes-Tr; CADANGAT00000253.
DR   EnsemblGenomes-Tr; CADANGAT00000254.
DR   EnsemblGenomes-Tr; CADANGAT00000255.
DR   EnsemblGenomes-Tr; CADANGAT00000256.
DR   EnsemblGenomes-Tr; CADANGAT00000257.
DR   EnsemblGenomes-Tr; CADANGAT00000258.
DR   EnsemblGenomes-Tr; CADANGAT00000259.
DR   EnsemblGenomes-Tr; CADANGAT00000260.
DR   EnsemblGenomes-Tr; CADANGAT00000261.
DR   EnsemblGenomes-Tr; CADANGAT00000262.
DR   EnsemblGenomes-Tr; CADANGAT00000263.
DR   EnsemblGenomes-Tr; CADANGAT00000264.
DR   EnsemblGenomes-Tr; CADANGAT00000265.
DR   EnsemblGenomes-Tr; CADANGAT00000266.
DR   EnsemblGenomes-Tr; CADANGAT00000267.
DR   EnsemblGenomes-Tr; CADANGAT00000268.
DR   EnsemblGenomes-Tr; CADANGAT00000269.
DR   EnsemblGenomes-Tr; CADANGAT00000270.
DR   EnsemblGenomes-Tr; CADANGAT00000271.
DR   EnsemblGenomes-Tr; CADANGAT00000272.
DR   EnsemblGenomes-Tr; CADANGAT00000273.
DR   EnsemblGenomes-Tr; CADANGAT00000274.
DR   EnsemblGenomes-Tr; CADANGAT00000275.
DR   EnsemblGenomes-Tr; CADANGAT00000276.
DR   EnsemblGenomes-Tr; CADANGAT00000277.
DR   EnsemblGenomes-Tr; CADANGAT00000278.
DR   EnsemblGenomes-Tr; CADANGAT00000279.
DR   EnsemblGenomes-Tr; CADANGAT00000280.
DR   EnsemblGenomes-Tr; CADANGAT00000281.
DR   EnsemblGenomes-Tr; CADANGAT00000282.
DR   EnsemblGenomes-Tr; CADANGAT00000283.
DR   EnsemblGenomes-Tr; CADANGAT00000284.
DR   EnsemblGenomes-Tr; CADANGAT00000285.
DR   EnsemblGenomes-Tr; CADANGAT00000286.
DR   EnsemblGenomes-Tr; CADANGAT00000287.
DR   EnsemblGenomes-Tr; CADANGAT00000288.
DR   EnsemblGenomes-Tr; CADANGAT00000289.
DR   EnsemblGenomes-Tr; CADANGAT00000290.
DR   EnsemblGenomes-Tr; CADANGAT00000291.
DR   EnsemblGenomes-Tr; CADANGAT00000292.
DR   EnsemblGenomes-Tr; CADANGAT00000293.
DR   EnsemblGenomes-Tr; CADANGAT00000294.
DR   EnsemblGenomes-Tr; CADANGAT00000295.
DR   EnsemblGenomes-Tr; CADANGAT00000296.
DR   EnsemblGenomes-Tr; CADANGAT00000297.
DR   EnsemblGenomes-Tr; CADANGAT00000298.
DR   EnsemblGenomes-Tr; CADANGAT00000299.
DR   EnsemblGenomes-Tr; CADANGAT00000300.
DR   EnsemblGenomes-Tr; CADANGAT00000301.
DR   EnsemblGenomes-Tr; CADANGAT00000302.
DR   EnsemblGenomes-Tr; CADANGAT00000303.
DR   EnsemblGenomes-Tr; CADANGAT00000304.
DR   EnsemblGenomes-Tr; CADANGAT00000305.
DR   EnsemblGenomes-Tr; CADANGAT00000306.
DR   EnsemblGenomes-Tr; CADANGAT00000307.
DR   EnsemblGenomes-Tr; CADANGAT00000308.
DR   EnsemblGenomes-Tr; CADANGAT00000309.
DR   EnsemblGenomes-Tr; CADANGAT00000310.
DR   EnsemblGenomes-Tr; CADANGAT00000311.
DR   EnsemblGenomes-Tr; CADANGAT00000312.
DR   EnsemblGenomes-Tr; CADANGAT00000313.
DR   EnsemblGenomes-Tr; CADANGAT00000314.
DR   EnsemblGenomes-Tr; CADANGAT00000315.
DR   EnsemblGenomes-Tr; CADANGAT00000316.
DR   EnsemblGenomes-Tr; CADANGAT00000317.
DR   EnsemblGenomes-Tr; CADANGAT00000318.
DR   EnsemblGenomes-Tr; CADANGAT00000319.
DR   EnsemblGenomes-Tr; CADANGAT00000320.
DR   EnsemblGenomes-Tr; CADANGAT00000321.
DR   EnsemblGenomes-Tr; CADANGAT00000322.
DR   EnsemblGenomes-Tr; CADANGAT00000323.
DR   RFAM; RF00005; tRNA.
DR   StrainInfo; 791018; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..335637
FT                   /organism="Aspergillus niger"
FT                   /strain="CBS 513.88"
FT                   /mol_type="genomic DNA"
FT                   /clone="An01c0080"
FT                   /db_xref="taxon:5061"
FT   tRNA            50..121
FT                   /gene="tRNA-Ala (TGC)"
FT                   /locus_tag="An01e01910"
FT                   /product="transfer RNA-Ala (TGC)"
FT                   /inference="profile:tRNAscan:1.4"
FT   CDS_pept        complement(join(714..2315,2362..2834,2883..2937))
FT                   /locus_tag="An01g01920"
FT                   /EC_number="3.2.1.52"
FT                   /note="Catalytic activity: hydrolysis of terminal
FT                   non-reducing N-acetyl-D-hexosamine residues in
FT                   N-acetyl-beta-D-hexosaminides."
FT                   /note="Similarity: similarity to bacterial and eukaryotic
FT                   beta-N-acetylhexosaminidases."
FT                   /note="Title: similarity to beta-N-acetylhexosaminidase
FT                   -Vibrio furnissii"
FT                   /note="See PMID 8969206"
FT                   /note="See PMID 10398828"
FT                   /db_xref="GOA:A2Q7T9"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR015882"
FT                   /db_xref="InterPro:IPR015883"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025705"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7T9"
FT                   /inference="profile:COGS:COG3525"
FT                   /inference="similar to AA sequence:UniProtKB:VFU41417.1"
FT                   /protein_id="CAK43562.1"
FT                   /translation="MRWRALGTLSLVLDFTICGFARLVTVPTIPFDDNNGTYALSQLTK
FT                   IVVDTRHASTVDTQGQTLIPPTLREFAATFQEDLRSSLGINLPLVSSSTSSDNTIFLTL
FT                   SNNTGFRDVAGRFTAEAYALHIDNKGITISGASPLGVWWGTRSLIQAAVVSKHDLPQGS
FT                   AIDAPGWETRGVMLDAGRHYYPPDFLIEMCSYLSFFKQNVFHLHLSDNLYNNVDLYSTQ
FT                   ESMDLYAAFRPWSDDPAVSGLNKRANESYTRSQFDHIQRQCARRGVTIIPEIEAPGHAL
FT                   AIVQWRPELGLTDLSMLNISHPDTIPTMKSIWKTFLPWFHSKTVHLGADEYSSSYVADY
FT                   TDFVNDMHTYIAEQSDKDTRIWGTFTPSEGANVSKAVTIQHWEYFEDNPYFDYIKNNYS
FT                   VLNSDDAFYIVGKWSGSYPQYLNKTRVFHGDPANNGPYAPNIFSTSNATDNPPRNNPYV
FT                   LGHIAALWNDYGPNATTYLEAYYSWRDVLPALADKQWGGDILEEEYDDVFDALHAVIPG
FT                   QNLDRHVPSKTDLILHYNFANATGTTVPDLSGNNYHATFNHTCPIDTSNSTIRFTGTCT
FT                   LTTPIQSKGRDYTLSFSVYPSTTHPSPLFSGRDSTLLNGNGSISNITLVSGGNPYTLNY
FT                   SLPVGKWSDVSLIGKGNKTFLSVDGGEKMEFLARLGVNGESLVWAPIAIEAPVQRIGEG
FT                   FVGMMGDVKLWGSAK"
FT   mRNA            complement(join(<714..2315,2362..2834,2883..>2937))
FT                   /locus_tag="An01g01920"
FT   exon            complement(714..2315)
FT                   /locus_tag="An01g01920"
FT                   /number=1
FT   mat_peptide     complement(join(717..2315,2362..2826))
FT                   /locus_tag="An01g01920"
FT   intron          complement(2316..2361)
FT                   /locus_tag="An01g01920"
FT                   /number=1
FT   exon            complement(2362..2834)
FT                   /locus_tag="An01g01920"
FT                   /number=2
FT   sig_peptide     complement(join(2827..2834,2883..2937))
FT                   /locus_tag="An01g01920"
FT                   /inference="protein motif:SignalP:2.0"
FT   intron          complement(2835..2882)
FT                   /locus_tag="An01g01920"
FT                   /number=2
FT   exon            complement(2883..2937)
FT                   /locus_tag="An01g01920"
FT                   /number=3
FT   CDS_pept        complement(join(3754..4222,4482..4524,4671..5013))
FT                   /locus_tag="An01g01930"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q7U0"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7U0"
FT                   /inference="profile:COGS:COG0542"
FT                   /protein_id="CAK43563.1"
FT                   /translation="MSNNLTRKPSISASSLGEVRKIYMSKMTEQGCSRTLKDKCRDIWH
FT                   EVINDAIDAEAECSMRGIAIVHEKKQEPAYIQSKGNGKKDSSEGDTESETETEESNSET
FT                   EVEIDPSLDGILVFVWRWIWMLGVCLNNMSSPSRDFSPEDLDDLANDLKDIQEGLAPSI
FT                   HYFISFQTGALLDHLDEVRDALDLQLINLTEMLDRLKRGLDQVKAIRKAVKAEENETSE
FT                   EEEVKESEQHPHQHHATKSPVAKSPKHRFSPAAKVKVQESDGDADSEREIEAEKEDFET
FT                   LFQ"
FT   mRNA            complement(join(<3754..4222,4482..4524,4671..>5013))
FT                   /locus_tag="An01g01930"
FT   exon            complement(3754..4222)
FT                   /locus_tag="An01g01930"
FT                   /number=1
FT   intron          complement(4223..4481)
FT                   /locus_tag="An01g01930"
FT                   /number=1
FT   exon            complement(4482..4524)
FT                   /locus_tag="An01g01930"
FT                   /number=2
FT   intron          complement(4525..4670)
FT                   /locus_tag="An01g01930"
FT                   /number=2
FT   exon            complement(4671..5013)
FT                   /locus_tag="An01g01930"
FT                   /number=3
FT   CDS_pept        complement(join(6553..6729,6791..7838,7905..7958,
FT                   8009..8055,8122..8415))
FT                   /locus_tag="An01g01940"
FT                   /note="Function: UGA4 of S. cerevisiae is a GABA-specific
FT                   high-affinity permease."
FT                   /note="Title: strong similarity to GABA permease Uga4
FT                   -Saccharomyces cerevisiae"
FT                   /note="See PMID 7888172"
FT                   /note="See PMID 8455553"
FT                   /db_xref="GOA:A2Q7U1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7U1"
FT                   /inference="profile:COGS:COG0833"
FT                   /protein_id="CAK43564.1"
FT                   /translation="MADIKAPANPAMETDGAELEKVRIAGTNQADTQLAAEFGYKPVFK
FT                   REFGYLSTFSFAVSISGLFATIMTTMSYPLEAGGSSAVVWCWLVSGAGCMCIALSVAEL
FT                   VSAYPTSGGLYFTISRLAPHDWVPSISWVTGWLNFLGQICGVASSEYGGAQMLLAIVSM
FT                   CKGMDNYEIKTTTTVGVMAGLTVITGLVNSLSTYWMEKMTKFYVIFHVCILVACAIALL
FT                   VMTDDKHDASYVFTHVESTTGWKPIGFSWLFGFLSVSWTMTDYDATAHITEEISNPEIK
FT                   APWAISMAMLFTYLAGFLFNIVLCFCMGDPNAILNSKMEQPVAQIFYNSLGKGGAIFFT
FT                   ISALLIIKFVTFTAMQSLGRTVFAFSRDRMLPFSNVWVKVSPITGTPLYAVWISVFFCI
FT                   AINLIALGSYTAVDAVFTLCSIALDWSYCIPVLCKLLFGQFKPGPWHMGIFSTVVNAWA
FT                   CLWTLFVSIIFVLPTDRPVTPDNMNYACVFLVFVLLFALVYWFISGKRFYHGPITEAVV
FT                   ADSASESNLPGDAKSEKDGQEN"
FT   mRNA            complement(join(<6553..6729,6791..7838,7905..7958,
FT                   8009..8055,8122..>8415))
FT                   /locus_tag="An01g01940"
FT   exon            complement(6553..6729)
FT                   /locus_tag="An01g01940"
FT                   /number=1
FT   intron          complement(6730..6790)
FT                   /locus_tag="An01g01940"
FT                   /number=1
FT   exon            complement(6791..7838)
FT                   /locus_tag="An01g01940"
FT                   /number=2
FT   intron          complement(7839..7904)
FT                   /locus_tag="An01g01940"
FT                   /number=2
FT   exon            complement(7905..7958)
FT                   /locus_tag="An01g01940"
FT                   /number=3
FT   intron          complement(7959..8008)
FT                   /locus_tag="An01g01940"
FT                   /number=3
FT   exon            complement(8009..8055)
FT                   /locus_tag="An01g01940"
FT                   /number=4
FT   intron          complement(8056..8121)
FT                   /locus_tag="An01g01940"
FT                   /number=4
FT   exon            complement(8122..8415)
FT                   /locus_tag="An01g01940"
FT                   /number=5
FT   CDS_pept        complement(join(10286..10871,10930..11435))
FT                   /locus_tag="An01g01950"
FT                   /note="Similarity: all yeast homologs are about 400
FT                   aminoacids longer at N-terminus."
FT                   /note="Similarity: bacterial homologs have about the same
FT                   length."
FT                   /note="Title: similarity to aluminium resistance protein
FT                   Alr1 - Saccharomyces cerevisiae"
FT                   /note="See PMID 9430719"
FT                   /note="See PMID 10220002"
FT                   /db_xref="GOA:A2Q7U2"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7U2"
FT                   /inference="profile:COGS:COG0598"
FT                   /inference="profile:PFAM:PF01544"
FT                   /inference="similar to AA sequence:PIR:S66827"
FT                   /protein_id="CAK43565.1"
FT                   /translation="MDAKGLHRFSHFSCRTQQVVTSSTWEGLLIEQSTLSADTKGSERD
FT                   TWWVDICDATEEEVSTVCQALSIHPLTAEDIATREPREKIEAFRNYYLISFQTLLPTDD
FT                   FKSSRSLKPSSSIPGSAGFYILVFKNATVTFSPSGCHHIARVRDRIRRTQDTHLVSSDW
FT                   ICYALIDEIIDDFEPYMRAAEREADAIEDQVFIARVDDVKALIPQLDSLRKSITQLIRC
FT                   LTGKYDVLSGFVKRCQAKDRNPMFPDGDLLVYLGDVQDHLVTTLTSLSHFDEIVGRSQS
FT                   NFLAQLSVNNIRLSYDVNAVLSKVTILATIFVPLHMVTGLFGMNVEVPGQNVDNLGWFF
FT                   GIVGCMCAFVMVCCLLAKRLRLL"
FT   mRNA            complement(join(<10286..10871,10930..>11435))
FT                   /locus_tag="An01g01950"
FT   exon            complement(10286..10871)
FT                   /locus_tag="An01g01950"
FT                   /number=1
FT   intron          complement(10872..10929)
FT                   /locus_tag="An01g01950"
FT                   /number=1
FT   exon            complement(10930..11435)
FT                   /locus_tag="An01g01950"
FT                   /number=2
FT   exon            13513..14340
FT                   /locus_tag="An01g01960"
FT                   /number=1
FT   CDS_pept        13513..14340
FT                   /locus_tag="An01g01960"
FT                   /EC_number="3.5.4.26"
FT                   /note="Catalytic activity: catalyzes the reduction of 2,4
FT                   diamino-6-ribitylamino-4(3H)-pyrimidine 5'-phosphate by
FT                   NADPH to yield DRTP."
FT                   /note="Pathway: riboflavin biosynthesis (second step)."
FT                   /note="Title: strong similarity to riboflavin biosynthesis
FT                   protein Rib7 - Saccharomyces cerevisiae"
FT                   /note="See PMID 3547188"
FT                   /note="See PMID 8256517"
FT                   /db_xref="GOA:A2Q7U3"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7U3"
FT                   /inference="profile:COGS:COG1985"
FT                   /inference="profile:PFAM:PF01872"
FT                   /inference="similar to AA sequence:PIR:S40698"
FT                   /protein_id="CAK43566.1"
FT                   /translation="MDSLNFPTQDRAFLEPHLPPKYGNPSSSSSLPFTTLTFATSLDSQ
FT                   LALSPGTRTVLSGPQSKAMTHYLRSRHDAILIGVGTAVADNPGLNCRLAGVGGYGSEGL
FT                   AGQPRPIIIDPSARWEFTAHSKIFELARNGRGRAPFIITAAETVPSAPQREVLESHGGK
FT                   FIALPVGVGSDGAHRIDWTALLECLVREGLRSVMIEGGGSIINSLLEPGCQTLVDSVIV
FT                   TIAPTWLGQGGVVVSPRRRVEGGMVVPASRLTGVKWYPFGEDVVLCGRIKGSD"
FT   mRNA            <13513..>14340
FT                   /locus_tag="An01g01960"
FT   CDS_pept        complement(join(14856..14860,14917..15243,15301..15604))
FT                   /locus_tag="An01g01970"
FT                   /note="Title: similarity to hypothetical protein encoded by
FT                   An04g02750 - Aspergillus niger"
FT                   /db_xref="GOA:A2Q7U4"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7U4"
FT                   /protein_id="CAK43567.1"
FT                   /translation="MGNKVSNISSIPEEFLADDWEEHYARARNPFCGYNYCCCYICGFQ
FT                   YNDSWGMRPVSYRVRGDKSYPRHPNYKAVAQAEGIEEERLRHIEYVPNRWWMWQRMIIH
FT                   REAKSTYRVSGTYLLEQETWRLCVPIMVKGKRVYVDPKVYCMGMKATSPADWVGCTVHA
FT                   RCWELLSHHALGRVAETDLPAVIAALRYRRRVVGSPCKRWEHKMFAED"
FT   mRNA            complement(join(<14856..14860,14917..15243,15301..>15604))
FT                   /locus_tag="An01g01970"
FT   exon            complement(14856..14860)
FT                   /locus_tag="An01g01970"
FT                   /number=1
FT   intron          complement(14861..14916)
FT                   /locus_tag="An01g01970"
FT                   /number=1
FT   exon            complement(14917..15243)
FT                   /locus_tag="An01g01970"
FT                   /number=2
FT   intron          complement(15244..15300)
FT                   /locus_tag="An01g01970"
FT                   /number=2
FT   exon            complement(15301..15604)
FT                   /locus_tag="An01g01970"
FT                   /number=3
FT   CDS_pept        join(16738..17681,17712..18185,18221..18353)
FT                   /locus_tag="An01g01980"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q7U5"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7U5"
FT                   /protein_id="CAK43568.1"
FT                   /translation="MPDFQDVEDVWHEICEYLETRDLFNICLTSRTINHVGTRYLYRKI
FT                   KWDWKGKKSRYRIMSLWTALVQDKDKRSRLCGSVREVHLLGSTPPKDTRIVECPEIQEG
FT                   NPSSLSIIRSDKVPFYQEIDYLRDVVSSVVESPKGRLAWLESIAARNVYALVALLLPLL
FT                   HNLRSLKLDYTFAVNGGYPGQMIESLTSGKEIHSAELQNNFEHLEVFDYGTNALHNNLP
FT                   HSCDNTHIRMRYSSQLIPIFQLQQVKHLKVWLRSRHGLLLARIPDVQMNHWALETLVLD
FT                   HISVMDCALFKVFKRTNKLRSLHLGMNAEEKDFCKYIWNGLRALCGCLEHLSISFSITP
FT                   RSREYRIDTIMWGPLFRHMTAGFFQDFTRLKTLELPIQMLNGFRDIMEVGIQQDLPVTL
FT                   EKLGLRWDFRDVESYDVPTATVRILWVLTEFLRLPDRHQRVPLLQEVIIRLFIGEDGLS
FT                   RTVVDCDDLIEQFNMTVDERTLMLNDVSLDIRGIMPNHRRQSYPSSTHYSLLLPDRQT"
FT   mRNA            join(<16738..17681,17712..18185,18221..>18353)
FT                   /locus_tag="An01g01980"
FT   exon            16738..17681
FT                   /locus_tag="An01g01980"
FT                   /number=1
FT   intron          17682..17711
FT                   /locus_tag="An01g01980"
FT                   /number=1
FT   exon            17712..18185
FT                   /locus_tag="An01g01980"
FT                   /number=2
FT   intron          18186..18220
FT                   /locus_tag="An01g01980"
FT                   /number=2
FT   exon            18221..18353
FT                   /locus_tag="An01g01980"
FT                   /number=3
FT   CDS_pept        join(19179..19245,19295..19470)
FT                   /locus_tag="An01g01990"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q7U6"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7U6"
FT                   /protein_id="CAK43569.1"
FT                   /translation="MCFTSYSDEPVSPARPRPTSTNEQEGDEADDTMEEAMFLAQLVAE
FT                   GEVGQAVVVVEEEEEEEEAAEEEEMMVEGEAEDEF"
FT   mRNA            join(<19179..19245,19295..>19470)
FT                   /locus_tag="An01g01990"
FT   exon            19179..19245
FT                   /locus_tag="An01g01990"
FT                   /number=1
FT   intron          19246..19294
FT                   /locus_tag="An01g01990"
FT                   /number=1
FT   exon            19295..19470
FT                   /locus_tag="An01g01990"
FT                   /number=2
FT   CDS_pept        join(20442..20490,20600..21530,21587..21881,21963..22157)
FT                   /locus_tag="An01g02000"
FT                   /EC_number="4.1.1.28"
FT                   /note="Catalytic activity: L-Tryptophan = Tryptamine + CO2"
FT                   /note="EC:4.1.1.28"
FT                   /note="Pathway: Histidine metabolism; Tyrosine metabolism;
FT                   Phenylalanine metabolism; Tryptophan metabolism; Alkaloid
FT                   biosynthesis I."
FT                   /note="Title: similarity to aromatic-L-amino-acid
FT                   decarboxylase DDC - Rattus norvegicus"
FT                   /note="See PMID 7567987"
FT                   /db_xref="GOA:A2Q7U7"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR010977"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR021115"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7U7"
FT                   /inference="profile:COGS:COG0076"
FT                   /inference="profile:PFAM:PF00282"
FT                   /inference="similar to AA sequence:PIR:DCRTA"
FT                   /protein_id="CAK43570.1"
FT                   /translation="MDREQFREAAHSAIDDIINYFDDLPNQRVVPTIEPGYLRPLIPTS
FT                   PPENPEPWSAIQSDIETKIKPGITHWQSPNFMAFFPAGVTYPSILGEMYSAAFTAPAFN
FT                   WLCSPACTELETIVMDWLAQALALPECFLSTSENRGGGVIQVTASDTVATMMIAARERR
FT                   VTEMVVSEGFKPDTVEYEDRMMELRSRLVALASNQAHSSTAKGALLAGTRFRSVEARLE
FT                   DNLEMTGERLRTVLEGLDRDKLTPYFITLGLGTTNSCAVDRFREIKAVLAEKEHWKRIW
FT                   VHIDAAYAGAALVADEWQYISKEFAEGVDSFNMNMHKWLLVNFDASCLFIRNREDLTNA
FT                   LDITPAYLRNHYSDSGKVTDYRNWSMSLGRRFRALKIWFVMRSYGLTGMKDYIRKSIGL
FT                   GETFAGLVRGRADLFDIITTPAFGLTAANELTKEVYELVNSRGEIFITSTVVCGVYAIR
FT                   VVSTNPAAEEKYVKRAFEILVETAEEIIKRG"
FT   mRNA            join(<20442..20490,20600..21530,21587..21881,21963..>22157)
FT                   /locus_tag="An01g02000"
FT   exon            20442..20490
FT                   /locus_tag="An01g02000"
FT                   /number=1
FT   intron          20491..20599
FT                   /locus_tag="An01g02000"
FT                   /number=1
FT   exon            20600..21530
FT                   /locus_tag="An01g02000"
FT                   /number=2
FT   intron          21531..21586
FT                   /locus_tag="An01g02000"
FT                   /number=2
FT   exon            21587..21881
FT                   /locus_tag="An01g02000"
FT                   /number=3
FT   intron          21882..21962
FT                   /locus_tag="An01g02000"
FT                   /number=3
FT   exon            21963..22157
FT                   /locus_tag="An01g02000"
FT                   /number=4
FT   exon            22790..23995
FT                   /locus_tag="An01g02010"
FT                   /number=1
FT   CDS_pept        22790..23995
FT                   /locus_tag="An01g02010"
FT                   /product="hypothetical protein"
FT                   /note="Similarity: blast matches to acid rich proteins due
FT                   to serine and aspartic acids repeats."
FT                   /db_xref="GOA:A2Q7U8"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7U8"
FT                   /inference="profile:COGS:COG1511"
FT                   /inference="profile:COGS:COG5271"
FT                   /protein_id="CAK43571.1"
FT                   /translation="MDKPTGVASSQMDKPRLGGKMNLPAGGATTAPVRDVSNKKKRALE
FT                   EDSDSENIDDGKRTCIHLIDEAMKDLELGFEKDSEDDYESDSKTESDSDGGSSNDEDRG
FT                   NSSTEETTVIDEDSSNDEDGGDSSTEETTVSDEDSSNDEGSDLGGRDVTMDEIMDFNSE
FT                   ESTSDETMDTSDEDSSRDEASDWSVGSGSSDEEEYMDVSDAESWSSEHWNDSDQSDDED
FT                   YTFERPEAWKWSKDNNINNNKDGDEEDGDRLMIQLTYPNHTHKICDDTSSEDEDGDALI
FT                   QEEVDDASSEDEVETEDENKSGCADGDSSTAFPACEFLDKHADKPGYIYDMTSHGKNIL
FT                   ILITTSSPPTLIRASTRDLIMGSSVFAKVFGYNEEIRVSGKIFSSWRKIQKVTGCHRAE
FT                   FI"
FT   mRNA            <22790..>23995
FT                   /locus_tag="An01g02010"
FT   CDS_pept        join(24538..24618,24671..24776,24868..24948,25007..25041)
FT                   /locus_tag="An01g02020"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   ssl3291 - Synechocystis sp."
FT                   /db_xref="GOA:A2Q7U9"
FT                   /db_xref="InterPro:IPR007361"
FT                   /db_xref="InterPro:IPR038694"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7U9"
FT                   /inference="profile:COGS:COG2343"
FT                   /inference="profile:PFAM:PF04248"
FT                   /inference="similar to AA sequence:PIR:S77173"
FT                   /protein_id="CAK43572.1"
FT                   /translation="MPLARATFEDIILAESPTWETVEGNIYFPPTAIKDKSLFVPIDKV
FT                   TFCPWKGDASYYSIVVGPTTIPGGAWYYPNPYDAASNIKDHVAFYTTGSIKVSVE"
FT   mRNA            join(<24538..24618,24671..24776,24868..24948,25007..>25041)
FT                   /locus_tag="An01g02020"
FT   exon            24538..24618
FT                   /locus_tag="An01g02020"
FT                   /number=1
FT   intron          24619..24670
FT                   /locus_tag="An01g02020"
FT                   /number=1
FT   exon            24671..24776
FT                   /locus_tag="An01g02020"
FT                   /number=2
FT   intron          24777..24867
FT                   /locus_tag="An01g02020"
FT                   /number=2
FT   exon            24868..24948
FT                   /locus_tag="An01g02020"
FT                   /number=3
FT   intron          24949..25006
FT                   /locus_tag="An01g02020"
FT                   /number=3
FT   exon            25007..25041
FT                   /locus_tag="An01g02020"
FT                   /number=4
FT   CDS_pept        complement(join(25341..26612,26616..26721,26830..27170,
FT                   27249..27323,27393..27674,27769..28640,28793..28888,
FT                   28938..29460))
FT                   /locus_tag="An01g02030"
FT                   /note="Function: FUM5 of G. fujikuroi is a PKS gene
FT                   required for fumonisin biosynthesis."
FT                   /note="Remark: all homologs are N-terminal much longer."
FT                   /note="Title: similarity to polyketide synthase FUM5
FT                   -Gibberella moniliformis"
FT                   /note="See PMID 10413619"
FT                   /note="See PMID 10802562"
FT                   /note="See PMID 10872449"
FT                   /db_xref="GOA:A2Q7V0"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7V0"
FT                   /inference="profile:COGS:COG3321"
FT                   /inference="profile:PFAM:PF00107"
FT                   /protein_id="CAK43573.1"
FT                   /translation="MVEDSGPSRQESICKIISAYVENDKNDDRSILFECVGKIKANCER
FT                   IVLGEVSSLDVLEVEGRLDRYNKWIQSQCNWSRFLSLLDHSNPTTRVLKIGSCTGSATE
FT                   AVLRYLRSPEGVPQCSQYTVTEECEATLTALQQKFQNQEGLQYALLDISGDLEAQGCNL
FT                   QSYDLIIASNVVAHGTARIATAVEHIRQLLAPNGRLLLHEIYPEGALSNWSSVEDFRAY
FT                   SIPYLSPDRWDIELRNAGFIGSEVMAYDVPHPHQTYFTMLSRVPHPPPEAETYDTVTIL
FT                   TTDSPGSWASEVASRFRQGGHVVNWTTLHDTPPKDQWIISLLDLDGPYLNNLSEERYLA
FT                   LQSSLMTADNSHLIWVTNTSQMACADPRYGLIFGLTRTLRHETATGISLFETDSYTQPA
FT                   AGALFQVFNKLQRTRQCPDARPADSEFSFEGVIHVGRCHWIHPKQITPRPETPCPRKLD
FT                   VSPVGLIDTAHWVPVDGHQGELETGQVEVDVHYVGLNFRDVLVGMGVFGSADELGLEGT
FT                   GVVRRVASDVKDLQAGDHVVMLAWRLFRTRVVLSATACRKLPANTPMDDAATVGSVYMT
FT                   AIFCLCHLARLQNGNSVLIHSACGGLSLAAIQVCKVMGAKIFATVGSDEKVEYLVKTFG
FT                   IPRSHIFSSRNTDFLPGLMAETQARGADIVLNSLSGKLLHTSWECVAPYGRFIEVGKRD
FT                   YLANGQLAMAPFIQNRSYIGFDLFQMGKEKPRDYDLLLQLFREWYEGGHIKPLRPVKIF
FT                   EAAKVTDAFRYMQGSHMGKILIRMPSDPMELAPTSVPPVSFSPNKSYLLVGGLGGVGRS
FT                   VCLWMMQRGARHLVILSRSAGKSNADRDFILDLEEQGCQVICVAGIVAAAADVQSAISK
FT                   CPQPLAGILQMSAISRDQRFANTTYDDWTTCLATKVQGTWNLHHAASDQPLDFFIVFSS
FT                   IAGICGNHGQASYAAANTFLDSFTRYRRHLGLPSATLALGPVEDCGLVSRNTKLLQAMQ
FT                   ATSVRLVGEDELLEGLELAIHQSHSPSPSALTTSHIKSISQSSTSDACIIGLGNTRSTN
FT                   DPSVRAVWTPSDPRFSLYTNIETKEQSTTVGGTALKEILRRVEQDPAMLNNSDAANNLS
FT                   HELSKHLARHMPGAAEMSAEEAAEMPIDSLMAVEIRRGLRGDLSWDISMVEVTKIGKIG
FT                   RLAEAAIQHLKKKYGLVKESEQ"
FT   mRNA            complement(join(<25341..26612,26616..26721,26830..27170,
FT                   27249..27323,27393..27674,27769..28640,28793..28888,
FT                   28938..>29460))
FT                   /locus_tag="An01g02030"
FT   exon            complement(25341..26612)
FT                   /locus_tag="An01g02030"
FT                   /number=1
FT   intron          complement(26613..26615)
FT                   /locus_tag="An01g02030"
FT                   /number=1
FT   exon            complement(26616..26721)
FT                   /locus_tag="An01g02030"
FT                   /number=2
FT   intron          complement(26722..26829)
FT                   /locus_tag="An01g02030"
FT                   /number=2
FT   exon            complement(26830..27170)
FT                   /locus_tag="An01g02030"
FT                   /number=3
FT   intron          complement(27171..27248)
FT                   /locus_tag="An01g02030"
FT                   /number=3
FT   exon            complement(27249..27323)
FT                   /locus_tag="An01g02030"
FT                   /number=4
FT   intron          complement(27324..27392)
FT                   /locus_tag="An01g02030"
FT                   /number=4
FT   exon            complement(27393..27674)
FT                   /locus_tag="An01g02030"
FT                   /number=5
FT   intron          complement(27675..27768)
FT                   /locus_tag="An01g02030"
FT                   /number=5
FT   exon            complement(27769..28640)
FT                   /locus_tag="An01g02030"
FT                   /number=6
FT   intron          complement(28641..28792)
FT                   /locus_tag="An01g02030"
FT                   /number=6
FT   exon            complement(28793..28888)
FT                   /locus_tag="An01g02030"
FT                   /number=7
FT   intron          complement(28889..28937)
FT                   /locus_tag="An01g02030"
FT                   /number=7
FT   exon            complement(28938..29460)
FT                   /locus_tag="An01g02030"
FT                   /number=8
FT   CDS_pept        join(30264..30440,30519..30795,30845..31263,31317..31964)
FT                   /locus_tag="An01g02040"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q7V1"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7V1"
FT                   /protein_id="CAK43574.1"
FT                   /translation="MAKPTSDIELSPADLGLPRFVEAHLAIVVRAKPEPHDCQRAAQEL
FT                   LATYPMLAMRMDFWRTKLLHSDYPAEIYHSRTLKKDLDEVLPCQTAKVGPPAVQLLDTC
FT                   SLLDCLNFNRDIWDEICGEQVLRIRVVFLNDAWAVRFIMSHTLGDIRVPVGLNSLLSNS
FT                   MCHTAMHWIADSFFAFLSGREVQTVSPIRSILTFKSDIIDSWNALTASGTTHSVAEDHQ
FT                   HEIVAGWLPTILSGARQILWYAYEASSPRRQVNKSLFIPQCIIDHWVQGARREGIQVTE
FT                   HDLLMGFIYEATYRALSAPPHFTFLMNFHQQLHSPGPLGNTWFQIPIPALHKSKSSPST
FT                   PFPKDHSSTLLPMLLHHAQLIRDIIVKCRHPACFPEIYEQHRRLGTTPWRPRSFGTRSP
FT                   HVMVSCWTKQQWYELDCTGGTPLFVDLGACFYRLFQLLGVQGPDDFVGTIKCPGGRNST
FT                   LMGEHKGYWVQGRLPEVTWATMVDMLTAVSFGDGGGQKQGLGQTFANI"
FT   mRNA            join(<30264..30440,30519..30795,30845..31263,31317..>31964)
FT                   /locus_tag="An01g02040"
FT   exon            30264..30440
FT                   /locus_tag="An01g02040"
FT                   /number=1
FT   intron          30441..30518
FT                   /locus_tag="An01g02040"
FT                   /number=1
FT   exon            30519..30795
FT                   /locus_tag="An01g02040"
FT                   /number=2
FT   intron          30796..30844
FT                   /locus_tag="An01g02040"
FT                   /number=2
FT   exon            30845..31263
FT                   /locus_tag="An01g02040"
FT                   /number=3
FT   intron          31264..31316
FT                   /locus_tag="An01g02040"
FT                   /number=3
FT   exon            31317..31964
FT                   /locus_tag="An01g02040"
FT                   /number=4
FT   CDS_pept        complement(join(32382..33429,33479..33527,33623..34550))
FT                   /locus_tag="An01g02050"
FT                   /note="Remark: At221 might be involved in the gene
FT                   expression regulation of lovF."
FT                   /note="Title: similarity to gene expression regulator At221
FT                   from patent WO200257456-A2 - Unclassified organism"
FT                   /db_xref="GOA:A2Q7V2"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7V2"
FT                   /inference="profile:PFAM:PF00172"
FT                   /protein_id="CAK43575.1"
FT                   /translation="MKRKAAFQLPHTPRRAPRQDPVSCDSCRLKKIKCDRQQPCSSCSA
FT                   RRLTCRYGKPEAAGTARVQKPLLAAGVERTSPPSNPTVPPRADNVPIEPTAAPLRACNR
FT                   ESLLTADWLENIHMADRVPTATPKWLRDGLDDPVRGRNLNLSLNDETGSARPLLSMPYM
FT                   NRSAIDENPASINLITFVPAKSEALDLFRYYHRYVDYLYHIIVPKRVEGQINGIYRCIE
FT                   SNAPVDLNHLALLFGILASSLCLQRSVVASTDAEARSQEFAFLTGAALIQSHYSLSPTL
FT                   VGLQATMVVMHNVSNWNIPPSVSGLFVHDLEVKRRLWWDLTSFDWLLGFLTGPQEWTYL
FT                   IQPHHMNVNQPLNIDDNAMCHNMVSMPNSTPTDMSFFLQRLTLAAVSREVVDATSYEHL
FT                   HGLEPIYEKILELDKKFHRAVAEIPDFFRLDPSSRRRFASLYEERPTIAWQGCLLQQGF
FT                   FSRLCRLHRDFFIRGAREPAYSYSHVICLQSARKVLEIKRIMDGNEPNYTPPNSVVWSV
FT                   MHHVFAAAVILLLDVCFNWDDILAEKRKEEVLDACRMLSKAQESSALVREGINAMMGVL
FT                   QKHWRTGKQAENHTITSQGADGARSHPGSAPAHVPALNAESNVMPPHLPAATNDNAPHE
FT                   RQLEDIWTEMLETGNDLALDSADWTELLNELTDPELSRG"
FT   mRNA            complement(join(<32382..33429,33479..33527,33623..>34550))
FT                   /locus_tag="An01g02050"
FT   exon            complement(32382..33429)
FT                   /locus_tag="An01g02050"
FT                   /number=1
FT   intron          complement(33430..33478)
FT                   /locus_tag="An01g02050"
FT                   /number=1
FT   exon            complement(33479..33527)
FT                   /locus_tag="An01g02050"
FT                   /number=2
FT   intron          complement(33528..33622)
FT                   /locus_tag="An01g02050"
FT                   /number=2
FT   exon            complement(33623..34550)
FT                   /locus_tag="An01g02050"
FT                   /number=3
FT   CDS_pept        join(35021..35070,35118..35334,35396..36172,36238..36351,
FT                   36436..36540,36719..36748)
FT                   /locus_tag="An01g02060"
FT                   /note="Similarity: similarity to YOR306c, YNL125c, YKL221w
FT                   and monocarboxylate transporter proteins."
FT                   /note="Title: similarity to monocarboxylate transporter 3
FT                   -Gallus gallus"
FT                   /note="See PMID 9168967"
FT                   /db_xref="GOA:A2Q7V3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7V3"
FT                   /inference="profile:COGS:COG0477"
FT                   /inference="profile:COGS:COG2271"
FT                   /protein_id="CAK43576.1"
FT                   /translation="MAHAEDAPTDSPPSEYTPRAVQTLLGSFCGMFCTVGFVNSFGLFL
FT                   EYYKKDQLSDQPESTIAWIAAIDIFFIFGVSVVSGPLLDTIGPRLLLCIGSLGSVFSIM
FT                   MTSLCKELYQFILAQGILLGISLSLLTCPMIALVGQHIKIKRGAAVGIVIGGSSLGGVL
FT                   WPIIVNELLQKPNIGFGWTMRIVGFIMLPLLTVTCFCCQPAAPPPSPSPSQYQPEPQSE
FT                   KSSPEPQSPDPTKDTETPLLQNRTLHLTCLSFFIIYFGMFSPFFYVSSYGVARGFSSSL
FT                   SFYTISMLNGASLFGRVIPGILADKYGRFNVCIVFTILAGIVALCWTKATSVAGLVVFS
FT                   IAYGFSSGCGSGIGYSLSPASVRVAVGDAEDGGVGGGGCYGGYGFECYGWDTYFRGAGA
FT                   EVWVSGAVDIRGGESARGWVVVICRYCISAR"
FT   mRNA            join(<35021..35070,35118..35334,35396..36172,36238..36351,
FT                   36436..36540,36719..>36748)
FT                   /locus_tag="An01g02060"
FT   exon            35021..35070
FT                   /locus_tag="An01g02060"
FT                   /number=1
FT   intron          35071..35117
FT                   /locus_tag="An01g02060"
FT                   /number=1
FT   exon            35118..35334
FT                   /locus_tag="An01g02060"
FT                   /number=2
FT   intron          35335..35395
FT                   /locus_tag="An01g02060"
FT                   /number=2
FT   exon            35396..36172
FT                   /locus_tag="An01g02060"
FT                   /number=3
FT   intron          36173..36237
FT                   /locus_tag="An01g02060"
FT                   /number=3
FT   exon            36238..36351
FT                   /locus_tag="An01g02060"
FT                   /number=4
FT   intron          36352..36435
FT                   /locus_tag="An01g02060"
FT                   /number=4
FT   exon            36436..36540
FT                   /locus_tag="An01g02060"
FT                   /number=5
FT   intron          36541..36718
FT                   /locus_tag="An01g02060"
FT                   /number=5
FT   exon            36719..36748
FT                   /locus_tag="An01g02060"
FT                   /number=6
FT   CDS_pept        complement(join(36813..37002,37072..37486,37532..38082,
FT                   38125..38513,38560..38910))
FT                   /locus_tag="An01g02070"
FT                   /EC_number="3.4.24.-"
FT                   /note="Function: A. fumigatus secretes a serine alkaline
FT                   protease (ALP) and a metalloprotease (MEP) when the fungus
FT                   is cultivated in the presence of collagen as sole nitrogen
FT                   and carbon source."
FT                   /note="Remark: putative sequencing error at position 82586
FT                   (Stop)"
FT                   /note="Remark: strong similarity to metalloproteases from
FT                   aspergillus."
FT                   /note="Title: strong similarity to metalloprotease mep
FT                   -Aspergillus fumigatus"
FT                   /note="extracellular/secretion proteins"
FT                   /note="See PMID 7715453"
FT                   /db_xref="GOA:A2Q7V4"
FT                   /db_xref="InterPro:IPR001842"
FT                   /db_xref="InterPro:IPR011096"
FT                   /db_xref="InterPro:IPR027268"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2Q7V4"
FT                   /inference="profile:PFAM:PF02128"
FT                   /inference="similar to AA sequence:UniProtKB:AFMETPRO.1"
FT                   /protein_id="CAK43577.1"
FT                   /translation="MHGLRLVCSIGTLPLVILAYPAASLHTTSAAVDLDSLRLTSNSEY
FT                   VNSVHVDTNRSVAVSAEEHYTDTAARLVQNIVPGASFRLIDDHFVGDNGVAHVYFRQTL
FT                   HGIDIDNADFNVNIGKDGLVLSFGHSFFTGALPSSHLDNTNVLSPEAALRGARDAIQLP
FT                   LTIDNVSTEAAEGRNEYIFREAVGAVSDPKAKLVYLVKPEGTLALTWRIETDMYEHWLL
FT                   TYIDAETTTVHGVVDYVADATYQVYPWGTNDPAEGHRTIVTDPWDLSASAYTWISDGRD
FT                   NYTTTRGNNAIAHWNPTGGGSYLYNLRPSDPNLNFQWPYSPNMSPPRSYINASIVQLFY
FT                   TANAYHDLLYTLGFTESAGNFQWNNSAHGGRDKDYVILNAQDGSGFSNANFATPPDGIP
FT                   GRMRMYIWIESTPSRDGSFDAGIVIHEYTHGVSNRLTGGSHNAGCLSALESGGMGEGWG
FT                   DFMATAIRIKPNDTRTTSYTMGAWADNDKCGVRDYPYSTSFTENPLNYTSVNTMNGVHA
FT                   IGTVWATMLYEVLWNLIDKYGKNDGSRPVFRNGVPTDGKYLMMKLVVDGMALQPCNPNF
FT                   VQARDAILDADIVLTGGKNRCEIWRGFAKRGLGQGAAHSSLNWMRRGSTLLPTGC"
FT   mRNA            complement(join(<36813..37002,37072..37486,37532..38082,
FT                   38125..38513,38560..>38910))
FT                   /locus_tag="An01g02070"
FT   exon            complement(36813..37002)
FT                   /locus_tag="An01g02070"
FT                   /number=1
FT   mat_peptide     complement(join(36816..37002,37072..37486,37532..38082,
FT                   38125..38513,38560..38820))
FT                   /locus_tag="An01g02070"
FT   intron          complement(37003..37071)
FT                   /locus_tag="An01g02070"
FT                   /number=1
FT   exon            complement(37072..37486)
FT                   /locus_tag="An01g02070"
FT                   /number=2
FT   intron          complement(37487..37531)
FT                   /locus_tag="An01g02070"
FT                   /number=2
FT   exon            complement(37532..38082)
FT                   /locus_tag="An01g02070"
FT                   /number=3
FT   intron          complement(38083..38124)
FT                   /locus_tag="An01g02070"
FT                   /number=3
FT   exon            complement(38125..38513)
FT                   /locus_tag="An01g02070"
FT                   /number=4
FT   intron          complement(38514..38559)
FT                   /locus_tag="An01g02070"
FT                   /number=4
FT   exon            complement(38560..38910)
FT                   /locus_tag="An01g02070"
FT                   /number=5
FT   sig_peptide     complement(38821..38910)
FT                   /locus_tag="An01g02070"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(join(39556..39594,39672..39771,39831..40234))
FT                   /locus_tag="An01g02080"
FT                   /note="Title: similarity to hypothetical protein SC2G5.30
FT                   -Streptomyces coelicolor"
FT                   /db_xref="InterPro:IPR018020"
FT                   /db_xref="InterPro:IPR036778"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7V5"
FT                   /inference="profile:COGS:COG3195"
FT                   /protein_id="CAK43578.1"
FT                   /translation="MSSDLPSPSSITSLPQEQQFRVLDTLFESSPELHTLMAPVLANQT
FT                   FSSYATLIDAVGGRMSALSAANSSKDRDILVGILGSHPRLGQPKGAPTEHLSELSKKEQ
FT                   ANLNTGAEEQAEKLKRMNAEYEQKFPGLRFVTFVNGRNRDVIMEEMRERIDRGNADREV
FT                   EEIIQDRARKLEQSAKI"
FT   mRNA            complement(join(<39556..39594,39672..39771,39831..>40234))
FT                   /locus_tag="An01g02080"
FT   exon            complement(39556..39594)
FT                   /locus_tag="An01g02080"
FT                   /number=1
FT   intron          complement(39595..39671)
FT                   /locus_tag="An01g02080"
FT                   /number=1
FT   exon            complement(39672..39771)
FT                   /locus_tag="An01g02080"
FT                   /number=2
FT   intron          complement(39772..39830)
FT                   /locus_tag="An01g02080"
FT                   /number=2
FT   exon            complement(39831..40234)
FT                   /locus_tag="An01g02080"
FT                   /number=3
FT   CDS_pept        join(42043..42116,42239..42426,42537..45572,45624..45667)
FT                   /locus_tag="An01g02090"
FT                   /note="Title: similarity to hypothetical protein
FT                   BX908807_12 - Neurospora crassa"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7V6"
FT                   /protein_id="CAK43579.1"
FT                   /translation="MSLNGLDNPTVIDAYQTALTEAGGWFLLRYVSRDEVALLDRGTGG
FT                   VPDVRNAIDGYEEKSPLYGFLQYRRRKVVLSYLPEGMSRLVQDKFSPHDTVFSVTQPSE
FT                   LTESALSSACLLHTASGSITSSSSSLRRRRLKEIAEDAEETTVGKDENQAQSAADGMPR
FT                   QRSFSQLSEATVVPPSVVSSVQQSPVGNEPTPKTSENASIRERSSSVATSERAPSYKNF
FT                   REDSSYAPSEPRQSSQSARPSVRDLERAGYKAKVKLGPRPSVDGSGRPRTAGNLSRSAE
FT                   RRPVASLPAGVRSSSLRKSNPSPSRPRSSGGHGTPVASRVPAVPPLLVPPFSMPISRPK
FT                   ISPGAKSLSALSSSTTSNEKERLMKALQMRKTQMEKKAKEGKNSSTTEKGEVSGLDMTE
FT                   NKENIGHIPSKMKHDGGDDRMAHLAGPNKEPLSETQPTLQPMLRHQGAEEEDGRTTPNS
FT                   PEPSGSHHSLSQPARLSNSSNEFQATTPTRSGSETQAGDRDLGASNSGGVSGGPSSPTR
FT                   LPSAIAAPLENNSGKAPDEEIVGPSPPKPVPHPVVPGEQEALLHHHHHHHPSTPDVTES
FT                   DLFESPARPDSSHHPSAATFTPNSLSIAAPPPTEPQHDLTPESSNVERQRSTSRKEKRK
FT                   PYLEPIQVPTPDYSDDENLLSDDSFMEELTSATVEEAKPISVGVSPLSPGYSNSSNGNV
FT                   SPDAWRNSRAVSNPSAIGHQSPNMSTIAVGRSVSTTGADSGSQNGPVLVARKINVSSGI
FT                   SSRIKALEKFSNSRDAPSMNGQTLAAPSAASFETLRKGYSGPSMPRPLSYAPESFSRSS
FT                   SVRRPSSQAGPGLAGPGLSRSPSSVSVTARIVRDPTAAETNPNADPSEPAVLNLQPSQI
FT                   TVEQETTELPVLTLQTEPTITQSEDDTLPPSSAGSDQQSSVSVQRPESRISTPTSIKEE
FT                   EEVASPAKSSGDAPSSPDEKKESRATRLLRRMSSITSRKSVVGVLNPIKGDDHVVPIKL
FT                   EEPERPVSRATEVAPAIDIGEVNVQFPDTLLWKRRFVRIDDQGYLILTPGNLDSTNRNL
FT                   VKRYHLSEFRTPCLPDEDRQELPNSILLDFLDGNTLQCACESRQGQTFVLQTLRDAHST
FT                   YQTVSH"
FT   mRNA            join(<42043..42116,42239..42426,42537..45572,45624..>45667)
FT                   /locus_tag="An01g02090"
FT   exon            42043..42116
FT                   /locus_tag="An01g02090"
FT                   /number=1
FT   intron          42117..42238
FT                   /locus_tag="An01g02090"
FT                   /number=1
FT   exon            42239..42426
FT                   /locus_tag="An01g02090"
FT                   /number=2
FT   intron          42427..42536
FT                   /locus_tag="An01g02090"
FT                   /number=2
FT   exon            42537..45572
FT                   /locus_tag="An01g02090"
FT                   /number=3
FT   intron          45573..45623
FT                   /locus_tag="An01g02090"
FT                   /number=3
FT   exon            45624..45667
FT                   /locus_tag="An01g02090"
FT                   /number=4
FT   CDS_pept        complement(join(46174..47345,47413..47446))
FT                   /locus_tag="An01g02100"
FT                   /EC_number="5.4.99.-"
FT                   /note="Function: Pus4p of S. cerevisiae catalyzes the
FT                   formation of psi55 in both mitochondrial and cytoplasmic
FT                   tRNAs."
FT                   /note="Title: strong similarity to tRNA-pseudouridine
FT                   synthase Pus4 - Saccharomyces cerevisiae"
FT                   /note="See PMID 9358157"
FT                   /db_xref="GOA:A2Q7V7"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7V7"
FT                   /inference="profile:COGS:COG0130"
FT                   /inference="profile:PFAM:PF01509"
FT                   /inference="similar to AA sequence:PIR:S60410"
FT                   /protein_id="CAK43580.1"
FT                   /translation="MSGEKIYEGVFAVHKPQGVSSADVVRTLQTHFNPSTLFAPWLADE
FT                   RARRARESTYQRKRRRTQRLDVKIGHGGTLDPLATGILVAGVGKGTKHLNEFLGCTKQY
FT                   ETVVLFGAETDTYDRLGKVVRKAPYEHVTREMVEKALEQFRGKIMQRPPIFSALKVNGK
FT                   KLYEYAREGKEPPIEIQKRPVEVTDLRIVEWYEPGTHEFKWPEVEAEGEEKAVAEKLLA
FT                   KEDELPIVEREADGEGEASAKRKSPPAEDAKEEKVEGGDAESAPSAKKQKVADGEAAPV
FT                   APAEQEASDAPKAEAEESSESKPQSQPQPAAVKITMTVSSGFYVRSLAHDLGKAVGSCG
FT                   LMSSLIRSRQAQFELHPDKVLEYKDLEAGEEVWGPKVQRFLEDWEEKRLARPSSPRSPK
FT                   QN"
FT   mRNA            complement(join(<46174..47345,47413..>47446))
FT                   /locus_tag="An01g02100"
FT   exon            complement(46174..47345)
FT                   /locus_tag="An01g02100"
FT                   /number=1
FT   intron          complement(47346..47412)
FT                   /locus_tag="An01g02100"
FT                   /number=1
FT   exon            complement(47413..47446)
FT                   /locus_tag="An01g02100"
FT                   /number=2
FT   CDS_pept        join(48103..48307,48394..48662,48738..48896,48952..50046,
FT                   50131..50160,50211..50246)
FT                   /locus_tag="An01g02110"
FT                   /note="Title: similarity to hypothetical protein CAD11409.1
FT                   - Neurospora crassa"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7V8"
FT                   /inference="similar to AA sequence:UniProtKB:NC9G6.5"
FT                   /protein_id="CAK43581.1"
FT                   /translation="MTSREDSVLAARDPSLTDENDWEEFSLSEVRVLVPGKSRYANLLT
FT                   ASPENPVQVTGCLDEVEEEQEKLVLDPEYLTKRIVLENVTHFAYGQHNDGEVGFWVAGK
FT                   AGWFSISPAKGYKAIFNDVVEAIDLLYFLADRHQSKRRRKRRNWNPSVEYLCEEYVSHT
FT                   HGICEDADDSAEVFYKHHHFLLSRMLKGEEDVQWTNTCIFEHLCEKFPDDFKQIKAQYE
FT                   GAKEVESEEEEEDEQEEDKEMDEKEGQDEAEARPDTSGLSKDQADAIYKVILDLKEAGY
FT                   LAKRQLTFELLINTLVERFAIDSTDYAHDLVAARADAIIEMMDEVKTYNFDWSRKVIYR
FT                   ELKAAAKKNRVQQITLTPLRPRPSDDDESSGEESEHEDHPRLRRRRVHKSVLRPKSSVA
FT                   TKQTGKRTRSAVDDQDDDSDNNEDAMDEFETPSKVRGHDLVRDPLSTRAKRRTRSLLYD
FT                   STPIQKTPLQETLQSRNTSVSGADRETNADASELEATFEDDVTSDTWTCHVRGCEKVIH
FT                   KSNSKRGKELIQDHALAHADDTKAKIDLVFAEQRLNIGLPVDNLLSRIREMGAFDTDHP
FT                   TDDVRVQSATVRSSQHITESG"
FT   mRNA            join(<48103..48307,48394..48662,48738..48896,48952..50046,
FT                   50131..50160,50211..>50246)
FT                   /locus_tag="An01g02110"
FT   exon            48103..48307
FT                   /locus_tag="An01g02110"
FT                   /number=1
FT   intron          48308..48393
FT                   /locus_tag="An01g02110"
FT                   /number=1
FT   exon            48394..48662
FT                   /locus_tag="An01g02110"
FT                   /number=2
FT   intron          48663..48737
FT                   /locus_tag="An01g02110"
FT                   /number=2
FT   exon            48738..48896
FT                   /locus_tag="An01g02110"
FT                   /number=3
FT   intron          48897..48951
FT                   /locus_tag="An01g02110"
FT                   /number=3
FT   exon            48952..50046
FT                   /locus_tag="An01g02110"
FT                   /number=4
FT   intron          50047..50130
FT                   /locus_tag="An01g02110"
FT                   /number=4
FT   exon            50131..50160
FT                   /locus_tag="An01g02110"
FT                   /number=5
FT   intron          50161..50210
FT                   /locus_tag="An01g02110"
FT                   /number=5
FT   exon            50211..50246
FT                   /locus_tag="An01g02110"
FT                   /number=6
FT   CDS_pept        complement(join(50483..50793,50875..51658))
FT                   /locus_tag="An01g02120"
FT                   /note="Function: Ebp2p of S. cerevisiae is required for the
FT                   maturation of 25S rRNA and 60S subunit assembly; it may be
FT                   one of the target proteins of Rrs1p for executing the
FT                   signal to regulate ribosome biogenesis."
FT                   /note="Remark: EbP2p is the genename for YKL172w of S.
FT                   cerevisiae."
FT                   /note="Similarity: shows also similarity to human nucleolar
FT                   protein p40."
FT                   /note="Title: strong similarity to nucleolar protein Ebp2
FT                   -Saccharomyces cerevisiae"
FT                   /note="nucleus"
FT                   /note="See PMID 10849420"
FT                   /note="See PMID 10947841"
FT                   /note="See PMID 11226172"
FT                   /db_xref="GOA:A2Q7V9"
FT                   /db_xref="InterPro:IPR008610"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7V9"
FT                   /inference="profile:COGS:COG0513"
FT                   /inference="profile:COGS:COG5271"
FT                   /inference="profile:COGS:COG5665"
FT                   /protein_id="CAK43582.1"
FT                   /translation="MPKRSKLLQALDEHRGRDYEAEKQKKLVKAAKKKTTATKGEDVKE
FT                   AVVEDKKEEKKKEEEVEEESEDEETPEETPSDAEEEEEEDDEEEAEESDIPLSDLSDDE
FT                   REDVVTHQRLTINNSAAITSSLKRISFLTPATPFSEHNSLVSQEPIEVPDANDDLNREL
FT                   AFYKVCQAAAMTARSTLKKEGVPFTRPGDYFAEMVKTDEHMGKIKKKLYDEAAAKKAAA
FT                   EARKQRDLKKFGKQVQVAKLQQRAKEKRETLEKINALKKKRKAETGGPTDDSSNMFDVA
FT                   IDDAAQAGGRKRGRDAEGGPSMKRQKKNEKFGFGGKKRFAKSGDAVSSGDMRDFSVKKM
FT                   KGGPKGGGAKRPGKSRRAAAKGRS"
FT   mRNA            complement(join(<50483..50793,50875..>51658))
FT                   /locus_tag="An01g02120"
FT   exon            complement(50483..50793)
FT                   /locus_tag="An01g02120"
FT                   /number=1
FT   intron          complement(50794..50874)
FT                   /locus_tag="An01g02120"
FT                   /number=1
FT   exon            complement(50875..51658)
FT                   /locus_tag="An01g02120"
FT                   /number=2
FT   exon            52974..54188
FT                   /locus_tag="An01g02130"
FT                   /number=1
FT   CDS_pept        52974..54188
FT                   /locus_tag="An01g02130"
FT                   /note="Function: het-6 of N. crassa is involved in the
FT                   restriction of heterokaryon formation during asexual
FT                   growth."
FT                   /note="Remark: in filamentous fungi, vegetative cell fusion
FT                   between genotypically distinct individuals leads to a
FT                   cell-death reaction known as vegetative or heterokaryon
FT                   incompatibility."
FT                   /note="Similarity: het-6(OR) of N. crassa has three regions
FT                   of amino acid sequence similarity to the predicted product
FT                   of the het-e vegetative incompatibility gene in P. anserina
FT                   and to the predicted product of tol, which mediates
FT                   mating-type vegetative incompatibility in N. crassa."
FT                   /note="Title: similarity to heterokaryon incompatibility
FT                   protein het-6 - Neurospora crassa"
FT                   /note="See PMID 10880472"
FT                   /note="See PMID 11035941"
FT                   /note="See PMID 11092825"
FT                   /db_xref="GOA:A2Q7W0"
FT                   /db_xref="InterPro:IPR010730"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7W0"
FT                   /inference="similar to AA sequence:UniProtKB:AF208542.1"
FT                   /protein_id="CAK43583.1"
FT                   /translation="MPLSYDKLDPSASQIRLLTIIPDENDENPVCGSLHTVSLNDTCDF
FT                   DALSYVWGDTSVTVDISVDNCIVGVTPNLHAFLRKIRQPNTERTVWVDYVCINQNNISE
FT                   RNSQVALMCQIYSNARSVVAWLGDLAPEALELIEWYHANRNGFYFESTGLHIDKAIEKL
FT                   LTPAKALCSSPYWHRVWTFQEWHLSKIAPVCMHEKTTFTMGNIFNRLHDEVAVARSRLT
FT                   SDTISLDMPYRAYPKPVVANSRCALFFGLQRRLDTLVNYIPRDILHLNPYTPRPSGLGD
FT                   LLSLTRDRQCSNELDKVYALYGLSPVARVTYPPDYRKTIGQVNHETTSFILGHEANMNI
FT                   FNDFDFCFNSANKDESLPSWVVDFTTTDPKHREKMQQSFSKTMNLDKALWEQSRDHAPI
FT                   VADDM"
FT   mRNA            <52974..>54188
FT                   /locus_tag="An01g02130"
FT   CDS_pept        complement(join(56646..56913,56981..57017,57068..57587,
FT                   57636..57887,57962..58133,58221..58462))
FT                   /locus_tag="An01g02140"
FT                   /note="Remark: the deletion of YGR260w in a bna1
FT                   auxotrophic mutant for nicotinic acid prevents growth at
FT                   low nicotinic acid concentration. This suggests that
FT                   YGR260w is necessary for nicotinic acid import into the
FT                   cell."
FT                   /note="Remark: the systematic name for TNA1 of S.
FT                   cerevisiae is YGR260w."
FT                   /note="Similarity: the ORF shows similarity to some
FT                   allantoate permeases."
FT                   /note="Title: strong similarity to high-affinity nicotinic
FT                   acid permease Tna1 - Saccharomyces cerevisiae"
FT                   /note="See PMID 8720066"
FT                   /note="See PMID 10373489"
FT                   /db_xref="GOA:A2Q7W1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7W1"
FT                   /inference="profile:COGS:COG0477"
FT                   /protein_id="CAK43584.1"
FT                   /translation="MKEESPVPAAMEAEKSSGAASHVEDAEKNSIHPGESLDYFTPKEK
FT                   KRLMRRIDIRLVIPLGCLYCISLLDRTNLGAASVAGMQEELKMNAKNNGYSISSLVFFI
FT                   TYTVFQPPMTVIIRKLGPRLFLSAIVLLWGVVMIGFGMSPTWPVLAGLRVILGALEAGF
FT                   YPGCVYLLSTWYPRFELQKRNALFYLIGSTASGFGGILAYGLMQMHGIGGKSGWRWIFI
FT                   TPQIEGILTCVMGIGSYAILVDFPEQSPKSWHFLNESEAAYVVATIENDRSDVYTEPFT
FT                   LKGYLRSGADSKVWAYAAMYMLTTANSYSIAYFLPIILEDSMGFSVAKAQCLVAPPYVA
FT                   AAIVMYTQAVYADKWHLRGPIIAANAAMGLVGLALLGYLSESGPRYFGVFLATIAANAN
FT                   CPALVSWQSNNVRGQWKRAFTSATLIGGGSIGGIIGTTVFRAQDAPNYRPGLLTTMIAN
FT                   ALVIVVVAGLSFKFWRANRRVDRGGKPIEGLAGFKYTY"
FT   mRNA            complement(join(<56646..56913,56981..57017,57068..57587,
FT                   57636..57887,57962..58133,58221..>58462))
FT                   /locus_tag="An01g02140"
FT   exon            complement(56646..56913)
FT                   /locus_tag="An01g02140"
FT                   /number=1
FT   intron          complement(56914..56980)
FT                   /locus_tag="An01g02140"
FT                   /number=1
FT   exon            complement(56981..57017)
FT                   /locus_tag="An01g02140"
FT                   /number=2
FT   intron          complement(57018..57067)
FT                   /locus_tag="An01g02140"
FT                   /number=2
FT   exon            complement(57068..57587)
FT                   /locus_tag="An01g02140"
FT                   /number=3
FT   intron          complement(57588..57635)
FT                   /locus_tag="An01g02140"
FT                   /number=3
FT   exon            complement(57636..57887)
FT                   /locus_tag="An01g02140"
FT                   /number=4
FT   intron          complement(57888..57961)
FT                   /locus_tag="An01g02140"
FT                   /number=4
FT   exon            complement(57962..58133)
FT                   /locus_tag="An01g02140"
FT                   /number=5
FT   intron          complement(58134..58220)
FT                   /locus_tag="An01g02140"
FT                   /number=5
FT   exon            complement(58221..58462)
FT                   /locus_tag="An01g02140"
FT                   /number=6
FT   CDS_pept        complement(join(59465..59855,59907..60071,60120..60820,
FT                   60870..60999,61111..61691))
FT                   /locus_tag="An01g02150"
FT                   /note="Function: arcA of A. nidulans is, together with
FT                   suDpro and suEpro, responsible for regulation of synthesis
FT                   of arginine catabolic enzymes."
FT                   /note="Title: strong similarity to transcription regulator
FT                   of arginine catabolism arcA - Aspergillus nidulans"
FT                   /note="See PMID 62492"
FT                   /db_xref="GOA:A2Q7W2"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7W2"
FT                   /inference="similar to AA sequence:UniProtKB:ENI294750.1"
FT                   /protein_id="CAK43585.1"
FT                   /translation="MASALGDHVSVPSDLDLSLDLTASGQITDILEFDLDENNLAVTTE
FT                   AITQDTSPSDEGGVSTPNSTSLDAPRPSAAKRKSKIVLAKPRRVRTGCLTCRERHLKCD
FT                   EALHRCQNCRKSGRVCRRGIRLNFIDIQKSTPPHCVVRIPATGVTFRDESRLIASEYVG
FT                   GFERYPPEVAEPSLEKGNATGPCLTPSLSASSTKEGHINATNHTCLNNPEEVYLLQVFV
FT                   EEVGLWMDSMDAVKHFTHILPFHALEEPMLLKALLACGARHLFHVDASYGEEKAAELHN
FT                   VASQYLLRSLQDPDRDSALCATTAILLNIYELMSGRPIQGMSHIAGARALIKECHWNAK
FT                   TPGLGGACFWLNVSMELLSCLHFNWTLSWDPDTWGVELDLNHAQPSVAGNEEAWTHQMV
FT                   FICAKIANFRSLAQPPALEAASDMRISQRYQEWCTYNEWCDQWARAVPRSMMPLGYIHS
FT                   WQTNSKSVFPQIWLIKRSTIIARLLYHTARILLTKTNPVESEYSAEMQTVQQSHARDIC
FT                   GIVAHSRDRGVASLSIRFLAIAAECLATREAQQEALGILEDIIKQTGWKAEHVKQELQE
FT                   AWGWSDSHGPPMHMSEDILALFNSDHPLAADHAPARPKVPAGVINPLMATADFSMENHP
FT                   YQDYYVAPHRSLSHYPFGGF"
FT   mRNA            complement(join(<59465..59855,59907..60071,60120..60820,
FT                   60870..60999,61111..>61691))
FT                   /locus_tag="An01g02150"
FT   exon            complement(59465..59855)
FT                   /locus_tag="An01g02150"
FT                   /number=1
FT   intron          complement(59856..59906)
FT                   /locus_tag="An01g02150"
FT                   /number=1
FT   exon            complement(59907..60071)
FT                   /locus_tag="An01g02150"
FT                   /number=2
FT   intron          complement(60072..60119)
FT                   /locus_tag="An01g02150"
FT                   /number=2
FT   exon            complement(60120..60820)
FT                   /locus_tag="An01g02150"
FT                   /number=3
FT   intron          complement(60821..60869)
FT                   /locus_tag="An01g02150"
FT                   /number=3
FT   exon            complement(60870..60999)
FT                   /locus_tag="An01g02150"
FT                   /number=4
FT   intron          complement(61000..61110)
FT                   /locus_tag="An01g02150"
FT                   /number=4
FT   exon            complement(61111..61691)
FT                   /locus_tag="An01g02150"
FT                   /number=5
FT   exon            complement(62563..64134)
FT                   /locus_tag="An01g02160"
FT                   /number=1
FT   CDS_pept        complement(62563..64134)
FT                   /locus_tag="An01g02160"
FT                   /note="Function: fnx1 of S. pombe required for entry into
FT                   the quiescent G0 state, that is normally induced by
FT                   nitrogen starvation."
FT                   /note="Similarity: similarity to several multidrug
FT                   resistance proteins."
FT                   /note="Title: strong similarity to multidrug resistance
FT                   protein fnx1p - Schizosaccharomyces pombe"
FT                   /note="See PMID 9710608"
FT                   /db_xref="GOA:A2Q7W3"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7W3"
FT                   /inference="profile:COGS:COG0477"
FT                   /inference="similar to AA sequence:UniProtKB:SPBC21D10.10"
FT                   /protein_id="CAK43586.1"
FT                   /translation="MRFWLIFSGILMGYVIGFFDSTLMASSHPVITSYFHASNSASWLS
FT                   TAFLLTSTAFLPLFGRISDTFGRKPVYLFAIAIFFVTTAWCAAAQSMFSFIAARAFCGL
FT                   GAGGVFSMGMILSSDLVRLEYRGVYQSYINLCLGIGGCLGLAFGGFLCDQVGWRGAFLV
FT                   QLPFIFVYFIVAAWTTPADLGLKRAKTERKSLTQLLKSIDLVGSLILVVGVTSLIMGLN
FT                   LGGNVLSWSHPIVITSLISSLILAVVFVRYERTVERGVMPISLLVQEPRASLIFGNFFG
FT                   AISVNTMVFNAPLYFQAVKLATPTDSGLRLIGSTLAVTISSVSTGFIITWTKRLKPTII
FT                   FGDIFLLLGGCAAASMSVGTPDWLAMVCVSLSSLGQGCSFPSLMVSVLATTDQEDQAVA
FT                   TTTLGLWRNLGSVMGVATSSWIFQNTLVYQLEEMVTGPNKEGVILLVRKSVQAIAKLDS
FT                   MHQQQGKSRLYVPVEVNDTKSLTSNRSVCCCPSRYFLLCCHLGCSYAPSAPSSPSPQIG
FT                   NQSMRT"
FT   mRNA            complement(<62563..>64134)
FT                   /locus_tag="An01g02160"
FT   mat_peptide     complement(62566..64083)
FT                   /locus_tag="An01g02160"
FT   sig_peptide     complement(64084..64134)
FT                   /locus_tag="An01g02160"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        join(66220..66457,66561..66787,66875..67159)
FT                   /locus_tag="An01g02170"
FT                   /note="Similarity: similarity to S. pombe hypothetical
FT                   protein SPAC13C5. 04, similarity to several esterases"
FT                   /note="Title: similarity to anthranilate converting enzyme
FT                   tdnT - Pseudomonas putida"
FT                   /note="See PMID 8990291"
FT                   /db_xref="GOA:A2Q7W4"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7W4"
FT                   /inference="profile:COGS:COG0512"
FT                   /inference="profile:COGS:COG0518"
FT                   /protein_id="CAK43587.1"
FT                   /translation="MPPLRIAILECDTPVEKVNNKYGGYRGVFSLLLRESAAALGQPDK
FT                   LDPETGLEFSGWDVVTAQEYPNLEDVDAIVLSGSKHDSFEDHPWILKLVEFTKKAFEDK
FT                   RVKIFAICFGHQILARALGARVGRNTAGWELAVCEVDLTETGKELFGRDKLRIHQMHQD
FT                   IAYGYPSEVISLGASPRCAVQGMYVPGKLISVQGHPEFREDIMTEILTLRTAAGIFSKE
FT                   QSEDAFNRAGIPHDGIAITMAFLKLLI"
FT   mRNA            join(<66220..66457,66561..66787,66875..>67159)
FT                   /locus_tag="An01g02170"
FT   exon            66220..66457
FT                   /locus_tag="An01g02170"
FT                   /number=1
FT   intron          66458..66560
FT                   /locus_tag="An01g02170"
FT                   /number=1
FT   exon            66561..66787
FT                   /locus_tag="An01g02170"
FT                   /number=2
FT   intron          66788..66874
FT                   /locus_tag="An01g02170"
FT                   /number=2
FT   exon            66875..67159
FT                   /locus_tag="An01g02170"
FT                   /number=3
FT   CDS_pept        complement(join(67349..67385,67548..68203))
FT                   /locus_tag="An01g02180"
FT                   /note="Title: similarity to hypothetical protein YOL032w
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="InterPro:IPR008493"
FT                   /db_xref="InterPro:IPR031318"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7W5"
FT                   /inference="similar to AA sequence:PIR:S66715"
FT                   /protein_id="CAK43588.1"
FT                   /translation="MFSVIIPDHPCLTDIVAVETQPNGQTTKFAFNFPLPPKLTELVVF
FT                   FLPGTVLPPDTAAAIYIQFPDPNNAPQFKFIGALANERPSAILKVQAPQIPGLQNGNAM
FT                   AGAAPMVTLGISLEPVQAVAPQIAALEAEQAGGAGSSLELVRHTRQQKEITTKVLAQRI
FT                   IGNAFNFLASFASEDPSNRGQETVPLKTFRDWWTKFERKVEMDPTFLEREDPSATGSLY
FT                   THRLWSSG"
FT   mRNA            complement(join(<67349..67385,67548..>68203))
FT                   /locus_tag="An01g02180"
FT   exon            complement(67349..67385)
FT                   /locus_tag="An01g02180"
FT                   /number=1
FT   intron          complement(67386..67547)
FT                   /locus_tag="An01g02180"
FT                   /number=1
FT   exon            complement(67548..68203)
FT                   /locus_tag="An01g02180"
FT                   /number=2
FT   CDS_pept        join(68648..68688,68754..69681)
FT                   /locus_tag="An01g02190"
FT                   /EC_number="2.7.6.2"
FT                   /note="Catalytic activity: ATP + Thiamine = AMP + Thiamine
FT                   diphosphate."
FT                   /note="Pathway: Thiamine metabolism."
FT                   /note="Title: similarity to thiamin pyrophosphokinase tnr3p
FT                   - Schizosaccharomyces pombe"
FT                   /note="See PMID 6282163"
FT                   /note="See PMID 7499352"
FT                   /db_xref="GOA:A2Q7W6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR031804"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7W6"
FT                   /inference="profile:COGS:COG0494"
FT                   /inference="profile:PFAM:PF00293"
FT                   /inference="similar to AA sequence:PIR:S52350"
FT                   /protein_id="CAK43589.1"
FT                   /translation="MGKSNLELVIECDRFPYYQDGPASYIEHLKNYHVFKVAGCDAILG
FT                   YILNSTVERFDLPSEWWATDSDNRSVTLLAPADATPQQRSEIMAKTLSKAVELGTFDIL
FT                   KGWRNEMYPIYGPGGKFLLEMERSATPLFGVVSYGVHSTVYVEDENGLRIWVPRRSKTK
FT                   QTYPGMLDNSVAGGMSTTEHPFECLVREAMEEASLPEDVVRANATPAGCVTYTYVRSAK
FT                   AGGETDLVQPEVEYIFDVKVGADIIPKPCDTEVEEFNLFTIEETKKALANGEFKPNCAV
FT                   VLIDFFIRHGILTPENEPDYLEIIARMHRRLEFPTASHVTV"
FT   mRNA            join(<68648..68688,68754..>69681)
FT                   /locus_tag="An01g02190"
FT   exon            68648..68688
FT                   /locus_tag="An01g02190"
FT                   /number=1
FT   intron          68689..68753
FT                   /locus_tag="An01g02190"
FT                   /number=1
FT   exon            68754..69681
FT                   /locus_tag="An01g02190"
FT                   /number=2
FT   CDS_pept        complement(join(69894..69999,70094..70422))
FT                   /locus_tag="An01g02200"
FT                   /EC_number="2.7.7.6"
FT                   /note="Catalytic activity: nucleoside triphosphate + RNA(n)
FT                   = Pyrophosphate + RNA(n+1)."
FT                   /note="Remark: RNA polymerases I, II, and III of S.
FT                   cerevisiae share three subunits that are immunologically
FT                   and biochemically indistinguishable (RPB5, RPB6, and
FT                   RPB8)."
FT                   /note="Title: strong similarity to 16 kD subunit of
FT                   DNA-directed RNA polymerase I,II,III Rpb8 - Saccharomyces
FT                   cerevisiae"
FT                   /note="nucleus"
FT                   /note="See PMID 1408842"
FT                   /note="See PMID 10653691"
FT                   /db_xref="GOA:A2Q7W7"
FT                   /db_xref="InterPro:IPR005570"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7W7"
FT                   /inference="profile:PFAM:PF03870"
FT                   /inference="similar to AA sequence:PIR:C34588"
FT                   /protein_id="CAK43590.1"
FT                   /translation="MSDPVLFEDTFTITTINSQKYDRVSRLSCNSTDTLSHFTLDVNSE
FT                   LYPCVVGESVNMALASTLSLDGKDDSGSKGWREVGMGEQTLANDYDYVCHGKVYRFEEG
FT                   SSQGNMAVFISFGGLLLYLEGPYKKLAPLRIDYVYLLLKK"
FT   mRNA            complement(join(<69894..69999,70094..>70422))
FT                   /locus_tag="An01g02200"
FT   exon            complement(69894..69999)
FT                   /locus_tag="An01g02200"
FT                   /number=1
FT   intron          complement(70000..70093)
FT                   /locus_tag="An01g02200"
FT                   /number=1
FT   exon            complement(70094..70422)
FT                   /locus_tag="An01g02200"
FT                   /number=2
FT   CDS_pept        join(70707..71178,71248..71957)
FT                   /locus_tag="An01g02210"
FT                   /note="Title: similarity to hypothetical protein
FT                   SPCC11E10.06c - Schizosaccharomyces pombe"
FT                   /db_xref="GOA:A2Q7W8"
FT                   /db_xref="InterPro:IPR008728"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7W8"
FT                   /inference="similar to AA sequence:PIR:T40857"
FT                   /protein_id="CAK43591.1"
FT                   /translation="MSFRKRNIGLSAGADRTGAVNANAQPQQPSATPELTPGVRPSPDD
FT                   GRPTTSTGTPSLDNLLAGHGGLPIGKTLLIEENGTTDFAGALLRYYAAEGVVQDQKIHI
FT                   VGMPEQWGRSLPGLLGPADAIDDKQDKRKGERMKIAWRYERLGEFGAGIAGSRAPSGDQ
FT                   SQSAADPNVDKRPAFCHAFDLTKRLTHPSIANLNYIPLAPSNEPLFVSIHKRLQAAIAS
FT                   CPPNTVHRILIPSLLNPTIYPPDSCQPDNLLPFLHSLRALMSAQGARVTAMITLPLSLF
FT                   PRATGLVRWMELLSDGVIELCPFPHSSDALATSGAATSQEEPPQGMLKVHRLPVLHERG
FT                   GGSDQNIGQDWAFTLSRKKFEIKPFSLPPAEGDKEGQDAAVTGGMPKKADLEF"
FT   mRNA            join(<70707..71178,71248..>71957)
FT                   /locus_tag="An01g02210"
FT   exon            70707..71178
FT                   /locus_tag="An01g02210"
FT                   /number=1
FT   intron          71179..71247
FT                   /locus_tag="An01g02210"
FT                   /number=1
FT   exon            71248..71957
FT                   /locus_tag="An01g02210"
FT                   /number=2
FT   CDS_pept        join(72861..73368,73491..73814)
FT                   /exception="reasons given in citation"
FT                   /locus_tag="An01g02220"
FT                   /note="Complex: in S. cerevisiae the tRNA splicing
FT                   endonuclease is a tetrameric enzyme."
FT                   /note="Function: in S. cerevisiae the tRNA splicing
FT                   endonuclease is responsible for identification and cleavage
FT                   of the splice sites in pre-tRNA."
FT                   /note="Function: splicing of tRNA precursors is essential
FT                   for the production of mature tRNA."
FT                   /note="Title: strong similarity to tRNA splicing
FT                   endonuclease gamma subunit Sen34 - Saccharomyces cerevisiae
FT                   [putative frameshift]"
FT                   /note="putative frameshift"
FT                   /note="See PMID 9200603"
FT                   /db_xref="GOA:A2Q7W9"
FT                   /db_xref="InterPro:IPR006676"
FT                   /db_xref="InterPro:IPR006677"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR016690"
FT                   /db_xref="InterPro:IPR036167"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7W9"
FT                   /inference="profile:COGS:COG1676"
FT                   /inference="similar to AA sequence:PIR:S40903"
FT                   /protein_id="CAK43592.1"
FT                   /translation="MDIEPTLPIPISYIGGSYFLFSIDAVTYVRREYHICGVLSGTLPQ
FT                   IPQQNVFLGLPLKLMPEEARLLVEKGVACIVDEVKVQKDGMRALMEEDRKKYLRELESQ
FT                   GQHAMRLQNDRKEQQREKALKKIEEKKAAKAKKSAERQQEQQPAPLNNEAAAQDPVVDL
FT                   FANDQEATASDVPSSYPLFAHLHSEGYFLSPGLRFGCQYLAYPGDPLRFHSHFLSVSAD
FT                   WDEELDLMSIVAGGRLGTGVKKGFLIGGAEKKIEGSDAGDPSSVRTFSIEWGGM"
FT   mRNA            join(<72861..73368,73491..>73814)
FT                   /locus_tag="An01g02220"
FT   exon            72861..73368
FT                   /locus_tag="An01g02220"
FT                   /number=1
FT   intron          73369..73490
FT                   /locus_tag="An01g02220"
FT                   /number=1
FT   exon            73491..73814
FT                   /locus_tag="An01g02220"
FT                   /number=2
FT   CDS_pept        complement(join(74751..74956,75022..75544))
FT                   /locus_tag="An01g02230"
FT                   /note="Remark: ribonuclease P is involved in processing of
FT                   tRNAs and rRNAs."
FT                   /note="Title: similarity to ribonuclease P protein subunit
FT                   p29 - Homo sapiens"
FT                   /note="See PMID 9759486"
FT                   /note="See PMID 10024167"
FT                   /db_xref="GOA:A2Q7X0"
FT                   /db_xref="InterPro:IPR002730"
FT                   /db_xref="InterPro:IPR016848"
FT                   /db_xref="InterPro:IPR023534"
FT                   /db_xref="InterPro:IPR023538"
FT                   /db_xref="InterPro:IPR036980"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7X0"
FT                   /inference="similar to AA sequence:UniProtKB:AF001176.1"
FT                   /protein_id="CAK43593.1"
FT                   /translation="MTTPKPHIAHTLLSRAHSPDTASQLFTERIKQKPLYVRPTSPTPA
FT                   DNRSRRRLHRLRKKEYFLRKQKPQPLSARQKRASGLYNLPKEECKYAVFQELHAMWVRY
FT                   MQDMLDLGAKKFKPPMTPLSHGSKLSSADFHGAEVEVVRSRCEGRVGVKGIVVRDTKFT
FT                   FVVVTRGDEVKTIPKEQTIFRFSVPLPEADDADGAAVTGETSADSAKKELVFELHGSQF
FT                   QNRPVDRANKKFKWRNVDYI"
FT   mRNA            complement(join(<74751..74956,75022..>75544))
FT                   /locus_tag="An01g02230"
FT   exon            complement(74751..74956)
FT                   /locus_tag="An01g02230"
FT                   /number=1
FT   intron          complement(74957..75021)
FT                   /locus_tag="An01g02230"
FT                   /number=1
FT   exon            complement(75022..75544)
FT                   /locus_tag="An01g02230"
FT                   /number=2
FT   CDS_pept        join(76332..76640,76745..77440)
FT                   /locus_tag="An01g02240"
FT                   /EC_number="1.-.-.-"
FT                   /note="Similarity: shows similarity to several
FT                   oxidoreductases with different specificities, e. g
FT                   1-aminocyclopropane-1-carboxylic acid oxidases."
FT                   /note="Title: similarity to
FT                   1-aminocyclopropane-1-carboxylic acid oxidase - Cucumis
FT                   sativus"
FT                   /note="See PMID 10608661"
FT                   /db_xref="GOA:A2Q7X1"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR026992"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7X1"
FT                   /inference="profile:COGS:COG3491"
FT                   /inference="profile:PFAM:PF03171"
FT                   /protein_id="CAK43594.1"
FT                   /translation="MSETNNLPPFPSDIPTAPLLRLSLSKLQAHDITETHNLLQACKDI
FT                   GFFYLDLRDSNEGTNLLNNADKLFPIGERLFDLPLDEKKKYDLASQKSYYGYKAQGAMV
FT                   SKDDILNIAPSLPSPPILQESRPLLESFVRTSHDIVTLLLSILSDSLSLPTSTLPDLHR
FT                   LTAPSGDQIRFIKAPPTATQNPTLGEHTDFGSVTILFNRIGGLQVLPPGADAEWTYVRP
FT                   LSGHAIINLGDAMVKFTNGLFRSNIHRVVAPPGQQAGCTRYSLVYFARPEDEVPLRRLE
FT                   SDRIPALGEGVVEEEISSKDWVIXRALGRRVDLGPVDYEKAAGTEGVSRRLRV"
FT   mRNA            join(<76332..76640,76745..>77440)
FT                   /locus_tag="An01g02240"
FT   exon            76332..76640
FT                   /locus_tag="An01g02240"
FT                   /number=1
FT   intron          76641..76744
FT                   /locus_tag="An01g02240"
FT                   /number=1
FT   exon            76745..77440
FT                   /locus_tag="An01g02240"
FT                   /number=2
FT   CDS_pept        complement(join(77769..78556,78646..79275,79335..80781))
FT                   /locus_tag="An01g02250"
FT                   /note="Title: weak similarity to hypothetical AAA-ATPase
FT                   AAR34299.1 - Geobacter sulfurreducens"
FT                   /db_xref="GOA:A2Q7X2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7X2"
FT                   /inference="profile:COGS:COG0465"
FT                   /inference="profile:PFAM:PF00004"
FT                   /protein_id="CAK43595.1"
FT                   /translation="MATITEEPIVAIPVDTPTKNSSHDSAVELLKELQDLRARIQSLEQ
FT                   SNAKITEKAANDKGDNDHSRDDSTSSDAEDEEPKHYPCDDSDDVIMDLRYVKWNEFKTM
FT                   YAEEKRHVIDVLEGPAQYCWQQTERIIRRFGDFALIRGEEGENTSEGDPKPKTDTGGAE
FT                   DDLPERIRINSSLLASLLKDIVSRIDQSAPFVVLRPYKILVGYDQEIRERHRQLAAKWR
FT                   IGSGHEELDDPTLLEPGKEPIDSRQAFRALDCLVSFMDRHLSPVISRHRALLDNFAPSP
FT                   STLDPTISFSNLWYLFHPGMQVACWFTPEQSAPHVQPTNRPSIWKVLQVSEGRPVLNSN
FT                   YSGRVNHFIIRLYKIGYDGERFGVLSRDFHLPHFSGERSIRSLGIVPTRFVDDYQALRD
FT                   KLLKQGELFATFATPQHRFYSGSTLTCHVDGASCPGSFNRRTDYIKGNIIVDFKTARNE
FT                   DQEWVPSLSIPSTMGGTGSEVQKLSIYDDDWVDVELTKDFIRDDAFLARQESAPEQQVT
FT                   RKEVWSDDELVMMPDRACAWDLHRRRWALCDLERMRPVPTDDGWKNLKLRPGHKRMLYA
FT                   QVKRHFSDRKSKEDGESQQVDPDVVRGKGEGLIILLHGEPGVGKTSTAECMAAWLERPL
FT                   YPITCGDLGTSAEVVEDKLNRISAQAEAWNCVLLLDEADVFLAARSKTELERNAIVSGL
FT                   LFLTTNRVGSFDEAFVSRIHLALYYPGLNKGQNHAIWEMNLEKAKARKTSLTIDMDPIL
FT                   EWADANWEQNSKSRTRWNGRQIRNGCQTAIALAEFEAEETSKPVFLQVKHVQQVAAASK
FT                   EFYDYVSRVLGADMAHRAFVERLRLDDWPSNMPADRDLYRVSSNYSPSIRAPEEITSPP
FT                   RNRRRGGGRANDLISSSGGGGAPRTANVHHQWQAGRHDEFDELAFQSPQRHRMQRTPET
FT                   TGRGMSDIHGLPYDDEDEFPDDFE"
FT   mRNA            complement(join(<77769..78556,78646..79275,79335..>80781))
FT                   /locus_tag="An01g02250"
FT   exon            complement(77769..78556)
FT                   /locus_tag="An01g02250"
FT                   /number=1
FT   intron          complement(78557..78645)
FT                   /locus_tag="An01g02250"
FT                   /number=1
FT   exon            complement(78646..79275)
FT                   /locus_tag="An01g02250"
FT                   /number=2
FT   intron          complement(79276..79334)
FT                   /locus_tag="An01g02250"
FT                   /number=2
FT   exon            complement(79335..80781)
FT                   /locus_tag="An01g02250"
FT                   /number=3
FT   CDS_pept        join(81785..81954,82007..82322,82370..82568,82643..82990,
FT                   83046..83989)
FT                   /locus_tag="An01g02260"
FT                   /note="Similarity: C-terminus shows weak similarity to
FT                   central part of bacterial ftsZ proteins."
FT                   /note="Title: strong similarity to hypothetical protein
FT                   encoded by An07g04490 - Aspergillus niger"
FT                   /db_xref="GOA:A2Q7X3"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7X3"
FT                   /protein_id="CAK43596.1"
FT                   /translation="MEPSLMPRMTPEQETHMAKSWLRGHSHRLRLPLSNRSQPQPSAQI
FT                   DLADTRQELDEDVDEVDEFCQVIQCYSNETKGTSEYGDGHGGGRFDIYGAHSWKEVVNI
FT                   VQAVEKDYNHSATGWKGLARRAFRKLGEHAEDFNPWLDLLPDDKYFSIACGGLKIVLGM
FT                   AARRSEQREAILAFFAEIPDIIFWTDRYHSLFQDEEGLKTYLYEFYLALLARIQGTIAA
FT                   LVDVSLWRKIISGLRVKNADKSLGHVNQRFMRARTQLDKHLQFVRDRLQVDTNQGVVYI
FT                   KPIVDNLATEQEIVIQQNSDLGNYVRGFRHEVMTRLERQLNNPSSNFAEQMQQVLRNEL
FT                   QKAQWQINQENMQRESRQWQITRQGYPRSDLYFFLRLNEQDVRQQFIQDLDDTGRDGQD
FT                   IDMAAQTHAQQLLRMPRFQDWIRSDQPDMLHVDGNCDNYAMARCSPFSLLCCVLVHELL
FT                   QQAHCQVLFFFCGLHNLAGEPMAGPVGLVKSLIIQLLLDTDGHYDLLFLTFGRREEALY
FT                   HNDLPTLCETLREMLIQNRSSALFCIVDGASLFEVREWREEMEYVVQRLFSLTIDPDIA
FT                   TAFKVLITSPGISRLASGVPQACRVYVSETNERISDAGFRNPEAFWDEVDRRREDMADT
FT                   AGRYEVNPYEAMYKVDMYSEEYE"
FT   mRNA            join(<81785..81954,82007..82322,82370..82568,82643..82990,
FT                   83046..>83989)
FT                   /locus_tag="An01g02260"
FT   exon            81785..81954
FT                   /locus_tag="An01g02260"
FT                   /number=1
FT   intron          81955..82006
FT                   /locus_tag="An01g02260"
FT                   /number=1
FT   exon            82007..82322
FT                   /locus_tag="An01g02260"
FT                   /number=2
FT   intron          82323..82369
FT                   /locus_tag="An01g02260"
FT                   /number=2
FT   exon            82370..82568
FT                   /locus_tag="An01g02260"
FT                   /number=3
FT   intron          82569..82642
FT                   /locus_tag="An01g02260"
FT                   /number=3
FT   exon            82643..82990
FT                   /locus_tag="An01g02260"
FT                   /number=4
FT   intron          82991..83045
FT                   /locus_tag="An01g02260"
FT                   /number=4
FT   exon            83046..83989
FT                   /locus_tag="An01g02260"
FT                   /number=5
FT   CDS_pept        complement(join(86263..86329,86384..86868,87284..87343,
FT                   87392..87446,87823..87875,87949..87984))
FT                   /locus_tag="An01g02270"
FT                   /EC_number="3.1.26.4"
FT                   /note="Catalytic activity: rinonuclease H catalyzes the
FT                   endonucleolytic cleavage to 5'-phospho- monoester."
FT                   /note="Function: ribonuclease H is an endonuclease that
FT                   degrades the RNA of RNA-DNA hybrids specifically."
FT                   /note="Title: similarity to ribonuclease H1 RNH1
FT                   -Trypanosoma brucei"
FT                   /note="See PMID 9178276"
FT                   /db_xref="GOA:A2Q7X4"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7X4"
FT                   /inference="profile:COGS:COG0328"
FT                   /inference="profile:PFAM:PF00075"
FT                   /protein_id="CAK43597.1"
FT                   /translation="MDAIYVIVAVPEVMSLSLFGNTLNGISTSTNRPNLLVMPIPPTIL
FT                   VDHPGTMESEMLEPDEIVVGKRERPNLPPPPTYPSPPWFTSSRFTLTVAVEPNGQPGSI
FT                   GAAAAAFKDASGRFHGETTEDLPSYTAPTNQRAEITSVILGLRMALKRYDQLHSDPWLD
FT                   VTIYSDSAFAVDCMEEWVYKWIRNGWMNCKGNEVANRDLIEEAVVLSDRLKEKGDVRYV
FT                   WIPREENQLCNDLKNARCDEQSSSSDDSY"
FT   mRNA            complement(join(<86263..86329,86384..86868,87284..87343,
FT                   87392..87446,87823..87875,87949..>87984))
FT                   /locus_tag="An01g02270"
FT   exon            complement(86263..86329)
FT                   /locus_tag="An01g02270"
FT                   /number=1
FT   intron          complement(86330..86383)
FT                   /locus_tag="An01g02270"
FT                   /number=1
FT   exon            complement(86384..86868)
FT                   /locus_tag="An01g02270"
FT                   /number=2
FT   intron          complement(86869..87283)
FT                   /locus_tag="An01g02270"
FT                   /number=2
FT   exon            complement(87284..87343)
FT                   /locus_tag="An01g02270"
FT                   /number=3
FT   intron          complement(87344..87391)
FT                   /locus_tag="An01g02270"
FT                   /number=3
FT   exon            complement(87392..87446)
FT                   /locus_tag="An01g02270"
FT                   /number=4
FT   intron          complement(87447..87822)
FT                   /locus_tag="An01g02270"
FT                   /number=4
FT   exon            complement(87823..87875)
FT                   /locus_tag="An01g02270"
FT                   /number=5
FT   intron          complement(87876..87948)
FT                   /locus_tag="An01g02270"
FT                   /number=5
FT   exon            complement(87949..87984)
FT                   /locus_tag="An01g02270"
FT                   /number=6
FT   CDS_pept        complement(join(90069..90243,90288..90371,90427..90621,
FT                   90679..91242,91297..91484,91800..92324))
FT                   /locus_tag="An01g02280"
FT                   /product="hypothetical protein"
FT                   /note="Similarity: shows only weak similarity to N-terminal
FT                   part of hypothetical protein DR0458 of Deinococcus
FT                   radiodurans."
FT                   /db_xref="GOA:A2Q7X5"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7X5"
FT                   /protein_id="CAK43598.1"
FT                   /translation="MCHTSLRFPLATTTLGACHSYLTVTLHTYNFLTHPPLARPVPPES
FT                   LFGFYLTFGSRWSFAFFLSSSPPRRQVVNLQFSTILAGDFVPLPACIPPPPPPPSPILS
FT                   QRHVPFPPAHTLHTLYFTSDISSTPGPQDLTAPQPIIRWICPQAVPIPCDPSCWVFHPS
FT                   HRLVGCPKPTVTRSTILPEKMSTQQDPNPSNEGKHDGLSKYVKRMKMALRRSSTVRTTT
FT                   PVMQKSREPEPSQAPAPQRIPQAPTVKATPDATVFTNWGAIQEEKARALFAKYGLTLEP
FT                   GEWRSPSDTTVQRVVRPIRMRVRRTCHRCQTTFGPNKVCVNCQHVRCKSCPHHPSTKTN
FT                   DHRDDTQAALQAIVAQKLHKPVPVQHKPKQPPLTLPSRTGGQDVIHHPTRQRVRRTCHQ
FT                   CSTVFAPDATECSTCQHIRCTMCPRDPPKLGKYPHGYPGDVDAPAEPPARTWKKPRQRV
FT                   RYTCHKCTTLYRSGERNCSNCGQEKGPETIRDPPRRDKPKPDPEIVRRVEERLAKVRIS
FT                   TGANGKSGFSNRLPKLRLFTYVLAPSYDKNSSSASFTLCSSRMPQGTGHATMVGGPSIV
FT                   "
FT   mRNA            complement(join(<90069..90243,90288..90371,90427..90621,
FT                   90679..91242,91297..91484,91800..>92324))
FT                   /locus_tag="An01g02280"
FT   exon            complement(90069..90243)
FT                   /locus_tag="An01g02280"
FT                   /number=1
FT   mat_peptide     complement(join(90072..90243,90288..90371,90427..90621,
FT                   90679..91242,91297..91484,91800..92264))
FT                   /locus_tag="An01g02280"
FT                   /product="hypothetical protein"
FT   intron          complement(90244..90287)
FT                   /locus_tag="An01g02280"
FT                   /number=1
FT   exon            complement(90288..90371)
FT                   /locus_tag="An01g02280"
FT                   /number=2
FT   intron          complement(90372..90426)
FT                   /locus_tag="An01g02280"
FT                   /number=2
FT   exon            complement(90427..90621)
FT                   /locus_tag="An01g02280"
FT                   /number=3
FT   intron          complement(90622..90678)
FT                   /locus_tag="An01g02280"
FT                   /number=3
FT   exon            complement(90679..91242)
FT                   /locus_tag="An01g02280"
FT                   /number=4
FT   intron          complement(91243..91296)
FT                   /locus_tag="An01g02280"
FT                   /number=4
FT   exon            complement(91297..91484)
FT                   /locus_tag="An01g02280"
FT                   /number=5
FT   intron          complement(91485..91799)
FT                   /locus_tag="An01g02280"
FT                   /number=5
FT   exon            complement(91800..92324)
FT                   /locus_tag="An01g02280"
FT                   /number=6
FT   sig_peptide     complement(92265..92324)
FT                   /locus_tag="An01g02280"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        join(94475..94616,94659..94717,94896..94958)
FT                   /locus_tag="An01g02290"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q7X6"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7X6"
FT                   /protein_id="CAK43599.1"
FT                   /translation="MKQPKNLNLHRRRSRSEKYSPTGFEGSELGFLLHRFVGTSLEGWC
FT                   WVGTGTGQDTWHENGGGDDDGDILLRIDPPTQNSSSFQHRTE"
FT   mRNA            join(<94475..94616,94659..94717,94896..>94958)
FT                   /locus_tag="An01g02290"
FT   exon            94475..94616
FT                   /locus_tag="An01g02290"
FT                   /number=1
FT   intron          94617..94658
FT                   /locus_tag="An01g02290"
FT                   /number=1
FT   exon            94659..94717
FT                   /locus_tag="An01g02290"
FT                   /number=2
FT   intron          94718..94895
FT                   /locus_tag="An01g02290"
FT                   /number=2
FT   exon            94896..94958
FT                   /locus_tag="An01g02290"
FT                   /number=3
FT   CDS_pept        complement(join(96719..96910,96982..97112,97261..97360,
FT                   97435..97437))
FT                   /locus_tag="An01g02300"
FT                   /note="Similarity: all matching proteins are 20-50
FT                   aminoacids longer at the C-terminus."
FT                   /note="Title: similarity to glia maturation factor BmGMF
FT                   -Brugia malayi"
FT                   /note="See PMID 7820553"
FT                   /note="See PMID 9047337"
FT                   /db_xref="GOA:A2Q7X7"
FT                   /db_xref="InterPro:IPR002108"
FT                   /db_xref="InterPro:IPR011171"
FT                   /db_xref="InterPro:IPR029006"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7X7"
FT                   /inference="profile:PFAM:PF00241"
FT                   /protein_id="CAK43600.1"
FT                   /translation="MSESRLYSFSPETKEKLRKFRLGTSRAKDPQAIIYIIDSKSQEIR
FT                   PEDGEVYSKMEDLADELPESSPRFILLSYPLTLASGRLTVPYVMLYYLPVNCNPNSRMM
FT                   YAGAVELMRNTAEVNRVIEVHEEDDIISIESKLQNAD"
FT   mRNA            complement(join(<96719..96910,96982..97112,97261..97360,
FT                   97435..>97437))
FT                   /locus_tag="An01g02300"
FT   exon            complement(96719..96910)
FT                   /locus_tag="An01g02300"
FT                   /number=1
FT   intron          complement(96911..96981)
FT                   /locus_tag="An01g02300"
FT                   /number=1
FT   exon            complement(96982..97112)
FT                   /locus_tag="An01g02300"
FT                   /number=2
FT   intron          complement(97113..97260)
FT                   /locus_tag="An01g02300"
FT                   /number=2
FT   exon            complement(97261..97360)
FT                   /locus_tag="An01g02300"
FT                   /number=3
FT   intron          complement(97361..97434)
FT                   /locus_tag="An01g02300"
FT                   /number=3
FT   exon            complement(97435..97437)
FT                   /locus_tag="An01g02300"
FT                   /number=4
FT   CDS_pept        join(97879..97965,98083..98249,98347..98974)
FT                   /locus_tag="An01g02310"
FT                   /note="Remark: shows similarity to several bacterial
FT                   competence-damage proteins."
FT                   /note="Title: strong similarity to hypothetical protein
FT                   YMR178w - Saccharomyces cerevisiae"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7X8"
FT                   /inference="profile:COGS:COG1058"
FT                   /inference="profile:PFAM:PF00994"
FT                   /inference="similar to AA sequence:PIR:S55125"
FT                   /protein_id="CAK43601.1"
FT                   /translation="MTSSVLPKNKRTIHTAACLIIGDEVLGGKTIDTNSAFFAKFCFSL
FT                   GIQLKRIEVIADDESEIIEAVRRMSDRYDFVVTSGGIGPTHDDITYESIAKAFGLNLKL
FT                   HQAAFERMKKLSKPHPMQPDFDWDTPSPSLTAKLRMVEIPHDESVPLEEQAVFVAEDMW
FT                   VPIAIVNGNVHILPGVPRLFERLLEHLKPNLLPRLVNPEGKGIYRYLFSTPLPESTVAP
FT                   YLTELATRVASKNIKVGSYPRWGNKRNTVTLVGTDKEFMDSLIAEVEQNVEGTKVTRED
FT                   ELDPPSDTEESK"
FT   mRNA            join(<97879..97965,98083..98249,98347..>98974)
FT                   /locus_tag="An01g02310"
FT   exon            97879..97965
FT                   /locus_tag="An01g02310"
FT                   /number=1
FT   intron          97966..98082
FT                   /locus_tag="An01g02310"
FT                   /number=1
FT   exon            98083..98249
FT                   /locus_tag="An01g02310"
FT                   /number=2
FT   intron          98250..98346
FT                   /locus_tag="An01g02310"
FT                   /number=2
FT   exon            98347..98974
FT                   /locus_tag="An01g02310"
FT                   /number=3
FT   CDS_pept        complement(join(100217..100452,100523..100798,
FT                   100865..100979,101131..101142))
FT                   /locus_tag="An01g02320"
FT                   /note="Function: Aras of A. nidulans is an essential gene
FT                   that regulates the ordered program of development."
FT                   /note="Title: strong similarity to GTP-binding protein
FT                   a-ras - Aspergillus nidulans"
FT                   /note="See PMID 8035812"
FT                   /note="See PMID 10835388"
FT                   /db_xref="GOA:A2Q7X9"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR020849"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7X9"
FT                   /inference="profile:COGS:COG0532"
FT                   /inference="profile:PFAM:PF00071"
FT                   /inference="similar to AA sequence:PIR:A53778"
FT                   /protein_id="CAK43602.1"
FT                   /translation="MASKFLREYKLVVVGGGGVGKSCLTIQLIQSHFVDEYDPTIEDSY
FT                   RKQCVIDEEVALLDVLDTAGQEEYSAMREQYMRTGEGFLLVYSITSRQSFEEIMTFQQQ
FT                   ILRVKDKDYFPIIVVGNKCDLEKERAVSEEEGEALARQFGCKFIETSAKSRINVENAFY
FT                   DLVREIRRFNKEMSSYPSGAGGGSRAPEGKMDVSEPGDDAGCCGKCIIM"
FT   mRNA            complement(join(<100217..100452,100523..100798,
FT                   100865..100979,101131..>101142))
FT                   /locus_tag="An01g02320"
FT   exon            complement(100217..100452)
FT                   /locus_tag="An01g02320"
FT                   /number=1
FT   intron          complement(100453..100522)
FT                   /locus_tag="An01g02320"
FT                   /number=1
FT   exon            complement(100523..100798)
FT                   /locus_tag="An01g02320"
FT                   /number=2
FT   intron          complement(100799..100864)
FT                   /locus_tag="An01g02320"
FT                   /number=2
FT   exon            complement(100865..100979)
FT                   /locus_tag="An01g02320"
FT                   /number=3
FT   intron          complement(100980..101130)
FT                   /locus_tag="An01g02320"
FT                   /number=3
FT   exon            complement(101131..101142)
FT                   /locus_tag="An01g02320"
FT                   /number=4
FT   CDS_pept        complement(join(105453..105771,105807..105889,
FT                   106061..106104,106523..106860,106926..107560,
FT                   107646..108031,108093..108630))
FT                   /locus_tag="An01g02330"
FT                   /note="Title: similarity to pyoverdine biosynthesis protein
FT                   PvcA - Pseudomonas aeruginosa"
FT                   /note="See PMID 8704959"
FT                   /note="See PMID 10383985"
FT                   /db_xref="GOA:A2Q7Y0"
FT                   /db_xref="InterPro:IPR007817"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Y0"
FT                   /inference="profile:COGS:COG3207"
FT                   /inference="profile:PFAM:PF05141"
FT                   /inference="similar to AA sequence:PIR:H83363"
FT                   /protein_id="CAK43603.1"
FT                   /translation="MEQGFGPDIIPLEIDMFPMESDNFLMEREFFHMKSDLVSMESGVV
FT                   PMESDIFPMESTIDPQVSERKYENDPLLKAFEIMEIIGRYRTMVPATASDRTSDGNIMF
FT                   LSKMWSQIRAKQPIRMILPAFPFKSPNQGNKTLGSLPDKGEEICLAHLNGLCAAISDVY
FT                   EYGAKLTIVSDGLVYNDILGVSDRDVWEYGHALREMVAENKYDHIEFARLRDLVHSHED
FT                   VKLDGETYERLAPVFRQELIEQHTPVGFDAAVMIKSDENICTTYRGYIKFLTKDLEHLY
FT                   VENGTTSRKAHKKYLGNVAKAMITRGAAFAEAIIKNYSGYIRLSIHPSNGLTKISINVL
FT                   PRSSKPVTPWHSAPCYTVDGRFIYGWREVFDANPELELVHKNGRPWCYRFISELYNWSS
FT                   PVAVDPIYPCGMMITPLNPTSISQVEMEKVQGLAHENSPVVLRGFTDTHDHELIAQKAE
FT                   SVDASYLSISDFNPEEKAEDGDSQDSKSTTLSGWLPYDGPTEIMEDQEAHHIKQCPVSS
FT                   PAKYQLISAPGPISENTRRSLFSASPLFFHHLPASYTVGILQQLSWNAETSSHDTETSS
FT                   LPLIIPHFSHGRPCFRYHSLLSQSNITCDPTLIAIEDISTADSTRLCNILNPLLYDRNI
FT                   PEKYQIQELVRHATTVGNETGKYRHNYATLIRGKAKELQIKWSDPEVTLLLRWSLQHPT
FT                   AFFWGTGIFSKKGSVRPTPLERDTKSSDVKRGEHNVQLITRLKILWSSSPLRFLQGDRQ
FT                   TDRQTARNQQRRPPAGPQALSTLSTPA"
FT   mRNA            complement(join(<105453..105771,105807..105889,
FT                   106061..106104,106523..106860,106926..107560,
FT                   107646..108031,108093..>108630))
FT                   /locus_tag="An01g02330"
FT   exon            complement(105453..105771)
FT                   /locus_tag="An01g02330"
FT                   /number=1
FT   intron          complement(105772..105806)
FT                   /locus_tag="An01g02330"
FT                   /number=1
FT   exon            complement(105807..105889)
FT                   /locus_tag="An01g02330"
FT                   /number=2
FT   intron          complement(105890..106060)
FT                   /locus_tag="An01g02330"
FT                   /number=2
FT   exon            complement(106061..106104)
FT                   /locus_tag="An01g02330"
FT                   /number=3
FT   intron          complement(106105..106522)
FT                   /locus_tag="An01g02330"
FT                   /number=3
FT   exon            complement(106523..106860)
FT                   /locus_tag="An01g02330"
FT                   /number=4
FT   intron          complement(106861..106925)
FT                   /locus_tag="An01g02330"
FT                   /number=4
FT   exon            complement(106926..107560)
FT                   /locus_tag="An01g02330"
FT                   /number=5
FT   intron          complement(107561..107645)
FT                   /locus_tag="An01g02330"
FT                   /number=5
FT   exon            complement(107646..108031)
FT                   /locus_tag="An01g02330"
FT                   /number=6
FT   intron          complement(108032..108092)
FT                   /locus_tag="An01g02330"
FT                   /number=6
FT   exon            complement(108093..108630)
FT                   /locus_tag="An01g02330"
FT                   /number=7
FT   CDS_pept        complement(join(109557..109722,109802..109857,
FT                   109913..110222,110279..110583))
FT                   /locus_tag="An01g02340"
FT                   /note="Similarity: shows strong similarity to several
FT                   dehydrogenases."
FT                   /note="Title: strong similarity to hypothetical short chain
FT                   dehydrogenase SPAC521.03 - Schizosaccharomyces pombe"
FT                   /db_xref="GOA:A2Q7Y1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Y1"
FT                   /inference="profile:COGS:COG1028"
FT                   /inference="profile:PFAM:PF00106"
FT                   /inference="similar to AA sequence:UniProtKB:SPAC521.3"
FT                   /protein_id="CAK43604.1"
FT                   /translation="MATAMAKRLEGKTILVTGASSGIGRSTAKEFARTSPKDLKIIVTA
FT                   RRIDSLQELAKEIKEEVGEGVKVLPVQLDVSNPEDIKKFVPSLPEEFKEIDVLVNNAGL
FT                   VKGVAKAPEIAPEDINVMFSTNVTGLINMTQAILPIFKKRADGGRGDIINIGSIAGREA
FT                   YPGGSIYCATKAAIRSFTDALRKELIATRIRIIEIDPGQVETEFSVVRFYGDKAKADAV
FT                   YAGCEPLTPDDIAEVVVFAAGRRENVVIADTLIFPSHQVSQTSHTGLNSIADGTVT"
FT   mRNA            complement(join(<109557..109722,109802..109857,
FT                   109913..110222,110279..>110583))
FT                   /locus_tag="An01g02340"
FT   exon            complement(109557..109722)
FT                   /locus_tag="An01g02340"
FT                   /number=1
FT   intron          complement(109723..109801)
FT                   /locus_tag="An01g02340"
FT                   /number=1
FT   exon            complement(109802..109857)
FT                   /locus_tag="An01g02340"
FT                   /number=2
FT   intron          complement(109858..109912)
FT                   /locus_tag="An01g02340"
FT                   /number=2
FT   exon            complement(109913..110222)
FT                   /locus_tag="An01g02340"
FT                   /number=3
FT   intron          complement(110223..110278)
FT                   /locus_tag="An01g02340"
FT                   /number=3
FT   exon            complement(110279..110583)
FT                   /locus_tag="An01g02340"
FT                   /number=4
FT   CDS_pept        complement(join(114543..114673,114928..115129,
FT                   115300..115602,115893..115931))
FT                   /locus_tag="An01g02350"
FT                   /note="Remark: the human NK cell antigen DX1 has the
FT                   patent-number WO9502611-A."
FT                   /note="Title: weak similarity to NK cell antigen DX1 - Homo
FT                   sapiens"
FT                   /db_xref="GOA:A2Q7Y2"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Y2"
FT                   /protein_id="CAK43605.1"
FT                   /translation="MDDEEASVVDIALAARLLGSPGWRVIVYVVDNFSSVLPGTVWLHD
FT                   PDSFQIAVMIYGTKLSVSTGVVGRRQSGCACRGDISQSRRRPVERDPEWHPTPCHWSLS
FT                   PMVDPWDATLLILCPLRNRKQSPRGAAKNQTRINSHMEKAGWLTQFGLDGVEECSSTGF
FT                   NLMRLGHDRAGVDSAASGGYDQGSEDMGACIAGQKMAFISPRLAEDPGWLLPNKVSYLD
FT                   KS"
FT   mRNA            complement(join(<114543..114673,114928..115129,
FT                   115300..115602,115893..>115931))
FT                   /locus_tag="An01g02350"
FT   exon            complement(114543..114673)
FT                   /locus_tag="An01g02350"
FT                   /number=1
FT   intron          complement(114674..114927)
FT                   /locus_tag="An01g02350"
FT                   /number=1
FT   exon            complement(114928..115129)
FT                   /locus_tag="An01g02350"
FT                   /number=2
FT   intron          complement(115130..115299)
FT                   /locus_tag="An01g02350"
FT                   /number=2
FT   exon            complement(115300..115602)
FT                   /locus_tag="An01g02350"
FT                   /number=3
FT   intron          complement(115603..115892)
FT                   /locus_tag="An01g02350"
FT                   /number=3
FT   exon            complement(115893..115931)
FT                   /locus_tag="An01g02350"
FT                   /number=4
FT   CDS_pept        join(115993..116187,116259..116295,116349..116416,
FT                   116458..116846,116977..117418)
FT                   /locus_tag="An01g02360"
FT                   /note="Function: M. grisea pth11p is a plasma membrane
FT                   protein that mediates appressorium differentiation in
FT                   response to inductive substrate cues."
FT                   /note="Remark: putative short form of M. grisea pth11p."
FT                   /note="Title: similarity to integral membrane protein PTH11
FT                   - Magnaporthe grisea"
FT                   /note="See PMID 10521529"
FT                   /db_xref="GOA:A2Q7Y3"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Y3"
FT                   /protein_id="CAK43606.1"
FT                   /translation="MLDEMMGGMLLPRTTDDGTARGQRALVVTAVLTGLSIVIVAMRMY
FT                   ARVGLMKLTGREDYMILISLVLSCTYLGLVAAEVHFGLGKHDADLSDVVVKEQLKSSVM
FT                   KRLWAAIPFYNASLIFTKFSILFQYLRIFPDRRFRLACWIVFGIVATYGTWAVVSGFLN
FT                   CVPVAKFWNRNISGYCLSFEAVWFFNASMNIATDTTLLILPMPLLSQLQLPRMQKFALM
FT                   GVFAIGGLPHSISFLLLEFRLTNEPDSNVGAAYWTAAECNVAIICACLPFLRPIVSRIF
FT                   PRFLSTNSYNRYTRNPTMTASRMTATRMTARSHRQKVELYSQDRDYGMYTIDVKSGEAS
FT                   HDSALDGIAVTTTTMIQETSRNNDESTSQRRLVVDV"
FT   mRNA            join(<115993..116187,116259..116295,116349..116416,
FT                   116458..116846,116977..>117418)
FT                   /locus_tag="An01g02360"
FT   exon            115993..116187
FT                   /locus_tag="An01g02360"
FT                   /number=1
FT   intron          116188..116258
FT                   /locus_tag="An01g02360"
FT                   /number=1
FT   exon            116259..116295
FT                   /locus_tag="An01g02360"
FT                   /number=2
FT   intron          116296..116348
FT                   /locus_tag="An01g02360"
FT                   /number=2
FT   exon            116349..116416
FT                   /locus_tag="An01g02360"
FT                   /number=3
FT   intron          116417..116457
FT                   /locus_tag="An01g02360"
FT                   /number=3
FT   exon            116458..116846
FT                   /locus_tag="An01g02360"
FT                   /number=4
FT   intron          116847..116976
FT                   /locus_tag="An01g02360"
FT                   /number=4
FT   exon            116977..117418
FT                   /locus_tag="An01g02360"
FT                   /number=5
FT   CDS_pept        complement(join(119509..120344,120409..120947,
FT                   121013..121347))
FT                   /locus_tag="An01g02370"
FT                   /note="Function: the Aspergillus nidulans SREA is involved
FT                   in regulation of siderophore biosynthesis and control of
FT                   iron uptake."
FT                   /note="Title: strong similarity to siderophore biosynthesis
FT                   repressor sREA - Aspergillus nidulans"
FT                   /note="See PMID 9988696"
FT                   /db_xref="GOA:A2Q7Y4"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="InterPro:IPR039355"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Y4"
FT                   /inference="profile:COGS:COG5641"
FT                   /inference="profile:PFAM:PF00320"
FT                   /inference="similar to AA sequence:UniProtKB:AF095898.1"
FT                   /protein_id="CAK43607.1"
FT                   /translation="MLASIPQMETVRSLPRNPDMVARHPSAEDLDAAQQLISSAQAGRE
FT                   HLVDRARDDDAARGYDAYDAYDGKHTPTPYDSERPTLPSTESASNTLAERTSPKSQKDT
FT                   SFLGHSCSNCGTKSTPLWRRSPTGAMICNACGLYLKARNVARPTKRNRIQTSTEPVQPQ
FT                   PSQQQPPSIAPQHEAHTHSEGGCHGSKGSCPGGGNCNGTGGAEGCDGCPAYNNRVYKSS
FT                   ARGTVPVHAWGRPANPDSEKPLPAQEPDVPGKSGASAEGNILVSCQNCGTTVTPLWRRD
FT                   ENGHPICNACGLYYKLHGCYRPTTMKKTIIKRRKRVVPALREHSPTAATQSSNGSSASP
FT                   EASPATLARVHDDHYRYYSSEPVDHYGPMSGDRISPAAPKQFGFAPPPVDFTGFSSGPV
FT                   SLPHHPPPPRLLEPDRINAPSHSPVSQFGRRSLSPNPSGNPKKRTLAETASSAEAMSIP
FT                   TTLENGSNQLPPIMSSVNPSPPARLSSISSLLNPNSHDESRLDPSLAALSRQHHQSHQA
FT                   PPLAPPPSQLLPGVSEFDNIREERRLKLQREAEEMREMLRAKERELAELGQQ"
FT   mRNA            complement(join(<119509..120344,120409..120947,
FT                   121013..>121347))
FT                   /locus_tag="An01g02370"
FT   exon            complement(119509..120344)
FT                   /locus_tag="An01g02370"
FT                   /number=1
FT   intron          complement(120345..120408)
FT                   /locus_tag="An01g02370"
FT                   /number=1
FT   exon            complement(120409..120947)
FT                   /locus_tag="An01g02370"
FT                   /number=2
FT   intron          complement(120948..121012)
FT                   /locus_tag="An01g02370"
FT                   /number=2
FT   exon            complement(121013..121347)
FT                   /locus_tag="An01g02370"
FT                   /number=3
FT   CDS_pept        join(122029..122144,122237..122394,122688..122754,
FT                   122875..123034)
FT                   /locus_tag="An01g02380"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q7Y5"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Y5"
FT                   /protein_id="CAK43608.1"
FT                   /translation="MEEARERKRERTVWRDGMDRSIVVGGRGGQRRQDKKDRRERKGRD
FT                   LGGAERLVEEVVNEQEGERAEEEIDNRGRKWVSMEMDGGGDDDDDEGSPSVIDLPGGST
FT                   TGGYSFSFFSVDRIFARESSVAQFPHPFFPLCWPIPIPFAYGLPRSNLPGSTASYYGLV
FT                   NWV"
FT   mRNA            join(<122029..122144,122237..122394,122688..122754,
FT                   122875..>123034)
FT                   /locus_tag="An01g02380"
FT   exon            122029..122144
FT                   /locus_tag="An01g02380"
FT                   /number=1
FT   intron          122145..122236
FT                   /locus_tag="An01g02380"
FT                   /number=1
FT   exon            122237..122394
FT                   /locus_tag="An01g02380"
FT                   /number=2
FT   intron          122395..122687
FT                   /locus_tag="An01g02380"
FT                   /number=2
FT   exon            122688..122754
FT                   /locus_tag="An01g02380"
FT                   /number=3
FT   intron          122755..122874
FT                   /locus_tag="An01g02380"
FT                   /number=3
FT   exon            122875..123034
FT                   /locus_tag="An01g02380"
FT                   /number=4
FT   CDS_pept        complement(join(123095..123205,123295..123364,
FT                   123460..123674,124065..124080,124173..124259,
FT                   124317..124363,124496..124585))
FT                   /locus_tag="An01g02390"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q7Y6"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Y6"
FT                   /protein_id="CAK43609.1"
FT                   /translation="MAFISGHIRVHLLTYSGKLDDEFPISLVDYYPERAELPRVGTPES
FT                   VANVSKPKSTQVADFSVIGKELYRYRKVSRGGGGQKSGNKEKKKEACQSVKKSDAAAPC
FT                   ALCSQCRKVMESLEDDGLHTPEQIGNPEEENKKRAQAKRYFVVVRLGGSLTGFHNIPNR
FT                   DQWDFGLILCSLRSMEARDIVIESPKQPMWLPRIPLTEAPGFGAPMIG"
FT   mRNA            complement(join(<123095..123205,123295..123364,
FT                   123460..123674,124065..124080,124173..124259,
FT                   124317..124363,124496..>124585))
FT                   /locus_tag="An01g02390"
FT   exon            complement(123095..123205)
FT                   /locus_tag="An01g02390"
FT                   /number=1
FT   intron          complement(123206..123294)
FT                   /locus_tag="An01g02390"
FT                   /number=1
FT   exon            complement(123295..123364)
FT                   /locus_tag="An01g02390"
FT                   /number=2
FT   intron          complement(123365..123459)
FT                   /locus_tag="An01g02390"
FT                   /number=2
FT   exon            complement(123460..123674)
FT                   /locus_tag="An01g02390"
FT                   /number=3
FT   intron          complement(123675..124064)
FT                   /locus_tag="An01g02390"
FT                   /number=3
FT   exon            complement(124065..124080)
FT                   /locus_tag="An01g02390"
FT                   /number=4
FT   intron          complement(124081..124172)
FT                   /locus_tag="An01g02390"
FT                   /number=4
FT   exon            complement(124173..124259)
FT                   /locus_tag="An01g02390"
FT                   /number=5
FT   intron          complement(124260..124316)
FT                   /locus_tag="An01g02390"
FT                   /number=5
FT   exon            complement(124317..124363)
FT                   /locus_tag="An01g02390"
FT                   /number=6
FT   intron          complement(124364..124495)
FT                   /locus_tag="An01g02390"
FT                   /number=6
FT   exon            complement(124496..124585)
FT                   /locus_tag="An01g02390"
FT                   /number=7
FT   CDS_pept        join(124952..125025,125283..125409,125518..125618,
FT                   125729..125882)
FT                   /locus_tag="An01g02400"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q7Y7"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Y7"
FT                   /protein_id="CAK43610.1"
FT                   /translation="MERSDRLAICEVLLSSVWSRLVGVGRPIGNIFEIAYLRAGVSPSP
FT                   NPGTGRACRTARACGVNVPMEQFACCLSGKPDQITLPTHASMGLSVVIVVGEDESMGFI
FT                   WCDVRLSTHILTSCHHATRPYYLDLRLPTSDLGLRFIIYHLLLIIQN"
FT   mRNA            join(<124952..125025,125283..125409,125518..125618,
FT                   125729..>125882)
FT                   /locus_tag="An01g02400"
FT   exon            124952..125025
FT                   /locus_tag="An01g02400"
FT                   /number=1
FT   sig_peptide     124952..125008
FT                   /locus_tag="An01g02400"
FT                   /inference="protein motif:SignalP:2.0"
FT   mat_peptide     join(125009..125025,125283..125409,125518..125618,
FT                   125729..125879)
FT                   /locus_tag="An01g02400"
FT                   /product="hypothetical protein"
FT   intron          125026..125282
FT                   /locus_tag="An01g02400"
FT                   /number=1
FT   exon            125283..125409
FT                   /locus_tag="An01g02400"
FT                   /number=2
FT   intron          125410..125517
FT                   /locus_tag="An01g02400"
FT                   /number=2
FT   exon            125518..125618
FT                   /locus_tag="An01g02400"
FT                   /number=3
FT   intron          125619..125728
FT                   /locus_tag="An01g02400"
FT                   /number=3
FT   exon            125729..125882
FT                   /locus_tag="An01g02400"
FT                   /number=4
FT   CDS_pept        complement(join(126313..126485,126546..126635,
FT                   126698..126813,126882..127019,127187..127375))
FT                   /exception="reasons given in citation"
FT                   /locus_tag="An01g02410"
FT                   /note="Title: similarity to hypothetical protein
FT                   SPAC6F12.04 - Schizosaccharomyces pombe [putative
FT                   frameshift]"
FT                   /note="putative frameshift"
FT                   /db_xref="GOA:A2Q7Y8"
FT                   /db_xref="InterPro:IPR013714"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Y8"
FT                   /inference="similar to AA sequence:PIR:T11655"
FT                   /protein_id="CAK43611.1"
FT                   /translation="MGLSSRVFAGAPETRPAESSTQRLGRPAACDSATTMLEPLHLLGF
FT                   PSALFLPTRICQRSLASKKLSPLYPFRYSVFVVEHPTYIPTTGYISRKSSLGLNTCQMD
FT                   LSNIFRIVNIAVGVLMVLGGISQFFPASMSSIIVGIYVILFGLIVGGLEFLPNVPDYVY
FT                   RYASFLFSFLGRGAFYIFVGCILLHDWVLRYIAGSIIGFIGLGYLALEFIPSIEPPSNM
FT                   RENDQGWGAEQV"
FT   mRNA            complement(join(<126313..126485,126546..126635,
FT                   126698..126813,126882..127019,127187..>127375))
FT                   /locus_tag="An01g02410"
FT   exon            complement(126313..126485)
FT                   /locus_tag="An01g02410"
FT                   /number=1
FT   intron          complement(126486..126545)
FT                   /locus_tag="An01g02410"
FT                   /number=1
FT   exon            complement(126546..126635)
FT                   /locus_tag="An01g02410"
FT                   /number=2
FT   intron          complement(126636..126697)
FT                   /locus_tag="An01g02410"
FT                   /number=2
FT   exon            complement(126698..126813)
FT                   /locus_tag="An01g02410"
FT                   /number=3
FT   intron          complement(126814..126881)
FT                   /locus_tag="An01g02410"
FT                   /number=3
FT   exon            complement(126882..127019)
FT                   /locus_tag="An01g02410"
FT                   /number=4
FT   intron          complement(127020..127186)
FT                   /locus_tag="An01g02410"
FT                   /number=4
FT   exon            complement(127187..127375)
FT                   /locus_tag="An01g02410"
FT                   /number=5
FT   CDS_pept        complement(join(127681..127994,128062..128776))
FT                   /locus_tag="An01g02420"
FT                   /note="Title: similarity to hypothetical protein SC6F7.17c
FT                   - Streptomyces coelicolor"
FT                   /db_xref="GOA:A2Q7Y9"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Y9"
FT                   /inference="profile:COGS:COG5271"
FT                   /inference="similar to AA sequence:UniProtKB:SCO939129.252"
FT                   /protein_id="CAK43612.1"
FT                   /translation="MKYKSPQVESETDAADAPKRKLDQRDPDISTGEGSLEVEKEQPPT
FT                   KASKSAANTVEEDDEVQEDSGYKDEEFEEEGEEDNEEFDEEEEYDEADDENVDFVKEQG
FT                   GEEEEDQDAEGEEDDEGEAKERVSSKPKLQKVVKEFGRPPLYGTEIAEGRLESSPDTLL
FT                   AMVMDAMLKSRPISHDLTQRAVNKLIEVGYHDIRKLGESSWEERTMVLKDGGYNRYREQ
FT                   GATNLGDLAEFVNEKYDGDLNNLLKKAHNDRDETRKLIKEIKGLGDLGVDLFFNNAQAV
FT                   WPSIAPFIDGRSLETADNVGLGTDLDAIYADLGRDSMSMSRLANGLSAVRLEKRQGDLM
FT                   AI"
FT   mRNA            complement(join(<127681..127994,128062..>128776))
FT                   /locus_tag="An01g02420"
FT   exon            complement(127681..127994)
FT                   /locus_tag="An01g02420"
FT                   /number=1
FT   intron          complement(127995..128061)
FT                   /locus_tag="An01g02420"
FT                   /number=1
FT   exon            complement(128062..128776)
FT                   /locus_tag="An01g02420"
FT                   /number=2
FT   CDS_pept        complement(join(129098..129817,129871..129974,
FT                   130025..130110,130197..130349,130413..130441))
FT                   /locus_tag="An01g02430"
FT                   /EC_number="1.4.3.3"
FT                   /note="Catalytic activity: the F. solani D-amino acid
FT                   oxidase converts D-amino acid and H2O and O2 to 2-oxo acid
FT                   and NH3 and H2O2."
FT                   /note="Catalytic activity: the F. solani D-amino acid
FT                   oxidase is able to oxidatively deaminate cephalosporin C to
FT                   7-beta-(5-carboxy-5-oxopentanamido)cephalosporanic acid."
FT                   /note="Remark: the D-amino acid oxidase posseses a wide
FT                   specificity for D-amino acids and also acts on glycine."
FT                   /note="Title: strong similarity to D-amino-acid oxidase DAO
FT                   - Fusarium solani"
FT                   /note="peroxisome"
FT                   /note="See PMID 1982443"
FT                   /db_xref="GOA:A2Q7Z0"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006181"
FT                   /db_xref="InterPro:IPR023209"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Z0"
FT                   /inference="profile:COGS:COG0665"
FT                   /inference="profile:PFAM:PF01266"
FT                   /inference="similar to AA sequence:PIR:JX0152"
FT                   /protein_id="CAK43613.1"
FT                   /translation="MANNRIVMLGAGVSGLTTAYLLSQDASNSITVLAKHMPGDYDIEY
FT                   TSPWAGANYLPYVLQGDHERWERNTWPALRELTKNHPEAGIHFQETIVYNRTKDQGSAT
FT                   GEWFSELVQKDPWYMEVVPDFQDIPADQLAPGIDNASKFTSVCINTAVYLPWLVGQCRK
FT                   NGVVFKRAVLKHVADAANGHHTGQKADVVVNCTGLSSKKLGGVLDDKLYPARGQIVVVR
FT                   NDPGKMVSISGTDDGEDEVVYMMTRAAGGGTVIGGSYQKNQWDPLPDPNLAVRIMKRAI
FT                   ALCPELVEKGQGIEGLDIIRHGVGLRPLREGGPRIEAEKVDGVSVVHNYGHGGFGYQAS
FT                   FGCAEDAVKLVQETLRRKDKAKL"
FT   mRNA            complement(join(<129098..129817,129871..129974,
FT                   130025..130110,130197..130349,130413..>130441))
FT                   /locus_tag="An01g02430"
FT   exon            complement(129098..129817)
FT                   /locus_tag="An01g02430"
FT                   /number=1
FT   mat_peptide     complement(join(129101..129817,129871..129974,
FT                   130025..130110,130197..130321))
FT                   /locus_tag="An01g02430"
FT   intron          complement(129818..129870)
FT                   /locus_tag="An01g02430"
FT                   /number=1
FT   exon            complement(129871..129974)
FT                   /locus_tag="An01g02430"
FT                   /number=2
FT   intron          complement(129975..130024)
FT                   /locus_tag="An01g02430"
FT                   /number=2
FT   exon            complement(130025..130110)
FT                   /locus_tag="An01g02430"
FT                   /number=3
FT   intron          complement(130111..130196)
FT                   /locus_tag="An01g02430"
FT                   /number=3
FT   exon            complement(130197..130349)
FT                   /locus_tag="An01g02430"
FT                   /number=4
FT   sig_peptide     complement(join(130322..130349,130413..130441))
FT                   /locus_tag="An01g02430"
FT                   /inference="protein motif:SignalP:2.0"
FT   intron          complement(130350..130412)
FT                   /locus_tag="An01g02430"
FT                   /number=4
FT   exon            complement(130413..130441)
FT                   /locus_tag="An01g02430"
FT                   /number=5
FT   CDS_pept        join(131488..131713,131810..132237,132289..133047)
FT                   /locus_tag="An01g02440"
FT                   /note="Title: similarity to hypothetical protein K21H1.13
FT                   -Arabidopsis thaliana"
FT                   /db_xref="GOA:A2Q7Z1"
FT                   /db_xref="InterPro:IPR003323"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Z1"
FT                   /inference="profile:PFAM:PF02338"
FT                   /protein_id="CAK43614.1"
FT                   /translation="MADAPNGGRIVPIVTTARQHYSSSPTDESMAKTTPQTSQKTKMPR
FT                   NARNKTAEAETLEIPCLNALGLYALPTEGDGNCLYYALSDQTYGDFTHADEIRDRLADH
FT                   ISANKDYFMSFIAAAGGERRAPRRAAAAAARQSYCSSSSASPAPPSAKDKERSFDSKVA
FT                   ESRKKGVWGGAEEIQAFCQAFKKDVCVYTMYGIQNFRDVHAPEGEERDIIHIAFHDFHH
FT                   YSSVRHSDGPHTGLPCIPKVGKEREAEASAAEPTVVDMATPWKISAIQEGLGGKYDQGA
FT                   IVEMLQQCRGNIDRAFMNLLGEDSNTSLADAPSSKAIMKSRLQASSRSSSPFSVGSKRS
FT                   ADESDADDSPQPAVRRTRTRESKRRILPDVMVGIEFRDDQNDLVSLRLRVSPDTVVPKP
FT                   AVQPSTEQAEASSLESATDSPSLLPQDRKLRIRSKTVSSETSSIPNESSDERKPPRRSQ
FT                   RISRTRPAPRSA"
FT   mRNA            join(<131488..131713,131810..132237,132289..>133047)
FT                   /locus_tag="An01g02440"
FT   exon            131488..131713
FT                   /locus_tag="An01g02440"
FT                   /number=1
FT   intron          131714..131809
FT                   /locus_tag="An01g02440"
FT                   /number=1
FT   exon            131810..132237
FT                   /locus_tag="An01g02440"
FT                   /number=2
FT   intron          132238..132288
FT                   /locus_tag="An01g02440"
FT                   /number=2
FT   exon            132289..133047
FT                   /locus_tag="An01g02440"
FT                   /number=3
FT   tRNA            134462..134552
FT                   /gene="tRNA-Asp (GTC)"
FT                   /locus_tag="An01e02450"
FT                   /product="transfer RNA-Asp (GTC)"
FT                   /inference="profile:tRNAscan:1.4"
FT   CDS_pept        complement(join(135328..136782,136847..137032,
FT                   137085..137621))
FT                   /locus_tag="An01g02460"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   EAA66045.1 - Aspergillus nidulans"
FT                   /db_xref="GOA:A2Q7Z2"
FT                   /db_xref="InterPro:IPR005330"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Z2"
FT                   /inference="profile:COGS:COG3300"
FT                   /inference="similar to AA sequence:UniProtKB:AE008856.10"
FT                   /protein_id="CAK43615.1"
FT                   /translation="MGGVGIWCMHYIGNRAIVLGNGEAQFQIIYSMTFTGVSFVLPVVV
FT                   LLVAFYSIGASEKAGYIRILTGGVLTGGAVCGMHYIGQLGISNYRCSYRVANIVGATII
FT                   AVFASTVALTVFFRWRATWTDSWWRRGICGCVLALAVSGMHWTAAVGTYYYNHDTTMKH
FT                   NGQLSRSQVVIISSVLACAACGVLTACAVVAGGNRRRLNIQARQLVLTCAFFDQSGRIM
FT                   VTPHALLPSRKIVDRYVGRTFNDDDLTRSHPAFLWAFRASRHWNLVKDVVPFMRSRIET
FT                   DKEATEHFLAKGEALDQENELQNDFDELFKRHFCVTAQDLADEVRQPLPALGKLYDDVL
FT                   VTTAPTSRFSRAMGYSRLNNSKGQMLFTVRHLDKQEANRLAAAGFRFTAVENVTSVLSS
FT                   RMHIPLPVLGEHLKDMRDYATGGRNYEPGVHLVSFVMRPTISDHFEVLTAKGTGNPLPS
FT                   STLPIKRINIQHLDLISHMEGWTISTCLSWLKSEAAQSNKEIDDFREQLIHAMTSLESA
FT                   LPPDINMASKFSARPLIAPCRMFSDSDASNSILLPFCAVGNLDTQVSNPDFTFMPLRLF
FT                   RAQQQLNDANIGSDGFAKELGRELYYSNARSSSATEADITPSIRSVLKLWPRKHADSPH
FT                   GDLSQETLTELSQLGDIMVRKEVKVDVAKLSTRSLDSAKHASHATVVAGDLATSSYVDE
FT                   LYNLCYSPGVRLRPDTAITRSSVTRSSMATG"
FT   mRNA            complement(join(<135328..136782,136847..137032,
FT                   137085..>137621))
FT                   /locus_tag="An01g02460"
FT   exon            complement(135328..136782)
FT                   /locus_tag="An01g02460"
FT                   /number=1
FT   intron          complement(136783..136846)
FT                   /locus_tag="An01g02460"
FT                   /number=1
FT   exon            complement(136847..137032)
FT                   /locus_tag="An01g02460"
FT                   /number=2
FT   intron          complement(137033..137084)
FT                   /locus_tag="An01g02460"
FT                   /number=2
FT   exon            complement(137085..137621)
FT                   /locus_tag="An01g02460"
FT                   /number=3
FT   CDS_pept        join(138077..138142,138217..138347,138413..138463,
FT                   138544..138732,138820..138939,139047..139166,
FT                   139268..139442)
FT                   /locus_tag="An01g02470"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q7Z3"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Z3"
FT                   /protein_id="CAK43616.1"
FT                   /translation="MAFSFQELHAAGPYYVLAMVLQWEPLIACGGHRDPSNFYVGCTRP
FT                   INMRGPQNEGLALFQRSHWAITIDRGCNQEPWGIEFTGKLKFFPSAKVGYYLSTRWVYV
FT                   YGSRRIRTAKANPVGRGPRRFSCAVWLNLRSSPKINQFCTIGLPLMARSPSAHRSQLHR
FT                   LNHPLATNTSRVLNLGSNYPEGPADSPIASTHAVDKDPEWSVDAVAGLARGTSIGNHAI
FT                   HRHGLAPLDELNVAEWEVREGERSRRSSEMHSRWTITRALGHFGVRQQPRDSDRGFLFS
FT                   IG"
FT   mRNA            join(<138077..138142,138217..138347,138413..138463,
FT                   138544..138732,138820..138939,139047..139166,
FT                   139268..>139442)
FT                   /locus_tag="An01g02470"
FT   exon            138077..138142
FT                   /locus_tag="An01g02470"
FT                   /number=1
FT   intron          138143..138216
FT                   /locus_tag="An01g02470"
FT                   /number=1
FT   exon            138217..138347
FT                   /locus_tag="An01g02470"
FT                   /number=2
FT   intron          138348..138412
FT                   /locus_tag="An01g02470"
FT                   /number=2
FT   exon            138413..138463
FT                   /locus_tag="An01g02470"
FT                   /number=3
FT   intron          138464..138543
FT                   /locus_tag="An01g02470"
FT                   /number=3
FT   exon            138544..138732
FT                   /locus_tag="An01g02470"
FT                   /number=4
FT   intron          138733..138819
FT                   /locus_tag="An01g02470"
FT                   /number=4
FT   exon            138820..138939
FT                   /locus_tag="An01g02470"
FT                   /number=5
FT   intron          138940..139046
FT                   /locus_tag="An01g02470"
FT                   /number=5
FT   exon            139047..139166
FT                   /locus_tag="An01g02470"
FT                   /number=6
FT   intron          139167..139267
FT                   /locus_tag="An01g02470"
FT                   /number=6
FT   exon            139268..139442
FT                   /locus_tag="An01g02470"
FT                   /number=7
FT   CDS_pept        complement(join(139831..139926,140180..140479,
FT                   140539..140616))
FT                   /locus_tag="An01g02480"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q7Z4"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Z4"
FT                   /protein_id="CAK43617.1"
FT                   /translation="MDLPSPIAARLDRIGVRPRYPGISWIAWSGAVSAYQLLLFLGAVE
FT                   GWRIFLDTSIVIYICDGGMKDPISWAAAPVLSAQLGKGDKFINLAAAACRLMLVLLCVD
FT                   VLTAGQRCFYGMVMELETFPSMGLTGRIWRIINWLSRSRATTTAAAADGTRRS"
FT   mRNA            complement(join(<139831..139926,140180..140479,
FT                   140539..>140616))
FT                   /locus_tag="An01g02480"
FT   exon            complement(139831..139926)
FT                   /locus_tag="An01g02480"
FT                   /number=1
FT   intron          complement(139927..140179)
FT                   /locus_tag="An01g02480"
FT                   /number=1
FT   exon            complement(140180..140479)
FT                   /locus_tag="An01g02480"
FT                   /number=2
FT   intron          complement(140480..140538)
FT                   /locus_tag="An01g02480"
FT                   /number=2
FT   exon            complement(140539..140616)
FT                   /locus_tag="An01g02480"
FT                   /number=3
FT   CDS_pept        complement(join(141714..141733,141824..141933,
FT                   141989..142064,142145..142448))
FT                   /locus_tag="An01g02490"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q7Z5"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Z5"
FT                   /protein_id="CAK43618.1"
FT                   /translation="MVSSVQLTSCDLLRTFRFCANNLIFHTLTFWGGGGGGIQTNHTTS
FT                   YVFLTSVTGMNRGSNTPSSYAAAITLPGQLLTNLRDPLVEKIVVKVFHVAVPGCSYKWE
FT                   YLGRWLQIDPDDCTNTGQAEYGCYGPKYEQYINRPEIENRLSLSYISDALFSGIHLSID
FT                   QHELMG"
FT   mRNA            complement(join(<141714..141733,141824..141933,
FT                   141989..142064,142145..>142448))
FT                   /locus_tag="An01g02490"
FT   exon            complement(141714..141733)
FT                   /locus_tag="An01g02490"
FT                   /number=1
FT   intron          complement(141734..141823)
FT                   /locus_tag="An01g02490"
FT                   /number=1
FT   exon            complement(141824..141933)
FT                   /locus_tag="An01g02490"
FT                   /number=2
FT   intron          complement(141934..141988)
FT                   /locus_tag="An01g02490"
FT                   /number=2
FT   exon            complement(141989..142064)
FT                   /locus_tag="An01g02490"
FT                   /number=3
FT   intron          complement(142065..142144)
FT                   /locus_tag="An01g02490"
FT                   /number=3
FT   exon            complement(142145..142448)
FT                   /locus_tag="An01g02490"
FT                   /number=4
FT   CDS_pept        complement(join(143708..144005,144137..144165))
FT                   /locus_tag="An01g02500"
FT                   /note="Function: thioredoxin is involved in oxidative
FT                   stress response and redox regulation."
FT                   /note="Localization: the S. cerevisiae TRX1 and TRX2 are
FT                   located in the cytoplasm, while TRX3 is located in the
FT                   mitochondrion."
FT                   /note="Remark: the A. nidulans thioredoxin is an
FT                   intercellular disulphide-reducing enzyme which exhibits an
FT                   unusual fluorescence emission spectrum, characterized by a
FT                   high contribution of tyrosine residues."
FT                   /note="Remark: the amino acid sequence of A. nidulans
FT                   thioredoxin was determined by automated Edman degradation."
FT                   /note="Similarity: the A. nidulans thioredoxin displays a
FT                   sequence similarity of 45% to at least one of three
FT                   thioredoxin homologues in S. cerevisiae TRX1, TRX2 and
FT                   TRX3."
FT                   /note="Title: strong similarity to thioredoxin -Aspergillus
FT                   nidulans"
FT                   /note="See PMID 1459127"
FT                   /db_xref="GOA:A2Q7Z6"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Z6"
FT                   /inference="profile:COGS:COG0526"
FT                   /inference="profile:PFAM:PF00085"
FT                   /inference="similar to AA sequence:PIR:S27053"
FT                   /protein_id="CAK43619.1"
FT                   /translation="MSHKVHDITSKAEFAEKVTNSTDAIVLDCFATWCGPCKAISPKVE
FT                   EFSNTYPNAKFYKIDVDELSEVAAELGIRAMPTFLLFKDGKKFDDLTGANPKGLEQKIQ
FT                   ALLA"
FT   mRNA            complement(join(<143708..144005,144137..>144165))
FT                   /locus_tag="An01g02500"
FT   exon            complement(143708..144005)
FT                   /locus_tag="An01g02500"
FT                   /number=1
FT   intron          complement(144006..144136)
FT                   /locus_tag="An01g02500"
FT                   /number=1
FT   exon            complement(144137..144165)
FT                   /locus_tag="An01g02500"
FT                   /number=2
FT   exon            complement(145579..147975)
FT                   /locus_tag="An01g02510"
FT                   /number=1
FT   CDS_pept        complement(145579..147975)
FT                   /locus_tag="An01g02510"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q7Z7"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Z7"
FT                   /protein_id="CAK43620.1"
FT                   /translation="MAIWPFGRKNKRHTIQLDAPAVADVQSSQEPRHSFDDGKLGRLSR
FT                   KHSKRQKNRHAQPVEVVPSFLHDASHPTSSPVVQYPPPTSHSEQPTPMKENRVPVSRAG
FT                   QHSDAYTTYSTMSHEQPSLSRSASLLKSKRNENGPAVLKKKLSKRKAYEIAREREIRML
FT                   ASAPIDIPRRPSPLPGEQFSIETRRANGAQSRRSDRHCSDTSLSMRDSAASSLSDIFES
FT                   YTFKVNTFAAWTPRPVIRYVEAPRVSTAKSQRPSEPSIRKDKTPAYATHNEHSRSKKRV
FT                   DKLADDLDAGALRELLERDRRRRERKQLEDQARLHRKLQRAAEQQRQAEAEAEADAVPQ
FT                   EPSSEAEDTSLAPRGRPGAESRAVSDRSKEYAPRTNETNAFLGGNSSGSWLRGASKDTD
FT                   RRGRESVDSVHVIGNIDDSSIREPKLVMRRSFAPSQDMGMSGSSLSHSPSRRELYSPTS
FT                   SQLYGIGRESTSDISRTIDSDRRLSDHGSGRVNTLTSIFRRGSSRLKRSYRERFHERSP
FT                   EHSNPSHESFFKVQTQSSGPPPSFVTAPRTFLGSGTIKRSQSKFTEHFGDEPLSPPDSR
FT                   LQSPDIPEVLDEFEREDEMSDINMGTQYPIPSSGSEPQDIPRNPHHSWTGDSWEGDPDN
FT                   LPLSQSLASIDSEGSWMSGQFLRRISQKKASNPLRTSLSSSRNIMEEGHEGSSNGDDVP
FT                   VSEPLVRFGTNQDEGLKSGPDVAGASPDKDSPMDSVPEQAEETWHDQIARRPVLVTPAI
FT                   RPKSNEGLLKNVQSFCAEEEFSPIEEHSAEFELETSDNHGNGRSN"
FT   mRNA            complement(<145579..>147975)
FT                   /locus_tag="An01g02510"
FT   CDS_pept        complement(join(148868..148887,148969..148973,
FT                   149004..149214,149296..149308))
FT                   /locus_tag="An01g02520"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q7Z8"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Z8"
FT                   /protein_id="CAK43621.1"
FT                   /translation="MYGVKNITEKIKRPGGGFGLVPSGSAVTAGPGEGRRCVTTNQPTR
FT                   SPGSETGGFVCVSALSVPRSRLLTVLSTSDNRKTAAR"
FT   mRNA            complement(join(<148868..148887,148969..148973,
FT                   149004..149214,149296..>149308))
FT                   /locus_tag="An01g02520"
FT   exon            complement(148868..148887)
FT                   /locus_tag="An01g02520"
FT                   /number=1
FT   intron          complement(148888..148968)
FT                   /locus_tag="An01g02520"
FT                   /number=1
FT   exon            complement(148969..148973)
FT                   /locus_tag="An01g02520"
FT                   /number=2
FT   intron          complement(148974..149003)
FT                   /locus_tag="An01g02520"
FT                   /number=2
FT   exon            complement(149004..149214)
FT                   /locus_tag="An01g02520"
FT                   /number=3
FT   intron          complement(149215..149295)
FT                   /locus_tag="An01g02520"
FT                   /number=3
FT   exon            complement(149296..149308)
FT                   /locus_tag="An01g02520"
FT                   /number=4
FT   CDS_pept        complement(join(150903..150995,151018..151070,
FT                   151170..151236))
FT                   /locus_tag="An01g02530"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q7Z9"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Z9"
FT                   /protein_id="CAK43622.1"
FT                   /translation="MAVKIVNLLACGQRKLDGLGAGSDGGAQNGEKLANSRPMEVSKTL
FT                   LSTRLTPYDQPAVIPIGYRWSCTDP"
FT   mRNA            complement(join(<150903..150995,151018..151070,
FT                   151170..>151236))
FT                   /locus_tag="An01g02530"
FT   exon            complement(150903..150995)
FT                   /locus_tag="An01g02530"
FT                   /number=1
FT   intron          complement(150996..151017)
FT                   /locus_tag="An01g02530"
FT                   /number=1
FT   exon            complement(151018..151070)
FT                   /locus_tag="An01g02530"
FT                   /number=2
FT   intron          complement(151071..151169)
FT                   /locus_tag="An01g02530"
FT                   /number=2
FT   exon            complement(151170..151236)
FT                   /locus_tag="An01g02530"
FT                   /number=3
FT   CDS_pept        join(151463..151548,152190..152418)
FT                   /locus_tag="An01g02540"
FT                   /note="Remark: ORF classified questionable due to
FT                   implausible gene structure with short, multiple Exons and
FT                   no significant blastp similarity."
FT                   /note="Title: questionable ORF"
FT                   /db_xref="GOA:A2Q800"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q800"
FT                   /protein_id="CAK43623.1"
FT                   /translation="MGKSAGLDRIELRQWLTLVSCDERLDCPGSETFRLTNIRWKEIGR
FT                   AQVAASFSCLACTEARAGGRRPLLMGFYSETSAWLNSVQHSARQGKVANTPGTMVLEQL
FT                   "
FT   mRNA            join(<151463..151548,152190..>152418)
FT                   /locus_tag="An01g02540"
FT   exon            151463..151548
FT                   /locus_tag="An01g02540"
FT                   /number=1
FT   intron          151549..152189
FT                   /locus_tag="An01g02540"
FT                   /number=1
FT   exon            152190..152418
FT                   /locus_tag="An01g02540"
FT                   /number=2
FT   CDS_pept        complement(join(153068..153143,153240..153292,
FT                   153486..153545))
FT                   /locus_tag="An01g02550"
FT                   /note="Remark: ORF classified questionable due to
FT                   implausible gene structure with short, multiple Exons and
FT                   no significant blastp similarity."
FT                   /note="Title: questionable ORF"
FT                   /db_xref="GOA:A2Q801"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q801"
FT                   /protein_id="CAK43624.1"
FT                   /translation="MVWAPRAGGLGIEMAGFFLGHDAVDKGLFAVITSSDVGIFPAVEG
FT                   YYTGVLSCILAVARAID"
FT   mRNA            complement(join(<153068..153143,153240..153292,
FT                   153486..>153545))
FT                   /locus_tag="An01g02550"
FT   exon            complement(153068..153143)
FT                   /locus_tag="An01g02550"
FT                   /number=1
FT   intron          complement(153144..153239)
FT                   /locus_tag="An01g02550"
FT                   /number=1
FT   exon            complement(153240..153292)
FT                   /locus_tag="An01g02550"
FT                   /number=2
FT   intron          complement(153293..153485)
FT                   /locus_tag="An01g02550"
FT                   /number=2
FT   exon            complement(153486..153545)
FT                   /locus_tag="An01g02550"
FT                   /number=3
FT   CDS_pept        join(153974..154159,155025..155255)
FT                   /locus_tag="An01g02560"
FT                   /note="Remark: ORF classified questionable due to
FT                   implausible gene structure with short, multiple Exons and
FT                   no significant blastp similarity."
FT                   /note="Title: questionable ORF"
FT                   /db_xref="GOA:A2Q802"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q802"
FT                   /protein_id="CAK43625.1"
FT                   /translation="MLHFVVRIFTILIYYELPTQATTRITCGINKRHPDGRLTGWTRAR
FT                   STSFHTKVKSTIRTTDKPVRLAFRNTISTTNMPTEKLLYGPGLIVAFLRSTSSSLFIIT
FT                   TIVVASYMAEERPSSFVRFRITEIQILLVCVASE"
FT   mRNA            join(<153974..154159,155025..>155255)
FT                   /locus_tag="An01g02560"
FT   exon            153974..154159
FT                   /locus_tag="An01g02560"
FT                   /number=1
FT   intron          154160..155024
FT                   /locus_tag="An01g02560"
FT                   /number=1
FT   exon            155025..155255
FT                   /locus_tag="An01g02560"
FT                   /number=2
FT   CDS_pept        join(155991..156178,156277..156304,156416..156452,
FT                   156509..156598,156667..156743,156826..156891)
FT                   /locus_tag="An01g02570"
FT                   /note="Remark: ORF classified questionable due to
FT                   implausible gene structure with short, multiple Exons and
FT                   no significant blastp similarity."
FT                   /note="Title: questionable ORF"
FT                   /db_xref="GOA:A2Q803"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q803"
FT                   /protein_id="CAK43626.1"
FT                   /translation="MLGTGKLSLRGHRHHTHCDHSGSLGGAAGQIVKTERGTRSMVCRP
FT                   GLRASSEAAWRKIQCWDRRVRSLADALADSSLRTSFVSDVRTAWVNVCPLVATVHCLEL
FT                   YAHTGAAEIHAGCQVLVSICWTFGSVGHDTDILSGSVMGSRRLGQSSTDVLSDVSAQ"
FT   mRNA            join(<155991..156178,156277..156304,156416..156452,
FT                   156509..156598,156667..156743,156826..>156891)
FT                   /locus_tag="An01g02570"
FT   exon            155991..156178
FT                   /locus_tag="An01g02570"
FT                   /number=1
FT   intron          156179..156276
FT                   /locus_tag="An01g02570"
FT                   /number=1
FT   exon            156277..156304
FT                   /locus_tag="An01g02570"
FT                   /number=2
FT   intron          156305..156415
FT                   /locus_tag="An01g02570"
FT                   /number=2
FT   exon            156416..156452
FT                   /locus_tag="An01g02570"
FT                   /number=3
FT   intron          156453..156508
FT                   /locus_tag="An01g02570"
FT                   /number=3
FT   exon            156509..156598
FT                   /locus_tag="An01g02570"
FT                   /number=4
FT   intron          156599..156666
FT                   /locus_tag="An01g02570"
FT                   /number=4
FT   exon            156667..156743
FT                   /locus_tag="An01g02570"
FT                   /number=5
FT   intron          156744..156825
FT                   /locus_tag="An01g02570"
FT                   /number=5
FT   exon            156826..156891
FT                   /locus_tag="An01g02570"
FT                   /number=6
FT   tRNA            157207..157278
FT                   /gene="tRNA-Met (CAT)"
FT                   /locus_tag="An01e02580"
FT                   /product="transfer RNA-Met (CAT)"
FT                   /inference="profile:tRNAscan:1.4"
FT   exon            complement(157462..157635)
FT                   /locus_tag="An01g02590"
FT                   /number=1
FT   CDS_pept        complement(157462..157635)
FT                   /locus_tag="An01g02590"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q804"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q804"
FT                   /protein_id="CAK43627.1"
FT                   /translation="MEDIITTGSGSNDRMQQQQRGGGQSSRASPVLCVLAGLASLKGGQ
FT                   LVTCWYSDLNHG"
FT   mRNA            complement(<157462..>157635)
FT                   /locus_tag="An01g02590"
FT   CDS_pept        join(157759..157780,157879..158002,158065..158253,
FT                   158305..160420,160475..160570)
FT                   /locus_tag="An01g02600"
FT                   /note="Remark: the adaptin complex proteins are involved in
FT                   the formation of clathrin coated pits and vesicels."
FT                   /note="Similarity: the predicted A. niger protein reveals
FT                   two conserved domains, the adaptin N-terminal region (aa
FT                   24-587, PF01602) and the C-terminal gamma-adaptin domain
FT                   (aa 726-848, PF02139), who are together part of the adaptin
FT                   complex (AP-complex)."
FT                   /note="Title: strong similarity to gamma1-adaptin - Homo
FT                   sapiens"
FT                   /note="See PMID 9733768"
FT                   /db_xref="GOA:A2Q805"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR008152"
FT                   /db_xref="InterPro:IPR008153"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017107"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q805"
FT                   /inference="profile:COGS:COG5096"
FT                   /inference="profile:PFAM:PF01602"
FT                   /inference="similar to AA sequence:UniProtKB:AB015317.1"
FT                   /protein_id="CAK43628.1"
FT                   /translation="MASRRCPFKQFIRNVRSAKTIADERAVIQKESAAIRASFREESHD
FT                   SGIRRNNVAKLLYLFTLGERTHFGQIECLKLLASHRFADKRLGYLGTMLLLDENQEVLT
FT                   LVTNSLKNDLNHSNQYIVGLALCALGNIASVEMSRDLFPEVENLMSTANPYIRRKAALC
FT                   AMRVCRKVPDLQEHFLEKAKTLLSDRNHGVLLCGLTLAIDMCEAEEAEEGQEGVIEMFR
FT                   PLAGGLVRSLKGLTTSGYAPEHDVSGITDPFLQVKILRLLRVLGRGDAATSEMINDILA
FT                   QVATNTDSTKNVGNAILYEAVLTILDIEADSGLRVLGVNILGKFLTNKDNNIRYVALNT
FT                   LNKVVAIEPNAVQRHRNTILECLRDPDISIRRRALDLSFMLINESNVRVLVRELLAFLE
FT                   VADNEFKPAMTTQIGIAADRYAPNKRWHVDTILRVLKLAGAYVKEQILSSFVRLIATTP
FT                   ELQTYSVQKLYLSLKEDISQEGLTLAATWVIGEYGDNLLQGGQYEEEELVKEVKESDIV
FT                   DLFTNILNSTYATQTVVEYITTASMKLTVRMSDPAQVERLRRFLSSRTADLSVEIQQRA
FT                   VEYVNLFGYDQIRRGVLERMPPPEIREEQRVLGAPTKKRQSKILKDKSKKPAKQAEQDM
FT                   LLDLMGGDAPPTSPTTNGSQNTADLLADILGGDSSLSSPSPQPAQKAAGSTNTSAIMDL
FT                   FNTNGSTPSPKPAEPASSGLDLLAGLSSSASPAPTPAPSATPAHTAFNKNDLSLALQVQ
FT                   RGSGGSAQIQARFRNNSSFGRFSNVGLQAAVPKSQKLQLSAINKADLDAGDEGIQMLKV
FT                   AALTGALPPKLRLRLRITYAKDGSDPVTDQVDWTEP"
FT   mRNA            join(<157759..157780,157879..158002,158065..158253,
FT                   158305..160420,160475..>160570)
FT                   /locus_tag="An01g02600"
FT   exon            157759..157780
FT                   /locus_tag="An01g02600"
FT                   /number=1
FT   intron          157781..157878
FT                   /locus_tag="An01g02600"
FT                   /number=1
FT   exon            157879..158002
FT                   /locus_tag="An01g02600"
FT                   /number=2
FT   intron          158003..158064
FT                   /locus_tag="An01g02600"
FT                   /number=2
FT   exon            158065..158253
FT                   /locus_tag="An01g02600"
FT                   /number=3
FT   intron          158254..158304
FT                   /locus_tag="An01g02600"
FT                   /number=3
FT   exon            158305..160420
FT                   /locus_tag="An01g02600"
FT                   /number=4
FT   intron          160421..160474
FT                   /locus_tag="An01g02600"
FT                   /number=4
FT   exon            160475..160570
FT                   /locus_tag="An01g02600"
FT                   /number=5
FT   CDS_pept        complement(join(161864..162004,162092..162166,
FT                   162534..162757,162809..162919,162967..163246))
FT                   /locus_tag="An01g02610"
FT                   /note="Title: strong similarity to EST an_2155 -Aspergillus
FT                   niger"
FT                   /db_xref="GOA:A2Q806"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q806"
FT                   /protein_id="CAK43629.1"
FT                   /translation="MGRVELLAYRPVESRQMVVGQVLLGTAAMRAAINWRTRSPWQGEQ
FT                   RSLVVARKSPDTNEIERRSRYKWCFSNGEDSMDETDDDAGSNGIAIDEQEEERERARDR
FT                   KNEEPRDAADGLRTLLRFPYAVSLGIGGSQYGITRDVGLTSSSSSLSVMHHAIYNGIHL
FT                   LESLCREYTTERLKDSDFQTWLSPSSSVFSVNSPRSEAMAPAARLLSGTSAAQRSEDGG
FT                   DKDKGIHQGRILAQYSGAMTAKYHITITYLLPEAIMKQPVKNAIGVLVPGQCDQ"
FT   mRNA            complement(join(<161864..162004,162092..162166,
FT                   162534..162757,162809..162919,162967..>163246))
FT                   /locus_tag="An01g02610"
FT   exon            complement(161864..162004)
FT                   /locus_tag="An01g02610"
FT                   /number=1
FT   intron          complement(162005..162091)
FT                   /locus_tag="An01g02610"
FT                   /number=1
FT   exon            complement(162092..162166)
FT                   /locus_tag="An01g02610"
FT                   /number=2
FT   intron          complement(162167..162533)
FT                   /locus_tag="An01g02610"
FT                   /number=2
FT   exon            complement(162534..162757)
FT                   /locus_tag="An01g02610"
FT                   /number=3
FT   intron          complement(162758..162808)
FT                   /locus_tag="An01g02610"
FT                   /number=3
FT   exon            complement(162809..162919)
FT                   /locus_tag="An01g02610"
FT                   /number=4
FT   intron          complement(162920..162966)
FT                   /locus_tag="An01g02610"
FT                   /number=4
FT   exon            complement(162967..163246)
FT                   /locus_tag="An01g02610"
FT                   /number=5
FT   CDS_pept        join(164072..164231,164613..164723,164789..164916,
FT                   165013..165270)
FT                   /locus_tag="An01g02620"
FT                   /note="Function: A. oryzae nuclear protein HAPC binds
FT                   specifically to a CCAAT sequence in the promoter region of
FT                   the A. oryzae Taka-amylase A gene."
FT                   /note="Similarity: the predicted A. niger protein contains
FT                   a CBFD-NFYB-HMF domain (aa 47-115, PF00808) which is
FT                   typical for histone like transcription factors."
FT                   /note="Title: strong similarity to CCAAT-binding protein
FT                   hapC - Aspergillus oryzae"
FT                   /note="nucleus"
FT                   /note="See PMID 10905428"
FT                   /db_xref="GOA:A2Q807"
FT                   /db_xref="InterPro:IPR003956"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q807"
FT                   /inference="profile:COGS:COG2036"
FT                   /inference="profile:COGS:COG5150"
FT                   /inference="profile:COGS:COG5208"
FT                   /inference="profile:PFAM:PF00808"
FT                   /inference="similar to AA sequence:UniProtKB:AB010431.1"
FT                   /protein_id="CAK43630.1"
FT                   /translation="MSSTSPSKEPEVEPEVQSGEDQEQMDKEQQDTQAQGQGEFEVKEQ
FT                   DRWLPIANVARIMKLALPENAKIAKEAKECMQECVSEFISFITSEASEKCQQEKRKTVN
FT                   GEDILFAMTSLGFENYAEALKIYLSKYRETQSARGEHQNRPTSSGYGAGAPVGAPGPAG
FT                   PGGRPMAPGAGFPDAADSANNIMNQSLDPSEQDTSAYGYPPMVGQPHNGTAGESY"
FT   mRNA            join(<164072..164231,164613..164723,164789..164916,
FT                   165013..>165270)
FT                   /locus_tag="An01g02620"
FT   exon            164072..164231
FT                   /locus_tag="An01g02620"
FT                   /number=1
FT   intron          164232..164612
FT                   /locus_tag="An01g02620"
FT                   /number=1
FT   exon            164613..164723
FT                   /locus_tag="An01g02620"
FT                   /number=2
FT   intron          164724..164788
FT                   /locus_tag="An01g02620"
FT                   /number=2
FT   exon            164789..164916
FT                   /locus_tag="An01g02620"
FT                   /number=3
FT   intron          164917..165012
FT                   /locus_tag="An01g02620"
FT                   /number=3
FT   exon            165013..165270
FT                   /locus_tag="An01g02620"
FT                   /number=4
FT   CDS_pept        complement(join(166303..167449,167509..168761))
FT                   /locus_tag="An01g02630"
FT                   /note="Pathway: amdR in A. oryzae and in A. nidulans is
FT                   involved in the capability of the fungi to grow on
FT                   gamma-amino-butyric acid (GABA) as a carbon and/or nitrogen
FT                   source."
FT                   /note="Similarity: the N-terminal region of the predicted
FT                   A. niger protein contains a fungal Gal4-type Zn(2)-Cys(6)
FT                   DNA-binding domain."
FT                   /note="Title: strong similarity to transcription regulator
FT                   amdR - Aspergillus nidulans"
FT                   /note="nucleus"
FT                   /note="See PMID 1479891"
FT                   /db_xref="GOA:A2Q808"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q808"
FT                   /inference="profile:PFAM:PF00172"
FT                   /inference="profile:PFAM:PF04082"
FT                   /inference="similar to AA sequence:PIR:A36332"
FT                   /protein_id="CAK43631.1"
FT                   /translation="MSMKDLAYICYSSPGSNENSPLGSAACVHCHRRKVRCDARIVGLP
FT                   CSNCRSAGKTDCRIHEKKKRLAVRSILDPVPIRCRPPPASSEPTHRHSLPLTATTPPDA
FT                   FTTTFRGVQPEVTTPVAHPASSLHNLHQTLNHNVNHHPPHNGAGSAAESPTYNRPAGQD
FT                   VSAESDSHADLEKRLVKLIDEEESGSREIRRGVRAIYVGHELSNMSFLIRQQRDKDDDV
FT                   YHFAGNEIPRRQLRTGHDQLLMDALTLPEPALADELVQAYFDHVNPGYPIIDEDLFMAQ
FT                   YRNRDPADPPPILLLQAILLVGAHVTRPKAERDALKDIFFRRAKWLFDSRIERNRDILV
FT                   QAALLLTWHSDGADDDVAANAHYWVGVAARIATGLGMHRNPISSRFVSRDRRMWRRLWH
FT                   IIVQFDVMVSLSYGRPQAINLEDSDVSPLTISDFEGCGPRVQSDYVIHFTELSVMISYI
FT                   VRSRFGLRVSAERRKAVLLEADEALANWSLKLPDKLRLRASDMDPWSAMLHLTYNNFLI
FT                   LLHRPHPRASAYSDDYGPHDAEICSAAAGVITSIFEELRLNDRLKFLWYSGVHTLFTAM
FT                   IQVRVELRFSNPVLAINALRRFDSASYSLRELASYWFHANTILRLFEDSRRLQEDLRMA
FT                   TSERPPRRFSNPQDQLKTTLHSTTTSTSAPTAMQTPRPPNPTPTDRPLPFEVPTPDSST
FT                   NHLPTSPHHSHPQPQSQPQQHHHLDAWIPPPPPSATMTPVVDAIDADAPRESLDWRQLF
FT                   SFTDLDQPVLPMAMEGLPELEDEWRQIYWQETPMSDLLLDGGWMHG"
FT   mRNA            complement(join(<166303..167449,167509..>168761))
FT                   /locus_tag="An01g02630"
FT   exon            complement(166303..167449)
FT                   /locus_tag="An01g02630"
FT                   /number=1
FT   intron          complement(167450..167508)
FT                   /locus_tag="An01g02630"
FT                   /number=1
FT   exon            complement(167509..168761)
FT                   /locus_tag="An01g02630"
FT                   /number=2
FT   CDS_pept        complement(join(169570..169880,169938..170395,
FT                   170452..170575,170656..170779,170870..171193))
FT                   /locus_tag="An01g02640"
FT                   /EC_number="2.1.1.-"
FT                   /note="Catalytic activity: omtB of A. parasiticus catalyzes
FT                   the conversion of demethylsterigmatocystin (DMST) to
FT                   sterigmatocystin (ST) and dihydrodemethylsterigmatocystin
FT                   (DHDMST) to dihydrosterigmatocystin (DHST)."
FT                   /note="Pathway: omtB of A. parasiticus is a component of
FT                   the aflatoxin biosynthesis gene cluster."
FT                   /note="Remark: aflatoxins are polyketide-derived secondary
FT                   metabolites."
FT                   /note="Remark: omtB of A. parasiticus is also called dmtA."
FT                   /note="Title: strong similarity to O-methyltransferase B
FT                   omtB - Aspergillus parasiticus"
FT                   /note="See PMID 10806361"
FT                   /db_xref="GOA:A2Q809"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q809"
FT                   /inference="profile:COGS:COG0500"
FT                   /inference="profile:PFAM:PF00891"
FT                   /protein_id="CAK43632.1"
FT                   /translation="MTYTNVSTVVEQCTNGDHTNGYHTNGHHTNGIHSNGHGPSKSDVN
FT                   VDTIAISPNAPDAVPTLIDQIASHKSISLENSVERLRLRDAARSLANALETPREAIVRQ
FT                   CWTTATLHAAIETALAIGVLSELSRDKPKSVAELAVITQSDPVLLSRIMKHLASMSVIT
FT                   EAGPDEYIATNLSTTLSVERYGDAFPALSAWLYPGIYAIPAFLKQTGFRNPTDPTKSPF
FT                   QLGQRVDEHFFECVQKNPTLNKQFGNHMSVYHQGRPSWMDKGFYPVQERLIKGTELSEK
FT                   DVFLVDVGGSTGHDVSEFRRKWPEVSGRLVVQDLPQVIETVRDLHVSIDPMAHDFFTEQ
FT                   PVKGARVYYMHSVLHDWPDDVCGQILSNLIPAMKPGYSKLLINEYVVPSLDAHFETTSL
FT                   DMIMMSIASGERTEKHWTTLIESVGLKVVKIWTVEKGVESLIECELA"
FT   mRNA            complement(join(<169570..169880,169938..170395,
FT                   170452..170575,170656..170779,170870..>171193))
FT                   /locus_tag="An01g02640"
FT   exon            complement(169570..169880)
FT                   /locus_tag="An01g02640"
FT                   /number=1
FT   intron          complement(169881..169937)
FT                   /locus_tag="An01g02640"
FT                   /number=1
FT   exon            complement(169938..170395)
FT                   /locus_tag="An01g02640"
FT                   /number=2
FT   intron          complement(170396..170451)
FT                   /locus_tag="An01g02640"
FT                   /number=2
FT   exon            complement(170452..170575)
FT                   /locus_tag="An01g02640"
FT                   /number=3
FT   intron          complement(170576..170655)
FT                   /locus_tag="An01g02640"
FT                   /number=3
FT   exon            complement(170656..170779)
FT                   /locus_tag="An01g02640"
FT                   /number=4
FT   intron          complement(170780..170869)
FT                   /locus_tag="An01g02640"
FT                   /number=4
FT   exon            complement(170870..171193)
FT                   /locus_tag="An01g02640"
FT                   /number=5
FT   CDS_pept        complement(join(171416..171536,171892..172004,
FT                   172097..172149,172231..172320,172542..172765,
FT                   172894..172983,173108..173232))
FT                   /locus_tag="An01g02650"
FT                   /note="Remark: ORF classified questionable due to
FT                   implausible gene structure with short, multiple Exons and
FT                   no significant blastp similarity."
FT                   /note="Title: questionable ORF"
FT                   /db_xref="GOA:A2Q810"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q810"
FT                   /protein_id="CAK43633.1"
FT                   /translation="MALPRIVQERGIKFSLELSPDKEHARHSRVQETFRVGKSRRRSDF
FT                   RTSLPGVRFHQRRRRRHAPSGTVLSLALHFFLEIDDQMIASVRNLKAPPNTDIKPPPPT
FT                   ATFKAEHQESLELLVWPRRSTMFLAPQSCPTAKYTVATRSYRGAPPLLLLRYGCSWQYW
FT                   RSTTLSETRGKSGTIGILCTYTTPISRILSGGGTLSYERMPIPELRLHISQAYLYCYFR
FT                   DLVSGSAALRRRRYISDSTAGHQSGQPESEINDQWRWQQLAYLFDLAPQ"
FT   mRNA            complement(join(<171416..171536,171892..172004,
FT                   172097..172149,172231..172320,172542..172765,
FT                   172894..172983,173108..>173232))
FT                   /locus_tag="An01g02650"
FT   exon            complement(171416..171536)
FT                   /locus_tag="An01g02650"
FT                   /number=1
FT   intron          complement(171537..171891)
FT                   /locus_tag="An01g02650"
FT                   /number=1
FT   exon            complement(171892..172004)
FT                   /locus_tag="An01g02650"
FT                   /number=2
FT   intron          complement(172005..172096)
FT                   /locus_tag="An01g02650"
FT                   /number=2
FT   exon            complement(172097..172149)
FT                   /locus_tag="An01g02650"
FT                   /number=3
FT   intron          complement(172150..172230)
FT                   /locus_tag="An01g02650"
FT                   /number=3
FT   exon            complement(172231..172320)
FT                   /locus_tag="An01g02650"
FT                   /number=4
FT   intron          complement(172321..172541)
FT                   /locus_tag="An01g02650"
FT                   /number=4
FT   exon            complement(172542..172765)
FT                   /locus_tag="An01g02650"
FT                   /number=5
FT   intron          complement(172766..172893)
FT                   /locus_tag="An01g02650"
FT                   /number=5
FT   exon            complement(172894..172983)
FT                   /locus_tag="An01g02650"
FT                   /number=6
FT   intron          complement(172984..173107)
FT                   /locus_tag="An01g02650"
FT                   /number=6
FT   exon            complement(173108..173232)
FT                   /locus_tag="An01g02650"
FT                   /number=7
FT   CDS_pept        join(173725..173895,174054..174349,174403..174647,
FT                   174707..174737,174815..175175)
FT                   /locus_tag="An01g02660"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   encoded by An03g05810 - Aspergillus niger"
FT                   /db_xref="GOA:A2Q811"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q811"
FT                   /protein_id="CAK43634.1"
FT                   /translation="MTAVSSEYAHQTKGPRILAVFWTMTSLAILAVAARLFIRIKVLRN
FT                   PGADDWLIATSMTRTRSASQLYQLRLGHNLLRLTQISRGCPAEPFSESDNDTTRDLMGI
FT                   DGVCGTGVVYLHLGALYHVRSSESSLGHVPSVKGRELPELVDPCGLCHLHWSHICLYGS
FT                   VFGNLSDSHLTKASYVDAETIGVVCSAGSECSVSKNSRSSSSSVLAKKQGYSACAMAII
FT                   KCMQLPGLADLSDTTYATADLVIWTSIESNVVILASCIPTLQPLLEIILGKRSLRSTGG
FT                   YQYKESSTQLPESNKWSSKRSGHRKSKGNMMIADIGSQDSILQIGDDHEDESHYMGHIR
FT                   RTDKITVVYESVTPQPGGGDKTNDPVK"
FT   mRNA            join(<173725..173895,174054..174349,174403..174647,
FT                   174707..174737,174815..>175175)
FT                   /locus_tag="An01g02660"
FT   exon            173725..173895
FT                   /locus_tag="An01g02660"
FT                   /number=1
FT   sig_peptide     173725..173823
FT                   /locus_tag="An01g02660"
FT                   /inference="protein motif:SignalP:2.0"
FT   mat_peptide     join(173824..173895,174054..174349,174403..174647,
FT                   174707..174737,174815..175172)
FT                   /locus_tag="An01g02660"
FT   intron          173896..174053
FT                   /locus_tag="An01g02660"
FT                   /number=1
FT   exon            174054..174349
FT                   /locus_tag="An01g02660"
FT                   /number=2
FT   intron          174350..174402
FT                   /locus_tag="An01g02660"
FT                   /number=2
FT   exon            174403..174647
FT                   /locus_tag="An01g02660"
FT                   /number=3
FT   intron          174648..174706
FT                   /locus_tag="An01g02660"
FT                   /number=3
FT   exon            174707..174737
FT                   /locus_tag="An01g02660"
FT                   /number=4
FT   intron          174738..174814
FT                   /locus_tag="An01g02660"
FT                   /number=4
FT   exon            174815..175175
FT                   /locus_tag="An01g02660"
FT                   /number=5
FT   CDS_pept        complement(join(175522..176483,176514..176703))
FT                   /locus_tag="An01g02670"
FT                   /note="Function: the S. pombe scn1 protein interact with
FT                   the CUT9 protein, a putative component of anaphse-promoting
FT                   complex (APC) which is required for cyclin degradation and
FT                   metaphase-anaphase transition."
FT                   /note="Function: the predicted S. pombe scn1 protein
FT                   contains a TatD related DNAse domain (aa 19-357, PF01026),a
FT                   feature of a large superfamily of metalloenzymes."
FT                   /note="Remark: the S. cerevisiae homolog of S. pombe scn1
FT                   is YMR262W."
FT                   /note="Title: strong similarity to hypothetical protein
FT                   scn1p - Schizosaccharomyces pombe"
FT                   /note="See PMID 7798319"
FT                   /db_xref="GOA:A2Q812"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q812"
FT                   /inference="profile:COGS:COG0084"
FT                   /inference="profile:PFAM:PF01026"
FT                   /inference="similar to AA sequence:PIR:B55164"
FT                   /protein_id="CAK43635.1"
FT                   /translation="MSETDQNDAFPWHLGVFDAHCHPTDTMSSIAEIPQMKVLTLTVMS
FT                   TRGEDQDLVLQTATSLTQGPVLPCFGWHPWFSHQIIDDTTGSPKTDESTSPIELKKLHY
FT                   KKVLTPEPDDDFILSLPDPKPLSELLSESRARLLAYPRSLVGEVGLDRAFRLPKAWTEE
FT                   EKETRDERMTPGSREGRQLSPYRVQLAHQKAVLEAQLRLAGELQRPVSVHSVQAHGAVF
FT                   DLLKALWSGHERKNASRRERRRRYSVPDAHAESDAEDERMQQKPAKSDEKSLPFPPRIC
FT                   MHSYSGPVEPLKQFLHQSNPSDVYFSFSSVINFGGPSSQKVINVIKALPDDRILIESDL
FT                   HTAGQQMDDLLEEIARQICNIRGWELHQGVRQLAENWKRFVLG"
FT   mRNA            complement(join(<175522..176483,176514..>176703))
FT                   /locus_tag="An01g02670"
FT   exon            complement(175522..176483)
FT                   /locus_tag="An01g02670"
FT                   /number=1
FT   intron          complement(176484..176513)
FT                   /locus_tag="An01g02670"
FT                   /number=1
FT   exon            complement(176514..176703)
FT                   /locus_tag="An01g02670"
FT                   /number=2
FT   exon            177142..178380
FT                   /locus_tag="An01g02680"
FT                   /number=1
FT   CDS_pept        177142..178380
FT                   /locus_tag="An01g02680"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q813"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q813"
FT                   /protein_id="CAK43636.1"
FT                   /translation="MSSISAFLSLPLLTLFSLPLALLACFTTFLSIIFLLLRFSVIYIE
FT                   LCLAIITNYFVIPTAANTSLLNFSASEPTTPAASTTPKRRSVDHSLNNGLLTALATYRP
FT                   GYNPPRRTNSLTTTTSTSSTSQDTTTVPLYRKDEPANNAPSALLTLISGDEGRDFEGLG
FT                   GWRCATTAKAAAATTTTTARYPAHHLLSDTASPSPNITTSEYDERAWLSINERLELPSQ
FT                   PLLSIRNNSNSSNNEALESLPWRHRQMASTSPPPGGSNNLIRSPRHHHRSATTSLLSTS
FT                   LSPRSSLPDAVPHHGLDHPQRRATSPLLSQQQNSTNTLFCTPSPTGKFPGASIPRVSSP
FT                   TEGSGGYFSLRPGSTSSTSGSTTPGEERRSPRPSAKSMVHYPAGVRYRRRSMSGPNSGV
FT                   KLTKASSGTERAL"
FT   mRNA            <177142..>178380
FT                   /locus_tag="An01g02680"
FT   CDS_pept        complement(join(178816..179091,179251..180348,
FT                   180416..180583))
FT                   /locus_tag="An01g02690"
FT                   /note="Remark: information regarding S. cerevisiae ICT1 has
FT                   not yet been published and is available from SGD and MIPS."
FT                   /note="Similarity: the predicted A. niger protein shows
FT                   similarity to S. cerevisiae ICT1, disruption of ICT1 leads
FT                   to enhanced sensitivity to benomyl and azoles."
FT                   /note="Title: strong similarity to hypothetical protein
FT                   SPAC6G10.03c - Schizosaccharomyces pombe"
FT                   /db_xref="GOA:A2Q814"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q814"
FT                   /inference="profile:COGS:COG0596"
FT                   /inference="profile:PFAM:PF00561"
FT                   /inference="similar to AA sequence:PIR:T39053"
FT                   /protein_id="CAK43637.1"
FT                   /translation="MASESFNSPSGEFRGRSQEPVASRRESTPHAARGASATPAPLAWF
FT                   PLGYREGFSQWWASLPAATAEHRVLSHLPYLQHQPPTHLQTGKTSSVSGGTGSLQSADQ
FT                   TQQGEVSASSTNDPYGPRMWRSSMVELSGKNRALNEFSVERIGEEADQHLVMLHGYGAG
FT                   LGFFYKNFEPLSRLKGWQLHALDLLGMGRSTRPPFRIKAKEREEAIKEAEAWFVDALEE
FT                   WRVKRNIDRFTLLGHSLGGYMAVAYALKYPGRLNKLILASPVGIPEDPYAVRAEMPAPN
FT                   ESTMANELTQNQRNIAESASSVPPTELQKGDNNILLKGSPTDSGASQDRPPRRMVPKWF
FT                   AYLWDANISPFSLVRWAGPLGPRLVSGWTSRRFSHLPAEEAKSLHDYSYSIFSMRGSGE
FT                   YALSYILAPGAFARSPLIRRIEGNGLPIIFMYGDHDWMDVKGGLAAKAKLDQEKERILQ
FT                   NATVEEREADNGSAKVVIIKRSGHHIYLDGWEDFNRIVLAEMEEVAQKERANRAS"
FT   mRNA            complement(join(<178816..179091,179251..180348,
FT                   180416..>180583))
FT                   /locus_tag="An01g02690"
FT   exon            complement(178816..179091)
FT                   /locus_tag="An01g02690"
FT                   /number=1
FT   intron          complement(179092..179250)
FT                   /locus_tag="An01g02690"
FT                   /number=1
FT   exon            complement(179251..180348)
FT                   /locus_tag="An01g02690"
FT                   /number=2
FT   intron          complement(180349..180415)
FT                   /locus_tag="An01g02690"
FT                   /number=2
FT   exon            complement(180416..180583)
FT                   /locus_tag="An01g02690"
FT                   /number=3
FT   CDS_pept        join(181437..182055,182150..182832)
FT                   /locus_tag="An01g02700"
FT                   /note="Title: similarity to hypothetical protein SPBC902.03
FT                   - Schizosaccharomyces pombe"
FT                   /db_xref="GOA:A2Q815"
FT                   /db_xref="InterPro:IPR005605"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q815"
FT                   /inference="similar to AA sequence:PIR:T50384"
FT                   /protein_id="CAK43638.1"
FT                   /translation="MASASLDQLVKGSPAPNSRLASSATSSSESLAPAFHSHPPSSDPS
FT                   SPPRSSTPDPLSTLPSSPPQIYLNLLILESSLRAQYLALRERRRQNTFFLLLLAAWIAY
FT                   FAYALFLRPREDGRGVGGSVYWVVEMGEKVALMGGVVTALLVWGTGQWERGVSLAAALA
FT                   RRSQPRPPHHEHQDRGHPRSLVAGAFLLPFFPISILCTLFPVPRLVQEDLSPGGDYIRL
FT                   LLLPKSFSPEFRENWDEYRSEFWDKENDRRAQLRQKLRQRERQLVQQDGGWFWWFGLSW
FT                   KASQRRRVAAATISRPGDADKVQHRSHHHHHSSSISKLALESKSPLRRGGPRSESHSRT
FT                   PSRSTTPVDTDDRPPSRSSVSGRPRRGSTSPSTEQHIQQSRKKKASKAATRGLSPLTQA
FT                   QIREGVRTPSFSSDDSSFMGTPSEKEKPKDESVE"
FT   mRNA            join(<181437..182055,182150..>182832)
FT                   /locus_tag="An01g02700"
FT   exon            181437..182055
FT                   /locus_tag="An01g02700"
FT                   /number=1
FT   intron          182056..182149
FT                   /locus_tag="An01g02700"
FT                   /number=1
FT   exon            182150..182832
FT                   /locus_tag="An01g02700"
FT                   /number=2
FT   mobile_element  complement(183599..184037)
FT                   /mobile_element_type="transposon:Vader"
FT                   /locus_tag="An01e02710"
FT                   /note="Remark: Vader is flanked by 44 bp inverted repeats
FT                   (IR)"
FT                   /note="Title: transposon Vader - Aspergillus niger"
FT   CDS_pept        complement(join(184378..184414,184477..186548,
FT                   186606..186869,186925..187030,187081..187127,
FT                   187197..187248,187321..187339,187398..187464))
FT                   /locus_tag="An01g02720"
FT                   /note="Complex: the six S. cerevisiae MCM proteins (MCM2-7)
FT                   interact with each other to form predominantly a hexameric
FT                   complex containing all six MCM proteins but also other
FT                   smaller subcomplexes."
FT                   /note="Function: S. cerevisiae MCM3 is a helicase subunit
FT                   involved in DNA replication initiation, DNA unwinding and
FT                   in the pre-replicative complex formation and its
FT                   maintenance."
FT                   /note="Similarity: the predicted A. niger protein contains
FT                   a MCM 2/3/5 domain (aa 110-664, PF00493) which is a
FT                   component of proteins required for the initiation of DNA
FT                   replication."
FT                   /note="Title: strong similarity to replication helicase
FT                   subunit Mcm3 - Saccharomyces cerevisiae"
FT                   /note="nucleus"
FT                   /note="See PMID 2233713"
FT                   /note="See PMID 9427284"
FT                   /note="See PMID 10980206"
FT                   /db_xref="GOA:A2Q816"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008046"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018525"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027925"
FT                   /db_xref="InterPro:IPR031327"
FT                   /db_xref="InterPro:IPR033762"
FT                   /db_xref="InterPro:IPR041562"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q816"
FT                   /inference="profile:COGS:COG1241"
FT                   /inference="profile:PFAM:PF00493"
FT                   /inference="similar to AA sequence:PIR:A36376"
FT                   /protein_id="CAK43639.1"
FT                   /translation="MEGQFDDAAQDRVRAAVEFLDPSDARARSYRADILLMLNRGLRRL
FT                   IVSIDEIRAHNREMADGLLTSPYEYSDAFEKALKEIIKTLPNRPSRETGDDVNYHCGFV
FT                   GAFGEYSCNPRTLGSSHLNRMISLEGIVTKCSLVRPKIIQSVHWSERGQKFLTRKYMDA
FT                   TMTASGATSMSIYPQEDEEKNPLVTEYGFSTYMDHQTISIQEMPERAPAGQLPRSVDVI
FT                   VDDDLVDRAKPGDRIQLVGVYRSLGNRNASSTSATFRTLVLANNIIQLSSKSGGGIAQA
FT                   TITDTDIRNINKVSKKKGVFELLSHSLAPSIYGHDYIKKAILLMLLGGMEKNLDNGTHL
FT                   RGDINILMVGDPSTAKSQLLRFVLNTAPLAIATTGRGSSGVGLTAAVTSDKETGERRLE
FT                   AGAMVLGDRGVVCIDEFDKMSDVDRVAIHEVMEQQTVTIAKAGIHTSLNARCSVLAAAN
FT                   PIYGQYDPHKDPHKNIALPDSLLSRFDLLFVVTDDIEDSRDRMVSEHVLRMHRYRQPGT
FT                   EEGAPVREQLHQTLGVGLEDTQDSNQPTDVYEKFNVMLHAGMAHMSRSKSKNIEILSIP
FT                   FIKKYIQYAKSRVKPVLTKGAADHIVATYSALRNDELSGNQRRTSPITARTLETLIRLS
FT                   TAHAKSRLSNRVEERDAKIAESILRFAMFKEIVEDERRKRRKVASFDEDSESSDSDSDD
FT                   DDNTPAQTSSATPRSTRRGGLRSRGANARSTTNEDTEMDADGDAVSEDGDGLYNASPRG
FT                   QRLRSSQTSRTQTQTQSQSRMSVASSRPASQLVESQTDNSQSQNTTVSSEPIQPARLTV
FT                   FRQALGPLMGTRLFTHGDTADVESLIGAVNTALRSTPSLGESHVFQRGEAIQALRAMNE
FT                   RNELMYLEEDETVYRI"
FT   mRNA            complement(join(<184378..184414,184477..186548,
FT                   186606..186869,186925..187030,187081..187127,
FT                   187197..187248,187321..187339,187398..>187464))
FT                   /locus_tag="An01g02720"
FT   exon            complement(184378..184414)
FT                   /locus_tag="An01g02720"
FT                   /number=1
FT   intron          complement(184415..184476)
FT                   /locus_tag="An01g02720"
FT                   /number=1
FT   exon            complement(184477..186548)
FT                   /locus_tag="An01g02720"
FT                   /number=2
FT   intron          complement(186549..186605)
FT                   /locus_tag="An01g02720"
FT                   /number=2
FT   exon            complement(186606..186869)
FT                   /locus_tag="An01g02720"
FT                   /number=3
FT   intron          complement(186870..186924)
FT                   /locus_tag="An01g02720"
FT                   /number=3
FT   exon            complement(186925..187030)
FT                   /locus_tag="An01g02720"
FT                   /number=4
FT   intron          complement(187031..187080)
FT                   /locus_tag="An01g02720"
FT                   /number=4
FT   exon            complement(187081..187127)
FT                   /locus_tag="An01g02720"
FT                   /number=5
FT   intron          complement(187128..187196)
FT                   /locus_tag="An01g02720"
FT                   /number=5
FT   exon            complement(187197..187248)
FT                   /locus_tag="An01g02720"
FT                   /number=6
FT   intron          complement(187249..187320)
FT                   /locus_tag="An01g02720"
FT                   /number=6
FT   exon            complement(187321..187339)
FT                   /locus_tag="An01g02720"
FT                   /number=7
FT   intron          complement(187340..187397)
FT                   /locus_tag="An01g02720"
FT                   /number=7
FT   exon            complement(187398..187464)
FT                   /locus_tag="An01g02720"
FT                   /number=8
FT   CDS_pept        complement(join(187902..188521,188593..188659))
FT                   /locus_tag="An01g02730"
FT                   /note="Remark: the C. lindemuthianum CIH1 is a fungal
FT                   glycoprotein specifically located at the biotrophic
FT                   interface formed in the Colletotrichum lindemuthianum-bean
FT                   interaction."
FT                   /note="Title: similarity to proline-rich glycoprotein CIH1
FT                   - Colletotrichum lindemuthianum"
FT                   /note="plasma membrane"
FT                   /note="See PMID 9721685"
FT                   /db_xref="GOA:A2Q817"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q817"
FT                   /inference="profile:COGS:COG0741"
FT                   /inference="profile:COGS:COG1376"
FT                   /inference="profile:PFAM:PF01476"
FT                   /inference="similar to AA sequence:UniProtKB:CLAJ1441.1"
FT                   /protein_id="CAK43640.1"
FT                   /translation="MLAATLLSLSAVAVALPASTYDALPTAGTVINLDITALNETYTVQ
FT                   ENDTLSAIAAKYGVGTCDLARLNILADPNFIYAGEVLRIPAQPTFPDDLSCFSTNNTEA
FT                   TNTCIDSGPHVYTIMPGDTIQKIANERFNITVESVINQTAQTGYIAALNPGPYDVLQTG
FT                   ETVKIPICDNTACTMTQFTLGYGTLQDFATYYGVAVGQIMALNLGYNHSEAAVPLGVLY
FT                   DCSAVN"
FT   mRNA            complement(join(<187902..188521,188593..>188659))
FT                   /locus_tag="An01g02730"
FT   exon            complement(187902..188521)
FT                   /locus_tag="An01g02730"
FT                   /number=1
FT   mat_peptide     complement(join(187905..188521,188593..188599))
FT                   /locus_tag="An01g02730"
FT   intron          complement(188522..188592)
FT                   /locus_tag="An01g02730"
FT                   /number=1
FT   exon            complement(188593..188659)
FT                   /locus_tag="An01g02730"
FT                   /number=2
FT   sig_peptide     complement(188600..188659)
FT                   /locus_tag="An01g02730"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(join(189643..190362,190435..191481))
FT                   /locus_tag="An01g02740"
FT                   /EC_number="3.1.1.20"
FT                   /note="Catalytic activity: the A. oryzae tannase converts
FT                   digallate and H(2)O to 2 gallate."
FT                   /note="Remark: an alternate name for tannase is tannin
FT                   hydrolase and tannin acetylhydrolase."
FT                   /note="Remark: tannase is an esterase that hydrolyses the
FT                   acyl esters of tannins, making tannins more soluble at a
FT                   lower temperature and pH."
FT                   /note="Remark: the ORF shows strong similarity to patent
FT                   JP08080196-A in PATENTPROT:AAR93195."
FT                   /note="Title: strong similarity to tannase precursor from
FT                   patent JP08080196-A - Aspergillus oryzae"
FT                   /note="See PMID 8917102"
FT                   /db_xref="GOA:A2Q818"
FT                   /db_xref="InterPro:IPR011118"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q818"
FT                   /protein_id="CAK43641.1"
FT                   /translation="MYSLAAATLVGVASAASLNSVCTTDYVTSVLPTASDDIPSGITID
FT                   TSSVSASIYRNYSLTDSIFWEDLTINFCEVSFAYSHQNGDDRVVVQYWMPSPDLFQNRF
FT                   LATGGSAYEINNGSGGGDIAGGVAFGAATGYTDGGFPYWGGTDFDDVVILGNGTANWPA
FT                   IYNWGYQAIAEMTQIGKAFTNNFFNVGNNVTKLYTYYIGCSEGGREGMSQAQRAPELYD
FT                   GIVAGAPAMRYGQQQVNHIAPPIQIQTIGYYPPSCVFDTVINATINACDGMDGKIDGVV
FT                   ARSDLCFQNFNVSSMLGKSYYCEAGSTTSLGLGYGKRSKRQTTSATPAQNGTINAKDIE
FT                   VIQDLLTGLKDSNGDLVYFPFQPTAGFGDTTVYDSTTDSWTITSPNSNGEWITKFLNWQ
FT                   NVTDLDMWGVTNDDLKAWMIEGMTKYMDSLQTTLPDLTPFHSKGGRLLHYHGEADSSVP
FT                   PTGSIHYHESVREIMYPDLSFAEGNEKLNDWYRFYLVPGAAHCATNDEQPNAGFPRDNF
FT                   AHMIKWVEEDVVPVRINATVTSGEHKGEVQELCTWPSRPYWTDNNTMVCEQNATSIQAM
FT                   LWKLSAYLTPVY"
FT   mRNA            complement(join(<189643..190362,190435..>191481))
FT                   /locus_tag="An01g02740"
FT   exon            complement(189643..190362)
FT                   /locus_tag="An01g02740"
FT                   /number=1
FT   mat_peptide     complement(join(189646..190362,190435..191436))
FT                   /locus_tag="An01g02740"
FT   intron          complement(190363..190434)
FT                   /locus_tag="An01g02740"
FT                   /number=1
FT   exon            complement(190435..191481)
FT                   /locus_tag="An01g02740"
FT                   /number=2
FT   sig_peptide     complement(191437..191481)
FT                   /locus_tag="An01g02740"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        join(192696..192739,192792..193197,193247..193372)
FT                   /locus_tag="An01g02750"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   CAC28656.1 - Neurospora crassa"
FT                   /db_xref="GOA:A2Q819"
FT                   /db_xref="InterPro:IPR014851"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q819"
FT                   /inference="similar to AA sequence:UniProtKB:NC93G11.4"
FT                   /protein_id="CAK43642.1"
FT                   /translation="MFVRIDLLCQESDVLFLFRFNHTPSSLNHSSPWMHVEDNTHLTLQ
FT                   CLSLSLSPLKAFLKEVRTYPRKVSESTISIYRTQSTPRDIHWMPVATRLPRDISTIILN
FT                   ENKKQKILQDITEYLHPQGRQRWRSRRSGEAEDRRREGETAGACGRGFLLQYKREPEKA
FT                   CENVAGWVEEDLGVDDEQTTNTEEDRDK"
FT   mRNA            join(<192696..192739,192792..193197,193247..>193372)
FT                   /locus_tag="An01g02750"
FT   exon            192696..192739
FT                   /locus_tag="An01g02750"
FT                   /number=1
FT   intron          192740..192791
FT                   /locus_tag="An01g02750"
FT                   /number=1
FT   exon            192792..193197
FT                   /locus_tag="An01g02750"
FT                   /number=2
FT   intron          193198..193246
FT                   /locus_tag="An01g02750"
FT                   /number=2
FT   exon            193247..193372
FT                   /locus_tag="An01g02750"
FT                   /number=3
FT   exon            complement(193688..194305)
FT                   /locus_tag="An01g02760"
FT                   /number=1
FT   CDS_pept        complement(193688..194305)
FT                   /locus_tag="An01g02760"
FT                   /note="Title: weak similarity to killer toxin Khr
FT                   -Saccharomyces cerevisiae"
FT                   /note="See PMID 1368554"
FT                   /db_xref="GOA:A2Q820"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q820"
FT                   /inference="similar to AA sequence:PIR:JT0548"
FT                   /protein_id="CAK43643.1"
FT                   /translation="MVKLSKVLCGVLACGFIDPCLAGDNETAYDVITTPIVADWDDGAG
FT                   NMTVKLKVINADYAWQWANVTSDTTDLEKRTGITIQKVVTTAKVASHVIFTVKAGLEIW
FT                   EFLAGLIKSKSDADSCTLTYGTDVSGEKVLGYAYKATTTGSNCDTTAEKKTILAAVEKC
FT                   VTTLHNSGTTVGCCEFSHGGTWRGHLRLSAEPSVYPVHAVDC"
FT   mRNA            complement(<193688..>194305)
FT                   /locus_tag="An01g02760"
FT   mat_peptide     complement(193691..194239)
FT                   /locus_tag="An01g02760"
FT   sig_peptide     complement(194240..194305)
FT                   /locus_tag="An01g02760"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(join(194423..194463,194554..194651,
FT                   194728..194795,194935..195027))
FT                   /locus_tag="An01g02770"
FT                   /note="Remark: ORF classified questionable due to
FT                   implausible gene structure with short, multiple Exons and
FT                   no significant blastp similarity."
FT                   /note="Title: questionable ORF"
FT                   /db_xref="GOA:A2Q821"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q821"
FT                   /protein_id="CAK43644.1"
FT                   /translation="MSSFRIGNEGRAFRTVGSLKWDFVSLQFSAQQNRLIWPFLWWWRV
FT                   LPPLIYSRCVNQIPQEPLIYTSGDWKLSSEYWQGLCPPGCKALIPRYGSVQLVP"
FT   mRNA            complement(join(<194423..194463,194554..194651,
FT                   194728..194795,194935..>195027))
FT                   /locus_tag="An01g02770"
FT   exon            complement(194423..194463)
FT                   /locus_tag="An01g02770"
FT                   /number=1
FT   intron          complement(194464..194553)
FT                   /locus_tag="An01g02770"
FT                   /number=1
FT   exon            complement(194554..194651)
FT                   /locus_tag="An01g02770"
FT                   /number=2
FT   intron          complement(194652..194727)
FT                   /locus_tag="An01g02770"
FT                   /number=2
FT   exon            complement(194728..194795)
FT                   /locus_tag="An01g02770"
FT                   /number=3
FT   intron          complement(194796..194934)
FT                   /locus_tag="An01g02770"
FT                   /number=3
FT   exon            complement(194935..195027)
FT                   /locus_tag="An01g02770"
FT                   /number=4
FT   CDS_pept        complement(join(195747..196713,196789..199634))
FT                   /locus_tag="An01g02790"
FT                   /note="Function: a N. crassa cya-5 mutant contains coxI
FT                   mRNA but the COXI protein could not be detected. The CYA-5
FT                   protein of N. crassa is required in a post-transcriptional
FT                   step for COXI expression, most probably for the efficient
FT                   translation of coxI mRNA."
FT                   /note="Localization: CYA-5 is a nuclear encoded protein. A
FT                   mitochondrial targeting sequence at its amino-terminus
FT                   suggests a mitochondrial localization."
FT                   /note="Title: strong similarity to COXI translation protein
FT                   CYA-5 - Neurospora crassa"
FT                   /note="See PMID 9342407"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q822"
FT                   /inference="profile:PFAM:PF01535"
FT                   /protein_id="CAK43645.1"
FT                   /translation="MLERAAGCLENAGRRFFRDPNGAVRGRGSIYSTLGQFSSAGAELL
FT                   VFLQATQRSASNTSTATSTTGRTATDPRAPVLDFLYPPRTQEFIATCLIRSPRRLVPRR
FT                   KRKAVPGLSRNYSSEAVSLDRRVDAEAHMLDDSAEIIADEDRAIAKNELRALLDKEEIE
FT                   DSDKLWSLFSKAGHPLDLTSALLAGIGSSERDVDSRRARRLLNSLPTESRTSEDYLHMT
FT                   KSCIATGNFSDVIGICREAVSCGRGVSCWAYCFAQFVNSERWDYVQDIWRSRPLGDNSL
FT                   WHAVAPWLQLSSVHKPLFALADYLQDQSLHSPVRHATRFILNNVFSSTEFAEATATETL
FT                   LALLQKFNHLDMVTSRNYFDLINILQESEHRSTFVRSIVVYRNFRWQMEEETPPRKLLA
FT                   KLLKRLASFEITTGILYFLDEISQFHRKPTEDVYRQALIVFSRAGDVDNVQHVFERFLS
FT                   DHGKPRSRKLVAPLLYVYARIGDVEKTTRQFRRISEEFNLQPNIICWNILLTAYSKAGD
FT                   LSGTFAMFKKMIEEGVEPSSHTFGIMMGLCANRGDVTHVRDLLSLAQQHNVQITAPMID
FT                   TVVEAYCNNSEWEMAEHVAETCLGLDVKGSRVRMWNILLWNYAFRMDLEAISRIRSRMD
FT                   AAGLEPDDMTYSALMLSLVLIGQTDSARRILRALHRGRRVYATEFHYAVILYGYLKDRN
FT                   RDMVHIIFREIKDRFNQPGLGSRLLVLKSQIQRDLQLLAQGGQVGNHANIRLENSEKFL
FT                   AETLADYHSTKLATKYPLLGSGRMSARKGFPAVYYEYMISAYGMKGAYLSARRLFDDYT
FT                   ASHAPKDSDEENYHDIAPLRLLSALMLAHLKAEQYHQVEECWNLAFTRALKIASPTSPD
FT                   IDEWLSRQLNPVTPPLPSHAELVVNPDSSQATSSEPATTKKDPILPAYRFMLSRPLSLY
FT                   LRSLAYGNEVSKISEVIAKLSDQIEAFTVFEHKFMPNFPGWDNLRRGYGARPPGVPSTI
FT                   DAMENPKRAKPPNVLGKLGRRYWSKIQPDFMQPTYVSMVYLAAALRRLRERSIHEGGTD
FT                   LQAIYDAAPKTIAAVARLPYLREKFQGVLLRRRQEKGEMVDELGRDRYVWTGGILGVGG
FT                   LTRSKSRVEPTGDKAEQDSSNVRVESKDASSNPIDEPPLNVGISELDDDEQDSDVAPSP
FT                   FRKTLDYPDEYDMEAETLLEERGKELGTKEELMDDESLVEDDEDEFDDLEEDLEMEEEE
FT                   EKEEEEEDWIAEEAEEGEDTPDAAEQDIYDPQDEGQIPQGEGETR"
FT   mRNA            complement(join(<195747..196713,196789..>199634))
FT                   /locus_tag="An01g02790"
FT   exon            complement(195747..196713)
FT                   /locus_tag="An01g02790"
FT                   /number=1
FT   intron          complement(196714..196788)
FT                   /locus_tag="An01g02790"
FT                   /number=1
FT   exon            complement(196789..199634)
FT                   /locus_tag="An01g02790"
FT                   /number=2
FT   CDS_pept        join(200121..200311,200405..201547,201603..202110)
FT                   /locus_tag="An01g02800"
FT                   /note="Complex: the signal recognition particle consists of
FT                   a 7S RNA molecule of 300 nucleotides and six protein
FT                   subunits: SRP72, SRP68, SRP54, SRP19, SRP14 and SRP9."
FT                   /note="Function: the signal-recognition-particle assembly
FT                   has a crucial role in targeting secretory proteins to the
FT                   rough endoplasmic reticulum membrane. SRP68 binds the 7s
FT                   RNA, SRP72 binds to this complex subsequently. This
FT                   ribonucleoprotein complex might interact directly with the
FT                   docking protein in the er membrane and possibly participate
FT                   in the elongation arrest function."
FT                   /note="Title: strong similarity to signal recognition
FT                   particle 68K protein SRP68 - Canis lupus"
FT                   /note="cytoplasm"
FT                   /note="See PMID 1702390"
FT                   /note="See PMID 6292236"
FT                   /note="See PMID 8388879"
FT                   /db_xref="GOA:A2Q823"
FT                   /db_xref="InterPro:IPR026258"
FT                   /db_xref="InterPro:IPR034652"
FT                   /db_xref="InterPro:IPR038253"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q823"
FT                   /inference="similar to AA sequence:PIR:A58947"
FT                   /protein_id="CAK43646.1"
FT                   /translation="MEITDFIFSQREESLLTGNYNAYRAHTTRKLHSARLRLGQTTPKR
FT                   SKYIAKRPVTAEDVNSNVEYVHTLLISAERAWANAMHMKTTHSADPSAKGVSGTTRGHI
FT                   ISKLRKAVTFAKQLVHVLEDQETSGAADTDVLEARAYLASLLGAYFLEKRNWEQCLQNY
FT                   SVSRVIYAALGQQVKKDAFRDLLSGTVDPSIRYAAYQLKLPRSKPIPSLALSYFPSDAT
FT                   IRSEVEKLDPNCLKEDAAGTRRTADGEVQQLPGSVTWRSHTVGLEDAAISQALASAAAA
FT                   ESRLTTWLAEGEGKNASSKDKAAAYDNVIIASQDAVDATKTAIDDLAGEGVDPSDKRMQ
FT                   ALQITRTAVNYDLVGWRIGRNRVLCGDNDGVSFESVSTKLPKSAKATAKQDDATGKKLA
FT                   RLRERVVLYDSTLQSIEFILELPGVAADTAFVRELDAKRRYFRALRCLTIGRSHGILGK
FT                   STNALALFAQALALVTETARSPQSLTETEGPPRLDISRSQVQTLELTLKGLVAQYRGLV
FT                   TLEKMSAEAQSKSVTQRPAVERLHDFAGDALDLTNIVPYPPQMQPIPVKPLFLDVAWNY
FT                   IEYPRQSTPAADNSQAQPEPQPEEKKGGRRGWFGFGR"
FT   mRNA            join(<200121..200311,200405..201547,201603..>202110)
FT                   /locus_tag="An01g02800"
FT   exon            200121..200311
FT                   /locus_tag="An01g02800"
FT                   /number=1
FT   intron          200312..200404
FT                   /locus_tag="An01g02800"
FT                   /number=1
FT   exon            200405..201547
FT                   /locus_tag="An01g02800"
FT                   /number=2
FT   intron          201548..201602
FT                   /locus_tag="An01g02800"
FT                   /number=2
FT   exon            201603..202110
FT                   /locus_tag="An01g02800"
FT                   /number=3
FT   CDS_pept        join(204184..204343,204416..204566,204652..205900,
FT                   205953..205988)
FT                   /locus_tag="An01g02810"
FT                   /EC_number="1.14.-.-"
FT                   /note="Cofactor: Heme."
FT                   /note="Function: Erg5 is a cytochrome P450 involved in C-22
FT                   denaturation of the ergosterol side-chain."
FT                   /note="Pathway: S. cerevisiae Erg5 is involved in the
FT                   Ergosterol biosynthesis."
FT                   /note="Remark: alternate names for S. cerevisiae Erg5:
FT                   Cyp61, YMR015c."
FT                   /note="Similarity: S. cerevisiae Erg5 belongs to the
FT                   cytochrome p450 family."
FT                   /note="Title: strong similarity to cytochrome P450 sterol
FT                   delta22-desaturase Erg5 - Saccharomyces cerevisiae"
FT                   /note="See PMID 7791529"
FT                   /note="See PMID 8635732"
FT                   /note="See PMID 331007"
FT                   /note="See PMID 10390230"
FT                   /db_xref="GOA:A2Q824"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q824"
FT                   /inference="profile:COGS:COG2124"
FT                   /inference="profile:PFAM:PF00067"
FT                   /inference="similar to AA sequence:PIR:S54015"
FT                   /protein_id="CAK43647.1"
FT                   /translation="MASVNGSFVSPSADAVVSPRLFEPTGLVASVLEGFTVWKALLTLF
FT                   VAAVIYDQFRYLWLKGSIVGPAWKLPFMGPFLQSVNPKFHEYKAKWDSGELSCVSVFHK
FT                   FVVIASTRDMSRKIFNSPTYVKPCVVDVAHKLLGADNWVFLDGKDHVEFRKGLNGLFTR
FT                   QALSFYLPRMEEVYNEYYARFLRISKENNFKPTPWMPEFRELMCAVSCRTFVGHYITEE
FT                   AIQKIADDYYMITAALELVNFPFILPYTKAWYGKKAADMVLAEFSNCAAKSKARMAAGG
FT                   EISCIMDAWVKAQQDSAKYREKIAQGIAVEASDKPAQVLRDFTDYEIAQTVFTFLFASQ
FT                   DATSAASTWLFQLMADRPDVLDKVREENLSVRNGDIKAPLTMELLDQLPYTRAVVKETL
FT                   RYRPPVIMVPYLVKKDFPITENVTVSKGSMIIPSVWPACHDEEAYPNADSFDPDRWITG
FT                   TAEQQTKNWLVFGTGPHYCLGQTYAQLNLMAMIGKASMEMDWEHTPTPESEDIKVFATI
FT                   FPQDDCLLAFRPRP"
FT   mRNA            join(<204184..204343,204416..204566,204652..205900,
FT                   205953..>205988)
FT                   /locus_tag="An01g02810"
FT   exon            204184..204343
FT                   /locus_tag="An01g02810"
FT                   /number=1
FT   intron          204344..204415
FT                   /locus_tag="An01g02810"
FT                   /number=1
FT   exon            204416..204566
FT                   /locus_tag="An01g02810"
FT                   /number=2
FT   intron          204567..204651
FT                   /locus_tag="An01g02810"
FT                   /number=2
FT   exon            204652..205900
FT                   /locus_tag="An01g02810"
FT                   /number=3
FT   intron          205901..205952
FT                   /locus_tag="An01g02810"
FT                   /number=3
FT   exon            205953..205988
FT                   /locus_tag="An01g02810"
FT                   /number=4
FT   CDS_pept        join(208173..208272,208452..208661,208745..208779,
FT                   208860..208901)
FT                   /locus_tag="An01g02820"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q825"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q825"
FT                   /protein_id="CAK43648.1"
FT                   /translation="MVEAYGNLHSRIISDCAVSCFHDQVVVICSSPLSHFLETLGHATS
FT                   HTVGTYNGLLEVQVTRDRETGKLITTCEHRVLGSSQGTLFTSKIDLGALLYDRVGETHD
FT                   SVAIPGPAEIAQSADLAFEIIGSW"
FT   mRNA            join(<208173..208272,208452..208661,208745..208779,
FT                   208860..>208901)
FT                   /locus_tag="An01g02820"
FT   exon            208173..208272
FT                   /locus_tag="An01g02820"
FT                   /number=1
FT   intron          208273..208451
FT                   /locus_tag="An01g02820"
FT                   /number=1
FT   exon            208452..208661
FT                   /locus_tag="An01g02820"
FT                   /number=2
FT   intron          208662..208744
FT                   /locus_tag="An01g02820"
FT                   /number=2
FT   exon            208745..208779
FT                   /locus_tag="An01g02820"
FT                   /number=3
FT   intron          208780..208859
FT                   /locus_tag="An01g02820"
FT                   /number=3
FT   exon            208860..208901
FT                   /locus_tag="An01g02820"
FT                   /number=4
FT   CDS_pept        join(209258..209545,209601..209978)
FT                   /locus_tag="An01g02830"
FT                   /note="Title: similarity to heat shock protein 67B2
FT                   -Drosophila melanogaster"
FT                   /note="See PMID 2454316"
FT                   /db_xref="GOA:A2Q826"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q826"
FT                   /inference="profile:COGS:COG1054"
FT                   /inference="profile:PFAM:PF00581"
FT                   /inference="similar to AA sequence:PIR:S00688"
FT                   /protein_id="CAK43649.1"
FT                   /translation="MASLLPLRRAPTSLLSSTSKQSTLLVRSLRASTTIPSTRTFTTRS
FT                   STLLPNTITKRTTITPISRPHHHLLISSTSIRQKSTKDNDAPTFRQWGFEDINASLPNS
FT                   PTEKPIILIDVREPAELSSTGIIPSAVSVPLASQPDALFLTPEEFETRFGFPKPGVKGD
FT                   EEGAEIVFYCKAGVRARAAAQLAEQAGYEASRLGVYDGSWLDWAKKGGRVERWEGNDN"
FT   mRNA            join(<209258..209545,209601..>209978)
FT                   /locus_tag="An01g02830"
FT   exon            209258..209545
FT                   /locus_tag="An01g02830"
FT                   /number=1
FT   intron          209546..209600
FT                   /locus_tag="An01g02830"
FT                   /number=1
FT   exon            209601..209978
FT                   /locus_tag="An01g02830"
FT                   /number=2
FT   CDS_pept        complement(join(210632..210875,210930..213412,
FT                   213490..213948))
FT                   /locus_tag="An01g02840"
FT                   /note="Function: IF2 is a translation factor that catalyzes
FT                   the binding of initiator methionyl-tRNA to the ribosomal P
FT                   site."
FT                   /note="Title: strong similarity to translation initiation
FT                   factor IF2 - Homo sapiens"
FT                   /note="See PMID 10200264"
FT                   /db_xref="GOA:A2Q827"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q827"
FT                   /inference="profile:COGS:COG0481"
FT                   /inference="profile:COGS:COG0532"
FT                   /inference="profile:PFAM:PF00009"
FT                   /inference="similar to AA sequence:UniProtKB:HSA6776.1"
FT                   /protein_id="CAK43650.1"
FT                   /translation="MAPKKKGNKRQEEDWEAELGESAPAAGGEAEAPAAEEGAPADEDA
FT                   GMGGGGLLAALRKNKNKKAKKGKPVNDFVEGEDATQEANGDADFASKQPEEGTFDEDDV
FT                   FAGKAKPKKAAAAPEPKPAEEEEGGFRVKSKKEKEREKKEREKQRKREQAAKKKTAAPA
FT                   EKAQPAKAEPEKKAEAAPAPAAAPVPETGGKKKKIPAHLLAIQKQQEALRQQREEEERL
FT                   LAEAQAAEEERRRIEEEEEKKREEARQRKKEKEKEKKEQLRKEGKLLTKAQREAKERNE
FT                   RRMQQMLAAGVGKVAGLEEGQAEKKRPVYENRKKRGPKKQEDDLEAAAARAKAQREAEE
FT                   ERRRKEEEEKKAKAEAEAAAAAGGEESELDDWEKAADAEEVKDSWDAPSDEEEEKPATN
FT                   GKAAEKPASKEDEEDESEDDSDETSDEDSEDEEQSAAQKAIAQRKAEAAERRKKQHEEA
FT                   MAARSKDNLRSPICCILGHVDTGKTKLLDKIRQTNVQEGEAGGITQQIGATYFPVDALR
FT                   QKTAVVNKDGQFEFKIPGLLIIDTPGHESFSNLRSRGSSLCNIAILVVDIMHGLEPQTL
FT                   ESMRLLRDRRTPFIVALNKIDRLYGWKKIDNNGFQESLALQNKGVQNEFRTRLERTKLL
FT                   FAEQGFNSELFYENKSMARNVSLVPTSAHTGEGIPDMLKLLTTLTQERMTNSLMYLSEV
FT                   ECTVLEVKVIEGLGTTIDVVLSNGILREGDRIVLCGLNGPISTNIRALLTPAPLKELRL
FT                   KSQYVHNKEVKAALGVKIAANDLEQAIAGSRLMVVGPDDDEEDIEEEVMSDLENLLSKV
FT                   SRDQRGVSVQASTLGSLEALLEFLRVSKIPVANISIGPVYKRDVMMAGTMLEKAKEYAV
FT                   MLCFDVKVDKEAAAYADEVGVKIFTADIIYHLFDDFTKHMAELTERRKEESKMLAVFPC
FT                   VLKTVAVFNKKDPIVIGVDVAEGSLRLHTPVAAVKANPETGAKEIIDLGRVVSIERDHK
FT                   PIQVCKRGQPSVAVKIEGSNQPMYGRQLEDKDTLYSHISRASIDTLKEFYRSDVSMEEW
FT                   GLVKKLKPVFDIP"
FT   mRNA            complement(join(<210632..210875,210930..213412,
FT                   213490..>213948))
FT                   /locus_tag="An01g02840"
FT   exon            complement(210632..210875)
FT                   /locus_tag="An01g02840"
FT                   /number=1
FT   intron          complement(210876..210929)
FT                   /locus_tag="An01g02840"
FT                   /number=1
FT   exon            complement(210930..213412)
FT                   /locus_tag="An01g02840"
FT                   /number=2
FT   intron          complement(213413..213489)
FT                   /locus_tag="An01g02840"
FT                   /number=2
FT   exon            complement(213490..213948)
FT                   /locus_tag="An01g02840"
FT                   /number=3
FT   CDS_pept        complement(join(214577..216019,216070..216236,
FT                   216300..217854,217914..218028,218083..218639))
FT                   /locus_tag="An01g02850"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q828"
FT                   /db_xref="InterPro:IPR004871"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q828"
FT                   /protein_id="CAK43651.1"
FT                   /translation="MATSGSGAGLAVTTSATGDSMDIETENIYSASQAKIGLLSHTLVS
FT                   SPIIQWILPAHLRSKDQNDVVFVGERHLQIKEAVSGVHLEEVTTKSDFDSCIMAAKVVN
FT                   VSTELPWEEEMKLGASNSTLRANSDLRQDLPPQILVLSLASKELVFLYFSNASGHFVYH
FT                   RRPLPNDVSAFERFGRNIAVEPRSRAVAVSASSDYFGIFVLKRPPVIQAQMTQNRLDPI
FT                   AEERFFRVEGDIIAMEFLYPKSEDGDKITLLLLVAQDQLTQAVCYEWDANESLRQATPR
FT                   VTKKVLPLEDRLPTMLIPLTKTSSFMLVTTTSITVYQNKLDPQRLPSRYPLPVYEKESQ
FT                   KSPLWTRWARPLRNWLYNQKHDDIYLCREDGEITYLGIGTDGELENQAHLGQLCCDVDA
FT                   AFDILDIGYEGGDLLLAAGTTGDGGLFVQKARDHPRCVQKFMNWTPVTDSVVVKSEDTT
FT                   PSDIASDRLFVCSASSFSRGAVVELRHGVEAQIGLIVALEELSGTRDIWTMPDGSTGGV
FT                   FVLTSDPMSSLLLYLPADFGEELCAIDEAESGLDSSTQTLAAGCTVSGAIIQVTDRTVC
FT                   VGATPEMPGYRSEVGPGQTIVVAAVDGPASLIAAVVRTQDEVRLHFKKLTSDGQHQLLD
FT                   VATPSLIQHEPICMIMENLDSSLFLFVGTSNGRILVYRLSESISFLLEATVNVENENDI
FT                   SRAIDSIAIIKNAGEESLKMCTVLCGLRSGILVPFGLLLDRESIDSPIALTQVAPQHLG
FT                   HTSVKVQGKGEFALLTCGQGFWQASCTGRLADYSLQRIWVTDQNNPAYHPKSIHSFSIS
FT                   SSGSQDMDGFSNTLFCVADGQLMICTLEQGTKTVPRRIDLPGSASRLAYSRYLKSLIVV
FT                   YSQTEYDTDADPIKRYTRPFIEFIDPDMQNSLIDSLENPLEDDPRPWRPQGAAGEKISC
FT                   ILEWTPRKGDEEYHFIVIGTSRKHQQERGRVIFLQAYRDPSKPSRIECSVKYIHKFEGP
FT                   VFAIAPYGAFTLMVSTGHEIVPLEPKFSQTRWVRAARYSVLSPAVLITAREPYLYMTTS
FT                   RESLMVLKATEDKLTLHAYDRQKHDGLAHVYIGGKLNLVLCSSRGGRVSLLTENGVTET
FT                   NKMLPTALCEAHLPSSVMRLSSGSDKSPLSTTSQVFYGTAMNGTVYRFLTIGEKEWRLL
FT                   RLLQDLCIRDPMICPFIPKRRRQRNPVGLMDPQPSQMHIDGDVLSRLLIRGPGYLMQML
FT                   SKETLGGPAAPGIRPEQGVPEHFAELTRHALGETSDAVASVMRWLQRILPVDV"
FT   mRNA            complement(join(<214577..216019,216070..216236,
FT                   216300..217854,217914..218028,218083..>218639))
FT                   /locus_tag="An01g02850"
FT   exon            complement(214577..216019)
FT                   /locus_tag="An01g02850"
FT                   /number=1
FT   mat_peptide     complement(join(214580..216019,216070..216236,
FT                   216300..217854,217914..218028,218083..218585))
FT                   /locus_tag="An01g02850"
FT                   /product="hypothetical protein"
FT   intron          complement(216020..216069)
FT                   /locus_tag="An01g02850"
FT                   /number=1
FT   exon            complement(216070..216236)
FT                   /locus_tag="An01g02850"
FT                   /number=2
FT   intron          complement(216237..216299)
FT                   /locus_tag="An01g02850"
FT                   /number=2
FT   exon            complement(216300..217854)
FT                   /locus_tag="An01g02850"
FT                   /number=3
FT   intron          complement(217855..217913)
FT                   /locus_tag="An01g02850"
FT                   /number=3
FT   exon            complement(217914..218028)
FT                   /locus_tag="An01g02850"
FT                   /number=4
FT   intron          complement(218029..218082)
FT                   /locus_tag="An01g02850"
FT                   /number=4
FT   exon            complement(218083..218639)
FT                   /locus_tag="An01g02850"
FT                   /number=5
FT   sig_peptide     complement(218586..218639)
FT                   /locus_tag="An01g02850"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        join(219989..220238,220288..220419,220466..221352)
FT                   /locus_tag="An01g02860"
FT                   /note="Title: similarity to hypothetical protein
FT                   SPBC651.03c - Schizosaccharomyces pombe"
FT                   /db_xref="GOA:A2Q829"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q829"
FT                   /inference="profile:COGS:COG5210"
FT                   /inference="profile:PFAM:PF00566"
FT                   /inference="similar to AA sequence:PIR:T40602"
FT                   /protein_id="CAK43652.1"
FT                   /translation="MDQPSENNEPDHITETSLETEQKTAAEAEALESERLKNAELERRR
FT                   AEKEKAIRQACDLRDFDALVSYATSEGGFLNDDVRRTAWPILLQCDRRGPNFDFAGWEQ
FT                   LPAHSDEEQVQLDVNRSFVYYPECSDQELSIKKDELSKLIKQVLRCFPMLCYFQGYHDI
FT                   VQVLLLVLGGQNSAAAVAQISLLRIRDYMLPSLSPALKHLELIPAIIEKADPALRRHLA
FT                   ETKPFFALAATLTMYSHDIQEYSDIARLFDFLLAQEPVVSIYLFAAIILSRKKELLEFS
FT                   VDETDMLHFTLSKLPNPLDLEGLISRAMQLFEAHPPESLPFGAWKRIPECSVLKSSRDL
FT                   VRIQAPDETVGLFAKQVRHLRYEERKEKTVAFLWNHRRTIGSVAVTIFIGAMSFWIKKR
FT                   GFDNTIWSYVSRFHGALQARGYI"
FT   mRNA            join(<219989..220238,220288..220419,220466..>221352)
FT                   /locus_tag="An01g02860"
FT   exon            219989..220238
FT                   /locus_tag="An01g02860"
FT                   /number=1
FT   intron          220239..220287
FT                   /locus_tag="An01g02860"
FT                   /number=1
FT   exon            220288..220419
FT                   /locus_tag="An01g02860"
FT                   /number=2
FT   intron          220420..220465
FT                   /locus_tag="An01g02860"
FT                   /number=2
FT   exon            220466..221352
FT                   /locus_tag="An01g02860"
FT                   /number=3
FT   CDS_pept        join(221584..221745,221804..221855,221924..222629,
FT                   222711..222801)
FT                   /locus_tag="An01g02870"
FT                   /note="Title: similarity to hypothetical protein SPAC227.06
FT                   - Schizosaccharomyces pombe"
FT                   /db_xref="GOA:A2Q830"
FT                   /db_xref="InterPro:IPR006977"
FT                   /db_xref="InterPro:IPR039765"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q830"
FT                   /inference="profile:PFAM:PF04893"
FT                   /inference="similar to AA sequence:PIR:T50162"
FT                   /protein_id="CAK43653.1"
FT                   /translation="MVASAWLSRQPLRCTLAFPHLPGTESSTTTFENERELPKMANQGY
FT                   DVVVDVDAEGDLGHTDLQEDLEFHRSNFENDQRNAKAQQDSAPFLGGGSSRGRDRSPGG
FT                   TPSKLNWWSIHYYSQFFDVDTNEVLRRCVAALYPRSNFLDVLEGNPDLYGPFWIATTVV
FT                   VILFLTGTISQWLSNNDDEHFEYDFTLLSGAAGLVYGYTGIIPIALWGALKWFGSSSAD
FT                   LVESWALYGYSNLVWIAVALVSWSPLTALNWALVGVGFGWTVFFLLRNLYPVLSATDAK
FT                   ASKILLILVIVLHAGFALAIKILFFAHGSPVSKKNKDHDDDDDHDDDKRRMFGGW"
FT   mRNA            join(<221584..221745,221804..221855,221924..222629,
FT                   222711..>222801)
FT                   /locus_tag="An01g02870"
FT   exon            221584..221745
FT                   /locus_tag="An01g02870"
FT                   /number=1
FT   sig_peptide     221584..221661
FT                   /locus_tag="An01g02870"
FT                   /inference="protein motif:SignalP:2.0"
FT   mat_peptide     join(221662..221745,221804..221855,221924..222629,
FT                   222711..222798)
FT                   /locus_tag="An01g02870"
FT   intron          221746..221803
FT                   /locus_tag="An01g02870"
FT                   /number=1
FT   exon            221804..221855
FT                   /locus_tag="An01g02870"
FT                   /number=2
FT   intron          221856..221923
FT                   /locus_tag="An01g02870"
FT                   /number=2
FT   exon            221924..222629
FT                   /locus_tag="An01g02870"
FT                   /number=3
FT   intron          222630..222710
FT                   /locus_tag="An01g02870"
FT                   /number=3
FT   exon            222711..222801
FT                   /locus_tag="An01g02870"
FT                   /number=4
FT   CDS_pept        complement(join(223256..223342,223452..223562,
FT                   223798..223978,224102..224108,224196..224196))
FT                   /exception="reasons given in citation"
FT                   /locus_tag="An01g02880"
FT                   /note="Title: strong similarity to cytoplasmic ubiquitin /
FT                   ribosomal fusion protein Cep52 - Saccharomyces cerevisiae
FT                   [putative frameshift]"
FT                   /note="cytoplasm"
FT                   /note="putative frameshift"
FT                   /db_xref="GOA:A2Q831"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR001975"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR038587"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q831"
FT                   /inference="profile:COGS:COG5272"
FT                   /inference="profile:PFAM:PF00240"
FT                   /inference="profile:PFAM:PF01020"
FT                   /inference="similar to AA sequence:PIR:A29456"
FT                   /protein_id="CAK43654.1"
FT                   /translation="MQIFVKTLTGKTITLDVESSDTIDNVKTKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSICRKCYARLP
FT                   PRATNCRKKKCGHTNQLRPKKKLK"
FT   mRNA            complement(join(<223256..223342,223452..223562,
FT                   223798..223978,224102..224108,224196..>224196))
FT                   /locus_tag="An01g02880"
FT   exon            complement(223256..223342)
FT                   /locus_tag="An01g02880"
FT                   /number=1
FT   intron          complement(223343..223451)
FT                   /locus_tag="An01g02880"
FT                   /number=1
FT   exon            complement(223452..223562)
FT                   /locus_tag="An01g02880"
FT                   /number=2
FT   intron          complement(223563..223797)
FT                   /locus_tag="An01g02880"
FT                   /number=2
FT   exon            complement(223798..223978)
FT                   /locus_tag="An01g02880"
FT                   /number=3
FT   intron          complement(223979..224101)
FT                   /locus_tag="An01g02880"
FT                   /number=3
FT   exon            complement(224102..224108)
FT                   /locus_tag="An01g02880"
FT                   /number=4
FT   intron          complement(224109..224195)
FT                   /locus_tag="An01g02880"
FT                   /number=4
FT   exon            complement(224196..224196)
FT                   /locus_tag="An01g02880"
FT                   /number=5
FT   CDS_pept        complement(join(224265..224372,224408..224489,
FT                   224549..224579,224695..225111,225162..225548,
FT                   225599..225737,225791..225896,225953..226197,
FT                   226414..226416))
FT                   /locus_tag="An01g02890"
FT                   /note="Complex: forms a complex with the other RRN proteins
FT                   RRN6 and RRN11."
FT                   /note="Function: involved in the transcription of 35S rRNA
FT                   genes by the core domain of RNA polymerase I."
FT                   /note="Title: similarity to protein Rrn7 - Saccharomyces
FT                   cerevisiae"
FT                   /note="See PMID 7958901"
FT                   /note="See PMID 8887672"
FT                   /db_xref="GOA:A2Q832"
FT                   /db_xref="InterPro:IPR033599"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q832"
FT                   /inference="similar to AA sequence:PIR:S50785"
FT                   /protein_id="CAK43655.1"
FT                   /translation="MPVVRDLWALRLETYAEKINDPSEQDEEPEFFSSQVTSGLDGAED
FT                   IKFRGRQATWPRLIDSIALCYLGALLMRLPVGVGDFYRMVMRGEVPFIRIVKDIPREMR
FT                   DRLPQEFISILETTRLLQAEHLHGAVSDLLLLYHGKFNMQFPSLNWPVLLYKYVKRLAL
FT                   PLDIYPAAKKLQHLLGFNFEFPTSISGRRRPLQLPELQLVALVVISTKLLFPFDDVERY
FT                   PTNIEEPTVQVIDWSLWSQIQRHFDNRETPAGQLGKGKEILVTERDVFSMTPSQLDEYM
FT                   DWYENNWLDASKVSNPLAELFPTGPSAGESQATAPTPELTDEEALDELVKASTSQLRAR
FT                   QVIAKDDLDTPRPGCSYTRYRTESDLPDTARAFYETAAKVVGVSISTLIRAVSQAENQI
FT                   NRWLEEQRRVEYFGSMGMEFSQESSTDSDNDEEKTSEIVSHIWSSVRSSIMKAQSQHGP
FT                   RTTDHGPRTASNLGYGLWRLRRGPERGRTALNPDHVRSVPPLLSEKS"
FT   mRNA            complement(join(<224265..224372,224408..224489,
FT                   224549..224579,224695..225111,225162..225548,
FT                   225599..225737,225791..225896,225953..226197,
FT                   226414..>226416))
FT                   /locus_tag="An01g02890"
FT   exon            complement(224265..224372)
FT                   /locus_tag="An01g02890"
FT                   /number=1
FT   intron          complement(224373..224407)
FT                   /locus_tag="An01g02890"
FT                   /number=1
FT   exon            complement(224408..224489)
FT                   /locus_tag="An01g02890"
FT                   /number=2
FT   intron          complement(224490..224548)
FT                   /locus_tag="An01g02890"
FT                   /number=2
FT   exon            complement(224549..224579)
FT                   /locus_tag="An01g02890"
FT                   /number=3
FT   intron          complement(224580..224694)
FT                   /locus_tag="An01g02890"
FT                   /number=3
FT   exon            complement(224695..225111)
FT                   /locus_tag="An01g02890"
FT                   /number=4
FT   intron          complement(225112..225161)
FT                   /locus_tag="An01g02890"
FT                   /number=4
FT   exon            complement(225162..225548)
FT                   /locus_tag="An01g02890"
FT                   /number=5
FT   intron          complement(225549..225598)
FT                   /locus_tag="An01g02890"
FT                   /number=5
FT   exon            complement(225599..225737)
FT                   /locus_tag="An01g02890"
FT                   /number=6
FT   intron          complement(225738..225790)
FT                   /locus_tag="An01g02890"
FT                   /number=6
FT   exon            complement(225791..225896)
FT                   /locus_tag="An01g02890"
FT                   /number=7
FT   intron          complement(225897..225952)
FT                   /locus_tag="An01g02890"
FT                   /number=7
FT   exon            complement(225953..226197)
FT                   /locus_tag="An01g02890"
FT                   /number=8
FT   intron          complement(226198..226413)
FT                   /locus_tag="An01g02890"
FT                   /number=8
FT   exon            complement(226414..226416)
FT                   /locus_tag="An01g02890"
FT                   /number=9
FT   CDS_pept        complement(join(227340..227410,227479..227611,
FT                   227670..227936,228162..228173))
FT                   /locus_tag="An01g02900"
FT                   /note="Function: Translation intitiation factor eIF-5A
FT                   (previously named eIF-4D) is a highly conserved protein
FT                   that promotes formation of the first peptide bond. One of
FT                   its lysine residues is posttranslationally modified by
FT                   spermidine to form hypusine. eIF-5a is essential for cell
FT                   growth in yeast cells."
FT                   /note="Title: strong similarity to translation initiation
FT                   factor Eif-5a.2 - Saccharomyces cerevisiae"
FT                   /note="See PMID 1903841"
FT                   /db_xref="GOA:A2Q833"
FT                   /db_xref="InterPro:IPR001884"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR019769"
FT                   /db_xref="InterPro:IPR020189"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q833"
FT                   /inference="profile:COGS:COG0231"
FT                   /inference="profile:PFAM:PF01287"
FT                   /inference="similar to AA sequence:PIR:FIBYA2"
FT                   /protein_id="CAK43656.1"
FT                   /translation="MADEHHETFESADAGASATFPMQCSALRKNGHVVIKGRPCKIVEM
FT                   STSKTGKHGHAKVHIVAIDIFTGKKLEDLSPSTHNMDVPNVYRKEYQLLDVTDDDFLSL
FT                   MDENGNTKDDVKVPEGEVGDRIRRMFHDEEKDCNVTILSSMGEQVCMDVKEAPKGN"
FT   mRNA            complement(join(<227340..227410,227479..227611,
FT                   227670..227936,228162..>228173))
FT                   /locus_tag="An01g02900"
FT   exon            complement(227340..227410)
FT                   /locus_tag="An01g02900"
FT                   /number=1
FT   intron          complement(227411..227478)
FT                   /locus_tag="An01g02900"
FT                   /number=1
FT   exon            complement(227479..227611)
FT                   /locus_tag="An01g02900"
FT                   /number=2
FT   intron          complement(227612..227669)
FT                   /locus_tag="An01g02900"
FT                   /number=2
FT   exon            complement(227670..227936)
FT                   /locus_tag="An01g02900"
FT                   /number=3
FT   intron          complement(227937..228161)
FT                   /locus_tag="An01g02900"
FT                   /number=3
FT   exon            complement(228162..228173)
FT                   /locus_tag="An01g02900"
FT                   /number=4
FT   CDS_pept        join(228681..229547,229600..229894,229949..230769)
FT                   /locus_tag="An01g02910"
FT                   /note="Title: strong similarity to hypothetical ARE1-like
FT                   protein F3I17.5 - Arabidopsis thaliana"
FT                   /db_xref="GOA:A2Q834"
FT                   /db_xref="InterPro:IPR007258"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q834"
FT                   /inference="profile:PFAM:PF04129"
FT                   /inference="similar to AA sequence:PIR:G96737"
FT                   /protein_id="CAK43657.1"
FT                   /translation="MWLDRISGHATPSGPQFDSRSSSPLPRRTSSRLAPTPQNNRPASS
FT                   RQGSALSLLSTPNDSSTSLSAPARGEGSSPKPSATRPRPSDVADPLEVLNGIIGKQGKT
FT                   RDSSPASVAELKPPELVEDIDFHGLSLEDFIAEEDQPRRAWQSDVGAQTIQQFEKERDK
FT                   FQDLHSAITGCDDVSKSVEMYLNDFQNELGAVSAEIESLQSRSIQLNAMLENRRNVEQL
FT                   LGPAVEEISLSPKTVRLVAEGPIDENWVKALNEIETRTASIEAKASGTNSSKSIEDVRP
FT                   LLGDIKKKAVERIRDYLVSQIRALRSPNINAQIIQQQRLVKFKDLYGYISRAHPTLTGE
FT                   ITQAYINTMRWYYLSHFTRYHQALEKIKVYPSDRNEVLGGDPTSHKTGNIVPGGRAGSA
FT                   AHDPFSLGRRVDILRAGNQMAISSYLAEEDNAFHGLEIPFRNFNLALLDNVSAEYSFMT
FT                   EMFSTLGFQQISRKAVEIFEPVFTLGQTLTKHLIEQTTDALGVLICVRLNQQAAFELQR
FT                   RKVPVADSYVNGTNMQLWPRFQVIMDTQCESLKRVAANTGRSAVSALSLAGGDDLNKSS
FT                   APHFLTQRFGQLLHGILVLSSEAGDDEPVSNSLGRLTTEFDNLLTKLSRIGGDAKRRER
FT                   FLYNNYSLVLAIISVSRSIRRGYWC"
FT   mRNA            join(<228681..229547,229600..229894,229949..>230769)
FT                   /locus_tag="An01g02910"
FT   exon            228681..229547
FT                   /locus_tag="An01g02910"
FT                   /number=1
FT   intron          229548..229599
FT                   /locus_tag="An01g02910"
FT                   /number=1
FT   exon            229600..229894
FT                   /locus_tag="An01g02910"
FT                   /number=2
FT   intron          229895..229948
FT                   /locus_tag="An01g02910"
FT                   /number=2
FT   exon            229949..230769
FT                   /locus_tag="An01g02910"
FT                   /number=3
FT   CDS_pept        join(231177..231392,231472..231597,231674..232663)
FT                   /locus_tag="An01g02920"
FT                   /note="Title: similarity to hypothetical protein PA5145
FT                   -Pseudomonas aeruginosa"
FT                   /db_xref="GOA:A2Q835"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q835"
FT                   /inference="profile:COGS:COG0579"
FT                   /protein_id="CAK43658.1"
FT                   /translation="MPTPPGVGNNHLSASPHPNNAPPYNAGIVTTIPLSHPVSMATRIL
FT                   RSLPNSRLLSRRAFSSTAASKADVTHAVIGAGVVGLAVARQLAMKEGTSTILLERHEAP
FT                   GTETSSRNSEVIHAGLYYGTDTLKTTLCIKGKELLYALCAQHNIPHRNTKKWIVAQTPE
FT                   QWEACLRVHEHAKRIGVPTRILGQDEARRREPEVRALAGIVESPTTGIIDSHSLMTYLQ
FT                   GDFEDRGGDCAFMTKVTGIEPVAASEGGGYRISAVSADGSETTITAETVINSAGNGACA
FT                   INNMVLPAERHRKAYFAKGTYFSYSASTPKTSVLVYPATLPGTGGLGTHLTLDMGGRIR
FT                   FGPDVEWVEDPNDLKPSPTRLQQALPEIRAYLPNVDVEAIDLDYCGIRPKLGKGGAVNT
FT                   GKGFHDFVIQEEEGFPGFVNLLGIESPGLTSCLAIGERVRDILY"
FT   mRNA            join(<231177..231392,231472..231597,231674..>232663)
FT                   /locus_tag="An01g02920"
FT   exon            231177..231392
FT                   /locus_tag="An01g02920"
FT                   /number=1
FT   intron          231393..231471
FT                   /locus_tag="An01g02920"
FT                   /number=1
FT   exon            231472..231597
FT                   /locus_tag="An01g02920"
FT                   /number=2
FT   intron          231598..231673
FT                   /locus_tag="An01g02920"
FT                   /number=2
FT   exon            231674..232663
FT                   /locus_tag="An01g02920"
FT                   /number=3
FT   exon            233505..234287
FT                   /locus_tag="An01g02930"
FT                   /number=1
FT   CDS_pept        233505..234287
FT                   /locus_tag="An01g02930"
FT                   /note="Title: similarity to hypothetical protein encoded by
FT                   An12g09280 - Aspergillus niger"
FT                   /db_xref="GOA:A2Q836"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q836"
FT                   /protein_id="CAK43659.1"
FT                   /translation="MTTHLQQPHHHNFHPHTSSYNPYHPYTIPNHAQTKKQRSRPHRRQ
FT                   RQHHPSTKPPNPSALKTPSSPSPSKSNRCFTWLLLPPASNTHIAKNRSSFSSYRRAPCK
FT                   IANQRVLGVGTVQLRVQRAPDDPRTNTLVLHDVLHMPNARCNGISVAKYTGESEEETAS
FT                   EGGSSAGERAVVEEVENGGLVKVKSEREDGEGLWFARGRSRGGQGKGEGGDDGLRVVLA
FT                   GEKEMEKDDGAGKGIMGVVASKEELEMLNERVKNRSWV"
FT   mRNA            <233505..>234287
FT                   /locus_tag="An01g02930"
FT   CDS_pept        complement(join(234397..235438,235483..235607,
FT                   235655..235705,235751..235873,235920..236991,
FT                   237059..237113,237162..237237))
FT                   /locus_tag="An01g02940"
FT                   /note="Remark: the similarity is restricted to the
FT                   C2H2-type zinc finger motif."
FT                   /note="Title: weak similarity to regulator protein Mhy1
FT                   -Yarrowia lipolytica"
FT                   /db_xref="GOA:A2Q837"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q837"
FT                   /inference="profile:COGS:COG5048"
FT                   /inference="profile:PFAM:PF00096"
FT                   /protein_id="CAK43660.1"
FT                   /translation="MVLRKCTICDRRFKKTEHFKRHERSHTKEKPYECNVCHKRFSRSD
FT                   VLSRHARGHNQPAANAAVRPGAGLPATPTNQAPADRSSTMTADTQNYVLGIGAESARPL
FT                   QHGSSAPHNSAFSAALDQQSTSLDFLANVSAHQPRTEPIANQVMASEHQEYLGWNDVPV
FT                   PDQQCYRGTMLDPLHNDILQFWLEPQGDSISQQGSIDLGGNSNLGMLGGAVASSESRPS
FT                   IGSMSLSSGGSIPIERFARVQRYWLAPSNNTGRLMNSLWHDIAYSEEDNVFALRPTHSS
FT                   SGPSGYMQGSRYGVDEECRQRLYTIFSQSRGQFQMRSSESTAVSPFTQPPRNNSNFPPA
FT                   EILDMALDLFFRDFHPLVPFIHVPTFSAKDARPSLLYAMCLIGMVLLGTKGTLNFVVNN
FT                   FSSMLESVTADLSKCSVGVEGSLSTVSTFAAAFLFLNLAAMTGEKEHLVKCQMLYVNLI
FT                   SIAQRHGLFAAREGQVLGANLFDAIPNTETRWKAWSKVESVKRLITGLLLLDSWYSSFM
FT                   STSPIIVPDSVQMILPCEEALFRATSSTRWMQLSDSDKVRLMPTILMPSENVDVPTLHS
FT                   PVDDFCMYAVLAMVQSRLSEAYYRLLSNRASYPFAPCNTYAMDGRARCLPSLQLQLTSK
FT                   YGDVLDRLNPNAAVMWHNMCMTLTADTQIFDMAAGRSGPGPARKALDDIAAWSQTPAAR
FT                   RACLHAAHIYRAMTNRRASDHTMFHSVFSLFYAALVLGLYVFMVPNPSEMQRGGNSIEL
FT                   FDDIDWQKVGTEGFTSFMEPRKGQPFPPSEEPALEFIKNGGTVYLRGVPIQGGYQAARR
FT                   ILLDYAGLLKDTGKWSVRKFSYVLHIMSDVLMDVE"
FT   mRNA            complement(join(<234397..235438,235483..235607,
FT                   235655..235705,235751..235873,235920..236991,
FT                   237059..237113,237162..>237237))
FT                   /locus_tag="An01g02940"
FT   exon            complement(234397..235438)
FT                   /locus_tag="An01g02940"
FT                   /number=1
FT   intron          complement(235439..235482)
FT                   /locus_tag="An01g02940"
FT                   /number=1
FT   exon            complement(235483..235607)
FT                   /locus_tag="An01g02940"
FT                   /number=2
FT   intron          complement(235608..235654)
FT                   /locus_tag="An01g02940"
FT                   /number=2
FT   exon            complement(235655..235705)
FT                   /locus_tag="An01g02940"
FT                   /number=3
FT   intron          complement(235706..235750)
FT                   /locus_tag="An01g02940"
FT                   /number=3
FT   exon            complement(235751..235873)
FT                   /locus_tag="An01g02940"
FT                   /number=4
FT   intron          complement(235874..235919)
FT                   /locus_tag="An01g02940"
FT                   /number=4
FT   exon            complement(235920..236991)
FT                   /locus_tag="An01g02940"
FT                   /number=5
FT   intron          complement(236992..237058)
FT                   /locus_tag="An01g02940"
FT                   /number=5
FT   exon            complement(237059..237113)
FT                   /locus_tag="An01g02940"
FT                   /number=6
FT   intron          complement(237114..237161)
FT                   /locus_tag="An01g02940"
FT                   /number=6
FT   exon            complement(237162..237237)
FT                   /locus_tag="An01g02940"
FT                   /number=7
FT   CDS_pept        complement(join(239265..241561,241623..242285,
FT                   242334..242985,243061..243563,243631..244627))
FT                   /locus_tag="An01g02950"
FT                   /note="Title: similarity to hypothetical protein CAD21096.1
FT                   - Neurospora crassa"
FT                   /db_xref="GOA:A2Q838"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q838"
FT                   /inference="profile:COGS:COG0775"
FT                   /protein_id="CAK43661.1"
FT                   /translation="MMPTSPSKRDMRAHPHQNRKVPPRHDEYNVGWICVLPIEMAVAKL
FT                   MLDEIHPPLPMPPNDPNTYILGRVGDHNVVIACLPAGTYGSTTSVALERQVSSSFPAIR
FT                   FYLSVGIGGGIPSSKADIRLGDVVVSQPIGKSGGLIRYDLGKVLSWDESSHQVPEFLST
FT                   ALAALQVNHNLSGRMGGHVASYLSDMQEKLPPAAAEKFARPEEDFLFQPEYEHIGFDSC
FT                   ADCDRSKLILRRDREHEEPVIHYGSIASGPQVMKNGQLRDRIGQELGVLCFELEAAGLL
FT                   DNLPCLAIRGISDYADSHKNTAWQGYAAAAAAAYAKELLLVVPALEKKIHTASFSVRAM
FT                   SPSNQARSTDASGYSNPTPGWSRQKESTFNAPPTDSGYASTTHQKVLRGEEYRTEYVHD
FT                   VQSIVSGEERFSSPPAAASPRKAEDYSEDTESIYTARSGISPSDKESYISELVNDLFRK
FT                   VQYDQDAQNLPERIHGILPQLLKAFAMRFGQFGSTQIHRDIMYPDSEIANGLRVKYLED
FT                   QTETHVSRQDDTKMELGDLMDLWDQNLEDADDDLAIPQFDSGAENSDSDEDILIEDDEN
FT                   LPEYATYRKLITGSPVYEWLLRSLRRKLQLHPAEPNVQDAIRDRILKTLPSSRRVSRYD
FT                   QPTVYQVVYLLKWDPVSFIAEQEYDISKEGFLGKIITITGTSQDAQAMTCLQYLHQTWH
FT                   SYGANILQLVEAALVDERGYEHRCTLPDNTQLAAWANEKEFLVEVTGIEGSIAEIGEQL
FT                   AWLGSVLRCSPHDSRISYCTPFVSNTSVEEASIPTSQTPTLTRVSCTIDFKVDDQEQAN
FT                   SPPSLGQCWHDLFRYPTVAMGFPIPYRSREQTGLEIPLNILAGLAQAEQVDIFSDKLFI
FT                   KGFSSLLIPTKYIRDQDQMIWHLRYNVHGDRISYLDGIEAHVGHITLADLESSRHILGW
FT                   CSDAKCYAGTADASYSINRSWLRPPSSRCSLNNTFIAAGRLITGGDPAIYGNKDLPYRL
FT                   IRDEYIEKLSWIARQYVVMWDAGGKRGWLVNGACALLHLLIASLHFNRTGPLGFAFHLT
FT                   PTDIKVPENTITPSSAMEVLLNPDNLCLTLYHAKQSEPNEATLPTVQIKDRVDRLYSML
FT                   EKIMDHQAEIMGTEGAASRKMARGILEGWDFKDLATQEDPLYPRFCKLGTRGKSWVELT
FT                   RDVRAAVLFGTGFGEILRPVDNGQLCPYWSRMPEGKSYLAVSGYDLANIIDRFGNPHSS
FT                   PVRLTRNLIWCNCLGNGPPACKCIGCPEQTVHSELAQVVLPSHFRKRIPKHNAVRPSGW
FT                   SHGAILFGYNRDLRWTWNDTGFPEQEDVLSCSDDDSGSDSDDDFHDSGLGTILAPSATA
FT                   NGPGRLPLSRSPPEGITHEDYEVGIVCALSKELLAVRALFDSPHPDLEKDRNDPNCYCL
FT                   GRMKGFNVVAAGLPHDDYGTNSATNVASHLIRTFPRLKFCLVFGIGGGVPSAARDIRLG
FT                   DVVVGTGVIQGDMGKWIQNSEFKMTAQKQQPPPYLRAVITKIRSNGFISFESASNPLLD
FT                   DLSLIASMKPEYSYPGAGKDMLFDPGDVHVETEPTCDNCIGSRRPRTRQHDGPNVFYGL
FT                   IASGNQLVRDARYRDRLGQENVICVEMEAAGVMRTTTDCLVIRGICDYADSHKNDQWQE
FT                   YAAATAAAYAKFFLSHMREGVHEFAVRVPSRLEAPTGPVHLQKQKRAAPCAEYDQHMVL
FT                   KRSRWQ"
FT   mRNA            complement(join(<239265..241561,241623..242285,
FT                   242334..242985,243061..243563,243631..>244627))
FT                   /locus_tag="An01g02950"
FT   exon            complement(239265..241561)
FT                   /locus_tag="An01g02950"
FT                   /number=1
FT   intron          complement(241562..241622)
FT                   /locus_tag="An01g02950"
FT                   /number=1
FT   exon            complement(241623..242285)
FT                   /locus_tag="An01g02950"
FT                   /number=2
FT   intron          complement(242286..242333)
FT                   /locus_tag="An01g02950"
FT                   /number=2
FT   exon            complement(242334..242985)
FT                   /locus_tag="An01g02950"
FT                   /number=3
FT   intron          complement(242986..243060)
FT                   /locus_tag="An01g02950"
FT                   /number=3
FT   exon            complement(243061..243563)
FT                   /locus_tag="An01g02950"
FT                   /number=4
FT   intron          complement(243564..243630)
FT                   /locus_tag="An01g02950"
FT                   /number=4
FT   exon            complement(243631..244627)
FT                   /locus_tag="An01g02950"
FT                   /number=5
FT   CDS_pept        complement(join(245178..245327,245380..245498,
FT                   245549..245903,245960..246597,246651..246879))
FT                   /locus_tag="An01g02960"
FT                   /note="Catalytic activity: homogentisate + o(2) =
FT                   4-maleylacetoacetate."
FT                   /note="Pathway: The HmgA protein catalyzes an essential
FT                   step in phenylalanine catabolism."
FT                   /note="Remark: defects in homogentisate dioxygenase are the
FT                   cause of alkaptonuria, an autosomal recessive error of
FT                   metabolism which is characterized by an increase in the
FT                   level of homogentisic acid."
FT                   /note="Title: strong similarity to
FT                   3,4-dihydroxyphenylacetate 2,3-dioxygenase hmgA -
FT                   Aspergillus nidulans"
FT                   /note="See PMID 7673153"
FT                   /db_xref="GOA:A2Q839"
FT                   /db_xref="InterPro:IPR005708"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q839"
FT                   /inference="profile:COGS:COG3508"
FT                   /inference="profile:PFAM:PF04209"
FT                   /protein_id="CAK43662.1"
FT                   /translation="MTRKPTRDNDPYEYMAGFGNRFQSEVIPGTLPAGQNNPQEPRFGL
FT                   YTEGLTYSAFTAPRNANFSTYMYRVRPAAAHNGYRNDCEHKSDIENCFLTLNPKVTTFA
FT                   GQAEWAPFHLPKEDERLDFVDGLHTLGGSGDPNLREGIALYVFMINADMDHRAYCNADG
FT                   DFLIVAQLGILDLQTEMGMLFLQPGEVCVIPRGVRFTIRLGPEHNVARGYIVEIWGSRW
FT                   ELPDLGPLGGHGLANPRDFLHPVAHIDENLHEDWEIVNKANGQYSVIEQGHSPFDLVAW
FT                   HGNVIPYKYDLTKFASQNATSIDHTDPSVNCVLTAPSKDPVTPLADFLWFGPRWDVASN
FT                   TFRPPYFHRNSATEFLACLYGSGLGRSEEFLPGGGSIEVSHTPHGNFSDDYVHEMRNQV
FT                   NDPRRILENQMTIMVESSRSFLFTEYARTGCGTFKAQGPDPKVWDALPDKFSAYPNIKE
FT                   ILSQVKADKEALKKQLEAYYDDKTLAEMARGQRESLVR"
FT   mRNA            complement(join(<245178..245327,245380..245498,
FT                   245549..245903,245960..246597,246651..>246879))
FT                   /locus_tag="An01g02960"
FT   exon            complement(245178..245327)
FT                   /locus_tag="An01g02960"
FT                   /number=1
FT   intron          complement(245328..245379)
FT                   /locus_tag="An01g02960"
FT                   /number=1
FT   exon            complement(245380..245498)
FT                   /locus_tag="An01g02960"
FT                   /number=2
FT   intron          complement(245499..245548)
FT                   /locus_tag="An01g02960"
FT                   /number=2
FT   exon            complement(245549..245903)
FT                   /locus_tag="An01g02960"
FT                   /number=3
FT   intron          complement(245904..245959)
FT                   /locus_tag="An01g02960"
FT                   /number=3
FT   exon            complement(245960..246597)
FT                   /locus_tag="An01g02960"
FT                   /number=4
FT   intron          complement(246598..246650)
FT                   /locus_tag="An01g02960"
FT                   /number=4
FT   exon            complement(246651..246879)
FT                   /locus_tag="An01g02960"
FT                   /number=5
FT   exon            complement(247561..248994)
FT                   /locus_tag="An01g02970"
FT                   /number=1
FT   CDS_pept        complement(247561..248994)
FT                   /locus_tag="An01g02970"
FT                   /note="Function: PcaB confers the ability to use
FT                   4-hydroxybenzoate or protocatechuate as the only carbon
FT                   source. Hydroxyaromatics catabolism by pcaB serves both
FT                   nutritional and detoxifying purposes."
FT                   /note="Title: strong similarity to
FT                   3-carboxy-cis,cis-muconate cycloisomerase pcaB -
FT                   Bradyrhizobium japonicum"
FT                   /note="See PMID 9582432"
FT                   /db_xref="GOA:A2Q840"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q840"
FT                   /inference="profile:COGS:COG0015"
FT                   /inference="profile:PFAM:PF00206"
FT                   /inference="similar to AA sequence:UniProtKB:AP005964.17"
FT                   /protein_id="CAK43663.1"
FT                   /translation="MSASSFAQLCRITRPRISISPIVSRRYIGSVSAIDSGIFRTLFGT
FT                   EEIRKVFDDEAYIKRCMDAEAALARAQSRCDVIPSQIGEMVTRKLRESKLDMERLRYET
FT                   EIVGYPILPLVRQLSAICGDEAGKYVHWGATTQDIMDLASVLQMKEGLDIVEHHLKKVI
FT                   STLRGLSVKYKDTPMAGRTHLQHALPVTFGYKCAVWLSGFQRHLERLEQLKDRCLLVQF
FT                   GGAAGSMASLGTGDDGLRVRKALAEELGLTDPPITWHVARDGIAEITNFLALMGGSMGK
FT                   LALDIIIMSSNELGEVSEPFVPHRGASSTMPQKRNPISSEVILAASKILRSNAGLVLDG
FT                   MVADFERASGPWHLEWVAIPESFVIAVGALSQTQFALSGLCVHSQKMLENLHSTKGLIV
FT                   AEAVMMGLAPHVGRQQAHDTVYEACRESIEANQSLLECLMKKTEVTSKMSEERLSQLYD
FT                   PVNYLGASTRMVEDVLAVD"
FT   mRNA            complement(<247561..>248994)
FT                   /locus_tag="An01g02970"
FT   CDS_pept        join(249891..250019,250066..250177,250225..250298,
FT                   250343..250366,250457..250783)
FT                   /locus_tag="An01g02980"
FT                   /note="Title: similarity to hypothetical protein CG7415
FT                   -Drosophila melanogaster"
FT                   /db_xref="InterPro:IPR039461"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q841"
FT                   /inference="similar to AA sequence:UniProtKB:AE003678.41"
FT                   /protein_id="CAK43664.1"
FT                   /translation="MDLYNTCEGNWEQLATKTGVGILLLDEFLDYAARFLSNIGNYFGS
FT                   GDQKFTPDISGEALNFLASVSSSASKILEQIKPDDIAYNMYLQLGVDGLRGLENYDPTT
FT                   KILEQAHSRDVEKNSLTVKVDRSRVISHGKPSLGRMLLKLHIYRCTADVSNCRRFYENL
FT                   SIVDDEALKWRDILVSKKDPPLVFSQANTYLVGDDVKIKEYEPTAQGVVQSWAERSIE"
FT   mRNA            join(<249891..250019,250066..250177,250225..250298,
FT                   250343..250366,250457..>250783)
FT                   /locus_tag="An01g02980"
FT   exon            249891..250019
FT                   /locus_tag="An01g02980"
FT                   /number=1
FT   intron          250020..250065
FT                   /locus_tag="An01g02980"
FT                   /number=1
FT   exon            250066..250177
FT                   /locus_tag="An01g02980"
FT                   /number=2
FT   intron          250178..250224
FT                   /locus_tag="An01g02980"
FT                   /number=2
FT   exon            250225..250298
FT                   /locus_tag="An01g02980"
FT                   /number=3
FT   intron          250299..250342
FT                   /locus_tag="An01g02980"
FT                   /number=3
FT   exon            250343..250366
FT                   /locus_tag="An01g02980"
FT                   /number=4
FT   intron          250367..250456
FT                   /locus_tag="An01g02980"
FT                   /number=4
FT   exon            250457..250783
FT                   /locus_tag="An01g02980"
FT                   /number=5
FT   CDS_pept        join(251426..251791,251856..251945)
FT                   /locus_tag="An01g02990"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q842"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q842"
FT                   /protein_id="CAK43665.1"
FT                   /translation="MPYYVHLQEHVVDGMLEPIMRKYYLMTAANATAAEKFLVGLQKYA
FT                   RTPNTQMYNAKAVTLEWWNCKVSSAGTIRWIYNEMIAERPENYNYVQELTDCCDTILIS
FT                   DLEAVNWPILPVNQETSQNGLGGYGHVVVGFPILLAVACIENDQNAK"
FT   mRNA            join(<251426..251791,251856..>251945)
FT                   /locus_tag="An01g02990"
FT   exon            251426..251791
FT                   /locus_tag="An01g02990"
FT                   /number=1
FT   intron          251792..251855
FT                   /locus_tag="An01g02990"
FT                   /number=1
FT   exon            251856..251945
FT                   /locus_tag="An01g02990"
FT                   /number=2
FT   CDS_pept        join(252725..252986,253055..253249,253313..253699,
FT                   253765..254109,254172..254269,254329..254556)
FT                   /locus_tag="An01g03000"
FT                   /note="Title: strong similarity to hypothetical
FT                   succinyl-CoA:3-ketoacid-CoA transferase SCOT - Homo
FT                   sapiens"
FT                   /db_xref="GOA:A2Q843"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR014388"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q843"
FT                   /inference="profile:COGS:COG4670"
FT                   /inference="profile:PFAM:PF01144"
FT                   /inference="similar to AA sequence:SWISSPROT:SCOT.HUMAN"
FT                   /protein_id="CAK43666.1"
FT                   /translation="MSRPVPAVFRPIWRRNFSVSTAKRAIDKLCPSAQEAIKDMKGSST
FT                   LLVGGFGFAGVPTTLIDAVRDRPDIKDLTVVSNNAGMPGVGLGQLLESKQISKMIASFI
FT                   GENKVFEKMYLTGDLSLELTPQGTIAEKCAAGAAGVPAFYTPAAYGTIVQSGELPVRYN
FT                   KDGSVAIKNAPKEEREFNGKKYILEESIFGDYALVKVHKADKLGNCQFRKSMNNFNEAM
FT                   AKNAKYTIVEADHIVEVGEIDPESIHLQGIYVNKVIQSTGEKKIEKLTFAKDPNEMLQA
FT                   GSGDATARRERIVKRAAKEFKDGMYVNLGIGMPLIAPSYVEEGVEVVLQAENGILGLGG
FT                   YPKPGEEDPDLINPGKETVTLGRGASVFGSHESFGMIRSGRIDLTMLGALQVSQYGDLA
FT                   NFMLPGKVKGMGGAMDLVSNPEKTKVVVTMEHTDKKGNPKILPECSFPLTGPRCVWKII
FT                   TDLAVFEVSPTEGLTLAEYAEGVTVEEIRSKTAAPFKVSADLKPML"
FT   mRNA            join(<252725..252986,253055..253249,253313..253699,
FT                   253765..254109,254172..254269,254329..>254556)
FT                   /locus_tag="An01g03000"
FT   exon            252725..252986
FT                   /locus_tag="An01g03000"
FT                   /number=1
FT   intron          252987..253054
FT                   /locus_tag="An01g03000"
FT                   /number=1
FT   exon            253055..253249
FT                   /locus_tag="An01g03000"
FT                   /number=2
FT   intron          253250..253312
FT                   /locus_tag="An01g03000"
FT                   /number=2
FT   exon            253313..253699
FT                   /locus_tag="An01g03000"
FT                   /number=3
FT   intron          253700..253764
FT                   /locus_tag="An01g03000"
FT                   /number=3
FT   exon            253765..254109
FT                   /locus_tag="An01g03000"
FT                   /number=4
FT   intron          254110..254171
FT                   /locus_tag="An01g03000"
FT                   /number=4
FT   exon            254172..254269
FT                   /locus_tag="An01g03000"
FT                   /number=5
FT   intron          254270..254328
FT                   /locus_tag="An01g03000"
FT                   /number=5
FT   exon            254329..254556
FT                   /locus_tag="An01g03000"
FT                   /number=6
FT   exon            complement(254799..255074)
FT                   /locus_tag="An01g03010"
FT                   /number=1
FT   CDS_pept        complement(254799..255074)
FT                   /locus_tag="An01g03010"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q844"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q844"
FT                   /protein_id="CAK43667.1"
FT                   /translation="MPSKPIASPPLQPKKVHGAVRDDLPVDDYENAWAQQEEEEDEEQK
FT                   ERSGNIAYNAPNVAAARRMNTGTAPNPAEGTHKGTTGSVNRSKTGH"
FT   mRNA            complement(<254799..>255074)
FT                   /locus_tag="An01g03010"
FT   CDS_pept        complement(join(255979..256674,256705..256742,
FT                   256828..256841,256899..256933,257201..257281,
FT                   257315..257344))
FT                   /locus_tag="An01g03020"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q845"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q845"
FT                   /protein_id="CAK43668.1"
FT                   /translation="MDATTTNAYNSRVIVDPSRTGTGTAHRGSHASAKRSAWLVIPAGF
FT                   GNRSAVGITQSAVRLARTVETCINLIPLSGPAKGYIEALEHRLHETESLLLNLLAQIPD
FT                   SQLSASVQGRQDRSSRHRNSGSPPQTYSSSSSRLGKRGTDYWKRFPLHTVQDIRDWQND
FT                   CLSNDGDGSTRHSSGPEAVKRPSASQSEYQPETVSPKDQMPEFQGYRDMPTLPRIHQIE
FT                   IPNSPIDAGSSPAKVAYGSGFDGEARENRPRMDPVFEAIQYQRARAEAVHEFPGMQKPS
FT                   LWRGAPSVSFQQQFLW"
FT   mRNA            complement(join(<255979..256674,256705..256742,
FT                   256828..256841,256899..256933,257201..257281,
FT                   257315..>257344))
FT                   /locus_tag="An01g03020"
FT   exon            complement(255979..256674)
FT                   /locus_tag="An01g03020"
FT                   /number=1
FT   intron          complement(256675..256704)
FT                   /locus_tag="An01g03020"
FT                   /number=1
FT   exon            complement(256705..256742)
FT                   /locus_tag="An01g03020"
FT                   /number=2
FT   intron          complement(256743..256827)
FT                   /locus_tag="An01g03020"
FT                   /number=2
FT   exon            complement(256828..256841)
FT                   /locus_tag="An01g03020"
FT                   /number=3
FT   intron          complement(256842..256898)
FT                   /locus_tag="An01g03020"
FT                   /number=3
FT   exon            complement(256899..256933)
FT                   /locus_tag="An01g03020"
FT                   /number=4
FT   intron          complement(256934..257200)
FT                   /locus_tag="An01g03020"
FT                   /number=4
FT   exon            complement(257201..257281)
FT                   /locus_tag="An01g03020"
FT                   /number=5
FT   intron          complement(257282..257314)
FT                   /locus_tag="An01g03020"
FT                   /number=5
FT   exon            complement(257315..257344)
FT                   /locus_tag="An01g03020"
FT                   /number=6
FT   CDS_pept        join(257732..257981,258033..258871)
FT                   /locus_tag="An01g03030"
FT                   /note="Catalytic activity: multiple catalytic activities of
FT                   TDH: as tartrate dehydrogenase catalyzes the oxidation of
FT                   (R,R)-tartrate to oxaloglycolate by NAD+ and enables the
FT                   organism to grow with tartrate as the sole carbon source;
FT                   as D-malate dehydrogenase catalyzes the oxidative
FT                   decarboxylation of D-malate to pyruvate and carbon dioxide
FT                   by NAD+; as tartrate decarboxylase catalyzes the
FT                   decarboxylation of meso-tartrate to D-glycerate and carbon
FT                   dioxide."
FT                   /note="Title: strong similarity to tartrate dehydrogenase
FT                   TDH - Pseudomonas putida"
FT                   /note="See PMID 2184888"
FT                   /note="See PMID 8053675"
FT                   /db_xref="GOA:A2Q846"
FT                   /db_xref="InterPro:IPR011829"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q846"
FT                   /inference="profile:COGS:COG0473"
FT                   /inference="profile:PFAM:PF00180"
FT                   /protein_id="CAK43669.1"
FT                   /translation="MTTETTTYRIASIPGDGIGEEVVRATIEVINKLAQTLNTFNIEFT
FT                   HLPWGTEYYKQHGRYVSEGYLDTLRQFDAGLFGSVGHPDVPDHVSLWGLLLALRSPLQL
FT                   YANVRPVRTFPGTKSPLTTAVNGIDWVLVRENSEGEYCGQGGRSHTGQPWEAATEVAIF
FT                   TRVGVERIMRFAFETARSRPRRHLTVVTKSNAMRHGMVLWDEVAEEVAKDFPDVTWDKM
FT                   LVDAMTLRMISKPESLDTIVGTNLHMDILSDLAAGLAGSIGVAPSSNLDPTRKNPSLFE
FT                   PVHGSAFDIMGKGVANPVATFWSAAEMLAWLGEKDAAKKLMDCVEKVCAAGILTPDLGG
FT                   SANTQGVVDAVCKEIEQQLASS"
FT   mRNA            join(<257732..257981,258033..>258871)
FT                   /locus_tag="An01g03030"
FT   exon            257732..257981
FT                   /locus_tag="An01g03030"
FT                   /number=1
FT   intron          257982..258032
FT                   /locus_tag="An01g03030"
FT                   /number=1
FT   exon            258033..258871
FT                   /locus_tag="An01g03030"
FT                   /number=2
FT   CDS_pept        join(259367..259436,259501..261178,261301..261796)
FT                   /locus_tag="An01g03040"
FT                   /note="Similarity: the ORF shows similarity to some
FT                   transcription factors."
FT                   /note="Title: similarity to acetate regulatory DNA binding
FT                   protein facB - Aspergillus nidulans"
FT                   /db_xref="GOA:A2Q847"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q847"
FT                   /inference="profile:PFAM:PF04082"
FT                   /protein_id="CAK43670.1"
FT                   /translation="MIAGPPRENQYPGIDIHSIRNVDVQSEILDFNANFSSMLSPYPRR
FT                   QHHDPTRMEPPDLTNGPSEIGSLTAHSKDESQFVGSSSGVYFINTVRRAFSESLDPSGS
FT                   SPAQDFPQPEDTLVGSDASHKTSPVALQDDQFPCRWAYDSAVAAVLGNAPPLDTARELM
FT                   MVYFKVWHPLFPFLHGPTFLQAMEGLYSEDRQEPARNEAMADHRHVCWTTIFQCIFNLA
FT                   NSVHPEINLPLESRIESPSSMHSLLGTLTSKHDMLSLQALLACQLYLLARMSLRTASTV
FT                   GGCMLRSMLHAGLHRCPYRYKELTTHDRQLRKRIFWCAYAIDRYLSQALGLPLGVQDSD
FT                   IDVCSPNAPEIHIPGMCNRSHFVRSTSYAEQREHRSQLTSNQHLENTSPHAFSAHSSSS
FT                   AEEAQQNRRELAFASYVESGTLTGRALELFHKSITVRSVPRSSVLFLITDVHKWWNNLS
FT                   IETLQGQQQQPQPQQSSTDQPPSSSPAATTTAAFNFAPFFTVLYQHLILLINRPSLSLS
FT                   PSTPEFCSGLQTCINAAREIISALTTQQESGQSFFWPGFLSAAWMSGLVLAFACQLRQY
FT                   VLSKGAQEITKCLTILHTMSTQWDAAKHCHRALSLLSRTIHENTTTAGDPSSSPNKRRK
FT                   VVVDPHQTTFFTPINSLSTTNLNEEYARGRAGRRTPATATVATTSGLHEPTNTSSHVHL
FT                   SHEDRLFSAEGVSTTNDNNGDAVGEFDFGIVDLLEGSNFDDLADMFGQQYPSF"
FT   mRNA            join(<259367..259436,259501..261178,261301..>261796)
FT                   /locus_tag="An01g03040"
FT   exon            259367..259436
FT                   /locus_tag="An01g03040"
FT                   /number=1
FT   intron          259437..259500
FT                   /locus_tag="An01g03040"
FT                   /number=1
FT   exon            259501..261178
FT                   /locus_tag="An01g03040"
FT                   /number=2
FT   intron          261179..261300
FT                   /locus_tag="An01g03040"
FT                   /number=2
FT   exon            261301..261796
FT                   /locus_tag="An01g03040"
FT                   /number=3
FT   CDS_pept        complement(join(262656..262716,262787..264921))
FT                   /locus_tag="An01g03050"
FT                   /note="Function: The poly(A)-binding protein (PABP) is the
FT                   major mRNA-binding protein in eukaryotes, and it is
FT                   essential for viability of the yeast S. cerevisiae."
FT                   /note="Localization: The nuclear protein appears to be
FT                   derived from the cytoplasmic one by proteolytic cleavage
FT                   into 53 and 17 kd polypeptides."
FT                   /note="Remark: The proteins has four tandemly arrayed 90
FT                   amino acid regions of homology that probably represent
FT                   poly(A)-binding domains."
FT                   /note="Title: similarity to polyadenylate-binding protein
FT                   Pabp - Saccharomyces cerevisiae"
FT                   /note="See PMID 3537727"
FT                   /note="See PMID 1675426"
FT                   /db_xref="GOA:A2Q848"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR002004"
FT                   /db_xref="InterPro:IPR006515"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR036053"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2Q848"
FT                   /inference="profile:COGS:COG0724"
FT                   /inference="profile:PFAM:PF00076"
FT                   /inference="profile:PFAM:PF00658"
FT                   /inference="similar to AA sequence:SWISSPROT:PABP.YEAST"
FT                   /protein_id="CAK43671.1"
FT                   /translation="MSADVSTTPAAENVNGAAEASPAPAAAAPSATTPEVTAVENSTPA
FT                   PAANQPHSASLYVGELDPSVTEAMLYELFSSIGQVASIRVCRDAVTRRSLGYAYVNYNN
FT                   TADGERALEDLNYTLIKGKPCRIMWSQRDPALRKTGQGNVFIKNLDSAIDNKALHDTFA
FT                   AFGNILSCKVAQDEFGNSKGYGFVHYETAEAANNAIKHVNGMLLNDKKVFVGHHISKKD
FT                   RQSKFEEMKANFTNVYIKNLDSEIDDDEFRKMFEKFGEITSATLSRDQEGKSRGFGFVN
FT                   FSTHESAQAAVEEMNDKEIRSQKLYVGRAQKKHEREEELRKQYEAARLEKASKYQGVNL
FT                   YVKNLTDDIDDEKLRELFGPYGTITSAKVMRDTNVERDQSPDSAGKEKEADKENDKEAT
FT                   PEAEKAEKAEEKPSESSEEKDKEAKKSDKKPFGKSKGFGFVCFSSPDEASKAVTEMNQR
FT                   MVNGKPLYVALAQRKDVRRSQLEASIQARNTIRQQQAAAAAGMPQPYMQPAVFYGPGQQ
FT                   GFIPGGQRGMAFPPQPGMVMGIPGGRPGQYPGPFPGQQGGRGMGPNQQIPPNFAQGIPM
FT                   GMQGPGGIPNGMGYPQMAQVQFGRGAGGRGQVPGMPMGQGMRGGPGYGQGRGAPVQQGQ
FT                   MRPGQGGRGQNAAAPAGPQEGAAGGVNAQTLGAAPPAQQKQMLGEALYPKIQAQQPELA
FT                   GKITGMLLEMDNTELLSLTRKPCAPRSMRPLAFTMST"
FT   mRNA            complement(join(<262656..262716,262787..>264921))
FT                   /locus_tag="An01g03050"
FT   exon            complement(262656..262716)
FT                   /locus_tag="An01g03050"
FT                   /number=1
FT   intron          complement(262717..262786)
FT                   /locus_tag="An01g03050"
FT                   /number=1
FT   exon            complement(262787..264921)
FT                   /locus_tag="An01g03050"
FT                   /number=2
FT   CDS_pept        complement(join(266548..267219,267276..270293))
FT                   /locus_tag="An01g03060"
FT                   /EC_number="6.3.2.19"
FT                   /note="Function: pub1 (protein ubiquitin ligase 1)
FT                   catalyzes the attachment of the small protein ubiquitin to
FT                   proteins such as the mitotic activating tyrosine
FT                   phosphatase cdc25 thus specifically marking them for
FT                   degradation by proteasomes."
FT                   /note="Title: similarity to ubiquitin protein ligase ub1p
FT                   -Schizosaccharomyces pombe"
FT                   /note="See PMID 8635463"
FT                   /note="See PMID 9197411"
FT                   /db_xref="GOA:A2Q849"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="InterPro:IPR035983"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q849"
FT                   /inference="profile:COGS:COG5021"
FT                   /inference="profile:PFAM:PF00632"
FT                   /protein_id="CAK43672.1"
FT                   /translation="MFQSFTGNSRRPRQVNLGGRNTNPFAAYPSGRQNPHGAGPQNTLA
FT                   IAQQERLARQQERERLTASRLVQRTWRGYRSRKITRRTWRNEWDTTEKKQGKDHVPSFE
FT                   ILAQQPDVVLQPSLRYGTAADCLSQLRLLVQFLEPWDSGDIARLVYFSEAFQRTLHEVP
FT                   SIATEGEWTTPLKKLASLTLRVLRSVTSPTVPVFAVQRLLQLLVFLTGLIPKHMARLAK
FT                   EYYSVMVILTTDFESISTRYKLSRDSLTESVLALLRPITSETLTAYEWFAKIYLTIPNL
FT                   PEYIGSLDGLANNINYKLLTSALGPLQTLFGDRPKSAEDVDARLWLLAYFIFFHRCALG
FT                   GQTGRPAPEPGFVKVVSELLNSTAVHISRRLESEESNDYDEAPEQTPLHPFIKEQLVSL
FT                   VNQSNITGLLSQLHTTHLSQGELANAQSDASKEAKILATYALTLLRVFPRRGDDIRMWL
FT                   YLGSATSSDQLTGQEGSRIPAIKYFWQASKASRIFAAISQDSTKVLPLLKPAEESQGTR
FT                   SPEISQVERDEEWTIILLFLELYTFVLKVMDDEEFFSSESSFTASSNTRVSWTKESALP
FT                   LKDIKDMTIFLKNLGFTLYWNSADLSEKEATQDTGGIRSYFSSSAAPPDAIASVRDIEM
FT                   KNKEKGLPGVTGIPLDYFKGLVTGLLRMIHERDSRRKFLPDGHWLMTSRFDMEGFIPAV
FT                   VAEEENRHQLQDEDEEEEQDDLMSDAYFEPSPGLIGTGRAQLTRRIEALRRRQQQAARR
FT                   KQLEAVAPRMEILRNMPFFIPFPTRVQIFREFIYRDQMRRRQGYIDPDAWRMSVAQASM
FT                   GRLIDGRPAVQDILSRHHANIRRESIFKDAFDEFYELGDGLKEPIQITFIDKFNTTEAG
FT                   IDGGGVTKEFLTSVTSEAFKSTSDLNLFEENDQHLLYPNPAAVEQRRELLRQLGFVENT
FT                   AEWNENVRDLLRRYEFLGRIIGKCLYEGILVDVNFAPFFLLKWALTGGTGSAQRETAYR
FT                   ANLNDLKDLDQGLYQGLLQLKNYPGDVEDFSLNFTVTDTIPLPDGGNRTTTRDLKSHGS
FT                   DIPVTNQNRLVYISYIARYRLQVQPALQTNAFLQGLGQIIQPSWLSMFNQTELQTLVSG
FT                   DSGDIDVADLRRNTLYGGVYTIGDDKEEHPTVKLFWEVMEKMSNEERQKVLRFVTSTPR
FT                   APLLGFSHLNPRFSIRDSSEDQERLPSTSTCVNLLKLPRYTNANILREKLLYAVNSGAG
FT                   FDLS"
FT   mRNA            complement(join(<266548..267219,267276..>270293))
FT                   /locus_tag="An01g03060"
FT   exon            complement(266548..267219)
FT                   /locus_tag="An01g03060"
FT                   /number=1
FT   intron          complement(267220..267275)
FT                   /locus_tag="An01g03060"
FT                   /number=1
FT   exon            complement(267276..270293)
FT                   /locus_tag="An01g03060"
FT                   /number=2
FT   CDS_pept        complement(join(271781..272002,272081..272263))
FT                   /locus_tag="An01g03070"
FT                   /note="Title: similarity to mitochondrial ribosomal protein
FT                   Yml27 - Saccharomyces cerevisiae"
FT                   /note="See PMID 1764528"
FT                   /db_xref="GOA:A2Q850"
FT                   /db_xref="InterPro:IPR019189"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q850"
FT                   /inference="similar to AA sequence:UniProtKB:S77888.1"
FT                   /protein_id="CAK43673.1"
FT                   /translation="MFKPSQPMLARLRLTTKQVLGGYYKGNRTGSMGYFAKNGSYVIDW
FT                   KKVRTFVVPENLDQFKLTPFVTKRMPPTKSKYTKEVEKRGRIVTLERAFSGKDYLDMWA
FT                   SDNGQEVLEQERLDSEAATEQSSTTQPARQ"
FT   mRNA            complement(join(<271781..272002,272081..>272263))
FT                   /locus_tag="An01g03070"
FT   exon            complement(271781..272002)
FT                   /locus_tag="An01g03070"
FT                   /number=1
FT   intron          complement(272003..272080)
FT                   /locus_tag="An01g03070"
FT                   /number=1
FT   exon            complement(272081..272263)
FT                   /locus_tag="An01g03070"
FT                   /number=2
FT   CDS_pept        join(272584..275322,275411..275593)
FT                   /locus_tag="An01g03080"
FT                   /note="Title: strong similarity to hypothetical coiled-coil
FT                   protein - Schizosaccharomyces pombe"
FT                   /db_xref="GOA:A2Q851"
FT                   /db_xref="InterPro:IPR006709"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q851"
FT                   /inference="profile:COGS:COG5271"
FT                   /inference="profile:COGS:COG5644"
FT                   /inference="profile:PFAM:PF04615"
FT                   /inference="similar to AA sequence:PIR:T38948"
FT                   /protein_id="CAK43674.1"
FT                   /translation="MPRRQTQMRGPKDRDQSLQKSKKPAPKNKKSGNYLNAFAIAESEN
FT                   PGKLGVKRTRLGKEDEPFKRKRHNARDADDSDGPDYSKRRRTGDDEASEMDSNAGSDGE
FT                   GHRWRIGEVGSDDDSELDSDEAMGSSDEERFEGFTFRGSSTMKNKPKQKAPERKKRTRE
FT                   INLSEDAEVSEDEDDLEDDSDDLGEDAIDLTTAWDMNMAEEEEEKAKKAKSKSKQSAES
FT                   DESEEYDSESEDSDSDDNDDELPLSGDDMDEDEVDEHGLSKLQSFVNAMNTEGTTKTAR
FT                   KTGGKQEQGAPTEFGLTSTRKLTIADLLPSITDSRLKSSLKHVDATTTSNTKTSGVPGK
FT                   LDAPLAKRQQDRLDRAAAYEKSKETLDRWLETVKANRRAEHLVFPLPDPEANQTHRMGA
FT                   AEPRTDLESTIQNILQESGLIENNGKSAEEQVQEFEELQARKLPIEEIRARRAELRKRR
FT                   DLLFREEVRAKRIKKIKSKSYRRVHRKERERLEQQERQALLEAGVDLDEEEREKNDRLR
FT                   AEARMGSKHKESKWAKSLKQTGRTAWDEDARRGTQDLALREEELRKRIEGKRVTNGDED
FT                   YLGSSSSESEDEDPWDEEAGSDAEKRKIRQKLSQLEGDDDADTELKGPHAKLLSMKFMQ
FT                   NADAARKAENDAEVRRLNRELHGEESQSEAESEVGRRKFGRKKEEAKTAKESKAKLARN
FT                   EFEEAPGSDDEAQQEADQEVDIVVDRPAKKGPAAPQNKPRGRPQKEIAEEEDAAAVEEN
FT                   PWLVQTNRNNRRAIVNDSQQTVDITLDDANASSGKSKSAPKAQKASAPSKKKVDAEVYG
FT                   SDDEESVPVLLKNHDLVKRAFAGDEVVQDFEQEKFDTIKEEDDQVIDNTLPGWGSWAGD
FT                   GISKKQQKRQKRFLTKVEGVKPEDRKDAKLSRVIINEKRVKKNTKYMATQLPHPFETKQ
FT                   QYERSLRLPIGPEWSTKETFQNATKPRVMIKQGVIKPMEKPMA"
FT   mRNA            join(<272584..275322,275411..>275593)
FT                   /locus_tag="An01g03080"
FT   exon            272584..275322
FT                   /locus_tag="An01g03080"
FT                   /number=1
FT   intron          275323..275410
FT                   /locus_tag="An01g03080"
FT                   /number=1
FT   exon            275411..275593
FT                   /locus_tag="An01g03080"
FT                   /number=2
FT   CDS_pept        join(277393..277554,277608..278136,278192..278301,
FT                   278350..280077,280133..280194,280248..280584)
FT                   /locus_tag="An01g03090"
FT                   /EC_number="3.2.1.39"
FT                   /note="Catalytic activity: hydrolysis of
FT                   1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans."
FT                   /note="Function: Gel1 of A. fumigatus has a role in cell
FT                   wall biosynthesis."
FT                   /note="Localization: Gel1 of A. fumigatus is anchored to
FT                   the plasma membrane via a glycosylphosphatidylinositol
FT                   linkage."
FT                   /note="Remark: Gel1 of A. fumigatus was originally called
FT                   ENGL1."
FT                   /note="Remark: the official name for
FT                   1,3-beta-glucanosyltransferase is glucan
FT                   endo-1,3-beta-D-glucosidase."
FT                   /note="Similarity: Gel1 of A. fumigatus belongs to family
FT                   72 of glycosylhydrolases."
FT                   /note="Title: strong similarity to
FT                   1,3-beta-glucanosyltransferase gel1 - Aspergillus
FT                   fumigatus"
FT                   /note="plasma membrane"
FT                   /note="See PMID 9846753"
FT                   /note="See PMID 10769178"
FT                   /note="See PMID 10809732"
FT                   /db_xref="GOA:A2Q852"
FT                   /db_xref="InterPro:IPR005200"
FT                   /db_xref="InterPro:IPR040451"
FT                   /db_xref="InterPro:IPR040720"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q852"
FT                   /inference="profile:COGS:COG5498"
FT                   /inference="profile:PFAM:PF03639"
FT                   /inference="similar to AA sequence:UniProtKB:AF121133.1"
FT                   /protein_id="CAK43675.1"
FT                   /translation="MERKHRWGSSFLLMWLLAAEGVYSAPRRSSSTASPKTQFPPGAET
FT                   ERILPGTNGLYPTSLEREGHPVLPTPTSTGNTKDPWGLDGLLESLGDTADLPNELLSEF
FT                   LPGWGKNYPVTVPVSAYKPASAETTSSATEPQTQPETSDTSTPQAPSQNVPEATTDSSQ
FT                   VSSQASSTTSLTQPSSTTSTTQLSSTTSPTQPTSSASSAQPSSSASLTTTASQTTQADN
FT                   SITSSVVQASVTPMSGQDVFVPLATTPFPQTITARNDHPVPKKGIENVTTPIETNKFYA
FT                   GLFLGSQSNTTFTHPYGLSWAKGSGNAKSYGMAISHNEVNVVANGPTNANIPGNPISYY
FT                   INPIGIQHMILSATELNTSTVLTAENLLPFSADAVLSPTPGSSQRITIPLVQGMGFVTG
FT                   MYNNLQPLIQSGVFFSKVVTASSPRIGIYKYKVSLADGTEWLVYAIPQDGKDPDFRLES
FT                   NTDFRGPSGWSGTVQITKNPAGDSGEKLLDGSSGVFALEAAVSGSVQDNSGTYNLAFAK
FT                   SGKQLQQTPLLMYALPHHVESFDNTTKGRMTSITLRTTTKGNATAVVGETWTMLEPNLP
FT                   TQMGFDPWSVSAGNVNNLSAAAKQVILSVAPTELNQSIDQQSDLNSMYYSGKALSKFAT
FT                   LVYTVNKLGGNPDLAASALQNLKTAFSRFVDNKQQFPLVYDSVWKGVVSSASYGGDSGA
FT                   DFGNTYYNDHHFHYGYFIHAAAIIGSLDSTWLTDSNKAWVNMLVRDAGNSAANDPYFPF
FT                   SRSFDWYHGHSWAKGLFESFDGKDEESTSEDTMFAYALKMWGKTIGDASMEARGNLMLG
FT                   ILRRSLHNYFLMESDNKNQPANFIANKVTGILFENKVDHTTYFGNNLEYIQGIHMLPLL
FT                   PSSPYVRSQNFVREEWNALFSANATDPALNVTGGWKGVLYANLALIDPASSWNFFAQSN
FT                   FDYSWIDGGASRTWYLAFAAGQYIPPTSQSMMLLTTYAGLGGGPA"
FT   mRNA            join(<277393..277554,277608..278136,278192..278301,
FT                   278350..280077,280133..280194,280248..>280584)
FT                   /locus_tag="An01g03090"
FT   exon            277393..277554
FT                   /locus_tag="An01g03090"
FT                   /number=1
FT   sig_peptide     277393..277464
FT                   /locus_tag="An01g03090"
FT                   /inference="protein motif:SignalP:2.0"
FT   mat_peptide     join(277465..277554,277608..278136,278192..278301,
FT                   278350..280077,280133..280194,280248..280581)
FT                   /locus_tag="An01g03090"
FT   intron          277555..277607
FT                   /locus_tag="An01g03090"
FT                   /number=1
FT   exon            277608..278136
FT                   /locus_tag="An01g03090"
FT                   /number=2
FT   intron          278137..278191
FT                   /locus_tag="An01g03090"
FT                   /number=2
FT   exon            278192..278301
FT                   /locus_tag="An01g03090"
FT                   /number=3
FT   intron          278302..278349
FT                   /locus_tag="An01g03090"
FT                   /number=3
FT   exon            278350..280077
FT                   /locus_tag="An01g03090"
FT                   /number=4
FT   intron          280078..280132
FT                   /locus_tag="An01g03090"
FT                   /number=4
FT   exon            280133..280194
FT                   /locus_tag="An01g03090"
FT                   /number=5
FT   intron          280195..280247
FT                   /locus_tag="An01g03090"
FT                   /number=5
FT   exon            280248..280584
FT                   /locus_tag="An01g03090"
FT                   /number=6
FT   CDS_pept        join(284159..284539,284617..285467,285534..285606)
FT                   /locus_tag="An01g03100"
FT                   /note="Function: HUM1 is required for vacuolar Ca2+/H+
FT                   exchange and is related to mammalian Na+/Ca2+ exchangers."
FT                   /note="Remark: A single nucleotide change in the MNR1 gene
FT                   determines resistance to manganese in S. cerevisiae. MNR1
FT                   was shown to correspond to HUM1, which determines a
FT                   vacuolar membrane protein."
FT                   /note="Title: strong similarity to manganese resistance
FT                   protein 1 Mnr1 - Saccharomyces cerevisiae"
FT                   /note="See PMID 8668190"
FT                   /note="See PMID 10219995"
FT                   /db_xref="GOA:A2Q853"
FT                   /db_xref="InterPro:IPR004713"
FT                   /db_xref="InterPro:IPR004798"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q853"
FT                   /inference="profile:COGS:COG0387"
FT                   /inference="profile:PFAM:PF01699"
FT                   /inference="similar to AA sequence:UniProtKB:SCMNR1W30.1"
FT                   /protein_id="CAK43676.1"
FT                   /translation="MTGLSSENGSTEPDERAALLGDIARSNSGLRPRQQKLHWSHWPRR
FT                   VAHLTWSTLVRDYVNVLLIFVPLGIISGALHWDSTVIFTLNFLAIIPLASLLSFATEEL
FT                   AATMGQALGGLMNATFGNAVELIVSIIALKDNQIRVVQASMLGSILSNILLVLGCCFFV
FT                   GGLKYSQQSFNSTVASTMSSLMTVSSASLIIPATLYASLSGSKDKEQRRDNILILSHGT
FT                   AIILLVLYVMYLYFQLKSHAELFEAANDELNDTENQGGEVEEAEEEEHLLSPWAATVAL
FT                   IVITVLVAICADYLVGSIDSIVTKTGMSRTFIGLVLIPIVGNAAEHVTAVVVAWKGKMD
FT                   LAIGVAIGSSLQIALFVTPFLVILGWIMNVDMTLHFHIFETMAFFISGLVVTFLIQDGK
FT                   SNYLEGGLCLGMYLILAIAFYIYPDDVNEDALFNH"
FT   mRNA            join(<284159..284539,284617..285467,285534..>285606)
FT                   /locus_tag="An01g03100"
FT   exon            284159..284539
FT                   /locus_tag="An01g03100"
FT                   /number=1
FT   intron          284540..284616
FT                   /locus_tag="An01g03100"
FT                   /number=1
FT   exon            284617..285467
FT                   /locus_tag="An01g03100"
FT                   /number=2
FT   intron          285468..285533
FT                   /locus_tag="An01g03100"
FT                   /number=2
FT   exon            285534..285606
FT                   /locus_tag="An01g03100"
FT                   /number=3
FT   CDS_pept        join(286281..286628,286747..287079,287152..287570,
FT                   287643..287670,287868..288008)
FT                   /locus_tag="An01g03110"
FT                   /note="Title: similarity to ribosomal protein of the small
FT                   subunit Rsm7 - Saccharomyces cerevisiae"
FT                   /db_xref="GOA:A2Q854"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q854"
FT                   /inference="profile:COGS:COG0542"
FT                   /inference="similar to AA sequence:PIR:S57136"
FT                   /protein_id="CAK43677.1"
FT                   /translation="MPPRLNLFTARAVPVLRQSANSSAASRRSFATILNTNRPCAASTG
FT                   HGLKSGLSASVRGQRRCNSSGSDGQDRPKGPTEDPLPHVSEEAAEVSKIMDKKCDGTPA
FT                   SPELEQGSPISEILQRDKEALKHMPKVMQDQMKRPSGSRSFSTSARRLQPELQGKELDD
FT                   ASASVVANMISQVNQQATELHPGLKFEAPQNLPKTENFRKRYETIVEQFTKLLMQDGKL
FT                   SKAQNTMAFILDHLRTAPPPNINPRRRLLPGPPAPQLPLNPVLYLTLIVDSVAPLLKLR
FT                   QQKGIVGGGVSVQVPSPLALRQRRRTAIKWIIDASDKRRDAIFGQRVANELVAVAEGRS
FT                   GVWDKREQVHKLGVAGRSNLGLVARRRAFGYIVPMMCEVDATNEVLDSGHEPMTRAMTN
FT                   SASRGWVPLQSRPILAPRKAAYL"
FT   mRNA            join(<286281..286628,286747..287079,287152..287570,
FT                   287643..287670,287868..>288008)
FT                   /locus_tag="An01g03110"
FT   exon            286281..286628
FT                   /locus_tag="An01g03110"
FT                   /number=1
FT   intron          286629..286746
FT                   /locus_tag="An01g03110"
FT                   /number=1
FT   exon            286747..287079
FT                   /locus_tag="An01g03110"
FT                   /number=2
FT   intron          287080..287151
FT                   /locus_tag="An01g03110"
FT                   /number=2
FT   exon            287152..287570
FT                   /locus_tag="An01g03110"
FT                   /number=3
FT   intron          287571..287642
FT                   /locus_tag="An01g03110"
FT                   /number=3
FT   exon            287643..287670
FT                   /locus_tag="An01g03110"
FT                   /number=4
FT   intron          287671..287867
FT                   /locus_tag="An01g03110"
FT                   /number=4
FT   exon            287868..288008
FT                   /locus_tag="An01g03110"
FT                   /number=5
FT   CDS_pept        join(288747..288829,288988..290251,290310..291429,
FT                   291493..291634,291769..291805)
FT                   /locus_tag="An01g03120"
FT                   /note="Function: a synthetic lethal phenotype was observed
FT                   in S. cerevisiae when additional to Pho90 four other
FT                   phosphate transporters were inactivated."
FT                   /note="Remark: the identical protein match in the patent
FT                   database uses wrong codes and descriptions."
FT                   /note="Title: strong similarity to phosphate transport
FT                   protein Pho90 - Saccharomyces cerevisiae"
FT                   /note="plasma membrane"
FT                   /note="See PMID 11779791"
FT                   /db_xref="GOA:A2Q855"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR004331"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q855"
FT                   /inference="profile:COGS:COG0471"
FT                   /inference="profile:COGS:COG5408"
FT                   /inference="profile:PFAM:PF03105"
FT                   /inference="similar to AA sequence:PIR:S46633"
FT                   /protein_id="CAK43678.1"
FT                   /translation="MKFSHSIQFNAVPDWSAYYLAYSNLKKLIYSLEQEVHHRSAGHEH
FT                   ADVEQAPLLDGGSLNTDAIFRRALDAELEKICSFYQSKEAEIFTEVEDVLRDAEEYAHR
FT                   ADTMNVDPMSDAMIKGRTASSSSRQRPGSIVRRVPSNQERRHSAFSETLADDDDDDADS
FT                   DDEPGTLSNQYRPQSHGAESSNPDGSRTDDMRDSVLWGADSRLLGYSGPSAHRGGAPDE
FT                   HFSDPIVVDLYNAGLSLKKRAVAAYVSICGLKSYIQLNKTGFSKALKKYDKILDRNLRR
FT                   EYVNSVVSLTYPFKDSTMEKVDDNIRKVEEVYANVVTTGNIPLAKRELRLHLREHVVWE
FT                   RNTVWREMIGIERKAQAANVGIRRTLLGGDEDPSKARRQGDEQEVMPKMIRTPFGTIRI
FT                   PQWLCSLSLVTLVLILLVFGILLSVPIMEKPEQQNCLAMLVFVSLLWATEVIPLFVTSL
FT                   LIPFLVVMLRIMLSDNKPHERLGPKEATAAAFSAMWTPVIMLLLGGFTIAAALSKYDIA
FT                   RRMAMFVLSKAGSNPNILLLTNMFVSMFLSMWISNVASPVLCYSIIQPLLRNLEPDSSF
FT                   AKSLVLGIALAANVGGAASPIASPQNIIALQNIYPSMSWGTWFFISLPVCILSIVAIWM
FT                   LLVLTFKPGRETAVAIRPLKDKFTGVQWFISIVTLSTIALWCGSHQLEHIFGDMGVIAI
FT                   IPMVLFFGTGILNKEDFNNFLWTIIILAAGGLCLGKAVTSSGLLHTLANAIRMRVEHLS
FT                   LYGVLLVFSALILVIATFISHTVAALIMLPLVRQIGLGMDDPHPNLLVMASALMCSVAM
FT                   ALPTSGFPNMTAIMTEVPQTGQRYLQVRHFFTRGIPASLMSFAVIVTVGYGLMYIAGLH
FT                   AARSGPGMLL"
FT   mRNA            join(<288747..288829,288988..290251,290310..291429,
FT                   291493..291634,291769..>291805)
FT                   /locus_tag="An01g03120"
FT   exon            288747..288829
FT                   /locus_tag="An01g03120"
FT                   /number=1
FT   intron          288830..288987
FT                   /locus_tag="An01g03120"
FT                   /number=1
FT   exon            288988..290251
FT                   /locus_tag="An01g03120"
FT                   /number=2
FT   intron          290252..290309
FT                   /locus_tag="An01g03120"
FT                   /number=2
FT   exon            290310..291429
FT                   /locus_tag="An01g03120"
FT                   /number=3
FT   intron          291430..291492
FT                   /locus_tag="An01g03120"
FT                   /number=3
FT   exon            291493..291634
FT                   /locus_tag="An01g03120"
FT                   /number=4
FT   intron          291635..291768
FT                   /locus_tag="An01g03120"
FT                   /number=4
FT   exon            291769..291805
FT                   /locus_tag="An01g03120"
FT                   /number=5
FT   CDS_pept        complement(join(292507..292513,292665..293443))
FT                   /locus_tag="An01g03130"
FT                   /note="Remark: Protein is rich in proline, glutamine and
FT                   glutamatic acid."
FT                   /note="Title: weak similarity to surface protein PspC
FT                   -Streptococcus pneumoniae"
FT                   /db_xref="GOA:A2Q856"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q856"
FT                   /inference="profile:COGS:COG3468"
FT                   /inference="profile:COGS:COG5271"
FT                   /protein_id="CAK43679.1"
FT                   /translation="MSDQSKQPESSTNNPSQEGENNNNNTTSSPSSPQQENPPTGDQEG
FT                   QEQKPEDTNDTTEDKPKEEEKEEDKQEDEDPQPKQEEQEQEPEPEKEPQPKQEPQEQED
FT                   KAPKQEPQSSDEEPEPEPEQRAPQPSQDRKRRSRPPQKLRQRDDYSDMDNNQQVDRPRR
FT                   QRRQRPQQQQQGQDGGPLGGLPGVGQAGDLVQNTAGNALNGVTGSAGKAVGGILGGGGG
FT                   GEEKEGKDEQLRLRLDLNLDIEVQLKAKIHGDLTLGLLN"
FT   mRNA            complement(join(<292507..292513,292665..>293443))
FT                   /locus_tag="An01g03130"
FT   exon            complement(292507..292513)
FT                   /locus_tag="An01g03130"
FT                   /number=1
FT   intron          complement(292514..292664)
FT                   /locus_tag="An01g03130"
FT                   /number=1
FT   exon            complement(292665..293443)
FT                   /locus_tag="An01g03130"
FT                   /number=2
FT   CDS_pept        join(295058..295551,296321..296350,296796..296844,
FT                   296963..296997,297028..297097,297451..297501,
FT                   297550..297591)
FT                   /locus_tag="An01g03140"
FT                   /note="Remark: unspecific blast hits are due to the low
FT                   complexity sequence of the ORF."
FT                   /note="Title: weak similarity to hypothetical protein
FT                   encoded by An12g10460 - Aspergillus niger"
FT                   /db_xref="GOA:A2Q857"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q857"
FT                   /protein_id="CAK43680.1"
FT                   /translation="MATAQAEKPATKTFANDPDDVSDYDSEDDYSDDDTQQKPQQQQQQ
FT                   QQQQRRRRRPQQQNPNDEDDTYYSDEYSDDYDDYDDEDDDYYDDEEEEVQAMERYQPTT
FT                   ISSRDNVPAQPIANGGMQEAEGKTGDDWEDQDGMKLKLELNLDIEVELKAHIHGDLTLS
FT                   LLVSTFGFYLIFSCLAYKKRYLWTLTNSTLSTTSPLFIRYNPVIGRNSQMVSWYCEVVV
FT                   KRFFTSNIFGEGGYSLAIRYTLVACSSSTHIREP"
FT   mRNA            join(<295058..295551,296321..296350,296796..296844,
FT                   296963..296997,297028..297097,297451..297501,
FT                   297550..>297591)
FT                   /locus_tag="An01g03140"
FT   exon            295058..295551
FT                   /locus_tag="An01g03140"
FT                   /number=1
FT   intron          295552..296320
FT                   /locus_tag="An01g03140"
FT                   /number=1
FT   exon            296321..296350
FT                   /locus_tag="An01g03140"
FT                   /number=2
FT   intron          296351..296795
FT                   /locus_tag="An01g03140"
FT                   /number=2
FT   exon            296796..296844
FT                   /locus_tag="An01g03140"
FT                   /number=3
FT   intron          296845..296962
FT                   /locus_tag="An01g03140"
FT                   /number=3
FT   exon            296963..296997
FT                   /locus_tag="An01g03140"
FT                   /number=4
FT   intron          296998..297027
FT                   /locus_tag="An01g03140"
FT                   /number=4
FT   exon            297028..297097
FT                   /locus_tag="An01g03140"
FT                   /number=5
FT   intron          297098..297450
FT                   /locus_tag="An01g03140"
FT                   /number=5
FT   exon            297451..297501
FT                   /locus_tag="An01g03140"
FT                   /number=6
FT   intron          297502..297549
FT                   /locus_tag="An01g03140"
FT                   /number=6
FT   exon            297550..297591
FT                   /locus_tag="An01g03140"
FT                   /number=7
FT   CDS_pept        join(298202..298293,298348..299155)
FT                   /locus_tag="An01g03150"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   EAA66565.1 - Aspergillus nidula"
FT                   /db_xref="GOA:A2Q858"
FT                   /db_xref="InterPro:IPR019595"
FT                   /db_xref="InterPro:IPR037119"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q858"
FT                   /protein_id="CAK43681.1"
FT                   /translation="MQNDNNIVETEGAGNFTCGLNIGGAPVPREGSPQTATTQSPNPAQ
FT                   PAASICESTYIKREIPLDKRTRKERQEKKQNEAKMAPDRSNISFTITHMNANHQDSLAA
FT                   YLQVYCHVSAREAKSARLEDITLSDLVISANGTRYTVPIDPAMGSFSESRSRLVAMHQE
FT                   CLARLGRSDITIKEYRRPEGIEIFLFFVFATALVAFSRRSNFLPGSLFYETVGLGAVPP
FT                   LAQLFYKTQPFVLTVMAGSHVVEASLFTVKRLKRHGVPVLSLVWCAWVVSNLIEGYTVW
FT                   RRFDWVVRQEGAKREHGK"
FT   mRNA            join(<298202..298293,298348..>299155)
FT                   /locus_tag="An01g03150"
FT   exon            298202..298293
FT                   /locus_tag="An01g03150"
FT                   /number=1
FT   intron          298294..298347
FT                   /locus_tag="An01g03150"
FT                   /number=1
FT   exon            298348..299155
FT                   /locus_tag="An01g03150"
FT                   /number=2
FT   CDS_pept        join(299995..300068,300152..300680)
FT                   /locus_tag="An01g03160"
FT                   /note="Complex: S8 is one of the protein constituents of
FT                   the 40S subunit of eucaryotic ribosomes."
FT                   /note="Function: involved in eucaryotic protein synthesis."
FT                   /note="Title: strong similarity to cytoplasmic ribosomal
FT                   protein of the large subunit S8 - Rattus norvegicus"
FT                   /note="cytoplasm"
FT                   /note="See PMID 3684599"
FT                   /note="See PMID 8910435"
FT                   /db_xref="GOA:A2Q859"
FT                   /db_xref="InterPro:IPR001047"
FT                   /db_xref="InterPro:IPR022309"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q859"
FT                   /inference="profile:COGS:COG2007"
FT                   /inference="profile:PFAM:PF01201"
FT                   /protein_id="CAK43682.1"
FT                   /translation="MGISRDSRHKRSATGAKRATYRKKRAFEKGRQPSNTRIGTKRIHL
FT                   VRTRGGNQKFRALRLESGNFSWGSEGISRKTRVIVVAYHPSNNELVRTNTLTKSAVVQI
FT                   DAAPFRQWYEAHYGQPIGRRRQQKTETTEEKKSNSVVKKQAARFAEQGKVESAVERQFE
FT                   SGRLYAVVSSRPGQSGRVDGYILEGEELAFYQRAIRK"
FT   mRNA            join(<299995..300068,300152..>300680)
FT                   /locus_tag="An01g03160"
FT   exon            299995..300068
FT                   /locus_tag="An01g03160"
FT                   /number=1
FT   intron          300069..300151
FT                   /locus_tag="An01g03160"
FT                   /number=1
FT   exon            300152..300680
FT                   /locus_tag="An01g03160"
FT                   /number=2
FT   exon            301131..302162
FT                   /locus_tag="An01g03170"
FT                   /number=1
FT   CDS_pept        301131..302162
FT                   /locus_tag="An01g03170"
FT                   /note="Title: similarity to hypothetical protein CG16717
FT                   -Drosophila melanogaster"
FT                   /db_xref="GOA:A2Q860"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q860"
FT                   /inference="profile:COGS:COG2129"
FT                   /inference="profile:PFAM:PF00149"
FT                   /inference="similar to AA sequence:UniProtKB:AE003551.31"
FT                   /protein_id="CAK43683.1"
FT                   /translation="MAPPTTSPPKTIKTSLLLLSDTHTLTPLPPIHPNTSTPFRHPLPA
FT                   TDLLIHAGDLTKVGHKHEHLTTLSFLKSARAPIKLIIPGNHDITLDEPYYKKIGHYRHR
FT                   YRTDHTAPSATSGSDNVSAGKGTPGMALSDDELREIKELYTGKEAWDAGIRYLEEGTHV
FT                   FRLQNGAVLRVYASPWTPEFCQWGFGYPRQVDRYNPPEEEGEGEEGAENPVPDYPGVDV
FT                   MITHGPPYGVLDQVVPNHMSVGCEHLYRAVKRARPRVHVFGHIHEGYGATRREWSSGNE
FT                   SVIQCDKERTLEERCARVDVSKEGGNGLRVGEETLFVNASVVTVQYQAINAPWVVEVDL
FT                   PVE"
FT   mRNA            <301131..>302162
FT                   /locus_tag="An01g03170"
FT   exon            complement(302634..308984)
FT                   /locus_tag="An01g03180"
FT                   /number=1
FT   CDS_pept        complement(302634..308984)
FT                   /locus_tag="An01g03180"
FT                   /note="Function: Drosophila Mbc encodes a conserved protein
FT                   that is essential for myoblast fusion, dorsal closure, and
FT                   cytoskeletal organization."
FT                   /note="Pathway: It is suggested that Mbc is a specific
FT                   upstream regulator of the activity of the GTPase Rac that
FT                   mediates several morphogenetic processes in Drosophila
FT                   embryogenesis."
FT                   /note="Title: similarity to myoblast city protein Mbc
FT                   -Drosophila melanogaster"
FT                   /note="See PMID 9245788"
FT                   /note="See PMID 9808621"
FT                   /db_xref="GOA:A2Q861"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR010703"
FT                   /db_xref="InterPro:IPR026791"
FT                   /db_xref="InterPro:IPR027007"
FT                   /db_xref="InterPro:IPR027357"
FT                   /db_xref="InterPro:IPR031057"
FT                   /db_xref="InterPro:IPR032376"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="InterPro:IPR042455"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q861"
FT                   /protein_id="CAK43684.1"
FT                   /translation="MPWRPLPRIAFAVAIYPFQPTTPADLPLELGDELYIIEQGGANGE
FT                   WCRGYLVAPPSLLAGLTSSKGQTLEARVFSGIFPRNCVEIREVLGDGEKTITNGDRSSV
FT                   AFTAVPEGDVRHSMASFQDDDHAFGEVSSVVIAKKGKPSQIFIQRLDEDGRGSPASPRS
FT                   PQNFLRTNSTPLAPINVAPRDPDAPKPAAPVPMLKIGDETPTSLSEPLVDEIASCLREW
FT                   HSTNLHQLLLSRQYVTVEEMTKIVEELDFARRQLLYNVLTAQEKDALRQEVVWKLVRGN
FT                   KALGGEIIVRDPQQRGRLLTGEDSAVELARLQSEMSMLDSSPMQQSDAAALHHLMLEVN
FT                   AVSGHAPGPVTLAVYLCSQSETGALTPLSETYVLDIPSPEKFASMGQSAKLKTLFTDLS
FT                   STDIGDNAANGPRLYMVVMVRAPETTSVVSAAAQPRTSISRDSSSGTKQQNGINQSVKG
FT                   SLRTRRSMMWTSKPRGIQSPEQGKEPSKAAPPSSGSNASAKEKASSQPVKESTQLRTVG
FT                   VGFLEISQILRQEKDAEQVINIWSPSEDSEDKEGRDDGFDGVVRTLLPSPTGKYVRSQR
FT                   AARLHFHLYPYVDPDADSLVRKNPTSLHNVVQTKRMGFSQAPTKPRSDIYVTICHATFP
FT                   PEALLSHPQSGQVPVPGHTGLHNLQLTLEVRTSSGARVDRCVFSASNHAAQTAWRTTVA
FT                   DRGAPWNQTIRLNIPTDQIPGSHLIMSIADAPEFPFALAWMPLWDNQAFMRDGPHSLLL
FT                   HAYDKCTSNIENGKGAYLSLPWSSLGKNESAKDEAITGPLATLRLDTHLCSTEYSQDQV
FT                   ILSLLNWRERPVNEVLDTLKRVLFVPEIEIVKQLSSVLDSLFGILVENAGNEEYEDLIF
FT                   NDLVTVLGIVHDRRFNLGPLVDHYADNQFNFPFATPCLVRSYLRLLQASSDAQQSRNLR
FT                   ATFKVGRHVLKFIINARLQQKAKEEGIGITRVQSTFNRDLHTIFKSLEALMKNPSPAMV
FT                   GNKTLVVQHFHTWLPELSKVLSRDETIMIALSFIDSCKDVTGMLILYKLVLIQHYTRLE
FT                   IFGSGSERKSLVSSCISWLAPYWGATGSVSDLYRDQVRLCCAIVAELLKQPDPYLYEFV
FT                   PKIVSSYYSIIPDGVEETTYLSLLFSKSFPFQVKSSKHSQKFDEALVELSAVLAGAATI
FT                   PNPKRPRLKGLELSSFLTQAFEVHNSILNCEAYPESWFSVHVYNHRATVKSLEYLATIL
FT                   TNKFLPSPDDAETFDTRLWETFFMTLLKVVSSDALALETYPEQKRRAIWKIAGDVREQG
FT                   ADLLHSSWESIGWETTDEEREHYGLSKLGGYQVQYVPGLVAPIIELCLSVHEGLRHVAV
FT                   DILRTMILSEWGLNQDLSIIETEVISSLDNLFKRKNMSESVVQKLFIAELSDHFEDSAD
FT                   YDEDLSSAVKALIATVDELLDLFVASQGGSMAESLHTLRLMKYMKDMGREDIFIRYVHE
FT                   LAQVQAEAGNFTEAGLALQFHADLYDWDPKRTLPELLNPAFPEQTSFERKEALYFTIIQ
FT                   HFEDGKAWAHALVCYKELAQQYEDIVVDFAKLSRAHASMAKIYDLISKESKQFPRYFRV
FT                   QYKGLGFPTTLRDKQFIIECAPTERMVSFIDRMQREHPAAQVVSSGEVHDYEGQYLHIN
FT                   PVSVHRDVDHPVYQRSKIPQSVRDHLLVSEPCHFSSTLRKHVRDVDVKEQWVEKTVYTT
FT                   AEPFPNILRRSEVVEVKEVALSPLHTALERTWRKTHELSMLQRRAASGEDTGLNNLSEA
FT                   LQQLLDLDAATPNCVAAYRQFLSDAHEEEEGGLVTPKPADPMKNALAVALIDHALGIKQ
FT                   ALALYHRPAHLATQAELTRRFEEAFGPEISSLRPAETEQAPQWPRRSTPESVKERQKPP
FT                   ASRALSPEQELIRSSRKNHSRKHSAKQSVSHRISVMNPFKRGNHVASNSVSTVQEDPKP
FT                   QSDSKVNGTTTEEHVNGEVDQDDAATIHSRTTTQSRDTHHKRRSRLGDVLHKHASSLSI
FT                   SASATEETQSQKKQRTRSASRDTAGKSHDSVSQTTSQTNGTSADDRPSVSSHKGGWSTI
FT                   PSITDYPRPVTRSSINSVRSPELMSPVSQSSGMRDSVFKRFSLLKGVSRKGSRLDFRTE
FT                   TPVREE"
FT   mRNA            complement(<302634..>308984)
FT                   /locus_tag="An01g03180"
FT   mat_peptide     complement(302637..308915)
FT                   /locus_tag="An01g03180"
FT   sig_peptide     complement(308916..308984)
FT                   /locus_tag="An01g03180"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(join(311397..312315,312375..313492,
FT                   313567..315854,315925..316123))
FT                   /locus_tag="An01g03190"
FT                   /note="Function: SEC3 is one of ten SEC genes required for
FT                   targeting or fusion of post-Golgi secretory vesicles to the
FT                   plasma membrane in S. cerevisiae. It is suggested that
FT                   polarized secretion would result from the coupling of
FT                   actin-dependent vesicle targeting with SEC3-dependent
FT                   establishment of the vesicle fusion site."
FT                   /note="Title: similarity to protein Sec3 - Saccharomyces
FT                   cerevisiae"
FT                   /note="plasma membrane"
FT                   /note="See PMID 9247645"
FT                   /note="See PMID 9491896"
FT                   /db_xref="GOA:A2Q862"
FT                   /db_xref="InterPro:IPR019160"
FT                   /db_xref="InterPro:IPR028258"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q862"
FT                   /inference="profile:COGS:COG0739"
FT                   /inference="profile:COGS:COG1674"
FT                   /inference="profile:COGS:COG2319"
FT                   /inference="similar to AA sequence:PIR:S41794"
FT                   /protein_id="CAK43685.1"
FT                   /translation="MSSRDRMRGPPPGEMPPQRDPRRAGDSRNGGNAGPGDASMSRAEK
FT                   FEDEKRRIIHSCFGKKDSDGSLVESYITHVRILEDAAYPSTPAPPNSPPENKKPRVIIV
FT                   AVRRSGRVRMHKARENNDGSFSIGKTWMLDDLSCIQSYNALVPSTPLEQQHKQWAANVG
FT                   FIVTVGKPYYWHARTSKEKDFFIGSLVKIYRKYTGGKVPTLIGFDDRERQLLAGGSAAG
FT                   PPAPKGPPPSGPPRPEVALPPPRPSSSQGSRPQSPYSSRAPSRDGPRRPPPAPSEEHVL
FT                   RAQRSRDQMGRPSTGQSGKSGTPPFSPPQHPPPLPPDQREQPPPRAAERLATEPRVPKV
FT                   PIISPPEPRNRDYPSSLQAAPVAGQRERPNGSFEEARSGSPLPDSRPPSSRDGRKGPES
FT                   RPTLRTHDLHPSRSTDGLRPTTPGSVSGENHTFMHSPGSSVGPRSPLREAAEKPIGSPA
FT                   RAARQEPEPPSNPINTPAVEVPAALTPGSSAFSKAPPAVESAEAPVPTAPTLSILTKDP
FT                   EPIEPIAETAAAAVPPPPSDLEATEPVEENDPDAHRPGLGPMIKKKQVKDVAGAFRKAA
FT                   TAHGAFKPRPGGAGERLLAAAKKQKAAADEPDGITSVVPAPFLLRTNSENTVTSPETPE
FT                   AETPPVVSSSPEKEVQPPAPPAPPAVQPPPEPPRIEPPAVEVTQAAPVEPTIGSTEVLA
FT                   EPRDTSRASVKVDTERSRSVSPSPHDRRRRRHEDNTIKYCQALGLNPTVLEGRGIDFDD
FT                   ILTDLGWNGRLGDEKKIEDLEADIRREIGRVETTSWLGNLEQQEGKIDQLAKLIDKTVV
FT                   ECEELDNLLTLYSHELNTLHDDVAYIETQSQGLQVQTANQKLLQNELQNLLRTLSISSD
FT                   DVRALKESSLSNPDGLRDTELALSTLYKAMLMIDSDIWHNKRRLADAAGDHGSLGVYAD
FT                   TEIGQMRAIKEKKEEYRTHARVFLQRLKQFMAIAYKVAEQKRIDAAANGQKDPLKLDSE
FT                   ARGYCRRELWQYNAVILFAREVSSGEWHALINLYEQQAKHPYQNDFRDNNLAWKKAARK
FT                   PSGEEQELLFTHQEKEKESEGITMAARKLTVRRGKTIRAAAGLRLPSGDKQHGKLEPCE
FT                   AFGGTLQETLHMISEEQNFIVYFFHLNSLSTVDFPDLVMSGAPDERRIPSFGSKQLHDP
FT                   DRAMAKKVEQIMDELFAFWPTDMQNLVDWAIRADPLQGIGILLAIEKAISEYDDTNQDF
FT                   IIHSLQKLHSRLLGLFNRFVDDQIRGIEETKVKVNKRKGVISFMRVFPHFSTAVENMLS
FT                   QEFYDIRVNVNEAYDRINRAMWESLKFIAKEAPGQPTGAAATSGDPEDKEILNYHILLI
FT                   ENMNHYIEEVDVRSLPVLERWRDRAHQDMQEHLKLYLDSIIHRPLGKLLEFIESVENLV
FT                   ATGINPADIASRPSHSRSVAKKVLATYDAKEIRRGIEMLKKRVEKHFGDADDPGLSRSL
FT                   VLKVLRECEGRYGEAYNRTRRVIDAVYEGQLELEWRKEDAIAMFQR"
FT   mRNA            complement(join(<311397..312315,312375..313492,
FT                   313567..315854,315925..>316123))
FT                   /locus_tag="An01g03190"
FT   exon            complement(311397..312315)
FT                   /locus_tag="An01g03190"
FT                   /number=1
FT   intron          complement(312316..312374)
FT                   /locus_tag="An01g03190"
FT                   /number=1
FT   exon            complement(312375..313492)
FT                   /locus_tag="An01g03190"
FT                   /number=2
FT   intron          complement(313493..313566)
FT                   /locus_tag="An01g03190"
FT                   /number=2
FT   exon            complement(313567..315854)
FT                   /locus_tag="An01g03190"
FT                   /number=3
FT   intron          complement(315855..315924)
FT                   /locus_tag="An01g03190"
FT                   /number=3
FT   exon            complement(315925..316123)
FT                   /locus_tag="An01g03190"
FT                   /number=4
FT   CDS_pept        complement(join(316971..317008,317139..317193,
FT                   317267..317983,318050..318399,318467..318634,
FT                   318691..318940))
FT                   /locus_tag="An01g03200"
FT                   /note="Remark: Incorporated choline is exclusively utilized
FT                   for the synthesis of phosphatidylcholine."
FT                   /note="Title: similarity to choline permease Hnm1
FT                   -Saccharomyces cerevisiae"
FT                   /note="See PMID 2203793"
FT                   /db_xref="GOA:A2Q863"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q863"
FT                   /inference="profile:COGS:COG0833"
FT                   /inference="similar to AA sequence:PIR:S11175"
FT                   /protein_id="CAK43686.1"
FT                   /translation="MSLLSLPPRVQKAAAEMSDNESPGTARAELPRQFSFLSTLALGYS
FT                   ITNSWAGYAGILSIPLVMGGGPTAFFGLFLASIACCFITAGLAELASAFPTSGGPYHFA
FT                   FIVSAPKHRAAVSFVVGWLTMISWCTVSTSNGIVCAQMINGLVTVHRPSVTVTAWRIYL
FT                   IYLPIVLLSTVVVCYLPRVIPLIEDCIIIFSLLTFGTSLITVLAMQDQKQSAHTLFLAY
FT                   ENHTGWSDGTAFMIGAGTCMYAYITVDSVTHIADEVPNPGRNIPRAMMATVLTGMVTCI
FT                   PYAIAILFCTTDLKAVASSPIPIYTAYLQATSSPVVATLFTAWVIFFYCAAELSCLLTA
FT                   GRLAYTFARAGGLPYSSFFVKITNEMPLNATLGCCVFICLYGLIYIGSATAFDSFISIV
FT                   IIALNICYVVPQAIVLLRGRDAVLGRRAFAMGKYFGLFCNTVAVVWVAVILVFFCLPLK
FT                   IPTTVHDMNYASVVLAGFVALIGIGWWGGKRKTFTGPLQDIESPHSGQTGTARVHALSL
FT                   ALTSNCTT"
FT   mRNA            complement(join(<316971..317008,317139..317193,
FT                   317267..317983,318050..318399,318467..318634,
FT                   318691..>318940))
FT                   /locus_tag="An01g03200"
FT   exon            complement(316971..317008)
FT                   /locus_tag="An01g03200"
FT                   /number=1
FT   intron          complement(317009..317138)
FT                   /locus_tag="An01g03200"
FT                   /number=1
FT   exon            complement(317139..317193)
FT                   /locus_tag="An01g03200"
FT                   /number=2
FT   intron          complement(317194..317266)
FT                   /locus_tag="An01g03200"
FT                   /number=2
FT   exon            complement(317267..317983)
FT                   /locus_tag="An01g03200"
FT                   /number=3
FT   intron          complement(317984..318049)
FT                   /locus_tag="An01g03200"
FT                   /number=3
FT   exon            complement(318050..318399)
FT                   /locus_tag="An01g03200"
FT                   /number=4
FT   intron          complement(318400..318466)
FT                   /locus_tag="An01g03200"
FT                   /number=4
FT   exon            complement(318467..318634)
FT                   /locus_tag="An01g03200"
FT                   /number=5
FT   intron          complement(318635..318690)
FT                   /locus_tag="An01g03200"
FT                   /number=5
FT   exon            complement(318691..318940)
FT                   /locus_tag="An01g03200"
FT                   /number=6
FT   exon            complement(319654..320628)
FT                   /locus_tag="An01g03210"
FT                   /number=1
FT   CDS_pept        complement(319654..320628)
FT                   /locus_tag="An01g03210"
FT                   /note="Function: NADPH:protochlorophyllide oxidoreductase
FT                   (POR) catalyses the light-dependent reduction of
FT                   protochlorophyllide to chlorophyllide, a key reaction in
FT                   the chlorophyll biosynthetic pathway."
FT                   /note="Localization: POR is a peripheral protein located on
FT                   the stromal side of the thylakoid membrane."
FT                   /note="Title: similarity to proteophosphoglycan ppg3 -Pisum
FT                   sativum"
FT                   /note="See PMID 7579182"
FT                   /note="See PMID 9224639"
FT                   /db_xref="GOA:A2Q864"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q864"
FT                   /inference="profile:COGS:COG1028"
FT                   /inference="profile:PFAM:PF00106"
FT                   /protein_id="CAK43687.1"
FT                   /translation="MSYSRSILITGGTAGLGYYCTIELARQFPDYQVIIASRSDSRDAA
FT                   GSINKLLGQSNVSYLRLDLSDLSKVRSFVQQWETNKYPPIQYLLLNAGLQFPGPVEYTV
FT                   DGYEKTFAINHIGHALLFSLLVPHLANTARIVVTSSGTHDPAQETGLPDAKYTSAEDLA
FT                   HPTKSSAQNPGRQRYSTSKLANVIWVYALHRRLSESKDARLKSWTVVAFDPGLMPGTGL
FT                   VREANPVLRFLWHVIFPRVIPLLRVMLGTPNIRLPQASGANLAWLASGKEASSSSGVYY
FT                   EGRKQIRSSEESYDVNKQDDLWDWTVRNVASTADEAARFSLIG"
FT   mRNA            complement(<319654..>320628)
FT                   /locus_tag="An01g03210"
FT   exon            320933..322495
FT                   /locus_tag="An01g03220"
FT                   /number=1
FT   CDS_pept        320933..322495
FT                   /locus_tag="An01g03220"
FT                   /note="Remark: the systematic name of Upc2 from S.
FT                   cerevisiae is YDR213w."
FT                   /note="Title: similarity to hypothetical RNA polymerase II
FT                   transcription factor Upc2 - Saccharomyces cerevisiae"
FT                   /db_xref="GOA:A2Q865"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="InterPro:IPR022698"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q865"
FT                   /protein_id="CAK43688.1"
FT                   /translation="MGWAANIASPSQPDDPAPSQLLHYLPDYQVVICSACRYAVQPHGI
FT                   LRHLKEIHRILRGRRRKYSHYVASLSLREPNDVIPPSGADQFPVPYLPVEPGLQCQSAG
FT                   CKYLCASNKRMQSHWRTVHGRKADCTTDWRTVPLQTFFRGNHLRYFTSEGAKTNHALSD
FT                   SVFGGHTQELSENQLHAGLDSMDSALLDHYLRHTYQSFTTNQETDKIWRLVVPELAYKN
FT                   VFLLHGLLACTSLHRAHMSSGHTNQEKVFLLRAYHHQEIALPQFRYAIEHPTEDNCHAI
FT                   LAFAHLLVVYSFAADQPRCSNSNMGTDSLFLVDRNSGEGSQPDSILCKWLYFLRAGCSM
FT                   LCEVWEQLKEGPVKALSEAWDIDLGDDPDLPYLELFMSMIPNESATTHETGDVTETSLV
FT                   WPEDVTAIYRQAAIELSRSFSYVHAHRGLLTTWDVLRIWPMEVSLEYMALLHQRHPGAL
FT                   ILLAYYCILLKQMERHWYFEGRAAMLICAIQRHLKPEWHVFIREPLHTVLGVPDGGHFL
FT                   GEL"
FT   mRNA            <320933..>322495
FT                   /locus_tag="An01g03220"
FT   CDS_pept        join(322953..323012,323082..324200)
FT                   /locus_tag="An01g03230"
FT                   /product="hypothetical protein"
FT                   /note="Similarity: the similarities are due to repetetive
FT                   sequences."
FT                   /db_xref="GOA:A2Q866"
FT                   /db_xref="InterPro:IPR007718"
FT                   /db_xref="InterPro:IPR039191"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q866"
FT                   /inference="profile:COGS:COG5021"
FT                   /inference="profile:COGS:COG5271"
FT                   /inference="profile:PFAM:PF05022"
FT                   /protein_id="CAK43689.1"
FT                   /translation="MAGQKSKQAKPAKASKSKETPAPPAQLVAALSAFLSESGFSKTKE
FT                   AFTKELASKSIDSDAKNVPSLLELYQSWEKSSEKSSGSSSSDSDSDSESESGSESDSES
FT                   SDSSSDESSDSDVEMNDKSESDSDSDSDDEEEKKKPAAPAAKSQGTKRKAESSSSESDS
FT                   ESEADEAPKSKKTKVTSAKEESSDSDSSDSESDSSSSSSESEESSDSDSSSDDSSSSSS
FT                   ESDSDSDSDSDSDSSSDDEDDKKADKKALKAATKTPLPPSESSSSGSSPSSSSDSDTTG
FT                   TVSNSDSAPKEQSKSAQTSYSSSASPAPGNGPQKKKHTGARPTPLAQLSELPTDHLLSN
FT                   DYVPYAYAEKAWQDLSVTRGKGFTKEKNKKKRGSYRGGPIDISGGKSFKFDD"
FT   mRNA            join(<322953..323012,323082..>324200)
FT                   /locus_tag="An01g03230"
FT   sig_peptide     join(322953..323012,323082..323144)
FT                   /locus_tag="An01g03230"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            322953..323012
FT                   /locus_tag="An01g03230"
FT                   /number=1
FT   intron          323013..323081
FT                   /locus_tag="An01g03230"
FT                   /number=1
FT   exon            323082..324200
FT                   /locus_tag="An01g03230"
FT                   /number=2
FT   mat_peptide     323145..324197
FT                   /locus_tag="An01g03230"
FT                   /product="hypothetical protein"
FT   exon            complement(324851..326725)
FT                   /locus_tag="An01g03240"
FT                   /number=1
FT   CDS_pept        complement(324851..326725)
FT                   /locus_tag="An01g03240"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   B23I11.30 - Neurospora crassa"
FT                   /db_xref="GOA:A2Q867"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q867"
FT                   /inference="similar to AA sequence:PIR:T51891"
FT                   /protein_id="CAK43690.1"
FT                   /translation="MLAELPPEIIQLITSYLPSASALVNLSRTCWRLHHVVAAQDWRIF
FT                   RSFVETKFPGVETPEIWREAAQALTSRSRALDKHAVVGRFVVPASEAVKVGSHSSTRRD
FT                   NPTHGYRPALDSYEVWNGSSWNDRKEVLAWGAADELVLRIAEPGPNSKGKWVVFNDLDH
FT                   ISSHDDICGVHILRPGHPSKEPQTEHIVVARARGELFHLSIDPNIACHIYKQRFMTSGG
FT                   GIERTDMSDGKDPILSAHLSDGSISFFSTTSGEAEVYPFARLNADSSNNATISSRHKYS
FT                   KFLSPSLFAVGTGRIHDAITISAITPQGLSPSRELNVELVDFERLNLDTTIRSNVNAIA
FT                   PLDPTGQVFLAAWGDRAIRYNHPICHYSTLYANTLRLHDLRSNEEYEKTYRDTTDQNPI
FT                   YCIHPFGHDRFVVGAGGDALVKIFDLRMPKHDTYSYRDARPSRTLLKNNEPIVDSLSSL
FT                   SLTATNNSIAFPRKDISIFLSAHPPSSRPQGRRRHNTRSYRGAIYSMTSPSPSSPTIYT
FT                   GVADGVVRLDFASTDDLLGPCQDWYREPLLLSNDVRLENTVAHTRSADKVLDLSGYERP
FT                   EDTTASITLRTQQPFVFVGVEDGLAEEITGWDRRWERLEKPGAWRRAD"
FT   mRNA            complement(<324851..>326725)
FT                   /locus_tag="An01g03240"
FT   CDS_pept        join(327604..327935,328004..329112,329177..329316)
FT                   /locus_tag="An01g03250"
FT                   /EC_number="1.14.-.-"
FT                   /note="Pathway: TRI4 of Fusarium sporotrichioides catalyzes
FT                   the first oxygenation step in the trichothecene pathway and
FT                   participates in apotrichodiol biosynthesis."
FT                   /note="Remark: TRI4 has been placed in a new cytochrome
FT                   P450 gene family designated CYP58."
FT                   /note="Remark: trichothecenes are sesquiterpenoid
FT                   mycotoxins and act as protein synthesis inhibitors for
FT                   eukaryotic organisms."
FT                   /note="Title: strong similarity to cytochrome P450
FT                   monooxygenase TRI4 - Fusarium sporotrichioides"
FT                   /note="See PMID 7651333"
FT                   /db_xref="GOA:A2Q868"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q868"
FT                   /inference="profile:COGS:COG2124"
FT                   /inference="profile:PFAM:PF00067"
FT                   /protein_id="CAK43691.1"
FT                   /translation="MAISAVTLAATSFCILLLAYKLIIYPVFLSPLSKIPNAHWSAPIS
FT                   PAWIIWKRYRAQNNRTIQSAHVRLGPIVRLAPSEVSVNCVDGGIKSIYTGGYEKHEWYP
FT                   RVFGSFGTVSMFTMTNNKAHSTRKRMLSNIYSKSFLQSSPHIHLISETILLDRLLPIIQ
FT                   DAASSGSPIEMHDLDQGITMDFVSAYLYGLANGTNFLQDEAFRRKILRLYQSRKPFEFY
FT                   HQEVPNLVSWTKRLGLRLIPKWCDEANEVLDAWGLSFCDKADECLSSTQLNTEPMVYKQ
FT                   LKQSISKQLPPKEAASYNKLIEQQRLDIACELYDHLTAGHETSAVALTYLFWELSKHPD
FT                   LQSALREELHTLEPKILYPRPSSSRDLPTPKSIDSLPLLDAIVTETLRLHAPIPGIQPR
FT                   VTPSPGCTLVGYSDIPGNTRVSAQAYSLHRNPEVFPEPETWQPKRWLKDCNPSEVLEER
FT                   RRWFWAFGSGGRMCVGSNLALQEMKLVVAAIYTNYTTAIIDDEDIEAIDAYTVKPRGEK
FT                   LVLKFESVA"
FT   mRNA            join(<327604..327935,328004..329112,329177..>329316)
FT                   /locus_tag="An01g03250"
FT   exon            327604..327935
FT                   /locus_tag="An01g03250"
FT                   /number=1
FT   sig_peptide     327604..327660
FT                   /locus_tag="An01g03250"
FT                   /inference="protein motif:SignalP:2.0"
FT   mat_peptide     join(327661..327935,328004..329112,329177..329313)
FT                   /locus_tag="An01g03250"
FT   intron          327936..328003
FT                   /locus_tag="An01g03250"
FT                   /number=1
FT   exon            328004..329112
FT                   /locus_tag="An01g03250"
FT                   /number=2
FT   intron          329113..329176
FT                   /locus_tag="An01g03250"
FT                   /number=2
FT   exon            329177..329316
FT                   /locus_tag="An01g03250"
FT                   /number=3
FT   CDS_pept        complement(join(329746..329844,329955..330034,
FT                   330108..330234))
FT                   /locus_tag="An01g03260"
FT                   /note="Title: similarity to hypothetical mitochondrial
FT                   ribosomal protein of the small subunit S37 - Saccharomyces
FT                   cerevisiae"
FT                   /db_xref="GOA:A2Q869"
FT                   /db_xref="InterPro:IPR017264"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q869"
FT                   /inference="profile:PFAM:PF05070"
FT                   /inference="similar to AA sequence:PIR:S77567"
FT                   /protein_id="CAK43692.1"
FT                   /translation="MPPKGVSTRLNPVRLQSIPHLRVRRPNTNEPNTCVAVMSSMLSCW
FT                   ASQGYTHEGCAILEQQLRSCMDAPKPKTQRRNPINYHLMRMFPKVVGPKKKDGVLG"
FT   mRNA            complement(join(<329746..329844,329955..330034,
FT                   330108..>330234))
FT                   /locus_tag="An01g03260"
FT   exon            complement(329746..329844)
FT                   /locus_tag="An01g03260"
FT                   /number=1
FT   intron          complement(329845..329954)
FT                   /locus_tag="An01g03260"
FT                   /number=1
FT   exon            complement(329955..330034)
FT                   /locus_tag="An01g03260"
FT                   /number=2
FT   intron          complement(330035..330107)
FT                   /locus_tag="An01g03260"
FT                   /number=2
FT   exon            complement(330108..330234)
FT                   /locus_tag="An01g03260"
FT                   /number=3
FT   CDS_pept        join(330507..330881,330943..332046,332321..332626)
FT                   /locus_tag="An01g03270"
FT                   /note="Title: strong similarity to hypothetical conserved
FT                   protein B24M22.130 - Neurospora crassa"
FT                   /db_xref="GOA:A2Q870"
FT                   /db_xref="InterPro:IPR018961"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q870"
FT                   /inference="similar to AA sequence:UniProtKB:NCB24M22.12"
FT                   /protein_id="CAK43693.1"
FT                   /translation="MSRRHVSAFYTNTVAPVCAPRRQSIPLSRCFSVGSVRRTAASSKP
FT                   GEQHENTKTQDETKEEEQGAMARRLSDMTEQAMLEGGRSAQRNMQQAGFSDELKQQLEE
FT                   RVAAAAFKNEYATAHSIVDMPSSAGQGTRDIAGAPAWTGTENTHDITLRMLDDSKKRIR
FT                   TPYKIPQPNPVDMRISPKPKESAGLRLAKARERRATYSLSQSEGISEDEREAMRREMRE
FT                   RFSPGARPMPATLQGLSALANERIEDAMARGQFNRIRRGKGVNTETDHRANSPFIDTTE
FT                   YFMNKMIQKQEIVPPWIEKQQDLAREVDRFRSRLRAEWRRHAARLIASEGGSLDIQMRR
FT                   AGAYAAAEARLAERAKIEQAFRESDSASSSGGLDSSDGAPQSSDSTVSGPQEDKDPLPY
FT                   VTPLRDPQYMNTERSFLELTIKNLNALTRTYNLQAPPVAQKPYLNLERELAACYAEVAP
FT                   SLAEEIKRRATERARPKNSGPQAANILESLSTSSKRRSRRLDTYCQTIPYLFDHGISVN
FT                   NPIYLTSSTAAPNHSVPVPQAPHRVQSANPDDCQQHITRCPQNSQEKRDSSIRPQTHQV
FT                   MSKIKSQYPGSKAVYERD"
FT   mRNA            join(<330507..330881,330943..332046,332321..>332626)
FT                   /locus_tag="An01g03270"
FT   exon            330507..330881
FT                   /locus_tag="An01g03270"
FT                   /number=1
FT   intron          330882..330942
FT                   /locus_tag="An01g03270"
FT                   /number=1
FT   exon            330943..332046
FT                   /locus_tag="An01g03270"
FT                   /number=2
FT   intron          332047..332320
FT                   /locus_tag="An01g03270"
FT                   /number=2
FT   exon            332321..332626
FT                   /locus_tag="An01g03270"
FT                   /number=3
FT   exon            334886..>335635
FT                   /locus_tag="An01g03280"
FT                   /number=1
FT   CDS_pept        334886..>335635
FT                   /pseudo
FT                   /locus_tag="An01g03280"
FT                   /note="Remark: C-terminally truncated due to contig
FT                   border."
FT                   /note="hypothetical protein [truncated ORF]"
FT                   /db_xref="PSEUDO:CAK43694.1"
FT   mRNA            <334886..>335635
FT                   /locus_tag="An01g03280"
FT   sig_peptide     334886..334933
FT                   /locus_tag="An01g03280"
FT                   /inference="protein motif:SignalP:2.0"
FT   mat_peptide     334934..>335635
FT                   /pseudo
FT                   /locus_tag="An01g03280"
FT                   /note="hypothetical protein [truncated ORF]"
XX
SQ   Sequence 335637 BP; 84311 A; 84319 C; 84025 G; 82978 T; 4 other;
     gcatgagtat ctcctgatcc attagatgaa ttaggaaagt atctcaactg gggttgtagc        60
     tcagtggtag agcgctcgct ttgcatgcga gaggtcaagg gttcgatccc cttcagctcc       120
     attttttgtt tttttggccc cctctcttct cagttatcca tactatctac ccatcacgac       180
     taagtaactt cccagagtag aatttttatc cttttttttt ttattgatgt gagatatttc       240
     cattactgat gaaaagtaaa taaaggaata aagttccacc agaacaaaaa tcatgcttct       300
     ggatcgcttc gcttatagac tagatttgca atgaaaaact ttaatcgggg cgggtccggc       360
     agacgggagg gaggggaacc actatctatt atccactgtc tatccagtaa ccagtgatag       420
     ccattttcag ggactcgtgg atgggattgg accatgaatg ggcgggttgg attcttggtt       480
     ttgtttatta gggggattgg agtggcaaac atcgtggaag tcggaatggg ttagctggtt       540
     tctgttattt caaattcggt tgtactagtg ttgttgaaat atatttctgc tacgtagtag       600
     gatgtaggct agcgaacatg gatttcgctc acgaagtgta ctactgaaag gttactgtct       660
     gaactgaagt atgatgtact cgacattcag aatgctgatc aaaggtatca tcttcacttc       720
     gcactccccc acaacttaac atcccccatc atccctacaa acccctcccc gatcctctgc       780
     actggtgcct cgatcgcaat gggcgcccac actagcgact ccccattcac ccctagtctc       840
     gctagaaact ccatcttttc gccaccatca acggaaagaa aagttttatt accctttccg       900
     attaaactaa catccgacca tttaccgacc ggaagactgt aattcaatgt gtatggattc       960
     ccgccgctca ccagggtaat attactaatt gacccgttgc cgttgaggag tgtcgagtct      1020
     ctccccgaga ataaaggtga cgggtgagtt gtggaaggat atacagaaaa agagagggta      1080
     tagtctctcc ctttgctctg gatgggtgta gtgagggtgc atgttcctgt gaacctgatt      1140
     gttgagttag aagtatcgat gggacaggtg tgattgaatg tggcgtggta gttattccct      1200
     gataagtctg gaactgtggt tccagtggca ttggcgaagt tgtagtgcag aatcaaatcg      1260
     gttttgcttg ggacatggcg atccaagttc tgccctggga tcacagcatg aagagcatcg      1320
     aacacatcat catattcttc ttccaggata tcaccgcccc attgcttgtc cgctagtgcg      1380
     gggagaacat cacgccagga gtaatacgcc tcgaggtagg tcgttgcgtt gggcccgtag      1440
     tcgttccaga gggcggcgat gtggccgagt acgtaggggt tatttcttgg agggttgtcg      1500
     gttgcgttgc tggtagagaa gatgttgggg gcgtagggac cgttgtttgc tggatcaccg      1560
     tggaagactc gcgtcttgtt gaggtactgt gggtagcttc cggaccattt cccgacaatg      1620
     tagaaggcgt cgtcggagtt gaggaccgag tagttattct tgatgtagtc gaagtagggg      1680
     ttgtcttcga agtattccca gtgctggatg gtgacggctt tggagacatt ggcgccctct      1740
     gatggggtga aggtgcccca gatgcgggtg tctttgtcgg attgctcggc gatgtaggtg      1800
     tgcatgtcgt tgacgaagtc ggtgtagtcg gctacgtagg aggaggaata ttcgtctgcg      1860
     ccgaggtgga cggttttgct gtggaaccag gggaggaagg ttttccagat ggatttcatg      1920
     gtcgggatgg tgtctggatg gctgatgttg agcatgctga gatcagtgag gccgagttca      1980
     ggtcgccatt gcacgatggc gagggcatgc ccgggggctt ctatctcagg gatgatagtg      2040
     acaccgcgac gggcgcattg gcgctggatg tgatcgaatt ggctgcgcgt gtaggattcg      2100
     ttggctcgtt tgttgagccc agatacggcg ggatcgtcgg accagggccg gaatgctgcg      2160
     tagaggtcca tggattcctg ggtggagtag aggtcgacgt tgttgtagag attgtcgctg      2220
     aggtggaggt ggaagacgtt ctgcttgaag aacgacaggt acgagcacat ttcgatcaaa      2280
     aagtcgggtg ggtagtagtg acgtccggca tcgagcttat cggttagatg ttggttgtat      2340
     agtggtaatg ggagggctta ccatgacacc gcgtgtttcc catcctggag catcgattgc      2400
     agagccctga ggaaggtcgt gtttgctgac tacagcggcc tggattagtg agcgcgttcc      2460
     ccaccagacg cctaggggac tcgctccaga gatggtgatt cctttgttgt cgatgtgcaa      2520
     ggcatatgcc tccgctgtga agcgtcctgc aacatcgcgg aagcccgtgt tattggagag      2580
     ggtcaggaag attgtattgt cgctggaggt gctactggag acgagtggga gattgattcc      2640
     aagcgaagat cgaaggtcct cttggaacgt cgcagcaaac tctctcaatg ttggcgggat      2700
     taatgtttga ccttgagtat ccacagtact ggcgtggcga gtatccacga caatcttggt      2760
     gagctgggac agtgcatagg tgccattatt atcatcgaat ggaatagtgg ggaccgtcac      2820
     cagacgggcg aaccctgtga ttgtaagaaa ctacatgagt tatgatagat caaggcgcat      2880
     accgcagatg gtgaagtcaa gaacaagact aagtgtgccc agtgccctcc accgcatggt      2940
     gataacttaa tgtgttttgg agtatttgga acgggcgtgc gccgctgaat aaatagtacc      3000
     ctggcaggtc cgttatagcg catgtaacct ggaaatactg gagaagactt gcagaatgat      3060
     agcaaggttg cagctcggct agcagggtta tattgaccgt ttcatgcaaa ctggaagtag      3120
     cgtcctcaag agatccttga ttggttatga ttgtgaagtt gagggctaag cgggaacccc      3180
     gcacggagtt gatatgcgct tcacagagat aacctatgag gtatcgggtt actatcggat      3240
     tgccccgaca gttgactgca gatcatgtac tagagcatac tagtagtgtc accttcccct      3300
     cttcatgtaa cgtaccactg tgaagaagat attgatagat cgaggttctt cagtgggtgg      3360
     atgtaacata taggccaggg aaggtctgtg tcgaaagaac cgataagcta aagcagcgcc      3420
     ggatacgatg tagaccctga taaaggtata cgtcattcta caaggcgcat gtctcaatag      3480
     tgtgagtagc tttatctacg tggatgtact gataggaggt gggatgagag atagagggta      3540
     ggaaacccac aattaagtca ataattttcc ggcaacagct gaaaaagccc aaaatgtata      3600
     tccggacgca atatcctgtt gcgttagcca gcaacactca tataagcttc acatgttagt      3660
     atcaatatac caaagccaac gacaccatac ccacatccca gtcatgatgt tcagacacag      3720
     tatatccatc ggatttacat cgagcctatc attctactgg aacaaagtct caaaatcctc      3780
     cttttcagct tcaatttcac gctccgagtc cgcatcccca tcactttcct gcaccttaac      3840
     cttcgcagca ggagaaaaac gatgtttcgg actcttcgcc accggactct ttgtcgcatg      3900
     atgctgatgg ggatgctgct cactttcctt cacctcctcc tcttccgagg tttcattctc      3960
     ctcagctttg acggccttcc tgatagcctt tacttgatcc aaccctctct tcagtcgatc      4020
     cagcatttct gtgaggttaa ttagctgcag gtccagggca tcgcggacct cgtcaaggtg      4080
     atccaacaat gcgccagttt ggaaggatat gaagtagtgg atgctcggag ccagtccttc      4140
     ctgtatgtct ttcaagtcat ttgcgaggtc gtcgaggtcc tcggggctga agtctcttga      4200
     tggggaggac atgttgttga ggctgatgct aaggggtgag tggtgaacgc gatgtattga      4260
     atggtgagtg gtgagtggga gagctcgagt tgatcggtcc aagttacata gaataggaat      4320
     gggacagaag attagaagga tataacagcc atatttaagt tatcaaggtg aaaatcgaga      4380
     ttgtagtcct aaattcatca acatctctat cccccggaac attcctctta atatcaaaac      4440
     accatcccca aacccccaaa tccggaaatt cccttcccta ccagaccccc aacatccaaa      4500
     tccacctcca aacaaaaacc aatactacac atcatcacac tcccctccat ccaacccaca      4560
     agaaagtaaa ctctccgcct cgctcccacc actctccacc aaactctccg gatactccac      4620
     ccggcaacaa gcacacgcgc acgcacaccc agacgcacat tcacactcac tgccatcaag      4680
     actcggatca atttccacct ccgtctcgga attgctctcc tcagtttccg tctcggactc      4740
     ggtgtctccc tcgctgctat ccttctttcc gtttcccttg ctctgaatgt acgcaggttc      4800
     ctgtttcttt tcgtgcacaa ttgcaattcc cctcatagaa cattcggctt ccgcatcaat      4860
     agcatcgtta atgacttcgt gccatatatc cctgcatttg tctttcaggg tccgggagca      4920
     cccctgctcg gtcattttcg acatgtagat tttgcggact tcgccgagtg aggaggctga      4980
     gatggagggt ttgcgggtga gattgttgga catggtgctt gcttcggtga gggttttatt      5040
     ggcggtatag cttgggggtg cggggatgag gaggatgggg tgggatgaag agatgggtgg      5100
     aggtggtagg gagaggggtg gagttggtta tctttgtttt gttgaatgtc gttatgttta      5160
     aagaaggaga gggaggatga aagtagaggt agacgggcaa agaagcgtta gagtacgaaa      5220
     aactgacgct gagacgaggg atacggaacg tcaatgaggc gtcagtttga gttctctgta      5280
     ttggggattg tgttgctacc tagcgggggg catgggatac ccgtgataat ggcccggcga      5340
     tggtgaatgg gctaatatta gtcgttatag cgggtcacct tacaagagtg tgcacgctca      5400
     gggcaaacat gaaagattga actgcgtgaa cggatgcata gtattcaaat ctgatatcac      5460
     aacctgattc aataatggga agcaccgcct ctccaaaaat aaactgtcta tagcatacat      5520
     ctgtgcgcga tgggctggaa tcttgcccga atccgatcgc cgtaggacaa agtagaaaga      5580
     agggaaaggg aaatgggaac ctccgctgtc tcgttgtctg gatcgtgaac ggctgttggc      5640
     gtggactcga ttgcaagagc gcataggctt gtaccgtgtc gggatggtcg aagtcaagaa      5700
     tatcatccac atcggatgtc tcgtgctata tcgacgtccc tagacgaaaa aggaacatga      5760
     aactgccggg catattttct ggcgttgggg cggggcgcgt gcggcactat ccgcgggagt      5820
     cttggcgatc gattggtcga accattgtca aaaggtgcat gggcattggg agatctccga      5880
     agtgtcgcgt tgggtcgtat ccatcatgcc actcaaggct ttaacggggc cacaataaac      5940
     gcaagcaaac attctcaaca gcaagcacct ggtaaaatca aaacttgcaa gaattgcaag      6000
     aacttttgga acagtatata cagaacaaca agcaagtaaa cacgtctcct acacaaggcg      6060
     aaacctcatg tgaagagaaa ccttcctaca tctgggccac taaacatttt tctggttgct      6120
     ggggcatcga tgcgatcagt ccattgtcgc aagggtaatt cggtacattc acgggcttcg      6180
     ggttgtcgct tcggatcgtc gctacagggc tttgttgaac ggaggtcgct agggatggca      6240
     tccaaatggg ggatcagtat tcacgtagcg ctggggatat ctgataatcg ctgggaaggc      6300
     cggttgtcgc aagggatcca atgggttgct gaagggcttg gtatgggaat gttatgtcgt      6360
     tgggtatata acagggcgct gggtataagg attgctgcgg ggctcgcttg gctcggcata      6420
     cgggttgtcg ctcaagggat cgattcgtac acgggcttgt tgcaggggtt cgctcgggta      6480
     tcatgtcgcg ggggtaaatg aagtaatggg ggtgtgtcgg agagcgcctc gggcaaacat      6540
     aatggccgtt catcagttct cttgtccgtc cttttccgat ttggcgtcgc cgggtaggtt      6600
     gctttcggag gctgaatctg ctacaactgc ttcggtaatg gggccatggt agaagcgctt      6660
     gccgctgatg aaccagtaaa ccagcgcaaa cagcaagaca aacaccagga acacacaggc      6720
     atagttcatc tgagggaggg tgatttggtc agcccaaaga gagcacgggt atgcaatcaa      6780
     atccacttac gttgtcaggg gtcacgggac ggtccgtggg cagaacgaaa ataatgctga      6840
     cgaatagtgt ccaaagacag gcccaggcat ttacgaccgt gctaaagatg cccatgtgcc      6900
     aaggtccggg tttgaattgg ccaaacagca atttgcacag aacggggatg caataactcc      6960
     agtcaagagc gatggagcag agggtgaaaa cggcatcaac tgccgtgtag gatcccagag      7020
     cgataagatt gatcgcaatg cagaaaaaca cggagatcca gaccgcatag aggggagtcc      7080
     cggtgatggg agataccttg acccacacgt tggaaaaggg aagcatgcgg tcacgtgaaa      7140
     atgcaaacac agtccggcca agcgactgca tggctgtgaa ggtgacaaac ttgataatga      7200
     gcagagcaga aatggtgaag aagatggcac cgccctttcc aaggctgtta tagaagatct      7260
     gtgcgactgg ctgctccatc ttggagttga gaatggcgtt cgggtcaccc atgcagaagc      7320
     acagaacgat attgaacagg aagccagcca gataagtgaa caacatagcc atcgaaattg      7380
     cccaaggcgc cttgatctca gggttgctga tctcctcggt gatatgggcc gtggcatcat      7440
     agtccgtcat ggtccagctg acagacagga agccaaacag ccaactgaaa ccgatcggct      7500
     tccaaccagt ggtcgattcg acatgggtga agacgtacga ggcatcgtgc ttatcgtccg      7560
     tcatgacaag aagagcaatc gcacaagcga cgaggatgca gacgtgaaag atgacataga      7620
     acttggtcat cttttccatc cagtatgtag acagagagtt aaccagaccg gtgatgacag      7680
     tcaaaccagc catcacacca acggtagtgg tggttttgat ttcgtaattg tccattccct      7740
     tgcacatcga gacaatggcc aggagcattt gcgcaccacc atactcggat gaggcaacac      7800
     cacaaatttg gccaaggaag tttaaccaac cagtcaccct aaagagtatc aacaatcatt      7860
     ctctgagaca aaataattgt cttggaacat caaggtttcc ataccaactg atcgatggga      7920
     cccaatcatg tggagcaagt ctagagatcg tgaaatacct gtcgcttagg gtcagcggct      7980
     gtcgttccga gcgaacggtg acacttacag gcctccagag gtcggatagg cggatacaag      8040
     ctcagcaacc gaaagctgca gcgggtttga tcagcctctg tacccacgcc gcatagcgca      8100
     ttgttatatc ggattaccta ccgcgataca catgcacccg gctcccgaaa caagccaaca      8160
     ccataccacc gcgctgcttc ctcccgcctc gagaggatag gacatggtgg tcatgatggt      8220
     tgcaaacaaa ccactgatac tgactgcgaa cgaaaaggtg gagaggtaac cgaactctcg      8280
     cttgaagacg ggcttgtaac caaactctgc ggcgagttgg gtgtcggcct gattcgtacc      8340
     ggcgatgcgg accttctcga gttcggcacc gtcagtctcc atggctggat tcgcgggtgc      8400
     tttgatgtct gccatgattg cttgtcgatt atacagcgtg gttgaggcag aatatccagg      8460
     gcaagcaggg ttaggaagcg ttaactgcag aatacaaaga gaagaaaaaa aacttttgag      8520
     agaaactgaa aagattttaa aagttcatgc aaggcgtcag cgatagtgaa atcggtctaa      8580
     gatatatccg gtatagtcgc atatcggcaa gaccaagttg cgcgtcggtg ggacgaatta      8640
     taacgaagct caatggtcaa gagacgcaga gacctggtaa gcttcgccgg cgggtcgtat      8700
     agaacgccgc tacggagtac cgggggctgt attgctgtgt cgggcgtgcc cctctatctc      8760
     cctattccac ggacatgagg cacaggaaca agggcaagtg gattctagtg gatcaccatg      8820
     acatcccgtc cgcgtttcct ggctgtttcg cgggacagct ttcctacacc cagtttagcg      8880
     ggtgcaccgg acctccattc cacggcctcc ccaatggcca gcccgccccc gccggcgttc      8940
     atttcccaga ggctctcctc gtctatcgct gcccctgatt ggtgttggcc gttagccacg      9000
     acgccacgtg ggacccccga taccgctgat gtcattgcac gggcccgggg tcctctggta      9060
     actcggctaa catgcctagt gtggtgataa tagaaactat tggaaaggca gagtaaattg      9120
     catgtgagag gtgaatgagt cgtatgaatc ctggttgtga ttttacgtga ttctctcagg      9180
     taaacctcgc tgagaatagg ggagagacag aggcagtctt agcgcagcga actaattaat      9240
     cggaccgaat gtcttggtgg gacaactgct ggcttaccta actggcttat cttgtagctg      9300
     ggaaatgcca ttggcggatt gtccgatagg agtgcgtctt ggctgcagtg acggaaaggc      9360
     ttgtcttact ggccagataa ggtgtcgggg ccgtatcttt ccgatgctga caatgaccga      9420
     cacagtaagg atgagcatct tcggagcaac tcgccccttg tcacgtgcag acgtaccgga      9480
     acaggcaagg ttttccagga tggctgacca gccggccgtg tgtatatagt cctgccatgt      9540
     tataccctta cactatccca acaatagaat ggtcgatatt gtctaaggtt tcatcgacat      9600
     agtagatatg tggaaactct cactatatcg ggaagcatta gccatgatcc atgatagaac      9660
     agcagtgctt atctgtagtg gcgcggtccg cgaccgtgtc tccgaccttc aattgattaa      9720
     acccgaacgc tagtctgcag acccattggt tgataccagc aatgtgcagg tcctcgtatg      9780
     atcagcgacc cggctaggtc ggtttgtctg cccgtgttcc gtctgaagcg cctcaacata      9840
     ttgcgatata ctccacatgg gacggtccgt agtccctggc caggagcggg gacgggaaag      9900
     cttgcggtac gggactttgg tcggagatct cgcagatagt acgaaaatcg attgagagat      9960
     atggctatca gatggagata gcgtgagacg tgataaaacg atgacaaacg tcttgacagt     10020
     tgatgacttg gtaatggtga gttgatggca agattaagag cggaatgaga tgaggtgaaa     10080
     ctagcaggaa ctcggtcacc tgagacggcg tgactgctaa ctgctacaaa ccgttcaaac     10140
     tctccgcggt attcggactc ataactacta gtatacgttg aaagatcttg tccagcagga     10200
     ttattccggg agatcagcgc tttattgatg ctattatcaa tgattcccga tcatatgaaa     10260
     ataaccatag aaccccgaat cgtgtctaga gcaaccgcag cctcttcgca agcaagcaac     10320
     aaaccataac aaacgcgcac atacacccta cgataccaaa aaaccatccc agattatcca     10380
     cattctgtcc aggcacctcg acgttcatac caaacaaccc agtaaccatg tgcaagggta     10440
     cgaagattgt cgccaggata gtcaccttac tcaagactgc attcacgtca taactcaacc     10500
     ggatattgtt gacgctcaac tgggccagga agttcgactg tgaccggccc acaatttcat     10560
     cgaaatggga caaactggtc aatgtggtca cgagatgatc ttgtacgtcg cccagataca     10620
     ccaagagatc gccgtccggg aacattgggt ttctgtcttt tgcctgacaa cgcttgacga     10680
     agccacttaa gacgtcgtac ttgccggtca ggcagcggat gagctgagtg atactcttgc     10740
     ggaggctatc aagttgagga atgagcgctt tgacgtcgtc gacgcgggcg atgaacactt     10800
     gatcttcgat cgcatcggct tcacgttctg ctgcgcgcat gtacggttcg aaatcatcga     10860
     taatttcgtc actggatttt ggttttagtt ggagtctggg aggatcagga caaggaatag     10920
     cgggcgtaca taagagcgta gcagatccaa tcactcgaca ccaaatgtgt gtcctgagtc     10980
     cgacggatcc ggtcccggac tcgggcgatg tggtgacatc cactgggaga aaaggtcacc     11040
     gtggcgttct tgaacaccag tatatagaaa cccgcggagc cggggatgga cgatgatggc     11100
     ttgaggcttc gagaactctt aaagtcgtct gttggaagca gggtttgaaa agatattagg     11160
     tagtagttgc gaaacgcctc aatcttctcg cgaggttccc gggtcgcgat gtcctctgcc     11220
     gtcaggggat ggatcgataa tgcctggcag acagtgctga cctcctcctc agtggcgtcg     11280
     cagatgtcaa cccaccacgt atcccgctct gaccctttcg tatcagcaga cagggtggac     11340
     tgctcgatga gcaaaccctc ccaggtggac gaggtgacga cctgctgggt ccgacaggaa     11400
     aagtgggaaa accggtggag tcccttggcg tccatcttgt gaatccagac tgagcagcca     11460
     cctcagggag cgaaagagcg acagtaaaaa ttattcacac acaagcgtat ctaaccacag     11520
     tgaaaacgca caaagccaga gaagggcagg aaaggcgtac actcagccca ttctatgata     11580
     taaacgcttg ttgactgatc gaacaagcaa aacgtcatag atcgtcgaca cggttttcat     11640
     ccgtaaacgg ctgggccaag gtagacagag agcgagtgac tttggattta aagagaaagc     11700
     agtaagaaaa aggacatcca cgttgcgcaa ggccaggggt caactgatat ttcacaaaag     11760
     tgcagcggca gccttgtagg gctgagggag cgggcccctt tcccctcccg aggagccaat     11820
     agtggagacc cccagcaaag tcttccggct gccctgccca gtcactcttc gcatctggcg     11880
     cgaattgacc cagccagctc ttctggttgg ccagctcccg aggaccccgt ggacaacttt     11940
     cggaaagtcg gaaggcagga tttggtagga ttatcgggtt caggcagcat ttttaccaca     12000
     ggctttcctg aatgggatta gaggattcta tctaaagatc caatgtcttt ggcgcggtgc     12060
     aacgtttacc cccgctgctg tggctcggac gagacccgtt gggaatgacg atagcaggct     12120
     gccaccttgg caatggcgca agcaaatggg atataacctt gacataagag ccttggcttg     12180
     tttcccactt tcaaggatca tgtctgaatc gatttgctca tccttgaagt ttcaaaacct     12240
     ttcctcaata gtaccacaag gactctttgt tcgttgagag aaaaaaacgc ccatcactaa     12300
     acgagatgtc ttccacctcc actctcatgt aagctgcagc acaatggtca actaaattca     12360
     actagcgtgc tgaccagttt taaacagatc cgccataggg gtcgtgtgga gatatgcctg     12420
     gtttctggcg tttcgtccat tggccatcct cgtgctgacg ggtgcaacca tatcccttat     12480
     tcgatctggt gtctcacttt gcaaagatat tccctccatg gcctatgaga tgtaggtatc     12540
     tgcttgactt gagctttacg atttccgcta attctgctta tcccagattc atgtggttca     12600
     cctcctaagg gtttggggag aaggatgtgt taatacctgc attacgtact ggagcgaggg     12660
     tatcttggcg ttgatttgtc ataaatgcat tgttcattgg ttaaagcgat tcaatcctgc     12720
     attgcatatg tacattgtat aatttttctg ccagcatctg ctgttcagac tatgtgtcac     12780
     atttattgga gttcagtgtc aattcaagct gtgattgttt atcagtacat aaaacctgtc     12840
     aaattgggcc ttgaaatctt ccataataaa taatttgaaa atctcacatg ttctgcttta     12900
     gcaaggattt aaacatattt gtcaggtaga ttgaaagaca ccaatgattc ggatagtgac     12960
     tgccgggtat ggagaggagg gaatggagag agcgaccgga tttgaccaaa tcttgagaag     13020
     gtcacatgac gcaagtctat ctccaaagat ggatattccg aactcacaga aaatactaga     13080
     ctgttccctg tagtagaaaa tatggaagat taagagaccc gcatgaccac gtctttatgg     13140
     cacattgcac tatttaccag gaatgtatat gacgattcgt ctatagacag aatctcagtc     13200
     taggatagac tttcgataca tcaagcctca tcacattagc attgtacaca atgattactt     13260
     actgccatgc aaaccggtcg ctggcagcga aaactggaat tgggagaagc acccaaatcc     13320
     atccaatcag atgcgatgac tttcgaatca aaagcacgca caattccgac caatcagtaa     13380
     tccccggaat tgaatccgct tcgcatctta tagcctgagg catcaacaca acctttcaca     13440
     gccccccacc accgtccaat ccgagctgat atcaccaata ccactgacca ccatcaattc     13500
     aacaacaaca caatggatag cctcaacttc cccacccaag accgcgcctt cttggaaccc     13560
     catctcccac ccaaatatgg caacccatca tcatcatcat ctctcccctt caccaccctc     13620
     accttcgcca catccctcga ctcacaatta gctctttccc cgggcacccg gaccgtgctg     13680
     tccggcccgc aatccaaagc catgacgcac tatctacgct cacgccatga cgccattctc     13740
     atcggcgtag gcactgccgt ggctgacaac ccgggcctga actgtcgatt ggcaggggta     13800
     ggcggatacg gctccgaagg tttagcgggc cagccccgac caattatcat cgacccctca     13860
     gccagatggg agtttacggc gcactcgaaa atcttcgagc tggcgaggaa tgggcggggc     13920
     agggctccgt tcatcattac ggctgcggag acggtgcctt ctgcacctca gagggaggtt     13980
     ttggagagtc atggggggaa gtttattgcg ttgccggtgg gggtcggttc ggatggtgcg     14040
     catcggatcg attggactgc gttgttggag tgtcttgtgc gtgaggggtt acggagcgtg     14100
     atgattgagg ggggcgggtc tattattaac tcgttgcttg agccggggtg tcagacgctg     14160
     gtggattcag tgattgttac gattgctcca acttggctgg ggcagggagg tgtggtggtt     14220
     tcgccaagga ggagggttga agggggtatg gttgttccag cttcgagatt gaccggggtc     14280
     aaatggtatc cgtttgggga ggatgtggtg ctttgtggga ggatcaaggg gtctgattag     14340
     gggggtctcc gttcgccaaa acgcatattc attcatgcag tatagaaaag atggttcctg     14400
     agtcatgatg cttccctatg aatcagattt ccctgttgca gcatattcac ggtatccagt     14460
     atgttgtcca tgcagttgaa gagataccgc cgaatacgca gtgcttcatt tccgtagatc     14520
     tgttcctcta gcttgagaca tagcctcttg taagcatcct tattcactgg gaggcctcgt     14580
     acctcgaaaa agttgttgac aatcctaaag taccaaaagg tggtgctcac gcgaacacct     14640
     aatgctcgct cagctctggc cacggtgcga gaagggcgat aatcaagaat tatgtagagg     14700
     acctccatgg gcaacttgca cactatgaga ggtatctgct cttccttttt ccggcgagat     14760
     aggtagagtc tctttaacca attgcgtctt ttaccctgca ttgcgccgta aactgcactc     14820
     gaaacacgct ttgtgcggac aaggatctag tgcattcagt ctgttatcaa ggtgtacaag     14880
     agcacacata ctgcctttac acaagctgag tcttaccttc cgcaaacatc ttatgttccc     14940
     aacgtttgca tggactacca accacacggc gtctatatcg aagggcagcg atgacagcag     15000
     gcagatcagt ctccgcgacg cgacccagcg catggtgcga cagcagttcc cagcagcggg     15060
     catgaacggt acaacctacc caatccgctg gagacgttgc cttcataccc atacaataca     15120
     ctttgggatc aacgtagact cttttcccct tgaccatgat aggaacacac aacctccaag     15180
     tctcttgttc taataagtat gtaccagaaa ctctatatgt ggacttcgct tccctatgga     15240
     taactgacat ttattatcag cttcaaactt cgaaaccacc ttgagtcatg taacactcac     15300
     tcatccgttg ccacatccac catcggttcg gcacatattc aatatgccgt agccgttctt     15360
     cttctatgcc ttcggcctga gcaacggctt tgtaatttgg atgacgaggg taacttttgt     15420
     ccccccgtac cctatacgag acagggcgca tgccccagga gtcattgtac tggaagccac     15480
     atatgtagca gcagcaatag ttatatccgc agaacggatt cctggctcga gcatagtgct     15540
     cttcccagtc atccgctagg aactcctccg gaatagagct tatattgctc accttgttcc     15600
     ccatggtaat tcttcgtggt tgaggaaaga agagatggaa tcaaccagcg tttatatatg     15660
     tacggtatgc tgcccctgac ggcaatgatg acaaaaaggc gggaatttat ttccgggcaa     15720
     actaaatgag taggcctcca tctttccctt acactgtgac ttgttggatt tgggagcatt     15780
     tcgctggcta cactggggag agagcggctc catgaaccta gttcgtcggc ttcagggcga     15840
     accagtcgtt agtcagattg tagttgagta atgtgaccgc catcgtgact ccatttcatt     15900
     actaaacccc gcttattagg tacttcttcc acggatatct gaccgggact atggttcgtc     15960
     atgtctttag ctggatgccc agttctatcg tctgcgcaat ccataccact ggcccctccc     16020
     ttgcaacaca aaaagagttg caagggacaa gatgtatctt ctaccatcag tcatgatctt     16080
     ttgcttcgtt ttcagtaatt aataaaataa cattatgcgg cacatgttct tacaagaaag     16140
     tatatttgcc ggccaatcct aaaaaaaagt tgtatataac cacgaaaaac agcttgtatg     16200
     tgctcttcgt tcttgctgga tgacaatcca ttcccgcttc taggcctggt gtagcttacc     16260
     tatgtggatt cttcctctca aaatcttgct tctttcgaag ccttccgaac tgcgcttttc     16320
     agtgaagcta ttctttccgg ggagtctggc gaaagcaagc acagattctc actatgccag     16380
     catgtgatgt ttaagtgact tcacagaaca gtgagttatt tctaggccct cgggatatgc     16440
     cagcaaatgc cgaaatagca caggtttgcc aaacatttta tcattgtgct ggcttgtact     16500
     agttcaacta ttggatctca taaacataaa cataatattc ccaaagacat tcatcacaca     16560
     aaatagtatt atagatcggc atatcccaag tcctcagtaa tattacgaca aagatttgat     16620
     cgtggagcct ttataaggtg ctctgattct atggataatt ataagcccct ttatatatcg     16680
     tcacagaccc atatacacaa cgacatccaa taggcccgca ttcaattgac taccgcgatg     16740
     cctgattttc aggatgtcga agatgtctgg catgagatat gcgagtatct cgagaccaga     16800
     gacctcttca atatttgctt gacatcccgc actatcaatc atgttggcac tcgctatctc     16860
     tatcgaaaga tcaagtggga ttggaaggga aagaagtctc gataccgaat tatgtcgctg     16920
     tggacagccc ttgtccaaga taaggacaaa cgcagccgcc tgtgtggctc tgtccgggag     16980
     gtgcatttac tggggagcac tcctcccaag gatactcgga tcgttgaatg ccccgagatc     17040
     caagagggta accctagctc actctctatc atcagaagtg ataaggtgcc cttttaccag     17100
     gagatcgact atctcagaga tgttgtgagt agcgtcgttg aaagcccgaa gggccgttta     17160
     gcatggctcg agtccattgc agcgcgaaac gtctatgctt tggtggccct cctcctacct     17220
     ttactccata acctgaggtc tctcaagctc gattacacct tcgctgtcaa tggcggatat     17280
     cctggacaaa tgattgaatc tcttacctct ggtaaagaga tacattccgc agagttgcag     17340
     aataactttg agcacctcga agtcttcgat tatggaacaa atgcactgca caacaatctg     17400
     ccgcattcgt gcgataatac acatattcgg atgcgttatt catcacaatt gatcccgata     17460
     ttccagttac agcaggtcaa gcaccttaag gtctggctac gtagccggca cggccttctt     17520
     ctcgcgcgga ttccagatgt tcagatgaac cactgggcac tcgaaaccct tgttttagac     17580
     catatttcag taatggactg cgcgctattc aaggtcttca aaagaacgaa caagcttcgc     17640
     agccttcacc ttggtatgaa cgccgaagag aaagatttct ggtatgttgg tataccctct     17700
     gcagatgata gcaaatacat ctggaacgga ctgagagcat tgtgtggttg tctggagcac     17760
     ctgtcgatca gtttctctat cacaccaaga agtcgggagt atcgcattga caccataatg     17820
     tggggccctc ttttcagaca tatgacggct ggattctttc aggattttac tcggctcaag     17880
     acacttgaat tgccgatcca gatgcttaat ggattcaggg atataatgga ggttggtata     17940
     cagcaagatt tgccagtaac actggaaaag cttggcctgc ggtgggactt ccgtgacgta     18000
     gaaagctacg atgtgccgac agctacagtg cgcattctct gggtattgac ggaattcctt     18060
     cggttgccgg accgtcatca acgggtgcct ctattgcagg aggtgattat ccgtctattt     18120
     atcggcgagg atgggcttag taggacagtg gtagattgtg acgacctgat tgagcaattc     18180
     aacatgtatg tgagagttcg cgctgaccat atgcgactag gactgtggac gaacggacct     18240
     tgatgctcaa cgacgtatca ctggacatac gcgggattat gccaaaccat cgacgacaat     18300
     cctacccaag ctcaactcat tattctctct tgttaccaga ccgccagaca taaggaggaa     18360
     aagtatgctt catttatata cttgaattgc tacacgaaag taacatgcaa aatgacatag     18420
     cctcagccct acgtaagata tacctatcat gctgtgatac agatgcagca ttatcatgat     18480
     ctaaaaaaca tgaactgtca atcaaactac tgctttatca attcagaatg aagctttggc     18540
     acgacagcac tattaagtaa atctttgtgt cgcattacaa agtccccagt aaacgccgtc     18600
     tcagtagtgg ttctatcagt tagaatcatc gcatcatctg ccgtccgatc atcagcttat     18660
     tgccgcagac ccaatatata ttttcaaaat ctttttccta acacctcggc tatttactac     18720
     tactaaccaa acccccatca aacaatggaa taaactcaga gaccctccaa ataccgatat     18780
     tgcacgtgcc ttcacccgca gcctcgtatc tcactcagcc agtcagcata gccacatcat     18840
     gcattccaaa ccatgcaagc acgagatgag gcggagtaat ccgtatgact ttgcccatca     18900
     cgcccatcag cagccttgtg taacttgaaa aaggctgagg ctcaacctgg tatatataat     18960
     atgatgaacc ccctctctgc tccatctccc atgctacaat acaatcttta tccttttata     19020
     cactaagaat ctgaaaacca tatataaaat tcaagataga caaggcattt tccgacccaa     19080
     caaactccac attccacatc accccacatt gatataccga acccataaca taaataccac     19140
     caactatctc acccaaaatc cctgcaaaat ccaagacaat gtgcttcacc tcatattctg     19200
     acgaacccgt ttccccggcc cgtcctcgac ccacatccac caacggtact acttctcgac     19260
     ctggtcaggg aacagcctgg cccaaccctt caagaacaag aaggagacga ggccgacgat     19320
     actatggagg aggctatgtt cctggcgcag cttgtggcgg agggggaggt ggggcaggct     19380
     gtggtggtgg tggaggagga ggaggaggag gaggaggctg ctgaggagga agagatgatg     19440
     gtggaggggg aagctgaaga tgagttttga tgatgttgtt cattttggtt gggttgttgt     19500
     tcttctggtc cggtgggttt gggggaggtt ttaaggatgg gggtgggaag gatagatgtt     19560
     tgactagatt gtttacagac gcatagggct taattgattt gctgatttgc tgatttgcct     19620
     ctggtatccg gataagatac aatatacgaa gtgtgaaatt tggtctatat tgccctgatc     19680
     ggactttgaa tgaactatcg caaaaggaat agatggatta gtgatgagtt ttccatcgag     19740
     taggcgtcga cagacctaaa tccgcagaga cgatggatct ctgtgtatca catattctga     19800
     tcagatgtag cctggcatga ttggagcgta aatattcgat gtcattgaga cagatgagca     19860
     aaaagccgtc tcggaattcg gaaggagaac actctgagcc ccatcagcag ccataacaca     19920
     cagacaaaac cccactcgct agcaaaatct cttctcgaat acttcgatca ttaaacatac     19980
     aataaatata ataacttatt ccttaccgaa agccatcaat aatattaccc agcggcatgc     20040
     tcggaatagg tgcaaaatcc gacaaacacc gccgccatac tcggaacatc cgtcaacacc     20100
     gaattcaacc agtgtcacgc ttatccagca caccattacg cacgaggagc aatctacaag     20160
     gaccctgaaa atattaagtg atccctgccg tgtttagagg atcaagttga tagcttgcaa     20220
     ttggactaaa catgcagatc agacgccctt cctctgacat accggaacag cctcggaatc     20280
     tattccggcg ccaaccccac cggcctcggc ttatcgataa aagaaatcca gatcctcatt     20340
     cctgcctcct ccgaactctc cgctgaattt cactttattt ttcctcatcc acctccccaa     20400
     tccccctcta aaatcacctc agggacatta atttctttcc aatggaccgc gaacagttcc     20460
     gggaggccgc ccactcggcc attgacgaca gttagtccct gttccaattc ctgcaccccg     20520
     cacttctcca aaccccgccc gcattgccac acaaacacac tcacacagac acacaactaa     20580
     ccaacccccc aaaaaacagt aattaactac ttcgatgacc tcccaaacca gcgcgttgtc     20640
     cccaccatcg aaccaggcta ccttcgtccc ctaatcccga cctcaccccc cgagaatccc     20700
     gaaccatgga gcgccattca atccgacatc gaaaccaaga tcaagccggg catcacccac     20760
     tggcaatccc ccaacttcat ggccttcttc cccgcaggtg tcacctaccc cagtattctg     20820
     ggcgaaatgt acagcgcagc attcacagcg cctgcgttca actggctctg ctccccggcg     20880
     tgcacggaac tcgagaccat cgtgatggat tggctcgctc aggcccttgc attgccggaa     20940
     tgtttcctca gcacgtcgga gaaccgcgga gggggcgtaa ttcaggttac ggcaagtgat     21000
     acggtcgcga cgatgatgat tgctgcaagg gagagacggg tgactgagat ggtggtgagt     21060
     gaggggttca agcctgatac agtggagtat gaggatcgga tgatggagtt gaggagtcgg     21120
     ttggtggctt tggcgagtaa ccaggcgcat agcagtacgg cgaagggggc gttgttggcg     21180
     ggaacgaggt tcaggagtgt tgaggcgagg ttggaagata acttggagat gaccggggag     21240
     aggttgagaa ctgttttgga ggggttggat cgtgataagc tgacgcctta ttttattacc     21300
     ttgggattgg ggacgacgaa ttcgtgtgcc gttgatcggt tcagggagat caaggctgtg     21360
     ttggccgaga aggaacattg gaagaggatt tgggtccata ttgatgctgc ttatgcgggt     21420
     gcggcgctgg tcgcggatga gtggcagtat atttcgaagg agtttgccga gggcgtcgac     21480
     agctttaaca tgaatatgca taagtggctg ttggttaact ttgatgctag gttagtcccg     21540
     ggcgtccaac acacatttcg tttctggata ctgacaactg atatagctgc ctcttcatcc     21600
     gcaaccgcga agacctcacc aacgccctcg acattacccc cgcctacttg cgtaaccact     21660
     actccgattc cggcaaagtg accgactacc gcaactggag catgtccctg ggccgccgat     21720
     tccgcgccct aaaaatctgg ttcgtcatgc gcagctacgg tctcaccggt atgaaggact     21780
     acatccgcaa atctatcgga ttgggcgaga cctttgcagg tctggtgcgc gggcgcgccg     21840
     acctgtttga tattatcacc acgcctgcat tcgggttgac tgtgttccgc atcaagagtc     21900
     ccaagtcagg gacgacgatg gtggaagctg acaatggggt ccttgttgcg cagccggatg     21960
     aggcggcgaa tgagctcacg aaggaggtgt atgagctggt gaactcacgg ggagagatct     22020
     ttattacatc gacggttgtt tgtggggttt atgccattcg ggttgtgagt acgaatccgg     22080
     cggccgagga gaagtatgtg aagcgggcat ttgagatttt ggtggagacg gcggaggaga     22140
     tcattaagcg ggggtagatg ttagatacca tgtgtgagat actgtagata tttggcatct     22200
     agcttataga tatgttatac gatattgcat tcgtgtcgtc ctttgctagt tgtgtgtgag     22260
     atagctttcc cgaatagtga ccgttcagct tactggcagc atccgaggta ttgcggagca     22320
     aaagaacaac agcatagttc agataacagc attcatgtat aacaatgtta atcaactcat     22380
     atcaagcgga tatttccatc ctatcccgta caacaaagag cgatatctat tatatcaaag     22440
     ttattgtaag cctccaagaa gccacaaagc aaacaaactg gtctcctaac cttcttccga     22500
     acacagtaga gaaacaatga tcctttgttc cccttccagt aacgctttac ctcctacgat     22560
     gcgcagtaac gcaaacggta catcccaggt gatgtattca agtaaagttc aaatacgaat     22620
     ggcaacaaag acaaggaggc gtgctctgaa gtaaccaaca ataccctcga aggagatata     22680
     ttgctcatgc ttgaccctct caagtaccct tctagaggct acctcgctat cactgccatt     22740
     tgaatccaat aaacgacaga acaggcttct gccacgtgcc ctgcctcgca tggataaacc     22800
     tacgggagtg gcatcttctc aaatggacaa accccgcttg gggggcaaga tgaacctacc     22860
     tgcaggcggt gctactactg cgcctgtcag agatgtctcc aacaagaaaa agcgtgctct     22920
     agaagaggac agcgacagcg aaaacattga tgatggtaag cgaacttgca tccatctaat     22980
     cgatgaagcg atgaaggact tggagttagg tttcgagaag gattcagaag acgactacga     23040
     atctgatagc aagacagaat cagacagtga cgggggcagc tctaatgacg aagatagagg     23100
     taactccagc actgaagaga caactgtcat tgatgaagac agctctaatg acgaagatgg     23160
     aggtgactcc agcactgaag agacaactgt cagtgatgaa gacagctcta atgacgaagg     23220
     gtcagatctc ggtggtcgag atgttacaat ggacgaaatc atggatttca atagtgagga     23280
     gagcacaagc gacgagacaa tggataccag tgatgaggac agctcacgcg acgaagcatc     23340
     ggattggagt gttggaagtg gctcaagcga tgaggaggaa tatatggatg tcagtgatgc     23400
     agagagttgg agttccgaac attggaatga tagtgatcaa agcgatgatg aggactatac     23460
     atttgaacga ccggaagctt ggaaatggag caaagacaac aacatcaaca acaataagga     23520
     tggtgacgag gaggacggtg ataggctaat gattcagctt acatatccca atcataccca     23580
     caagatctgc gatgacacat cttcagagga tgaggacgga gatgcactta tccaagaaga     23640
     ggtagatgac gcatcttcag aggatgaggt cgagactgaa gacgagaaca agtcgggctg     23700
     cgctgatggt gactcctcta ccgcattccc cgcatgtgag tttctcgaca aacacgccga     23760
     caaaccaggc tacatctatg atatgacatc acatgggaag aacatcctca tcctaatcac     23820
     gacatctagt cccccaactc tcatccgtgc ctccacaagg gatctgatca tgggatccag     23880
     tgtctttgct aaagtatttg gctacaatga agagattcga gtgtctggga agatattctc     23940
     aagctggcgg aagatccaaa aagtcacagg gtgtcaccga gccgaattca tttgaagata     24000
     tgcgagttgg tggaaagctt cgagaagctt gttaaggaaa cggcacctgg gtgccctgtt     24060
     cgaccacgtg agactttact tgcctgcgag aaagagatgc ggagatgcca gggcattaac     24120
     tgtgatgggc agaacacccg gaagactgat atatgccggg ctgtgactcg ttatagacgg     24180
     gggtttaact tcaaggagct gtcctggcct tgtccggatt gggtgggttt aatggcggac     24240
     agagagccgc tcaaggggtg gatgcattgg gattagaggt agaatattac gttacccatc     24300
     ggccacagaa tatcaagaat ggaaagaagg gttcgggctc tgtttaggtt caggttcgtc     24360
     tagagtgaat ccactcgggg aatttccccg cacttacgcc ataaatgcat tattaatgca     24420
     acagtcacac accagaaatc agtcgtagca gcaacaacta gtacctctta tcttcatctt     24480
     catcttccaa cataccagca ctagtgtaac taactcatct gcacctcctc cgtagccatg     24540
     cccctcgcca gggcaacctt cgaagacatc atcctcgctg aatccccaac ctgggagacc     24600
     gtcgaaggaa acatctacgt aagccccatc atatgtcaaa acaaccctat cactgaccac     24660
     aacctcccag tttcctccca cagcaatcaa agacaaatcg ctcttcgttc ccattgacaa     24720
     ggtaacattt tgtccttgga agggagacgc gtcatattac tctattgtgg ttggacgtga     24780
     gtatctccct cgacctcctg tttcgttcag actgctccct acgggagaca aaatcatcgt     24840
     aatcattgct aacaatatga tatctagcaa caacaatccc cggtggagcg tggtattatc     24900
     ccaacccata tgatgctgcc agcaatatca aggatcacgt ggcattttgt atgtgtttcc     24960
     ttttgtttgc ttctaagctg ggtgagctaa cggtgcatgg attcagacac aacaggcagc     25020
     atcaaagtga gcgtggaatg aatggatagt cgagattggt gttctgagtg gcatgtctgt     25080
     aatgaaggtt gatgattgat ccagaagtac taatttgaat aactctacct cttgacattc     25140
     caatacactg caggcgcggg ttatgctggt ttccttagct acattagtgc cgtattgtta     25200
     tatatactag cactgtgcaa tctgattctc tctgcaacta gtgattgaaa aatatatcga     25260
     gcccgaatag tgagtcgtct aatccaagtg gcaacagctg gccactagca tgctagtatt     25320
     aaagagcaag cacttcccac tcactgctca ctctccttca caagcccata cttcttcttc     25380
     aaatgctgaa tcgccgcctc cgccaaccgc cctatcttcc cgatcttcgt aacctctacc     25440
     atactaatat cccaactgag atcccctcgc aacccgcgcc gaatctccac cgccatgagg     25500
     gagtcaattg gcatctctgc agcctcctcc gccgacatct cagctgcccc cggcatatgc     25560
     cgcgccaggt gcttgctcaa ctcgtgggat aaattattcg ctgcgtcgga attattcagc     25620
     atggccgggt cctgttcgac cctgcgtaaa atttccttaa gtgccgtccc gccaaccgtt     25680
     gtgctctgtt cttttgtctc gatattggtg tagagggaga accgcgggtc agaaggcgtc     25740
     catactgccc gaacggaggg gtcgttggtt gagcgggtgt ttccgagtcc aataatacag     25800
     gcatctgaag tactactctg actgatagac tttatgtgag aggtggtgag cgccgaaggg     25860
     gacggggaat gggattggtg gattgccagc tccaaccctt ccaggagctc gtcctccccg     25920
     acgagccgca cagaagtcgc ttgcattgcc tgcagcagct tggtattacg actaaccaga     25980
     ccacagtcct cgactgggcc cagggcaagg gtggccgaag gaagccccag gtgacggcga     26040
     tagcgcgtaa agctgtcgag gaacgtgttg gcggcggcgt agctcgcctg cccatggttg     26100
     ccgcagatgc cggcaattga actaaagaca atgaagaagt caagcggctg atccgaggct     26160
     gcgtgatgga gattccaggt gccctggacc ttcgtggcaa ggcaggtggt ccagtcatca     26220
     taagttgtat tggcaaatct ctggtctctt gagattgcag acatttggag gattccagcc     26280
     agtggttgag gacatttgga aatcgccgac tgaacatcgg cagcggcggc gacaatccct     26340
     gccacgcaga tgacctggca gccctgctcc tccaagtcga ggatgaagtc ccgatcggca     26400
     ttggacttac cagcagaacg agacaaaatc actagatgtc gtgcaccacg ctgcatcatc     26460
     cacaagcaca cagagcgtcc caccccgccc aggccaccaa caagaagata tgacttgttg     26520
     ggcgaaaagc tgacgggagg cacagaggtt ggggccaact ccatcggatc tgaaggcatt     26580
     cggattaaga tcttacccat gtggcttccc tgctacatat atcgaaaggc atcggtgacc     26640
     tttgcggcct caaagatttt aacggggcgg agaggcttga tgtggccacc ctcgtaccac     26700
     tcccgaaata gctgcaacag cctgcagaga tccagttaga caaacaccct ccaagctctc     26760
     tctgtcgggc cgtgcatgca tgcatacatc tacgcatact gcacagaccg gggggagaag     26820
     gcgacttaca agtcatagtc ccgaggtttt tccttgccca tttgaaagag atcgaagccg     26880
     atataagacc gattctggat aaacggggcc atggctaact gaccgttagc cagatagtcc     26940
     cgcttcccga cctcgatgaa ccgcccgtac ggtgccacac attcccacga ggtatgcagc     27000
     agcttcccgg acagcgagtt gagcactata tctgccccgc gggcttgggt ctccgccatc     27060
     agaccgggga ggaagtcggt gttccgagag ctaaagatgt gactgcgtgg aatgccaaat     27120
     gtcttaacca gatattccac cttttcgtcg cttcccaccg tcgcgaatat ctgccggcca     27180
     cggcggcaca tggtcagcca agccatttaa acatattatg gcatggtaaa cagtgtccaa     27240
     agccttacct ttgcacccat cactttgcaa acctggatgg ccgccagact cagtccacca     27300
     caggccgaat gaatcagtac cgactgccgt gtagagcaca catgtcagtt gatgctcaca     27360
     aaacgattga aaatatcccc cggcgcactt acattgccat tctggagccg cgcgaggtga     27420
     cagaggcaga agatggcggt catgtaaacg gaccccacgg ttgccgcatc atccattggt     27480
     gtatttgcgg ggagcttgcg gcaagctgtg gccgaaagga ctacgcgtgt ccgaaatagt     27540
     ctccaagcta gcatcacgac atggtcaccg gcctgcagat ccttgacgtc ggacgccaca     27600
     cgccggacga ctccagttcc ttcgagaccg agctcgtctg cacttccaaa gacacccatt     27660
     cccactaaca cgtcctgtgt acatcggcgt cagtggttac tcattcactt cagcaggtag     27720
     gaaaatttat atagccgaag cgatggggtg agaaaagggg cggaataccc tgaagttcaa     27780
     gcccacgtaa tgcacatcaa cttcaacttg gcctgtctcc aattctcctt gatgaccatc     27840
     cactggtacc caatgagctg tgtcgatcag gccaactggg ctgacatcca gcttgcgtgg     27900
     gcatggtgtc tctggtcgcg gggtaatttg cttcggatgt atccaatggc atcgaccgac     27960
     gtgtatgacc ccctcgaagg agaattccga gtcagccggc cttgcatcgg gacactgtcg     28020
     tgtacgctgt agcttgttaa acacttggaa cagagctcca gcagccggct gtgtataact     28080
     gtccgtctcg aagagagaga ttccggtggc cgtttcatgt cgaagcgtac gtgtcaggcc     28140
     gaagatcagc ccgtatctgg ggtcggcaca ggccatctgc gaagtattag tcacccagat     28200
     taggtgggag ttgtcagctg tcatcaagga ggattgaagg gcgagatagc gttcttccga     28260
     gagattattc agataaggac catccaggtc cagaagagag ataatccact gatcttttgg     28320
     gggagtgtcg tgcagggttg tccaatttac gacgtgaccc ccttggcgga agcgggatgc     28380
     cacctcgctt gcccatgatc cgggagagtc cgtagtcagg atagtcaccg tgtcataggt     28440
     ttcggcctca ggcggtgggt gaggcacgcg agagagcatg gtaaagtagg tctgatgagg     28500
     gtgtggcaca tcgtaagcca tcacttcgct gccgatgaaa ccggcattgc ggagttcgat     28560
     atcccatcta tctggcgaaa gataaggtat actgtatgcc ctgaagtctt ccactgatga     28620
     ccaattgctg agagctccct gtttcaacgt gagtagaaag ataaacaaaa atgcaacgga     28680
     cctgaagggc tcggttcaac ttaccgttaa atactcggtg atcaaagttg tctctgttgc     28740
     atactttgtg tcttagaaaa caataccagt tagaaggtgc tgcaaggcat accagggtaa     28800
     atctcatgca gtaacagtcg accattcggg gctagaagtt gccttatatg ctcgacagca     28860
     gtcgcaatcc gcgcggttcc atgtgcaact gcttgccact cagttaactg ggcttgacta     28920
     tcccagacaa aggaaaccga cattagaagc gataatcagg tcataactct gcagattgca     28980
     tccttgtgcc tcgagatcac cggaaatatc gagcaaggca tattgtaagc cttcctgatt     29040
     ctgaaacttc tgctggaggg ctgtgagggt cgcttcacat tcctctgtga cagtgtactg     29100
     ggaacactgt ggtacgccct caggggaccg aaggtaacgc agcaccgctt ctgtagcact     29160
     cccggtgcaa gatccaatct tcagtactct agtagttggg tttgaatgat ccaaaagtga     29220
     cagaaatcga ctccaattac attgtgattg tatccattta ttgtatctgt cgagccgacc     29280
     ctccacctcg agaacatcga gtgacgaaac ctcccccaag acaatacgct cgcaattcgc     29340
     ctttatctta ccgacgcatt caaacaagat cgatcggtca tcatttttgt cattttccac     29400
     atatgcggat attattttgc agatcgactc ctgccgcgac gggccgctat cctccaccat     29460
     tgagtcgggt tgaacaggcc catctcgttg atgcagtcta ctggcctcag tggtaaccca     29520
     ttgtttccac ttgctcagat gatcgtccac agcggtgact tcacccaaac ggtcagatat     29580
     ccgcaatata ccggaattga cgacccgaag agacggctgc cttcgaaaac tacctgaatg     29640
     acgtcttcca gaatgtcaac aagaattgcg gggatcgcct gggcgatgat cacctttgca     29700
     acaattctcc acaaacggcg gcactgaagc aatgcgttga cgataacgcc aaatgggctg     29760
     cgacgacagc ggtcctgccg ctggtgggtt atttatcgga agaccggtgc gagcaggtat     29820
     cggattactt caaaagtgag cagctgtgga acgaggattt gccgaatagg gctcaggttt     29880
     atgtccagag ttgttagtag ccgtaggctt tggaagagaa gaggaggagg aggaggagga     29940
     ggaggaggag gaggaggagg agcaataagg gcttttaggg ttaaaggacg aagatgtcac     30000
     ctagataata ttaggcgaga gacaaaccca tgcaccggat aacagagaga aacagagttt     30060
     agatagccaa ataccatcgg cataaattca gtgttggccg atcagccccc gcttgccgca     30120
     gcccattact gaaagggaaa tctagagtca gtctcccgcc tagaattccg ggtagggatg     30180
     gaaggtattc ataccgcctg agggccaaag caaagaattt ggccccctcg tctagagatg     30240
     tatcgatgtc ccacatcggc atcatggcaa agccaaccag cgacatagag ctgtccccgg     30300
     cagacctggg actgcctcgc tttgtagaag cgcatctagc aattgtggta cgcgcgaagc     30360
     ccgagccaca tgattgccag agagctgcgc aagagctatt ggccacgtat cctatgctgg     30420
     cgatgcgaat ggacttttgg gtatgtcatt gcttccctga ctctattata ttcagccttg     30480
     ctaatggtcc ggatctgatg gaccttggac tccaacagcg caccaagctc ctccatagcg     30540
     attatcccgc agagatctat cacagccgaa ccctgaagaa ggacctcgat gaggtgctac     30600
     cctgtcaaac agcgaaggtg ggacctcccg cggtacaact cctcgacacg tgcagcctac     30660
     tcgattgcct gaatttcaac cgagacattt gggacgagat ctgcggtgaa caagtgctta     30720
     ggattcgtgt ggtattcctt aatgatgcgt gggctgtccg cttcataatg tcgcatacgc     30780
     tgggggatat acgaggtcgg accctctttc tgctcctcgt tttcgattta ccacgctgtg     30840
     gcagtgcccg tgggtctaaa ctccttattg tctaattcga tgtgccatac agctatgcat     30900
     tggattgccg attctttctt cgccttcctg tccggacgtg aagtccagac tgtctcgccg     30960
     attcgctcca tcttgacctt caaatccgat attatcgata gctggaatgc cctgaccgcg     31020
     tcaggcacga cgcactcagt agccgaagac catcaacatg agatagtggc tggctggctg     31080
     ccgacaatct tgtccggggc gcgacagatc ctctggtacg cctacgaagc cagctcgcct     31140
     cgacgtcagg tgaacaaaag cctattcatc ccgcaatgca tcatcgacca ttgggtgcag     31200
     ggggcgcgtc gagaaggtat acaagtgact gagcatgatc tgcttatggg atttatctac     31260
     gaggtatgta tatgctatag gcaaacgcca tcttccattt atgctgacga gcgaaggcca     31320
     catatcgagc cctctccgca ccacctcact tcactttcct tatgaatttc caccagcagc     31380
     tccattcacc cggtcccctg gggaacacct ggtttcaaat tcctattcct gctctgcaca     31440
     aatccaaatc ttctccttcc accccttttc cgaaggacca ctcatccact ctcctcccca     31500
     tgctcctcca ccacgcccaa ctcatccgtg atatcatcgt taaatgccgc catccggcct     31560
     gtttccctga aatctacgag caacaccgcc ggcttggaac taccccctgg cggccccgct     31620
     cttttggcac gcgcagcccc cacgtgatgg tatcttgctg gacgaaacag cagtggtatg     31680
     agctcgactg cacaggaggg acccccctat tcgtagacct tggagcgtgt ttctaccgac     31740
     tgtttcagct cctgggagtg cagggcccag atgactttgt cggcactatc aaatgccccg     31800
     gtggcaggaa tagcaccctg atgggggagc acaaaggtta ttgggttcag ggaaggctgc     31860
     cggaggttac ctgggcgact atggttgaca tgctgacggc ggtttctttc ggggatggtg     31920
     gtgggcaaaa acaaggtctg ggccaaacat tcgcgaatat ttagccagat gtctagctgt     31980
     ctctgaggtc tacgtttagc ggtgaggatc attcaccgaa tctccctaaa gtatgtacat     32040
     ttattttatt gtatcatggt acctctgcag agtagatttg tagttacccg aatagcatgt     32100
     aacggagaca acggagagaa ggtcatacag aaacataaag tacttacagc agttatatat     32160
     ttttattgct tagagaatat cttgtgttta cagacctctg aagtaataac tttttttatc     32220
     cagacccgtc gctaaaatga tacaagagct tctattaatt tcccgtaatt gtacttctct     32280
     tcataacggc gtgaagttgc gcgacgtaga ccttacttag aaagtaaagg ccaggacggc     32340
     actctaaagt ccggctgaga ctggtagttt ttgtacataa atcatcctcg agatagctcc     32400
     gggtctgtca gctcattcaa cagttccgtc cagtctgcag aatccagagc caggtcgtta     32460
     cccgtctcaa gcatctcggt ccagatatct tccagctgcc tctcatgagg tgcattgtca     32520
     ttggtggcag ctgggaggtg tggcggcatg acgtttgatt cagcattgag agctgggaca     32580
     tgagccggtg cagagccagg atgagatcgc gctccatccg ccccttgtga agtaatagtg     32640
     tgattttcag cctgctttcc ggttctccaa tgcttttgca acacacccat cattgcgttg     32700
     attccttccc tgaccagggc agacgactct tgtgccttgc tcagcatgcg gcaggcatcc     32760
     agcacttctt cttttcgctt ctcggctaga atatcatccc aattgaagca cacgtccagt     32820
     aataatatca cagcagcagc gaatacatga tgcattacgg accagacgac agagttcggt     32880
     ggggtgtagt tcggttcgtt tccatccatg attcttttaa tctcgagcac tttccgggca     32940
     gactgcaggc agatcacgtg ggaataggaa tatgctggtt cacgagctcc tctgatgaag     33000
     aaatctcgat gcagacggca taagcgggag aagaagcctt gttgtaggag acagccttgc     33060
     caggcaatgg tcggacgctc ttcgtagagc gaagcaaacc gtcgtctgga tgatggatcc     33120
     aggcggaaga agtcaggaat ctccgccacg gctcgatgga actttttgtc tagctcgagt     33180
     attttttcgt aaattggctc taagccatgg agatgctcgt aggatgttgc atcaactacc     33240
     tcccggctca cagcagctag ggtcaggcgt tgaaggaaaa aggacatgtc tgttggtgtg     33300
     gagtttggca ttgaaaccat gttgtggcac attgcattat catcgatatt caatggctgg     33360
     ttcacgttca tgtggtgcgg ctggatgagg tacgtccact cttgagggcc agtaagaaag     33420
     cccagtagcc tgcaattgtt aatcagccat gaccatccat cactcgaata cctcttacca     33480
     gtcgaaagac gtcagatccc accatagtcg tctcttgact tcaagatcta ttgcatcgta     33540
     atncttccct ctctctcatt ccgaaagcgc ggggagtcga tgcagtgcag catgagactc     33600
     ttcgcttggc tgactatcgc accatgtacg aagagaccgc tcacggatgg tggaatgttc     33660
     cagttagaga cattatgcat gaccaccatg gttgcctgca agcccacaag agttggagac     33720
     agagagtagt ggctttgaat taatgcagcg ccagtgagaa aggcaaactc ttggctgcgc     33780
     gcttctgcat cagtagatgc caccactgat cgttgtagac atagagagct ggctagaatg     33840
     ccgaaaagca gcgccaagtg gttgagatcc acgggcgcat tgctttcaat acaacgataa     33900
     atcccattta tctggccctc gacacgcttt gggacgatga tatggtagag atagtcgacg     33960
     taacgatgat agtatcgaaa gagatccaga gcctccgatt tcgcgggtac aaaggtgatc     34020
     aaattgatcg acgccggatt ctcatcgata gcggatcgat tcatgtatgg cattgacagt     34080
     aggggtcttg cagaacccgt ctcatcgttt aggcttaagt ttaagttgcg ccctcttact     34140
     ggatcatcca atccatctcg cagccatttt ggggttgctg ttggtacccg gtcagccatg     34200
     tgaatgttct ccagccagtc cgctgtgagc agcgactccc gattgcacgc ccgcaatgga     34260
     gctgcagtgg gctcaatagg cacgttatcg gctcttggag gcacagttgg gttactggga     34320
     ggggatgtcc gctccacacc agctgctaat agtggttttt gaacccttgc ggtacctgca     34380
     gcttctggct ttccataacg gcatgtcaac cggcgcgcag agcaactgct gcatggctgc     34440
     tggcgatcgc atttaatctt cttgagccga caagagtcgc aagacacggg gtcctgccgc     34500
     ggagcgcgtc ggggggtatg aggcagctgg aatgcagctt tgcgcttcat gatgagatgt     34560
     ctgtcgtctt ggtagtaggt taacaccgca gatgattgtt tgtacgggtc acgtgagtat     34620
     cggcctctat ttcagcatgc agtcacttca cttctgtgtt accaagatgt agagagcaaa     34680
     tttctccgtt gctggatagc aatgtcgaca gttcttcctt acggaggtgt gggattgttg     34740
     ttcttgatgg ctaaccgtct ccgcccggaa gctccgcgga cagtccgagc caatgccatc     34800
     aagcattaag cttcatacta tctacaacac catgaaacct tgtcctcgga gggtccgggg     34860
     ggttatactg tcaatacata gccctcaaat acattatata tatgcgctca gggttctgtt     34920
     ttcgataaac atgtttccat caacccatag atcacatcga gctgcactgt acgctcacta     34980
     tctaagttca gcttcacctt gtcaaatctg actagcaacc atggctcacg ctgaagatgc     35040
     tcctactgac tcgcctccct ccgaatacac gtaagtcacc catcccaaac catacacata     35100
     tcatcaacaa cttccaggcc gcgagcagtg cagaccctcc tgggctcatt ttgcggcatg     35160
     ttctgcactg ttggcttcgt gaactccttc ggcctattcc tagagtacta caaaaaggac     35220
     caactatcag accaacccga atcgaccatc gcatggatag cagccatcga catcttcttc     35280
     atttttggtg tatctgtcgt atccgggcct ctcctggaca cgatcggccc acgagtcagt     35340
     accctatact atcaacataa cactatacaa acccccagct aactgaaagg tctagctcct     35400
     cctctgcatc ggctccctcg gctccgtctt ctcaatcatg atgacctccc tctgcaaaga     35460
     actctaccaa ttcatcctcg cgcaaggcat cctcctcggc atctccctat cccttctcac     35520
     ctgtcccatg atcgccctcg tcggccaaca catcaagatc aagcgcggcg cagcagtcgg     35580
     catcgtcatc ggaggatcct ctctcggtgg cgtcctctgg ccgatcatcg tcaacgaact     35640
     gctacagaaa cctaacatcg ggttcggatg gaccatgcgc atcgtcgggt ttattatgtt     35700
     gccgctgctt acagtgactt gtttttgttg tcagcctgct gcaccaccgc catcaccatc     35760
     accatcccaa tatcagccag aaccacaatc agagaaatcc tcacccgaac cccaatcccc     35820
     ggatcccact aaagatacag aaacccccct cctccaaaac cgcaccctcc acctaacctg     35880
     cctctctttc ttcatcatct acttcggcat gttctcgccc tttttctacg tctctagcta     35940
     cggggtagcg cggggctttt cctcctcctt gtcgttctac accatatcca tgctgaacgg     36000
     cgcatccctc ttcgggaggg tcattcccgg tatactagcg gataaatacg gacggtttaa     36060
     cgtctgtatc gtctttacga ttctcgcggg gatagttgcc ctctgttgga cgaaggcgac     36120
     gagtgtggcg gggctggtgg tgttttcgat agcgtatggg ttttcttctg gtgtgagtat     36180
     aattttccct tccttgtttt atgctcttgg ggaaagtggg aagaagatgg ctaatagtgt     36240
     gggtctggga taggctattc tctctctcca gcaagcgtgc gcgttgcagt tggcgacgcc     36300
     gaagacggtg gggttggcgg tgggggttgt tatgggggct acggctttga ggtatgcaca     36360
     ttagatttat tttgaattga tcttcttggg gagtaagggt ggattttgct aatcatatct     36420
     tatctgggag tgtagtgcta tggctgggat acctatttcc ggggcgctgg tgcagaagta     36480
     tgggtttctg gcgctgtcga tatacgcggg ggtgagtctg ctcgtgggtg ggttgttgtt     36540
     gtgtgtggcg aggggggcgc agagtatgga gttgagggct gttgtttagg ttcttatgcg     36600
     ggggaggggt gtttggtgag gatgaggatg ttggtggtgt ggtgtttgtt tcgaagtaga     36660
     ctagggggtg atggggttta tgcgtgtgat aacttataga tttatactta ctgtttagat     36720
     ctgtcgatat tgtattagtg ctagataatt agtcctattc taataaacca ggcatctcca     36780
     ctcatctctc accaagaacg acctgtgcaa gactaacatc ccgtaggaag aagtgtactc     36840
     cccctccgca tccaatttaa actactatga gccgctcctt gccccaatcc tctcttcgca     36900
     aaccccctcc agatctcaca gcgattcttc ccgccagtca acacaatgtc tgcgtcaagg     36960
     atcgcgtccc tggcttgcac gaagttcgga ttacatggtt gccttcagtc cattagtcag     37020
     gataccacgg acattacaaa ggtgaaagaa gctattctgt gcatcactta cagtgccatc     37080
     ccatccacca ccaacttcat catcaagtac tttccatctg taggcacccc gtttctaaac     37140
     accggcctcg acccatcatt cttcccgtac ttgtcgatga ggttccacaa gacctcgtat     37200
     agcatggttg cccagacagt tccgatggcg tgcacgccgt tcatggtatt cacgctcgta     37260
     tagttcaaag ggttctcagt aaaggaggta gaataaggat agtcccggac accacattta     37320
     tcattatctg cccatgcacc catagtgtaa gacgttgtgc gtgtatcgtt gggcttgatt     37380
     cggatggccg tcgccataaa gtcgccccag ccttcgccca tgccacccga ttcgagggcg     37440
     ctgaggcatc cggcgttgtg ggagccgccg gtgagacgat tggatactgg tttgttagat     37500
     taggacttcc atcttctggg gagatgctta ccaccgtgag tgtattcgtg aattacaatg     37560
     cccgcgtcaa aacttccatc acgcgacgga gtagactcga tccagatgta catgcgcata     37620
     cggccgggga taccatcggg tggggttgca aagtttgcgt tgctgaaccc ggagccgtct     37680
     tgtgcgttga ggatcacgta gtctttgtct cggccgccgt gggcgctgtt attccattgg     37740
     aagttgccag cggattcggt gaagccgagt gtatagagga ggtcgtggta ggcgtttgct     37800
     gtgtagaaga gttggacgat ggaggcgttg atgtatgatc ggggtgggga catgtttggg     37860
     gagtatggcc attggaaatt caagttgggg tcggatggac gtaggttgta gagataggag     37920
     ccaccgccgg tcggattcca gtgtgcgatg gcattgttgc ctctggttgt ggtgtagttg     37980
     tcccgtccat cgcttatcca ggtgtatgcg gatgcggata ggtcccaggg gtcggtgaca     38040
     atggtgcgat gtccttctgc tggatcgttt gtgccccagg gactgttgtc ttagcttcgt     38100
     tattcgatgg ggagagccac tcactaaact tgatatgtcg cgtctgcgac atagtcaacc     38160
     acgccgtgga cagtggtagt ctctgcatca atgtatgtca gtagccagtg ctcatacatg     38220
     tctgtttcta tcctccaggt gagcgccaga gtcccttctg gcttgacaag gtagactagc     38280
     ttagctttgg ggtcagatac cgctcccact gcctctctga atatgtactc gttccgcccc     38340
     tctgcagctt cagtagaaac attgtcaata gtcagtggaa gctgtatagc gtcccttgct     38400
     cctctaagtg cagcctccgg actcaaaacg ttggtattgt ccagatggct gctcggcaac     38460
     gcgcctgtga agaacgaatg tccgaaagac aagaccagtc catcttttcc aatctgtaac     38520
     agtaagcttc cttccgaaca gagtaattgg ggagcagaca ttaacattga aatccgcatt     38580
     gtcaatgtca ataccatgga gcgtttggcg gaagtataca tgtgcaactc cattgtcgcc     38640
     gacaaagtgg tcatcgatga gacgaaagct cgctccagga acaatgttct gaaccagtcg     38700
     agctgctgta tcggtataat gttcttcagc ggacactgcg actgatcgat tcgtgtctac     38760
     atggacagaa ttgacgtatt cggagttaga ggtcagacga agggagtcca agtccacggc     38820
     tgctgaagtt gtatgcaatg aagccgccgg atatgccagg ataaccaaag gcaatgtccc     38880
     tatgctgcat actaggcgca gaccatgcat gtttgctcat gcgtggatgg gatgaaagat     38940
     gatttggggt cattggccat ccgcggaaca tttactacta tatatactag agtttgttct     39000
     gggtgaaaga gggactacta atcgatacag ccatacctac ccctatccct cctggttcgc     39060
     ccttaggata ttccctatca aagctattgt ccgacgttgc atggctgtcc aacattgtcg     39120
     aagtacaacc tctccaacct gccagctctc attggcctaa taatggctga cctcccgggt     39180
     tgtctcacaa gctggcctgc cgagtgctag gggaccccat agaggaggcg ttttaccatc     39240
     gatagtaaat caaatacgga cccgtcatac tatgaaaatg ctggtagcac gcgttcgacg     39300
     gaagatcgtc ccgtcgtaag acaaggcagg cttcccataa ttcgccggca ctagttggtc     39360
     actttatact aacggaatca ccaagttcca tgcagattac cagccattgt ttccggacag     39420
     aggcagagtg ctccatagat gaatcgcatg gaccgaaata tggcttgtaa agcagcgatt     39480
     cagcaaggag atgtcgcagc gcctgctgaa atcgaagggt attcattgtt taaatatatg     39540
     cttgcagtat gtgaactata tcttagcgga ctgctccagt ttccgcgccc gatcctttgc     39600
     aatatcgcac attgccttta aaggagcgaa ctgtcagcac tgctccgtgt ttgggtagac     39660
     agccatctca cctgtataat ctcctccacc tcacgatcgg cattgccccg gtcaatcctc     39720
     tcacgcatct cctccatgat gacatcccgg ttgcgaccgt ttacaaaagt actatgccag     39780
     ggagatatgt cagaccaaca caagtcgttg ggtatactga gagaacatac acaaaccgca     39840
     agccagggaa cttttgctcg tactcagcat tcatacgttt cagcttctcc gcttgttcct     39900
     ctgctccggt attcagattc gcttgttcct tcttgctcag ttcgctcaag tgctctgtcg     39960
     gagctccctt gggctgtccc aggcggggat gcgatcccag aatccccact agaatatcgc     40020
     ggtccttgga cgagttggca gcagacagag cagacatgcg accgccaaca gcatcaatca     40080
     gggtggcgta ggaggagaat gtctggtttg cgagaacggg ggccatgaga gtatgcagct     40140
     caggcgacga ctcgaacagg gtatccagga cgcggaattg ctgctcctgc gggagtgatg     40200
     taattgacga tggtgagggg agatcggagg acatgatgag cggggagtcg tggaaggagg     40260
     ataattgaca aaaaattacg agctgaaggt aatatttcga gcagaagtat cttggtcgat     40320
     tttcgttgga aaaaaccaca cggtgatagt tacactggga ggttgatgga tatatgctgc     40380
     ttcaatgagt ccccgcatcg gcagcctccg agtgatggag agccagcggg acggagacct     40440
     ccagatgcgg acagttcatt cacccccatc atattatggg tgagatctat ctcaatggca     40500
     acgaggggcc ggctttattc acaaccattt gaactgagac taaaggtgca cggacaagag     40560
     cttcaatgag cttgagcttc tcatcagcat ccgttaacta gaattgcatt gcaggctgac     40620
     gacacggtcg gacatcctta gaatctccgc ggtgttctag accccgacct tccgaactcc     40680
     ctagcgaggg atggagaatc tgggggggag gaagagggga ggaaacgatg acaagaatcg     40740
     gattgaccat cgatagtcgc aatgtaaggt aggataaagt ttgggtgggc aaccagataa     40800
     gactccatca gggagaattt ctcagcgata gatattgggg cctggataat tagcagttga     40860
     cgatcgcatg caatcctgac cgattttgag cctagcgggt gtaacgtgta atcatcacca     40920
     taccggcgtg tacgaccgct gtatttagaa tggcaatatt acaccacgag taagtaagta     40980
     gtactccgta gttatagcaa ggatcagtcg cacggccctg gcagcgacca aaaaaaaaaa     41040
     aaaaataaaa taaagcacct gcagacgaag gcagcccgca tccctgctcc tcctcctccc     41100
     gttcacgccg gctgtctggt gccgaggtga atggaaccag tctacaatga gtcttacaat     41160
     gtaatgtata cgtgaccgtg ggggggaaga agagaactaa gtcggtacct gagagtcagt     41220
     cctgagagtc agtcaatgga aattggttca tccaatagtc ccacggtcgg acttccctct     41280
     gcggcgtcat tattggatcc tcacctggtg ccttcaggga caactgctcc aagtagtagt     41340
     agccggtagt ccacttgtca atggcctgat ttatgagagg gagaccagag acacacatta     41400
     atatcgagaa taatctactt gacttttcct gagtattcag ttcaagattt cttttttttc     41460
     ttttgccttc ttttccattc gcttgggtga atggaattgt caactgaatt tcttcgactg     41520
     taactgaaag tggaggcagc cgggcatcca ctttcccacc cacttccctc cctctattaa     41580
     ccaaccatca ctcaccatct ccaaagcagc ccctgaacgg tcaggcccag ttgaactcct     41640
     gagaggttcg tgggcaagtc agtcaccact cggtccctcg gccgtctctg cggatggatc     41700
     agcattcttg ttcaccagaa agaattagtt atacattgta tctgattctc aatccatccc     41760
     gcttagtgtg tcccgcccgt ctttgatctc ggtccaccgc tggtgtgtga gagagtgtct     41820
     tgctctcgct ctcgctctct gccatcatac tcacacatcg aggcggcgcg ctgctttgct     41880
     tccttacatc ctgactttcc gctagaccct ccctttcccc tctttttctc ctctcgcccc     41940
     tcctcttctt ctcttccccc tcccccccat cgttcatcat catcacttta atcgtgatct     42000
     gtcgcgcggt cctgggcatc tgcctccaat gcagttcccg tcatgtcgct caatgggcta     42060
     gataatccca ccgtcatcga tgcctaccag accgcgctca ccgaggccgg tggatggtaa     42120
     gtactagtcc gtgtgtctcg gctataccct gcaccttcgg gtcctccgtt gcaagggtgg     42180
     ccattgcaac ccaatcgcat cggcaattca ctaatgcgca tggcttggtg tcttctaggt     42240
     ttctcctgcg gtatgtatca agggatgagg tggctctcct tgatcgcggc accggcgggg     42300
     tgcccgacgt gcgcaacgcg atcgacggct acgaggagaa gtctccgctc tatggcttcc     42360
     tacaatatcg gcgacggaaa gtcgtcctca gctatctgcc agagggcatg tcccgcctcg     42420
     tgcaaggttg gtggaaccct cctctctctc catcattgtt acgacaagct agagatccca     42480
     ctgacctcgt catcctcctg cagcccgaac gacggtccaa ttccaatcgg tcctagacaa     42540
     attctccccg catgatacgg tattctcggt gacgcagcca tcggaactta cagaaagcgc     42600
     attgtcctcc gcatgcttac tgcatactgc ttccggttcg atcacttcct cttccagctc     42660
     cctccgccgt cgccgattga aagagatcgc ggaagatgcc gaagagacta ccgtaggcaa     42720
     ggacgagaac caggcgcagt ccgcggccga tggaatgccg cgccagagat cgttcagtca     42780
     gctgtctgaa gccaccgtgg ttcccccatc agtggtgtcg agtgtccagc aatcaccagt     42840
     cggcaacgaa ccaaccccga aaacttccga aaacgcctcc attcgagagc ggtcttcatc     42900
     ggtggccaca tcggagcggg ctccttccta taagaacttt cgagaagact catcttatgc     42960
     tccgtcggag ccccgccaat cttcgcagtc cgcccgacct tccgtccgtg acctggagcg     43020
     tgccggatac aaagccaagg taaagctggg tcctcggcct tccgtagatg gcagcggacg     43080
     ccctcggact gcgggcaacc tctctcgaag cgctgaacgg cggccagtgg catctttgcc     43140
     tgcgggtgtc cggtcatcat ccttgcgcaa gtccaatccc agtccttcgc gacctcgatc     43200
     ttccggaggc cacgggaccc ccgtcgccag tagagtgccg gccgtgcctc cgttactggt     43260
     gcctcccttt tccatgccca tctcgcggcc caagatatcg cccggtgcca agtcactgag     43320
     cgcgctgtct tcgtccacca cgtccaatga aaaggagcgg ctgatgaaag cgctccagat     43380
     gcgaaagacg cagatggaga aaaaagcaaa ggaggggaag aacagttcca cgacggagaa     43440
     gggtgaggtg tccgggcttg atatgaccga aaataaggag aacatcggtc atataccaag     43500
     taaaatgaag cacgatgggg gcgatgaccg aatggcccac ttggcagggc cgaacaagga     43560
     gcccctttcc gaaactcagc caaccctgca gcccatgctc cgtcatcagg gggctgaaga     43620
     agaggacggc cgtactactc ctaattcccc tgaaccctcg ggcagccacc actcccttag     43680
     ccaaccggca cgcctgagca acagcagtaa tgagtttcag gcgacgacac ccactcgttc     43740
     gggatctgaa acgcaggcgg gcgacaggga cttgggcgca tccaattccg gcggcgtctc     43800
     gggtggcccc agctccccga ctaggctgcc tagcgccatc gccgctccac tcgagaacaa     43860
     ttctggaaag gctccggacg aagagattgt tggcccctcg ccaccaaaac cagtccccca     43920
     tcctgttgtt cctggcgaac aagaggccct cctccatcat catcaccacc accaccccag     43980
     cacgccagac gtgactgagt ccgatctgtt cgagtcgcct gctcggcccg attcctccca     44040
     ccatccttca gcagccacct tcacccccaa ttccttgtcg atcgccgctc cccctccgac     44100
     ggagccgcag catgacttga cccctgaatc ctcgaatgtg gagcgacagc gcagcacgtc     44160
     tcgaaaggag aaacgcaaac catacctcga acctattcaa gtcccaactc ccgactactc     44220
     ggatgacgag aaccttctct cagacgactc cttcatggaa gaattgacca gtgccacggt     44280
     tgaggaggct aagcccatct ctgtgggcgt ctctcccctc tccccgggct actcaaacag     44340
     cagcaacggc aacgtctcac ctgatgcgtg gaggaattct cgtgccgttt caaaccccag     44400
     cgccattgga caccagtccc ccaacatgtc gaccatagcc gtgggccgtt ccgtctcgac     44460
     gacgggtgcg gattctggtt cccagaacgg gccggtcctg gtggcgagga agatcaacgt     44520
     ctcgtcgggc atctccagcc gcatcaaggc attggagaag ttctccaaca gtcgcgacgc     44580
     cccatcaatg aacggccaaa ccctcgccgc tccgtcggcg gcctccttcg agaccctccg     44640
     caaaggctac tcgggacctt ccatgccccg acctctctca tacgcccctg aatccttctc     44700
     gcggtcatcg agcgtgagac gacctagctc acaggcgggc cctggcctcg ctggtcctgg     44760
     cctttcgcgc tccccaagct cggtctctgt gactgctcgc attgtccgcg atcccaccgc     44820
     tgctgaaacc aacccgaatg ccgacccgtc cgagccggcc gtcctcaacc tacaacccag     44880
     ccaaattacc gtcgaacagg aaactacaga gctccctgtt ctgactttgc aaacagaacc     44940
     tacaatcact cagtcggaag atgatacctt gcccccgtcc tctgctggat ccgaccagca     45000
     atcctccgtg tccgtacaac gtccggagag ccgaatctcc acccccacct ctatcaaaga     45060
     agaagaagag gtggcatcac ccgccaagtc atctggcgat gcgccctcct cccctgatga     45120
     gaagaaagaa tcccgtgcga cgcgacttct gcgccgcatg tcctctatca cttcccgtaa     45180
     gagcgttgtt ggtgtgttaa accctatcaa gggagatgac catgtggtcc ccattaagct     45240
     tgaggaaccc gagaggcccg tctcgagggc aacggaggtg gctccggcga tcgatattgg     45300
     cgaggtcaat gtacagtttc ccgacactct cctgtggaag cgtcggtttg tccgaatcga     45360
     tgaccagggt tatctgattc tgacacctgg caatctggac tccactaacc gcaacttggt     45420
     caagcggtat catctgtccg agttccgtac tccgtgcctg ccggacgaag accgccagga     45480
     gctgcccaac agcattctgc tggatttcct ggacggcaac actcttcagt gcgcctgcga     45540
     gtcgagacag gggcagacct ttgtgcttca gagtaagtcg cttgcaccga tatgttcagt     45600
     ggatggtaac taactgggta cagcgcttcg cgacgctcac agcacctacc agaccgtctc     45660
     tcactagcct tgatctactg catagagctt gtgcctttcc ttctccttga ccatgcatat     45720
     attgcgcatt ccttcctcca tttccttcct catccggtgt tttcagcggt atacccctca     45780
     aaacggtttc cttctaccca ctgttttgta tccatcacat tctactcttc tatccccttt     45840
     ttgttggact tgttagtgag aggcatgatg ttctgtcggc ttgctctgtg taaaatgttg     45900
     gatcttggct tgttcgtgtc gacattagca gcatttggcg gttggttctt taatagcgtg     45960
     gcgtggattg tccagacaac gaggttattc tactgtcagc agtgcagtcc cgttaatgtc     46020
     tgggagtgta gccttaagac atgctcgctg accgagcaag ttggaacact ggttccgatc     46080
     aggacttgac aagcatctac tcatccttca tccaagaata acatgcgaac gttttattac     46140
     atctcccaac gccggcccag tagctattac tgactaattt tgtttcgggg aacgcggaga     46200
     cgacggccga gccagtcgct tttcctccca gtcctcgagg aatcgctgga ccttggggcc     46260
     ccagacctcc tcgccggcct cgaggtcctt atactcgagc accttgtccg ggtgaagctc     46320
     gaattgagcc tgacgagacc ggatcagcga ggacatcagc ccgcagcttc cgaccgcctt     46380
     gcccaggtcg tgcgccaagg agcgcacata gaagccagaa gacaccgtca tggtgatctt     46440
     cactgcagcc ggctgaggct gggactgggg cttggattcc gaggattcct cggcttcagc     46500
     cttgggagca tccgacgctt cctgctcggc cggcgcaaca ggcgcagcct cgccatcagc     46560
     aaccttctgc ttcttagccg agggagcaga ctcagcatca ccaccctcta ccttctcctc     46620
     cttagcatcc tccgcaggcg gggactttct cttcgcagag gcctctcctt caccatctgc     46680
     ctccctctcc acaatcggca actcatcctc cttcgccaac aacttctccg caacagcctt     46740
     ctcctccccc tctgcctcaa cctcaggcca tttaaactca tgcgttccag gctcgtacca     46800
     ctcgacaatc ctcaaatccg tcacctcgac cggcctcttc tggatctcaa tcggcggctc     46860
     cttgccctcg cgggcatact cataaagctt cttgccattc accttcagcg ccgagaaaat     46920
     tggcggcctc tgcataatct tcccgcggaa ctgctccagt gccttctcca ccatctccct     46980
     tgtcacatgc tcgtagggcg ccttgcgcac caccttcccc agccgatcat aggtatccgt     47040
     ctcggcgccg aacagcacaa cggtctcata ttgcttcgtg catcctagga actcgttcag     47100
     gtgtttcgtg cccttgccga ctcccgcgac gagaatgccg gtcgcgaggg ggtcgagggt     47160
     gcctccgtgg ccgatcttca cgtcgagacg ttgcgtgcgg cggcgcttgc gctggtaggt     47220
     gctttcgcgg gcgcgacggg cgcgctcgtc ggcgagccag ggggcgaaga gcgtggaggg     47280
     gttgaagtgc gtttggaggg tgcggacgac gtcggcggag gagacgcctt ggggtttgtg     47340
     gacggctgtt tatcattccg ttatattagc ttggaggtac attaaagcaa taatgctagg     47400
     agtgaggtat accgaatacg ccttcgtaga tcttttcacc ggacatggtg cgacggaagg     47460
     gtctgagggc ttgacggaag ctcatcggcg agcgatgagt gtgagtggcg ggggatttga     47520
     ttgagtgaga gcggcaattg atcgactagc acagctcagt gatgcgatcg taaagagaca     47580
     actgtagata tagttgaaca caaccgaaag aatagaagtg caatgaataa ccgaaagtag     47640
     tagtgaagtc gtccaaaata tattttcagc tccgcaaaat tacccgcatg caagtttccc     47700
     attacggagt gagtctagtc cagtctaggc atgaaagatt cccgtctgta ttttacaccc     47760
     ccccaaagca gtaattaccc ggtatccttg tccacatccg cacctaatct cgacatagtc     47820
     agctgtgtat tgtctggtaa ttgccggact gccctccggc tggcaagcag cgcagcagca     47880
     gcagtagcag caagcatcat cgccgtgact gcagtcagct tcacccctcc cctctatcta     47940
     tccctcactt acttactcct ctctcactca ctcgttcact catttccttc ctctattacc     48000
     cactacttta tccattgcct ttcttatcct attttaaccc ccctctccta aaccgagaga     48060
     gaatacacag tcccccgaac aaagcaacat gcagtcccca ccatgacctc ccgcgaagac     48120
     agtgtcctgg ccgccagaga cccctccctc accgacgaaa acgactggga agagttcagc     48180
     ctgtcggaag ttcgagtcct ggttccgggc aaatcccgct atgcgaattt attgactgcc     48240
     tcgccggaga atccggtcca ggtgacgggg tgtttggatg aggtggagga ggagcaggag     48300
     aagttgggta atttccctca cttttgtctt cttatttctg cttctggagt tttggcaggg     48360
     ggggtagtgt ggtgctaact gattactggt tagtgctcga cccagaatac ttgactaaac     48420
     gcatcgtcct cgaaaacgtc acccacttcg cctacggaca acataatgat ggggaggtcg     48480
     ggttctgggt ggctgggaag gcgggctggt tctcgatatc tccggcgaag gggtacaagg     48540
     ccatatttaa tgatgtggtg gaggcgatag atttgttgta ttttctggcg gatcggcatc     48600
     agtcgaagag gaggaggaag agaaggaatt ggaatccgag tgtcgagtat ttgtgcgagg     48660
     aggtatgccc ccatattttc ttctgtctgt tgtgtgagga tttggtggat ggttgtttgc     48720
     taatggtttg ggtttagtat gtgagccata cgcatgggat ttgcgaggat gcggacgact     48780
     ctgcagaggt gttttacaaa catcatcatt ttctgctgtc gaggatgttg aagggcgagg     48840
     aggatgtgca gtggaccaat acgtgcatct tcgagcatct gtgtgaaaag tttccggtat     48900
     gttgtttttt ccctgttcct tggggtggtt tgaagggtgc taatggtgta ggatgacttt     48960
     aagcagatta aagcgcagta cgaaggggcg aaggaggtag agtcggagga agaagaggaa     49020
     gacgaacaag aggaagataa agaaatggac gagaaggagg gccaggatga ggcggaagca     49080
     cgaccagata catctgggct atcgaaagac caggcagatg ctatctacaa ggtcattctc     49140
     gatctcaaag aagcgggata cttggccaag cgccaattga ccttcgaact cctaatcaac     49200
     acccttgtcg aacgcttcgc catcgacagt actgactatg cacacgacct cgtcgccgca     49260
     cgggccgacg ctatcataga gatgatggac gaggtgaaaa catacaactt tgactggtct     49320
     cgcaaggtca tttatcggga gctcaaagcc gcagccaaga aaaacagagt tcagcagatt     49380
     accctaaccc cgctgcggcc tcgcccctcc gatgacgatg aatcgtccgg agaagagagt     49440
     gaacatgaag accatccccg actgcgcaga cgcagggtcc acaagtcggt tttgcgacct     49500
     aagagctctg ttgccacgaa gcagaccggc aaacgaacac ggagtgccgt tgatgaccaa     49560
     gatgatgact cggataacaa cgaagatgca atggacgagt tcgagactcc aagcaaagtc     49620
     cgcggccatg atctcgttcg tgacccgttg tcgacccgtg ccaagcgcag gactcggtcc     49680
     ctcctgtacg attcaacccc aattcaaaag acgccattgc aagagacgct tcaaagccgg     49740
     aacacatccg tttcgggggc ggaccgtgag acgaacgcag atgcatcaga attggaagcc     49800
     acatttgaag acgatgtaac atctgatacc tggacgtgtc acgttcgcgg ctgcgaaaag     49860
     gttatccaca agagcaattc taaacgtggc aaggagctaa tccaagatca tgctctggct     49920
     catgcagatg atactaaagc aaagatcgat cttgtctttg ccgagcagag actcaacatt     49980
     ggacttcctg ttgacaatct ccttagtcgc atcagagaga tgggcgcatt cgataccgat     50040
     catccggtgg atagcgcttt cactaatgga gtgaagacat aatcaggaca tacaatgaga     50100
     tcctacaaac tagatacaat ttctgtgcag acagatgatg tgcgtgtgca gtctgccacg     50160
     gtatgttgct tattgcttct gtatttaatg tcatactcac atttctctag gtgcgcagct     50220
     cacagcacat cacggagtca ggttagcggc gttgagatgg catgatacat ggcgggtggg     50280
     attctgcttc ttgagatatg atgatgtgat accagagata ccagcgtaat gaagtaccct     50340
     actcaggttc agctagatag acagtcacca ttccatgatt atcaatatac aaatcaaact     50400
     gtctatggaa acactgcttt tataaccctg accggtatcg agcaaaaaat aaaccatcaa     50460
     aagaaattta cagcgaatgg aatcaagaac gacccttagc agcagccctc ctgctcttgc     50520
     ccggccgctt ggcaccaccg cccttaggac cacccttcat cttcttgacc gagaagtcgc     50580
     gcatatcacc actcgagaca gcatcaccgc tcttagcaaa gcgcttctta ccaccgaacc     50640
     cgaacttctc attcttcttc tggcgcttca tcgacggacc accctcggca tcacgaccgc     50700
     gcttgcgacc acccgcctga gcagcatcat caatagcgac atcgaacatg ttggacgaat     50760
     catcagtagg gccgccagtt tcagccttgc gctctgcaca caccaaaaca gttagcaacc     50820
     actctcaaac ccacaaaggc caactccccc aaagaaacca agggataaac atactcttct     50880
     tcaacgcatt aatcttctcc aacgtctccc tcttctcctt cgccctctgc tgcaacttcg     50940
     caacctgcac ctgctttcca aacttcttca aatcacgctg cttcctggcc tccgccgcgg     51000
     ccttcttcgc cgcggcctca tcatacaact tcttcttgat cttgcccatg tgctcatccg     51060
     tcttcaccat ctcggcgaag taatcgccgg gtcgcgtaaa cggcacacct tctttcttca     51120
     gggtactccg cgccgtcatc gccgccgcct ggcagacctt gtagaaggcc agttcgcggt     51180
     tcaggtcatc gttggcgtcg ggcacttcaa tcggttcctg cgatacgaga ctgttgtgct     51240
     cggagaaggg agtcgcgggg gtgaggaacg agatgcgctt tagactgctg gtgatggcag     51300
     cgctgttgtt gattgtgagg cgttggtggg tgacgacgtc ttcgcgttcg tcgtcgctga     51360
     ggtcgctgag ggggatgtcg gattcttcgg cttcttcttc gtcgtcttct tcttcctctt     51420
     cttcggcgtc ggagggggtt tcttcggggg tttcttcgtc ttcggattcc tcctcaactt     51480
     cctcctcctt cttcttctcc tccttcttat cttcaacaac agcctccttc acatcttcac     51540
     ccttggtagc ggtagtcttc ttcttcgccg ccttgacgag cttcttctgc ttctcggcct     51600
     cgtagtcgcg gccgcggtgc tcgtccagag cttgaaggag cttgctgcgc ttaggcatga     51660
     tgggttatga gatgtgattg tggtggaact ggagtgagtt ggtctggtgc aaagctgcgg     51720
     gctggaactt tgctgcaaat caatgggaat atttttttgg ggagatttgg tgacgctagg     51780
     catgctttgg gtttagtgtt gtggggatgg gggaggaagg ttgttccgtt atcgggttat     51840
     cgataaggaa tttatagcag tagatatgta tgtagacgag atgtttacga gaataatagg     51900
     agtgttgatt gctatctttt tcttttcttt cttgtttatc tggaagtcaa tattgtaatg     51960
     ggattaatta tgcggaatta cctcatccat ctagttgtga aactaatcgg tttatcaaag     52020
     tcagctgttg ctggggtgtg taggagagtg cagaactacg tgtcttggta catgtgaaga     52080
     ggtctgttgg cggattagaa ttttactcta gtctgtttat tcaatgaaaa gatttagaca     52140
     tatggtatat taggggcact ttatcttcat cactggtagt aatgatacta gtacaagaaa     52200
     ctgatcactc ccatctgaaa tacgatatat atatatctgg ggtaactatc ttttctgaca     52260
     gctcacaaac tcgagaacgg tcatccatat agtacccaag gaatcatatc ctgaccctcc     52320
     ttaattttcc cactctagta cttaagttct tcagttcatc cacatcccaa tttcgccacg     52380
     cttgtttcca attgaagaac gcggcttccg gactcgccaa ccacaccata aagtcggcgt     52440
     gtagacttac tgaacaatca gtctctatcc atacatgata gaataggtaa aggtacccct     52500
     attcctaggc aatttcgccg gatccgtttc agtcttccta actatatctg ttatgaccat     52560
     cccggatgca atgacaccgt aaacacattc ggatcctgat atttgtaagg atcattagcg     52620
     tcatctacga tacatccctc cgtcctcggt gttggggttg cagtccagtt aatagaatcc     52680
     gcagacattc gaaaagctca agcaattcaa cgaaggcaat gcatcaagaa gagggggaca     52740
     gctacttctc ctcgagaaaa tgttctctag tagatggtta gtgtgtcagc cttgcagcat     52800
     tagcgccgcg ccatcatgtt tggtgactcc ggatttattg acccgaatgc agctcgtagg     52860
     gatacccgat cactacccaa gctacaacga gtacttgaga atcttataca ccagtacaag     52920
     catcatctct ttttgagcct gttgcttcca ccaaagattg agttagcttc atgatgccgt     52980
     tgtcatacga caagttggat cccagtgcca gtcagatccg tcttttaact atcattcccg     53040
     acgagaatga cgagaaccct gtttgtggat cgctccatac cgtgtctctc aacgacacct     53100
     gcgactttga cgccctgtcc tacgtatggg gcgacacttc tgtgactgtt gacatctcgg     53160
     ttgataattg tatagtcggt gtaacaccaa atctgcatgc tttcctgcgg aaaattcgcc     53220
     agccgaatac agaacgtacg gtatgggttg attatgtctg catcaaccag aacaatatct     53280
     cggagcgaaa ctcgcaggtt gctttgatgt gtcaaatcta ttcgaatgct aggtcggtgg     53340
     ttgcttggtt gggggatctg gcgccggaag ctctggagct cattgagtgg tatcatgcca     53400
     atcgaaatgg gttttacttc gaaagcacag gtcttcatat tgataaagct atagaaaagc     53460
     tgttgactcc tgcaaaagca ctgtgttcct cgccgtattg gcatcgggta tggacatttc     53520
     aagagtggca tctctcaaaa attgcccctg tctgtatgca tgaaaagacg actttcacca     53580
     tgggaaacat atttaatcga ctgcacgatg aagtagcggt cgccaggagt aggcttactt     53640
     ctgatactat ctctttggac atgccataca gagcatatcc aaagccggta gtagctaact     53700
     caagatgtgc gctttttttt gggttgcaac gaagactcga cacacttgtg aattatatcc     53760
     cgcgggatat tctgcacctc aatccgtata ccccgcgtcc atcggggctt ggtgacttgc     53820
     tatcgcttac gagggaccgg caatgcagca atgaactcga taaagtatat gcgttatatg     53880
     ggctttctcc tgtggctagg gtgacatacc ctcccgacta tcgaaagacc atcggccagg     53940
     tcaaccatga aacaacgtca tttatattgg gacacgaagc caatatgaat atattcaatg     54000
     acttcgattt ctgcttcaat tctgctaaca aagacgagtc actcccttca tgggttgttg     54060
     acttcaccac gacggatccg aaacatcgcg aaaagatgca gcaaagcttc tccaagacga     54120
     tgaatctgga caaggctctc tgggagcaaa gtagagacca tgctcccata gtagcagatg     54180
     atatgtagac tctcaaactc tggtgtcgta aagtaggcgt tagccttggt cttccatacg     54240
     tgttggactc agaagtcccc cgctgtatga cgcagacaca gctggctgcc agaatcatca     54300
     tgaaccaaag caaagaccgt gatcattgct cgaacataca cgatatggtg ataaaagctg     54360
     cttactacta cactgatagc tccaatctca ttccccttag tcccttattc gagatcatga     54420
     aaactcatca tctccctggc gagtttggac agtgggaaga gacgtttaaa acgtatcttt     54480
     tcgccaccta cctcattttt gagaaacttg cgcgaaagcg attgttttcc gtggccatct     54540
     agactgggag tagtattggt ttcactgatt gtgagattga aaaggatgat cgtcttgtca     54600
     tcccctgtgg aatcgcccaa gtgtttgttc tccgtcccat tcctgagaag ctgcttgtgg     54660
     atggtgaaga agttcagtgc ttcaaggtga ttggacgggc gtatgttgag ggaatttcgg     54720
     atcgagagga agtcatgccg catcctcttc gttccgagat ggaaaggaca tctcctacac     54780
     tgttctgtct ccgatgaaat tccattcctg ctctaattct ccgcactgtt gattgatcag     54840
     taggcatata cactattttc caatgaaacc agctgcattt gctataggat ggacatgaac     54900
     gtttcaaatg atttcaagga agagactaat ccaaaagacc actgcgagat tgtcataata     54960
     agaacctttt gctagcctgt aatgaatata agctacactt acattgcttc aataggacta     55020
     cacgtgtatt aaccactaag gctatataaa cgaaccttca catgacaaag ttcattaact     55080
     atggtaatag cctctaagtt tctcttggaa cttgttgagg gagatactca cccattgcat     55140
     cgagcacaaa gtagaagagc agagcgatta ccttgattca aggacatgac cgacaaaatg     55200
     tatttacact aaacgaaacc tctgcacttc cttacagacg acgatcaatg aaggtggatc     55260
     tgaagttcaa tagatatcgt tcctcttgat acgtctaata tccttccgct cattcaatag     55320
     atagataaat gtaggtgtcc agatagagga cgggaatgtc atttaggcca tgggccatga     55380
     ctgcaaggga tactacatgc acactcctat cctcacggac tctcgggatc tttctgcagg     55440
     acacaaacgg gaagaaagtg ttgttcaaac tctattactg cctacacatg ccatagccgt     55500
     ttgtgacacg aggccggaag gaccgagaaa ttaatgcaag ggggacaatg tttgacgggt     55560
     tgtgacactg acatatcagt aagagggtag agtatcatat acaataatgt aggtgcagaa     55620
     tggtgatgaa agtttccatc tacagaacgc tgcgtagggc tgcatcatgc agatttgtca     55680
     caccatggca agatggtatg tatatctcgg tcattccgag ctctgccagc taaccatgta     55740
     gtaaccttct agctggtgtc ttgttagatg tcttgtagag atttcagtaa acccaaccag     55800
     tctcaacgcg ttcagcttct tctaggaatg tgttatatgg tacacgtcaa tctaccaccg     55860
     taccagacat atatagctct cccaagtcat cacacttctg gtatgaacat tgttgacggg     55920
     gtggttatgg tatgtggtag ttggaggtgt ggtgaaggtg aaggtgctac tggggaggac     55980
     ggtggagggg aatgctttgg cgtggaggtt gtggtctatg tggttgatgg cgttgtatgc     56040
     tttgccttgt gtgtgtgttg ggggggaggg gggtgggggg atgaagttgg agtttgatat     56100
     agaggagtgt gataggggga gtaggagttg ggagaaagtg actccaaaga tgtagaatgg     56160
     aaggtgatgt tagagttagg agtttgattt tttgtgacct atctccaaag agagtgagag     56220
     ggatatgtag aaattaatta cagtagtaaa atcgaaatgg tctgggccgg aggagaccaa     56280
     aggaggggta atgagtgaac aggatgaaag tgtggtacag acaggggcca gccagtgaat     56340
     tgctgttgtc atctcaggtt atacttgacg gtcaacttta ttccttgtaa gcactataat     56400
     attataatgc taggcaagaa agtatatctg gcgagtctat catcaataag atgggtgaac     56460
     ggaccaatga catttgattt cggaacaggg atgtagaact gatgtattag cagcttcttt     56520
     gttcactaac tatagccata agatgatata atagatgaac gtcatatata gccttctaca     56580
     gctgacctaa agcaacagca tccatgcagt agtctcttcc tatcttccat gtccaataac     56640
     tccatctagt atgtatactt aaacccagcc aacccctcga tcggttttcc cccacgatca     56700
     acccgccgat tcgcccgcca gaacttgaag ctgagtcctg ccacaaccac gataaccagc     56760
     gcgttagcga tcatagtggt caataacccg ggtcggtagt tcggggcatc ttgggccctg     56820
     aagaccgttg tcccgatgat tcctccgata ctgcccccgc cgatgagggt ggcggatgtg     56880
     aaggcgcgct tccattggcc gcggacgttg ttactattaa tcatgttagt aactaatatt     56940
     atatataaca agagtgggat aattagggaa aggatcatac ctctgccatg agactaaggc     57000
     tgggcagttc gcattggcta tccttccatc agtacagcgg ttataccaac agggagagga     57060
     tactcaccag caatagtcgc cagaaagaca ccaaaatacc gtggccccga ctcactaaga     57120
     taccccaata aagcaagccc aaccaggccc atagcagcat ttgcagcaat gatcggccct     57180
     ctcaggtgcc atttgtcggc atacaccgcc tgcgtataca tcactatcgc cgccgcaaca     57240
     tacggcggag ccaccagaca ctgagccttt gcaaccgaga accccatact atcctccaga     57300
     atgatgggaa gaaagtaggc gatcgagtag ctgttcgctg tggtgagcat atacatggca     57360
     gcgtatgccc agaccttact atctgcgccg ctgcggagat agcctttcaa tgtgaatggc     57420
     tccgtgtaga cgtctgatcg gtcgttctcg atcgtagcta ccacgtaggc ggcctctgat     57480
     tcgttgagaa agtgccatga cttgggggat tgttcgggga agtcgactag gatggcgtag     57540
     gagccgatgc ccattacgca ggttaggatg ccttcgatct gtggggtctg cattagtgta     57600
     ggttttcaga aggtctgtgg ggtatggggc agtacaatga agatccatct ccacccggac     57660
     tttccgccaa ttccatgcat ttgcatcagt ccgtaggcga ggataccgcc gaatccggat     57720
     gccgtactgc caatcaggta gaagagggca tttcgcttct gtagttcgaa gcgagggtac     57780
     caggtgctta gtaggtaaac gcatcctggg tagaatcctg cttccagagc accaaggatg     57840
     acccgcagtc cagctagcac tggccatgtt ggcgacatgc caaagcccta gttggaacat     57900
     tagcaacgcc accactacta cccctaaaac agtatgctat tcactgatca taaaaactta     57960
     caatcattac cactccccat agcagaacaa tagcagaaag aaacagccga ggcccgagtt     58020
     tccgaataat caccgtcatg gggggctgaa acacggtata ggtaatgaag aagaccaacg     58080
     agctaatact gtatccatta ttcttggcat tcatcttcaa ctcttcctgc atcctatcag     58140
     tacgaaaaat tgagttagct taatctcttg gccgagccgt ggccatgaag cggggttgga     58200
     agaagactgg aatgccatac ccggcaaccg aggcagctcc caagttagtc ctatccagca     58260
     aactgataca atatagacaa cccagtggga taacgagacg aatgtcaatt ctccgcatga     58320
     gtcttttctt ttccttcgga gtaaagtagt cgagggattc cccggggtgg atgctgttct     58380
     tctcggcatc ctcgacgtgg gatgccgctc cggaggactt ttctgcttcc attgctgcgg     58440
     ggacggggga ttcttctttc atgttgagag gcttagagat ggatgattgt gaggcatttt     58500
     gactgctgta atgggatggc attatatagc tgtgtgaggg atggggatat acgaaagttt     58560
     ccccgcagga tgaccccgca gatctgttac cccggatttc gccatctcag gccaggagta     58620
     aacatcactc gcggatggag aatttagtta tgggtcgtag cgataggaca cgtcacgagt     58680
     cccgcagctg gacggtagat ggaaagccca cggcaggtca ctttgtactt ggcaccgagg     58740
     gacaagacaa tcagtggaag ggatcaattg ggtcctgttc cgtgtggcga gggactcgta     58800
     taatacgata gacaagatct tggttctccc cgagccagga gcctggatca tctctgaata     58860
     tattaaggtt atcaatttcg caatctggag tctttcggtt ctcccgaggc aggccggggg     58920
     ggagttctga tctggggatt tagagttcgt tatctctatt ccaagtcatg acatcaacat     58980
     gtccatgtga attctgattg aaatgaacca cctggtttga caggctggtg gcccaaagta     59040
     cctaaacgga actgtttccg cgattcatca gcatgccatc agcactgctg ggctggaagt     59100
     cccgtctgcg gggcaccttt taagctgttg attgatgcaa actgcatctt gtatcaactc     59160
     ggtcgtacaa caagaggctg ttggcagata accctcatct atccacagga aaggtgatca     59220
     ttctgatgat agtagtacag tagtatcgaa caccaggaac ttggtgggag atcgctaagg     59280
     atataaatga catgttcccg gccattgcta gatgagtcgc cgaggatatc cgtatctaag     59340
     catacacgag atgatagtac cgaaaacaga aactcacaac tctagtggta tctaaacaat     59400
     tcccttcaat aaatcaaacc agtcaaccat caacgccaac cgaaatagag acagccacac     59460
     cagtttaaaa gcccccgaac ggataatggc taagggaccg atgtggtgca acataatagt     59520
     cctggtatgg atgattctcc atcgaaaagt ccgcagttgc catgagcgga ttgatcactc     59580
     cagctggcac cttgggccgg gcaggagcgt gatctgcggc caaaggatgg tcactgttga     59640
     ataacgccag gatatcttcc gacatatgca ttggaggacc gtgagagtca ctccagcccc     59700
     aggcttcctg aagctcctgc ttcacgtgct cggctttcca gcctgtctgc tttatgatgt     59760
     cctcgagaat acctaaggct tcttgttgag cttccctggt cgccagacac tctgcggcaa     59820
     tggcgaggaa acgtattgat agacttgcga ctccactgct tcatattagt tgttgatcct     59880
     gttacacgta tatactggcg acgtaccgat ccctggagtg tgccacgatg ccgcagatat     59940
     cccttgcatg gctttgctgt acagtctgca tctcggcact gtactccgac tcaacggggt     60000
     ttgtcttcgt aagcaagatt cgtgcagtgt ggtatagtag tcgagcgatg attgtggaac     60060
     gcttgatgag cctataaata ttagtaagtc atgtgcgaat agatcagacc gatgctcacc     60120
     atatctgcgg aaagacggat ttagagtttg tctgccacga atgaatatat cccaggggca     60180
     tcatggaccg cggcacagct ctagcccact gatcgcacca ctcgttataa gtacaccact     60240
     cctgataacg ctggctgatt cgcatgtcac tggcagcctc cagtgctggc ggctgggcta     60300
     acgatcgaaa gttcgcaatc ttggcgcaaa tgaataccat ctggtgcgtc cacgcttctt     60360
     cattgcctgc aacacttggc tgtgcatgat tcagatccag ttcaacaccc cacgtgtccg     60420
     ggtcccagga aagcgtccaa ttgaaatgca aacagctgag tagttccatg cttacattca     60480
     accagaaaca agcacctccc agtcccggcg ttttggcatt ccagtgacac tctttgatca     60540
     aagctcgcgc accagcaatg tggctcatgc cttgaatcgg tcggccagac attaactcgt     60600
     agatgttcag cagaatcgct gtagttgcgc agagggccga gtcacgatca gggtcttgta     60660
     atgagcgaag aagatattgc gaggcgacat tgtgaagttc tgcggccttc tcctctccgt     60720
     acgaggcgtc cacgtggaat aagtgccttg caccgcatgc caacagagct ttaagaagca     60780
     taggttcctc aagtgcatga aatggaagaa tatgcgtgaa ctatggaaat aagcgactga     60840
     tgaccacgtc gcaaggatcg acaacttaca tgtttcaccg catccatcga atccatccat     60900
     agcccaacct cttcaacaaa tacctgtagc aggtaaactt cttctgggtt attgagacaa     60960
     gtgtggtttg tagcattgat atgaccttcc ttcgtggacc tgaaaggggc gaatgatgca     61020
     ttctggtcgt aaaaggcagg ggcatttgtt gggccgttaa acggtcctcc cagactccca     61080
     gactgggggg tcccgaagcc atgtacgaac gaggcactca gactaggagt cagacaaggc     61140
     cctgtcgcat tccccttctc caacgaaggt tccgccactt cggggggata tctctcaaac     61200
     ccacccacgt attcagacgc tataagccgc gactcatctc gaaaggtcac gccagtcgct     61260
     ggtatacgga ctacgcagtg cgggggcgtc gatttctgga tatctatgaa gtttaagcgg     61320
     attccacgcc tgcatactct gcccgacttc cggcaattct ggcatcggtg caaagcctca     61380
     tcgcacttca ggtgacgttc ccgacatgtc aagcatcctg tccgcactcg cctcggcttt     61440
     gcgaggacaa tcttgctttt tcgcttggcg gctgacgggc gcggtgcgtc cagcgatgtg     61500
     ctgtttggag ttgacactcc gccctcatcg gagggactcg tgtcttgtgt gatggcttcg     61560
     gtcgtgacag ccaaattatt ttcatcaaga tcaaactcaa gtatatcggt gatttgccct     61620
     gaagctgtca gatccagtga gagatccagg tccgacggga cagagacatg gtcgccgaga     61680
     gctgaagcca tctcaggctg cttcgatcaa ggatgacccg tcaagcctga accacaatgt     61740
     atcctcccag tcttgggtta tgatcatcag caaaccccaa attcagcccc cgaaactgtc     61800
     actcccgagc attctgccaa ccacaagatc tatagcgccg tccggcttcc taacgcagca     61860
     ccacttcaca tagatattcg gggccgataa gatgaatgac gtagctgaca gggatggcag     61920
     ataataatcg aagatttgcg cacgatgcta aggttattaa ggtgacaccg aaaattaaat     61980
     gcataggcac cggtatctgg aagcgatcta acagttgttg atctgtgcaa gaacgatgtt     62040
     agcttatgtt tgatagtatg caatatctcg caggcacagt cataccttag ggattaacag     62100
     aagaagagac aataaaatgt cagcaatcaa ctcacacaaa catgcggcaa tagagagaaa     62160
     ccggggagtc tcaaaagatc cgcggggaat cgtgactccg ggtcggagac actagtccca     62220
     gaatggtcta gggcgacaga tcaataccgc ggcagaacaa agaagcgata cggttaatcg     62280
     gtcccgctca attattttat ttcagtctct acgtgatgtg gtgtctttca cggattcgta     62340
     ttttcactta taaatttctt tgcaaactaa tcaagtctct ttataatagc gctcgcaatt     62400
     tttggtccag cattaccttt atccataact tttgggcatt gggtcgtaaa tcaatgaggt     62460
     cttcagcaac atgctgttca aaatgacagc tgcaagagag gtatctgtta tcgccgtcta     62520
     cattcgttcg gtcaatacca tgtactgtag catatcagca gctcatgttc tcatgctttg     62580
     gttcccaatt tggggactcg gactcgaagg tgcagaagga gcataagagc accccagatg     62640
     gcagcagaga agaaagtagc gcgaagggca gcagcatacg ctccgattac tagtcaagga     62700
     tttagtgtca ttaacttcca cgggtacata taatcgagac ttaccttgtt gctgatgcat     62760
     tgaatcaagt ttcgcgattg cttggacgga tttgcgaaca aggaggataa caccctcctt     62820
     gttgggtccg gtgaccatct cttcaagttg atacacgagg gtgttctgga aaatccaact     62880
     gctcgttgcg acacccatca ccgatccgag gtttctccac aaacccaagg tcgtcgtggc     62940
     cacagcctgg tcctcttgat cagtagtggc aagaaccgac accattagcg aggggaaaga     63000
     gcatccttgt ccgagactgg agagcgaaac gcaaaccatc gcaagccaat caggcgtacc     63060
     aacgctcatg gaagcggcag cgcaaccacc cagcagtaga aagatgtcac caaagatgat     63120
     ggttggctta agccgtttag tccaagtgat gatgaagcct gttgagacac tggaaattgt     63180
     caccgcaaga gttgagccaa ttagcctgag acctgagtca gtcggggtag ctagtttgac     63240
     tgcctgaaaa tacagaggcg cattgaagac catggtgtta acggagatgg cgccgaagaa     63300
     gtttccaaag atgaggctgg cgcgaggctc ctgtaccaat aacgagattg gcatcactcc     63360
     ccgctccacg gtccgctcat agcgaacaaa aacaacagct aagatgagag atgagatcaa     63420
     ggacgtgata acaatggggt gagaccagct caacacatta ccacccaggt ttagtcccat     63480
     aatcagtgaa gtcacaccga cgacaagtat gagtgagccc acaagatcaa tgctcttgag     63540
     gagctgcgtc aaactcttcc tctctgtttt cgccctcttc aggcccaagt cggcaggggt     63600
     tgtccaagct gccacgatga agtaaacaaa gatgaagggc aattgcacga ggaacgcacc     63660
     tctccacccc acttggtcgc acaggaaccc gccaaacgcc aaaccaaggc agccaccaat     63720
     acccagacag agattgatgt aggactggta gacgcctcgg tattcgaggc gtactaaatc     63780
     actggagaga atcataccca tggagaatac gccaccggct ccgagtccgc aaaatgctcg     63840
     agcagcgatg aagctgaaca tactctgggc ggctgcacac catgccgtag tgacgaaaaa     63900
     gatggcaatg gcgaaaagat acactggctt ccttccaaat gtgtcagaaa tgcgtccgaa     63960
     cagcgggagg aaagcggtag acgtcaatag gaatgccgtc gacagccaag atgcggagtt     64020
     cgaggcgtgg aagtaggagg ttataacagg gtgactcgaa gccatcaacg tggagtcaaa     64080
     aaatccgatc acgtatccca tcaagatacc agagaagata agccagaatc tcatcggtga     64140
     gacattgatg aaacgtgaag catagccagt aggctcaccg gcaactccat cttcggcatc     64200
     cccgggcact tgtttctggc tcacgggggc agaagggagt ctctcgaggt taggttcaat     64260
     ttcgagcccc tgggggattg aggtgactct agagagacta agtatcgcag ggtcctcttc     64320
     gggggcgaag atggttgagg acaggcttgg atcgacatcc ttatctacag tcgtatcgtc     64380
     ttgacttgta tataatgatt gacgagatga ctcatgcagc aatggcgtag actcagtagc     64440
     agggagaaat gatggtggct ttccatctgt tgtatgggga gaagtcataa tcggagtaga     64500
     tgcggtgaaa gaaattgtat caaatgatca ctctaaaata cgacttttgt tggatagaac     64560
     ttaaagatca tgaaacatag tatatggagc cgaatatttc cactgaagtt ctgttcatac     64620
     aaagaaggaa aaaaagatag ttgagaagag aaaggaaagg gagcagtcta caaggggagg     64680
     tgtaattcag tcggggagac tggctgagac aaattttata gagggatttt ctggtctgcg     64740
     gcactaaaga atgcacgctg cggcacggtg gattccctcc cgcacggaac tatggatatg     64800
     actcgactcg gtcagccttt gcctcctgga ccttattgcg cggaaagacc aacccattct     64860
     ccaccgattt ggacggctgc attggttggt tcagaggcat gaggagccca aaattttgac     64920
     atacgtaccc gtcaaagttc ttcaagtctc atggtagata gatatgaagt gaagtcaaca     64980
     aaccctggaa gctgatttga taagcgcagt tagcggcatt gctgcctcca acccctcatc     65040
     ttctagtatg catttagtat gcatgtggac aggatccttc ttgatgcacg caaatgagtg     65100
     tctcgctcgt gctgcgattt cggcccactc ccagaatatc acgtgtaatc actcttgctg     65160
     attggttcaa ctgcagtcat cggaccccat gccgtgtatg caccctgcag agtctaacct     65220
     gaataggaat gggggccctc agagcgatac cggcagagta catctcggta aggcatcaat     65280
     accgagtgga ctacttagta cctactaact tatctatggg ggtgcagtag tcgcctgtgt     65340
     catctgcgga gctgatggcg tgcgaactgt caggcccagg taccatcttc tatctaccaa     65400
     tgagtacttt tctcttatgg cattcaacgg acaactagcc gagctcgatc gttttccgaa     65460
     gccaaggatg agttatttct tttgagacag atgaagagaa accaccggta ctgcgcaagt     65520
     caacagatca gccttagcag atgacacagt gccgtatgca cgcagcttgc atgttcagta     65580
     aatgctgctg aaagaaccct gccacattgc accgactagt tgcagggttc aatcccgact     65640
     gcatggtgtg tgcaactcga tattttgtag tcgtctctgc ccaatgcttg aacaagattt     65700
     actcttcaac tatccaatca cctccaatca agaagcaagt tccatccggt ggccgctttg     65760
     ctatgacatc ctccccgcat caagatgcat gatcagccac tactttgcta gatgttagtc     65820
     aatgccatcc tatcaggtgc accgtgtata ctccttatca aggacactgc atggtctttg     65880
     agagattttc aagagagaca tagaacctca tgagaagagt ctggatggtt tcggtccgag     65940
     cgggaggcac atccgaagga ggtggcggga ctaccttctg ataaccagac tagcgcattc     66000
     gataagagca gccaacggtg attcatacaa ccatattacc tgtccaggcc accatttccg     66060
     acacagtcat tgcgcataac taacaagcag atcaaaccat aatctgcaaa cagcttgcat     66120
     tgcagataag taagtagcag cttttcaacc cgctcctgca gctgctttcc tctccggaac     66180
     ccgtcttcga atcaccgaat tacccctccc tccaccacca tgcccccgct tcgtatcgcc     66240
     atccttgaat gcgacacccc agtcgaaaaa gtaaacaaca aatatggagg ctatcgcggc     66300
     gtattctcac tcctgctgcg tgaaagtgct gcagcactag gacaacccga taagctagac     66360
     ccagaaaccg gcctcgagtt tagcggctgg gacgtggtaa ctgcgcaaga gtaccccaac     66420
     ctggaggatg tagacgcaat tgttttgtcc gggtcaagtg agttagctac ctacccttcg     66480
     tgctcttcct taattcccgc gcaccgtgca gcatgcactt cctctgcaag gcgcgccctg     66540
     tgactcacat tgtctcctag aacacgattc ctttgaggac cacccttgga tcctcaagct     66600
     ggttgaattc accaaaaaag ctttcgaaga caagcgcgtt aagattttcg ctatttgctt     66660
     cggccatcag atcctggcac gtgcgcttgg cgccagagtt ggtcgcaaca ctgcaggatg     66720
     ggaacttgca gtgtgtgagg tggacttgac tgagacgggg aaggagttgt tcgggaggga     66780
     taagcttgta tgtctaccat ccttctctcc gtcaccaggg catgcatata gcttttatgt     66840
     gtatgggttc tatgctgaca aagtatgttt acagcgcatt catcaaatgc accaggatat     66900
     tgcgtacggg tacccatccg aggtcatctc cctgggcgct tccccgaggt gtgcagtaca     66960
     gggcatgtat gtccctggga agttgatctc tgtccagggc catccggaat tcagagaaga     67020
     catcatgacc gagatcctta ctttgcggac tgcggctggt atcttctcga aagaacaatc     67080
     agaagatgcc tttaatcgcg caggcatccc acacgacggc attgcgatta ccatggcctt     67140
     cttgaagctt ctgatttgaa tagacctgaa catatagagc gacattttac tttgctgcca     67200
     ggactggctg agatacctcc atagctaaca atactttggg tacccgctga aattcagctc     67260
     cagcgacgca tataactaga cagatcaaga atagatgtct tttatccact aaagatgcaa     67320
     atggttaaaa ccgcaaaccc aagcgcatct agccagatga ccataaacga tgggtataga     67380
     gcgacctata tataatcaga gacaccgaaa tcaaatcaga ccccacagat cctataccga     67440
     tccgcaataa aaccatcacc gaaatgcaaa cgcttaaaat tgacaaaccc tccgaagcaa     67500
     caatatccca gtaaaacaat cacaccccaa tacctgcact atatcacccc gtagccgacg     67560
     gatcctccct ctccaaaaac gtcgggtcca tctccacctt cctctcaaac ttcgtccacc     67620
     aatcacgaaa agtcttcaac ggaacagttt cctgtcctct attgctcgga tcctccgacg     67680
     caaagctcgc caggaaattg aacgcattcc caataatcct ctgcgccagc accttcgtag     67740
     taatttcctt ctgctgtcgt gtatgtcgca ccaactctaa cgacgacccc gcgccgccag     67800
     cttgttccgc ctccagcgca gcgatctgtg gtgcaacagc ttgaacaggt tcaagcgaga     67860
     tccccagcgt taccattggt gctgcgcccg ccatcgcatt gccattctgt agtcctggga     67920
     tttgcggggc ctgcacttta aggatcgcag atggtctctc attcgctagc gcaccgataa     67980
     atttgaactg gggtgcgttg ttagggtcgg ggaattggat gtagatagca gcggcggtat     68040
     cgggcgggag gacggtgccg gggagaaaga agacgacaag ttcggtgagt ttgggcggaa     68100
     gggggaaatt gaaggcgaat ttggtggttt ggccgtttgg ttgtgtctcg actgcgacga     68160
     tgtctgtcag gcagggatgg tctggtatga tgacggagaa catggtgcgc aattggcagt     68220
     gaggaggggg atgacgaaat taagactgtt gtattgtata gagcatgtag attggatctc     68280
     gatgtggtgg gatagtaatc ttaatgtgta ttgttatagc tggactagaa cagccggaga     68340
     gaattgcgac gcatggctta aaagggtcct aaagcttccg gaggcggaga agagctagct     68400
     agccagcttt tgaagaattt cctggcgcgt tccatgatgg aatctcaaag aaagactcgg     68460
     tgacgaaatg gccgtctatt gcccttatcg ataagggttc cctcccgcgt ctaggctggt     68520
     tgaactcttc cagttggcag agggggggca tccccgcggc taagtttata attattatta     68580
     ttggtgactc accagcctac aggacttgtg tatatacgtc tttcgttaag attgttcttt     68640
     tagcatcatg ggcaagtcaa atcttgagct ggttattgag tgcgataggt aattattatc     68700
     ccatatcctt tgtcccgatc gcttgggttc taatcgtcag atccgcatgg cagatttccg     68760
     tactaccaag atggccccgc ttcttatatt gagcacctga agaattatca tgttttcaag     68820
     gtcgccggtt gcgatgccat tctcggttat atcctgaact cgacagtaga gaggttcgac     68880
     ttgccctcgg aatggtgggc gactgattcc gacaaccgga gcgtcaccct cctggctccg     68940
     gctgacgcga ctcctcaaca gcgcagcgag atcatggcca agacgttgag taaggcagtg     69000
     gagttgggaa catttgacat tctcaagggt tggcgcaatg aaatgtatcc tatctatgga     69060
     cccggcggta aatttctcct ggaaatggaa cgatctgcta ccccgctgtt tggtgtcgtt     69120
     tcgtacggcg tgcactcgac cgtttacgtg gaagacgaga atggtctacg catctgggtt     69180
     cccaggcgct cgaaaaccaa gcagacatac cccggtatgc ttgataactc cgtggcgggt     69240
     ggaatgagca ccacggagca cccgtttgaa tgccttgttc gcgaggcgat ggaggaagct     69300
     tccctgccgg aggacgttgt cagagctaat gccactccag cgggatgtgt cacgtacacg     69360
     tatgtccgga gtgcaaaggc tggaggcgaa acagacctgg tgcagccgga ggtcgagtat     69420
     attttcgatg tcaaggtcgg ggcggatatt atccccaagc cttgcgacac tgaagtcgag     69480
     gagttcaatc ttttcactat cgaagagacg aagaaggcac tggctaatgg ggagttcaag     69540
     cccaactgtg ccgttgtctt gattgacttc ttcattagac atggtatttt gacaccagag     69600
     aacgagccgg actaccttga gatcatcgca cggatgcatc ggcgcttgga gttcccgact     69660
     gcatcacacg tgacggtata acctacaact gactcgcata tatggaatca gaaatgtggt     69720
     gtgaagcaat atttaatgtt ctatttgata taccctatca ccaatcaaac gccggcgctg     69780
     caatcaaagt accccaagca tgcaaaagac ttttctgact atccaagaca gaacgggcca     69840
     acgccttaga ctttctggac actatatgtg atggtcgtga aagtttcttt tttctatttc     69900
     ttcaggagca gatacacgta gtcgatcctc aagggggcca acttcttgta aggaccttcg     69960
     aggtaaagca aaagtccacc gaaagagatg aaaacggccc tagacacgat ttagtcagtt     70020
     gttgatcgat aataatctcg gtcacatcgc gaagtccgca acagaccgcg atacgtgaca     70080
     caggaaatct tacatgttac cctgactcga accctcctcg aagcggtaaa ccttgccgtg     70140
     gcagacataa tcgtagtcgt tggccaaggt ctgctcgccc attccaacct ctctccagcc     70200
     cttcgatccg gagtcatcct tgccatccag agaaagcgtc gaggccagag ccatgttcac     70260
     agactcgcca acgacgcaag ggtaaagctc ggagttgaca tcgagggtga agtgcgagag     70320
     ggtatcagtg gagttgcagc tcagacgcga aacacggtca tatttctggg agttgatggt     70380
     ggtgattgtg aaggtgtctt cgaaaagtac cgggtcggac atggttgcgg cggtggcttt     70440
     gagcgttcaa ttgaatcgca aaatgaatga gatgcaggcg tttatgcgaa agacggtatt     70500
     cggggaggaa caagacgtgc gctggcaaca agaggcgtgg tggtcgtggt agcgccagaa     70560
     ggtgaaagcg aagagtcgag ggcggacagc ttttttgctc gacttttagc gcggcgccgc     70620
     ttttactttc cgggagctgc cccgcagcaa atcttcaaag tattccgttc ggttcactgc     70680
     tttcaatcac tctaccacct tacacgatgt cttttcgcaa gagaaatatt ggactttcgg     70740
     caggcgctga tcgcaccggt gccgttaatg ctaacgcaca gccgcaacag ccttctgcga     70800
     cgccagaatt gactcccgga gttcgcccct cccccgacga cgggcgcccg actacttcga     70860
     ctggtactcc gtcgctggat aaccttctgg ctgggcatgg aggtcttccc atcgggaaga     70920
     cactgctgat tgaggagaat ggaactacgg attttgctgg tgcactgcta agatactatg     70980
     cggcagaggg tgttgtgcaa gatcaaaaga ttcatatcgt gggaatgcct gaacaatggg     71040
     gaagaagtct tccgggcttg ttaggccctg ctgatgctat tgatgacaag caagacaaac     71100
     ggaaaggcga gcgcatgaag atcgcttggc gatacgagcg tctgggcgag ttcggagcag     71160
     gaattgctgg ttcaagaggt atactatctt gtcatattgt cactgtgaga gtttagaggt     71220
     agtgtgctaa cagacacgat tctgcagcgc cctcaggaga ccagagccaa tctgccgcag     71280
     acccaaacgt ggacaagcga ccagcattct gccatgcgtt tgacctcacg aaacgtctca     71340
     ctcacccatc catagccaac ctgaactata tacccctcgc gccatcgaac gagcctttgt     71400
     ttgtgtcgat tcacaaacgt cttcaagctg caattgcctc ttgcccgcca aatactgtcc     71460
     atcgcatcct catcccttcg ttattaaatc ccacgatata cccacccgat tcctgccagc     71520
     ccgacaacct tctaccgttc ctacactccc tcagggcttt gatgagcgcg cagggcgcac     71580
     gggtgacggc gatgatcact ctgcccttgt cccttttccc ccgcgccacg ggacttgtgc     71640
     gatggatgga attgttgagt gacggtgtca ttgaattgtg tcccttcccg cactcttctg     71700
     atgctctcgc aacctcgggt gccgctactt cacaggagga accaccacag ggcatgctga     71760
     aggtccatcg actaccagta ctgcacgaac gtggcggtgg tagcgatcag aacatcggac     71820
     aggattgggc tttcacgctg agccggaaga agttcgaaat caagccgttc agcttaccgc     71880
     cagctgaagg agacaaggag gggcaggatg cagcggtaac gggtggaatg ccaaagaagg     71940
     cggatcttga gttctaagtt gcacgaaggg tggaacagcc aaaaccagac cacaatcact     72000
     cctcgtgatc cgaatcgtcc aacatattct gcagctcgat ctgctcggac atagcggacc     72060
     cagtgttgac cattgatcgg aggtagtgtc tcccatatga gtcaagtcca ggtccggcag     72120
     gtgatgctga gaaataagtc cgaagacgag gtgcgatgaa tttcgagaag cctagatatg     72180
     cttcgagctg tcagcggctt gtcagtggag atgggcgagc cggtggtacc taagagtagc     72240
     agaaagggtg caaagaacac cataaaaagt aggaacaaga agctcattct gtcttagggt     72300
     ggcaatctag tcacttgaac agcttccgat aatgattata cggatcttat catctagtgg     72360
     tagctttcac gaatctccga agagcatcaa ctctcccaca ttctatgact aagcaccaat     72420
     aatgccacta gcttcaatag gaaaggcgtg atttccgcgc agctctttaa gagcttccac     72480
     cccaccgaat attttttctc gcttccatcc tcatcgctca ttcaacgaca atctggattt     72540
     gctggccaag tccacgagca tcatttctca attcgatact ctataatgct gagttgtatt     72600
     gatggtaagc aactgtccct ttcttccgcg tcaattgttc ttgcttgcat gattatacaa     72660
     atactataat ctgtcaatcc cctgaagctc aactaaaaaa tctcattaaa acgagcatat     72720
     gtgattgaga aacgtatcga aaatgattag cattttcttg cgctttatgt ttcatccata     72780
     catgtcatgg aagctgaacg ctaacgttca ttcagtcgca ccagatccct tgataaattg     72840
     aattgccctt agtcgctaaa atggatatcg aacccaccct tcctattccg atctcgtata     72900
     ttgggggtag ctactttctc ttctcaattg atgcagttac gtatgtgaga cgcgagtatc     72960
     acatttgcgg cgtcttaagc ggcacattgc ctcaaatccc acaacagaat gtcttcctgg     73020
     gcttgccatt gaagctaatg ccggaagagg cccggttgct cgtggagaaa ggtgtagcat     73080
     gcattgtaga cgaggtaaaa gtccaaaagg acggaatgcg agccctcatg gaggaggatc     73140
     gcaagaagta tctccgtgag ctagaatctc aaggccagca tgctatgcga ctacagaacg     73200
     accggaagga gcagcaacgc gagaaggctt taaagaaaat agaagaaaag aaggccgcaa     73260
     aggccaaaaa gtctgctgaa aggcagcagg agcagcagcc tgcccctctt aataatgagg     73320
     ctgctgctca agacccggtt gttgacttgt tcgcaaatga ccaggagggt actggcgaaa     73380
     tgtcgcgccg ttcttcgact gccactgctg ctccctttgg cactgtcatg ggagtcacgc     73440
     ctgctacatc ttatccgcct cttccgtatg agtggtctgc tgagcaacag ctaccgcttc     73500
     ctgatgtgcc ttcctcatac ccattattcg ctcaccttca ttccgaagga tacttcttat     73560
     cccctgggtt gcgattcggg tgtcagtatc ttgcctatcc cggtgatcct ttacggttcc     73620
     attcacactt cctgagtgtg tctgctgact gggatgagga gttggatttg atgagcatcg     73680
     ttgccggtgg tcgactaggt actggtgtga agaagggttt cttgattgga ggagctgaga     73740
     agaagatcga gggctcggat gctggagacc ccagtagtgt gaggactttc agcattgaat     73800
     ggggtggaat gtgatgtgga ctgttttcga cgtccttttc ggtcttcatt ggtcgtctcc     73860
     tgagctaagc agcgcatgtc gcgcgcgcac cgcttgcagc atatgcctga tagctgcttg     73920
     cctcagtgga acagaagcgt aacgtcaaaa gcagttgtgc ggcgttgcgc attaccttca     73980
     tgcgctctca agtctggcag aaatgcatac gggcttgatt gcagcagcca ttcatcggta     74040
     cagctagtag agctgttatc tggcaaggct aaacaaactg gtctacagct gtcgaattct     74100
     ccagcagaca ccccaggcag cacagtccga catacaggac tttgatcgat ctcactccag     74160
     cgttgaagat ccctgccatg ggtaaactac aaagatgaga tcaaatcgaa acatatcatc     74220
     aactatacat tctttattat tccggcgtac acttcctgta atagctaccg tatcaaaagg     74280
     gtcccggcct cttttgcaca aagggcgtgt ctcaagcctg atatcctgct ggaccaaatt     74340
     ggcatggcag tctgtcttgg ttcgctccaa ggactcgaga gcaaggctcg ctcacatggt     74400
     agaagaggat catcaatcct cccatcaaat atcaggtgcc agtgcgaggc tgaataatgc     74460
     ctcgtgcctt cgtaggaggt gctcccttat agggatcacc atatgggaat gaaatctcca     74520
     tagcacgtgc ctgcttgatg tgaagcctcc gtcaaacatg ctgcagacgg agcgatctcg     74580
     atgctgcgtc ccctggcgcg tcagccttga gtagtctacc acggctatgg tcagactgaa     74640
     ttagtggatc caagctctgc aggatagtct cccttgaccg ttcactcgtg cagtccactt     74700
     taaacgatcg agcgatcgtt gccatatgaa tcttccatct tctcaacagc ttagatataa     74760
     tccacattcc gccatttgaa tttcttgttc gccctgtcaa ccggacgatt ctggaactga     74820
     ctgccatgga gctcaaacac gagctccttc ttagcagaat cagcgctcgt ctccccagtc     74880
     accgccgcgc catcagcatc atccgcctca ggcaaaggca cactaaaccg gaaaatagtc     74940
     tgctccttcg gaatagctag attcacaccc acattagcaa cacacaaacc aaacctcatc     75000
     aagaaaaaga ataaaacata ctcttaacct catcccccct cgtaacaacc acaaacgtaa     75060
     acttcgtatc cctaaccaca atccccttaa ccccgaccct cccctcacac cgactcctta     75120
     caacctccac ctccgcgcca tgaaaatccg cactggagag cttactccca tgcgacaacg     75180
     gtgtcatcgg cggcttgaat ttctttgccc ccaagtctag catatcctgc atataccgca     75240
     cccacatggc atgcagctcc tggaaaaccg catacttgca ttcttccttg gggaggttgt     75300
     agaggcccga ggcgcgcttc tgacgcgcgg ataaaggctg cggcttttgt ttgcggagga     75360
     aatactcttt cttgcggagg cgatggaggc gccggcgcga gcggttgtcg gcgggcgttg     75420
     gggacgtggg acgcacgtag agaggctttt gttttatgcg ctcggtgaag agttgcgagg     75480
     ctgtgtcggg ggagtgcgcg cgcgagagga gcgtgtgtgc gatgtggggt ttgggggttg     75540
     tcattttttc cgaatccctt cctgtgcaat ggggtggata tgttgagggt ttgttggacg     75600
     gaggtatgga gtggtggttt ggtggtggtg gtgacgatgt gatggtgttg gaaatttggt     75660
     ggttatcggt tcctgataag atcacatgct gattgggttg gggtccactg gcttgcgacg     75720
     tatgcaaagt cctgcatcta tcatccactc aacgatagtc gattcttata cgattccttc     75780
     cgctgatatg gcttgtttag agtctaagtt ttgtcaatta agggaagttc atgagattta     75840
     agtgatttcc cacaccagct gtgacatgat gtagctaaat cggggcatcg cccacgactc     75900
     gattggtaca gactatagct caattctgac gatattatag tgattgctaa tctgaagacg     75960
     actttctgca tcagagctac tataaatttt ctcaaattgg ctcaccaacc ggattccacg     76020
     catataaagc cctagcattt ggttcttgtc tgccgccggc gtttgcacaa tattaagcga     76080
     tgcagcaaag aaaccctcgg atatagataa atagcacgat gtaccgctca tataacaaat     76140
     tagctctgac tcaaagcaaa catatgctgg tatgtctgga agtctggtct cttcgcttgc     76200
     atcacattat ggttgccgat tagttatccc tcggcataaa tgtcttcccc gcatgtcact     76260
     tactatatat actgagtgtc gagctaagac aatactgcca gaggttacag ccaacatcat     76320
     ctactaccac aatgtccgaa accaacaatt tacctccatt cccatccgac attcccacag     76380
     ctcctctcct ccgtctttca ctttccaaac tacaagccca cgatatcacg gaaacccaca     76440
     acctcctaca agcctgcaaa gacatcggct tcttctacct cgatctccgc gattcaaacg     76500
     agggcaccaa cctgctcaac aacgcagaca agctattccc aataggcgag cgcctattcg     76560
     acctacccct agacgagaaa aagaaatacg acctcgccag ccagaaatcc tattatggat     76620
     acaaagcgca aggtgccatg gtagcagaca gacagggcaa tctagacggg aatgagttct     76680
     acaatgtccc tatcccccat tataccatcc tacaatccaa ccacatacta acacccacat     76740
     gcaggtctcc aaagacgata tcctgaacat cgctccctct ctcccatccc caccaatcct     76800
     acaggaatcc cgtccccttc tcgaatcatt cgtccgaacc tcccacgaca tcgtgactct     76860
     ccttctctca atcctaagcg atagcctttc tcttcctaca tctaccctgc ccgacctcca     76920
     ccgtctaacc gccccaagcg gtgaccaaat ccgcttcatc aaggcccccc ctaccgctac     76980
     tcagaacccc acactaggcg aacacaccga cttcggcagc gtcaccatcc tcttcaaccg     77040
     tatcggaggc ctgcaagtcc tccctcccgg agcggacgca gaatggacgt acgtgcgtcc     77100
     gctatccggc catgctatta tcaacctagg tgatgcaatg gtgaagttca ctaacgggct     77160
     gtttcgatcg aatatccatc gggtggttgc gccgccggga cagcaggcgg gttgcacgcg     77220
     gtatagtctg gtgtattttg cgaggccgga ggatgaggtt cctttgcggc ggttggagtc     77280
     ggataggatt ccggcgttgg gggagggggt ggttgaggag gagattagta gtaaggattg     77340
     ggtgataagn agggcgttag ggaggagggt ggatttgggg ccggtggact atgagaaggc     77400
     ggctgggacg gagggggtga gtaggaggtt gagagtctag tcggataatt gtgctctgct     77460
     tttatagtaa ttcgtgcgat taatatacaa tgacttatgt ccctgatatt gctgtccaca     77520
     ggaatgtcgt tacgcacgga gaggggcttt tacactatta ttgatagttt ggctaatcta     77580
     tgaccgagta gactgtaagg tcacgccgat cacaagtagc cgcctaaagg tatatcttgt     77640
     gtcagtagta ccagtaattg gtaaccagag cctcggtagg attacgaatt cttccccctt     77700
     cataagatca aaacttttac catgcaatta gacatcagga ccacaaaata agttggtaga     77760
     ctacttcttt actcaaaatc atcaggaaat tcatcctcat catcatatgg caggccatgt     77820
     atgtccgaca tgccgcgccc agtagtttct ggagtcctct gcatccggtg cctctgaggc     77880
     gattggaagg ccaattcatc aaattcgtca tgtctaccag cttgccactg atgatggaca     77940
     ttggcggttc gaggagcgcc tcctccacca gagctactta tgagatcatt tgctcggcca     78000
     ccgccgcgac gtcggtttct cggaggcgac gtgatctcct ccggagcccg aatcgatggg     78060
     ctatagttgg aagatactct gtacaagtcc cgatcggctg gcatattgga cggccagtcg     78120
     tctaatcgta ggcgttcaac aaaagcccga tgcgccatgt cagctccgag gacccgcgag     78180
     acgtagtcgt agaattcctt ggatgcagct gctacttgct ggacgtgctt aacctgcagg     78240
     aacaccggct tggacgtttc ttcggcctcg aattccgcca gcgcgatggc agtttggcat     78300
     ccgttgcgga tctgtcgccc gttccagcgc gttctggatt tactgttctg ctcccagttt     78360
     gcatcagccc actccaggat ggggtccatg tcgatggtca atgacgtctt tcgcgctttg     78420
     gctttttcca aattcatttc ccagatggcg tggttctggc ctttgttgag cccggggtag     78480
     tagagggcca ggtggatgcg agagacgaag gcttcatcga aggagcccac tcgattggtg     78540
     gtgaggaaca ataagccttt gtagtattct agtactcgca agaacacttt cgttcgcaag     78600
     gtcagtaaga ttgagaggcc ctgtcaaatg aaggcgaaca ctcacctgaa acaattgcat     78660
     ttctttccaa ctccgttttg ctgcgcgccg caaggaagac atcggcttca tccagtagca     78720
     ggacgcaatt ccacgcctca gcctgggcgg atatacgatt tagcttgtct tccactactt     78780
     ccgcgcttgt tcccaagtca ccgcaggtga tcggatacag tggtctttca agccaagccg     78840
     ccatacattc agcagtcgac gtcttgccta cacccggctc accgtggagc aagatgataa     78900
     ggccttctcc ttttcctctg accacatcag gatcaacttg ctggctttct ccgtcctctt     78960
     tcgacttcct atctgaaaaa tggcgcttca cctgtgcgta gagcattctt ttgtgaccag     79020
     gccgcaattt gagattcttc cagccatcgt cagtaggaac aggacgcatg cgttcgagat     79080
     cgcaaagtgc ccaccgacgg cgatgaagat cccatgcgca agcacggtcg ggcatcataa     79140
     caagctcatc atcgctccac acttccttcc tggttacttg ctgttctggg gcagattctt     79200
     ggcgagccag gaaggcatca tcgcgaatga agtccttggt taactctaca tccacccagt     79260
     cgtcgtcgta gatcgcttcg gaaaaagatc gaatatagtc cttagtctca cggttcgcta     79320
     gcactcggac atacaaagtt tctgaacttc acttcctgtt cctcccatgg tactgggaat     79380
     tgacaagctg ggcacccact cctggtcttc gttgcgggct gttttgaaat caacaatgat     79440
     attacccttt atgtagtcgg tccgcctgtt aaaactcccc gggcaggatg cgccatccac     79500
     atgacacgtt agggtggatc ctgaatagaa acgatgttgt ggggtggcga aagtagcaaa     79560
     gagctcgcct tgcttcaaca acttatcgcg cagcgcttgg tagtcgtcca caaatcgagt     79620
     cgggactatc cccaaagacc gaatcgagcg ctctccactg aagtgaggaa gatggaagtc     79680
     tcgtgaaagc acaccgaacc gctccccatc atatccaatc ttataaagtc gaatgataaa     79740
     atgattaacc cttccagagt agttggagtt caagactggt cgtccttcag agacctgcag     79800
     tactttccaa atacttggac gattggttgg ctggacatgt ggtgcacttt gctccggagt     79860
     gaaccaacaa gccacctgca tacctgggtg gaataggtac catagattgc tgaaagagat     79920
     tgttgggtca agtgtcgatg ggcttggagc gaagttatct agtagagcac gatgacggct     79980
     tattaccgga ctgagatgac gatccatgaa actgacaagg cagtcgagtg cgcgaaaggc     80040
     ttgacgagaa tcaattggct ctttacctgg ctctagaagt gtagggtcat cgagctcctc     80100
     atgcccactc cctattcgcc atttagctgc gagctgtcga tgccgctcgc gtatctcctg     80160
     gtcgtatccg acgagtattt tgtatgggcg taacacgaca aacggggcag actgatcaat     80220
     tcgggaaaca atatccttca gaagggacgc tagaagactg gagttaattc gaatacgctc     80280
     tgggagatcg tcttcggcgc caccggtatc tgttttgggc tttgggtctc cttctgatgt     80340
     attttcgccc tcctcacccc tgatcagggc aaagtcaccg aagcgacgga tgattctttc     80400
     ggtttgttgc cagcagtact gcgcagggcc ttccaagacg tcgatgacat gacgtttttc     80460
     ctcggcgtac atcgtcttga actcattcca tttcacgtaa cggagatcca taataacatc     80520
     atcggagtca tcacaagggt aatgcttggg ttcttcgtcc tctgcatcgc tggatgtaga     80580
     gtcatcacga ctgtggtcgt tatcaccctt atcgtttgca gctttctcgg ttatcttagc     80640
     attgctttgt tcgagacttt gaattctcgc gcgaaggtcc tgcaactctt tcaacaactc     80700
     cacagcggag tcgtggctcg aattcttcgt aggagtatcg accgggattg ccactatcgg     80760
     ctcttcagtg atggtcgcca tgtttgaatt aataattcca ggtatgaact agatcgactg     80820
     gcgagcgttt ctgaaaaata aagagatcac attgaagggc aaagaccatg atttgaaaac     80880
     ggctcttctg agtgtgactt tatacgcatg taggctcagc acacgtctat tgagacagtt     80940
     gagaggagac gtgcgttcag gccaggaaag acatagtatt gcataccatc cagaacgaag     81000
     cttatcgtag ttcggaccct cggaaatgaa gttggcgaat gaaaggctga ggattgacag     81060
     tcaacacgaa ctatccctgc ccggagtcgg agtctcgggc taccgtgcat gaactacatg     81120
     gcgagaccgt gtccaatatg caacgctcgt tcagcttcat gggatggcgt tcttcatgtg     81180
     ccctcagtgc atgagacaga cagaatacag ccactcccaa atgagcagag ctgagagtgg     81240
     ctggctgaaa gacctggaga tggcatctgg caccagtaac agcgtgggaa atcccgcaag     81300
     tgcacggctt ccccgcctgt aagaccgcat ggagggatcc atctgcacgt cagcgtatct     81360
     atagcagtag ggaatgctct cgtatatctc cgcgggccgg actccgcttg ctaatcagtt     81420
     tgaccttgtt gtacggataa gtccgtggat acgtagagtt ccagccactc gaatgtcaat     81480
     gaaggctgaa gatgtcaggc cgaaagtctc gtgtatggca tccatccaat gcgtttgaca     81540
     gcgtgaaaaa tgccacaagc acgagattca cccgcctata ggccagcagg gaagtgattc     81600
     ggctgcacct atctttgtgc gctggactat gtgtgctagc caacctagct tgatcacgcg     81660
     ggagccatga atagatgggt aagacggctg aggcccacac gcatatctac catggtggat     81720
     cggataacag aggcaatggt agctctgaga agaacagtaa gaaccatcat aatcgcaagc     81780
     aagaatggag ccgtctttga tgcctagaat gactccggag caagaaactc acatggcaaa     81840
     aagctggctt agaggacata gccaccgact ccggttgccg ctttccaaca ggagccagcc     81900
     acagccatca gcccaaatcg atcttgcgga cacccggcaa gaacttgatg aagagtgagg     81960
     caatatagtg ctcctgtctt accaggttct gatccttcta taatagtgtc gacgaggtag     82020
     atgagttctg ccaagttatc caatgctatt cgaacgagac aaagggtact agtgagtatg     82080
     gcgatggcca cggtgggggg aggtttgata tatatggcgc gcacagctgg aaagaggtgg     82140
     ttaatattgt ccaagcggtc gagaaagact acaatcacag cgccactggc tggaaagggc     82200
     ttgctagaag ggcctttcgc aagctcggtg agcatgcaga ggatttcaac ccttggctgg     82260
     acctcttgcc ggatgacaag tattttagca ttgcttgtgg cgggctcaag atagtccttg     82320
     gtgttagtac actccgtgtc actggcttcg tgcatactga ttgaagtaga tggcagcgcg     82380
     aagaagcgaa cagcgggaag ccattcttgc attcttcgct gaaattccag atatcatttt     82440
     ctggaccgac cgttaccatt ctcttttcca ggacgaggag ggattgaaga cctacctgta     82500
     cgagttttat ctggctctcc tcgccagaat tcaaggcacg attgcagcgt tggtggatgt     82560
     atcactgtgt aggtgttggc ttctagctgc agcggatatg acaccaatac agtcccgtac     82620
     taacatgcgc gcttgaaatc agggaggaag attatttctg gtctgagggt caaaaatgca     82680
     gacaaatcgc ttggacacgt caaccaacgc ttcatgcggg ccaggactca gctcgacaaa     82740
     catctccagt tcgtgcgcga tcggctgcag gtagatacaa accagggggt agtttatatc     82800
     aagcctatcg tggacaacct tgcaacagag caggaaatag taatccagca aaactcagat     82860
     ctggggaatt acgtgcgtgg gtttcgccac gaggtcatga ctcggctgga aaggcagtta     82920
     aacaatccat cgagcaattt cgcggagcag atgcagcagg tcctccggaa tgagttgcag     82980
     aaagcgcagt gtaggttctc tcagtgccac ttatcttcaa cttaggcatt gaccttgcac     83040
     ttcagggcag ataaaccagg aaaacatgca acgagagagt cgacagtggc agattacgcg     83100
     ccaagggtat cccagaagcg acctatactt cttccttcgt ttgaatgagc aggatgtgcg     83160
     acagcagttt atccaagatc tcgatgatac tggccgtgat ggtcaggata ttgatatggc     83220
     tgctcaaacc cacgctcagc agcttctccg tatgccgcga ttccaagatt ggatccgttc     83280
     cgaccagcca gacatgctcc acgtcgacgg gaattgtgac aactatgcaa tggcgagatg     83340
     ttctccattc agcctccttt gctgtgtgct tgtccacgag ctactacagc aagcgcattg     83400
     ccaagttctg ttcttcttct gtggattgca caatctggcc ggggagccca tggcagggcc     83460
     tgtcggtctt gtcaaatcgc ttatcataca actgcttctg gatacagacg gccattatga     83520
     tctccttttc ctgacctttg ggcggaggga agaagcgttg tatcacaatg accttcccac     83580
     cctctgtgag acattgaggg aaatgctaat ccagaaccgc tcctctgctc ttttctgcat     83640
     tgtcgacggt gcttcgttat tcgaggtgcg agaatggcgt gaagagatgg agtatgttgt     83700
     ccagcgatta ttcagcctaa cgattgatcc ggacattgca acggcgttca aggtacttat     83760
     tacgagccca ggtattagtc ggctcgccag tggtgtgcct caagcgtgtc gcgtgtatgt     83820
     gtcagaaacc aacgagagga tttcagacgc aggcttccgc aacccagagg cattttggga     83880
     cgaagttgat cgccgtcgag aagacatggc agacactgca ggaagatatg aggtcaatcc     83940
     atacgaggca atgtacaagg tggatatgta cagtgaggaa tatgagtagc gaagtctacc     84000
     tctttccgaa aagagaaggt gtaacgcaag aatagttcgg gttagtcgtg gtagtactag     84060
     taattggcaa tgctgaggaa tcatggtatc aacaaaaatt tcagcgcatg tcatttgttg     84120
     tagccttgaa atataataca gttgagatca tcagaagttt tgagtcatac ttacacaatc     84180
     cttcgggcta ctgtgttgat aacaagcata tccaacgttt ccacacgaat atgacgacat     84240
     agtgctacgt gcattttttc cgcttcttgc cagccattaa atccttacca acacaaccga     84300
     ataagtccga ctggctatta atacctcaat atggctactt acatcataaa caaaaaggca     84360
     agaaatataa caaaacaaaa ttggtaaaat aacacaatac gccgacctaa cataccagca     84420
     agtcctccct tcgtaagtgc tgcctacctg cctatccgcc aagaaggcaa cgatgcatat     84480
     gcactgcatg cacgcaccaa aggaatgagt cagaaaaaaa gaaaaattaa atccagtcca     84540
     ctggcacatc tttttcattt ctttttctca cagggatgaa ttcttattcg gttccggcct     84600
     gttgggtcgc catacatgga aactcaggct caaattgatc atccgagttt ttgttttgtt     84660
     tttctttgtt tctttgcttt tgtggaagtt tgatgctcgg ctcggtcaat acataacata     84720
     taacttaata gtcaaaagtg ccagtggctg gggtcggggg ttcggtcttg gttgcttact     84780
     tgagaggggt gcgttgactg gcttgttgtc tttgcttgat tgtcagtctt ataatgtaac     84840
     tatcctatat cacagggtgt gtagtggatc atgtagtctt gctagtatat agaatgacac     84900
     gataagagct caatcacgta tcgattgtca agatgcctag agcagcattt agattgacgg     84960
     taaacaataa ctttcctcat tttattccct cgaaaatata ccagatcacc caccatgaga     85020
     tttacaagga tcacccatcc caagtaaccc tgacccgaca tgccaagaaa atgatctatg     85080
     caatgcctgg attgccctgt ttctggctgg tgcagtcagt cagtcagttg acaaatcgcg     85140
     aggtacagca gtcaagtagg gcggctgcaa gagaaccctt ccaccggagc ggtgatgatt     85200
     ctttcaagca agcaagcagc ctgtaaatta tgcgagggta agcgaggaaa aagcaaaaat     85260
     ggatggggat gacgcaagac ggcaggtggg agcggatgta cacaggataa ggcttactta     85320
     aggatgaggt ttgagtaacc attgaaagtt cgggtgtttg tcattgagtt agtgttttga     85380
     ttgtctttga cttgtttatg aaattgtcag tgtttattgc tttatgtgat cttcatacga     85440
     ggaatgagag tatgtataga tttaccgtgg ggatggacac actcaagata ggttactgtt     85500
     gaacactgca aattggtact aaaactggat tacaatagcg tatgatggac gaaagaaata     85560
     aagaagatac ccgtcccaag gtactcagta gataatccgc aaatctccgg cgggtcgtcg     85620
     acggatcgga ccgttcgaaa tggcccatgg taactgcact gtaattccat gtatacataa     85680
     aggtatcata tctacagtag cagaccgata aaatcacctt gtaattagat agataaggca     85740
     taccatgatc atcaccagga tgatgcttca taactcggat gatcggcgaa tatgaaagga     85800
     gcaagaatta cctagccctc cttgatcgac gtaagggcca gactatcagt atcctcctga     85860
     acacaagatt gacatcgagg tgatcttaat aaagtgatgt tacacgagat tatcagaaaa     85920
     tccttccgta agtatacacc ggatttgtca ataggtaggt aaatctacga gcgcctcctt     85980
     cccgcctgat ctaggcattg ttgctttaag aggatgagcc gggtgagtcg tcacacttgg     86040
     acagctatac tcatcctgcc tcttcgtgtc gacaatatct ctttagctgc ttcatcaaga     86100
     atgtcaagat gtcgcgtcaa gaggcaaaat catgtagcat aatatcctac ttagccttcg     86160
     agcagttcag tccacgatca gccaatatag attcgattcg ctccaacatc aatgaaaagt     86220
     ggttgtcggt ttgattccta gacacagaat ccctccaact gtctagtagc tgtcatcaga     86280
     agaggagctt tgctcgtcac acctagcgtt cttcaggtca ttgcacagcc tatcaactaa     86340
     acacatagtg ttcatcaaat cattgcacag cttatcaaca tactgattct cctctcttgg     86400
     aatccataca taacgcacat ctcccttctc cttcagccgg tcactgagaa ccactgcttc     86460
     ttcaatgaga tctcgatttg ctacctcgtt ccctttacaa ttcatccatc cgttcctgat     86520
     ccacttgtag acccactctt ccatacagtc aactgcaaat gccgagtcgg agtagatcgt     86580
     gacatccaac caagggtcag agtgtagttg atcatatctc ttcaaggcca tccttagacc     86640
     gaggataacg gatgttatct cagctcgctg attcgtcgga gcggtatatg aaggcaagtc     86700
     ttctgttgtc tcgccatgga atctgccgga cgcgtcctta aaagcagcgg ctgcagcccc     86760
     gatcgagcct ggctgaccgt tcggctctac agccaccgtc aacgtgaatc ttgatgatgt     86820
     aaaccatggc ggtgatgggt atgtcggggg aggaggcaga ttaggtctct aactactgcg     86880
     gatacgcgag ccttcttgta ggcgcctcca ggtttcgaac tgctgccttt cagcagcggg     86940
     tatctccacc agctgtatag cctcaactcc cagatgcttg cctggactcc caatgaggtc     87000
     tctagcaagg tggtgcttca agtgctcagt ttcccggcag tttccttgtg ttcncgatgc     87060
     atgtttaacc atcacctctt tcagtgccct atgttgtttc tcatcaactt atccccaagt     87120
     attctggcaa atcccaggat agcaacacga gatggccaat tacaacgtca cggctactgt     87180
     acttgcctcc attgctgcct cgcagtcaca tgagcacgat agtgattaca tttaatgtca     87240
     gtactgttgc aatgtcattc caaacaccac gatactatct tacctcccgc ttgccaacta     87300
     ctatctcgtc gggttccagc atctctgatt ccatggtgcc aggcttttgc atacaatcat     87360
     tcagttagtc ttactgttag atataacaca catggtcaac taagatcgtg ggcggtattg     87420
     gcatgaccaa gagattagga cgatttctac tttgcgttgg tgctagtttt gttctatctt     87480
     gaatattatg ccactgtact ctgttgtctc agtatataaa atgcccccaa agagccatcc     87540
     tcttaatctt acaacctctc tagttgctct accccaaggc atccatcata atcataaccc     87600
     ctctcgatcc ggaattcccc caaagtaatc accccattcc tactcacatg cacccctaca     87660
     acccccaaca actacgtagt acactcaaac caccaaatga tcaccacaaa ccccaccatc     87720
     caacgtccat caccccagaa caggaaacac acctccgaac cagagcactc cattcatcgc     87780
     tccgatccca agtaccgcgt gtagactact actagtactt acgtggaagt ggagatcccg     87840
     ttcaaggtat taccaaataa ggatagagac attacctagg tagatacggg cagagcagtc     87900
     aaggataagt agtactttat accttaccgg gagtccgtgc caactcacct ctgggacagc     87960
     aacgattacg tagatcgcat ccatgaataa taacactaaa gagctatttt atctcctctt     88020
     cagggactac atcgagtcat gccatgatgt gtcgggaagg aagaaaggaa gaatagggag     88080
     atggggaggg ggtgagcgaa gatcagcatt ggggatttat cctgttcggg gtaagcgtaa     88140
     cggctggtag tctactgcct agttgggaag caggagggaa ggaagtaact agtgtgggtg     88200
     tgggttgtgg gtgtggggat gatatgacag ctggaatttg ggtttcttgg gatttttgga     88260
     ttttctggga ggggagatgg tggtatttac tggtactttt gtagggtgaa gggtaaacta     88320
     ttagtacaaa gtatgtggtt aatggatagt atgcttagtt accttgcaac tttgtataca     88380
     aatgaaataa cattcttcat gaaaccgaag caaacctcac atttgcattg aaactacaca     88440
     actccataca tacttacata catacataca tacataccct ccccaactat aaatactata     88500
     cgtagtgtat atgagattat aataacatcc cagcctataa ccaccctgca taacaacagc     88560
     acattgccga aataagtagt gcctgcttag ctgctgctgg tggtggtggt ggcacaaccc     88620
     tcacatcaca ccacgccaaa caacccaaac caacgggtca cttaaaattc cattcccacc     88680
     actttggact catccatccc ggtgcttaac agaccgtctt atgcatcggc attccgcatt     88740
     gggtccttgg cacagcaaga ctaccgtcta cctgcgtatc catgtggggg tggtagtcta     88800
     ctactagtta tttagactgg gtccctactg ctagtatctt taggagaaat ggaatagata     88860
     ctacctagac atattcttct ttgttttgtg gtatggaaag ttacacagta tctcaaggta     88920
     cagaggtgag gacgaagacc cacttggctg actactttgc attcaagaca gctgctgaaa     88980
     attctctcat ttattagtta gttaataatg gtgtcgacta tccaagacaa tcttcataag     89040
     cacttaaacc gactccaaca gtttagcagc tactagcacc aaacacgatc tatctctgat     89100
     ccgtgcatga acatccgtgt tccggccgaa tcctctcgtt gcgggatttg gtcggcgttt     89160
     gcaaaaaaaa acctatctgc gcgagtcagg ggtagaatgt atccagcctc attggcaggt     89220
     cggaagtatc aaacaatgat tttagtacgc aggggctatt tattttttta atttatcggt     89280
     atcccagttt gctggtaccg ggaaattaga tctgctttag agggcaatcg ggttagtcga     89340
     cacaccgcgt gagtaagtgt gggcaggtca gatcaggtca ggtcagccgg tgtctctaca     89400
     ttcatcctca tgcataggag gacgacaacc aagtcgccgg agttggacag gataagtact     89460
     tcccgcccaa tgggcagtaa cagtcaagcc aagagagctt tgctgtcaca cacgcatata     89520
     cacgctgtta ctataggaga attaaccccg tgcatcatgc gatgggcagt caacttgctg     89580
     gacgaggaga caacgccaaa gcgccgggaa ccggtcccgg ccaacatcgt cttgcggggc     89640
     agtggagcta gctgaatatc ctggtcctca gggatccaga cccccgatga aaaggatggc     89700
     tggcgtggga tcatagggag actcgccatc agcctggcct cctgaatcct ccagggagga     89760
     taccgttagt cctgctactc ccctgaccgt ggttattggt tgataacggc cacttaacat     89820
     acgcagcggg gcgtaccgat tcccaccgtg gcatttaagt tgggaccaca agtggccctg     89880
     gttgacccgt ggctttggcc tctcccgacc agctggctgg ctagtggctc ctgctcagct     89940
     tagtttgcaa gggtattgtg ccacctttca gctcgttcgc cacagcgtcc aaactaagca     90000
     taacaagaat attacacaac ggagagtaaa ccggtcaata atcaggtgcc acaaagtaac     90060
     atcaagattc aaacaatgct aggtccgcca accatcgttg catgcccagt gccttgtggc     90120
     attcgagagc tgcaaagggt aaagcttgct gagctgctat tcttgtcgta agaaggtgcg     90180
     agcacgtaag tgaacagacg cagctttggc aaccggtttg aaaatcctga cttgccattt     90240
     gcgctgcata acgaagtaga ttgattgtat accagccaac tatctaccca gtactgatcc     90300
     tgacttttgc caatcgctct tcaacccgtc gaacaatttc ggggtctggt ttcggcttgt     90360
     ctctgcgagg tctgggatgt attagcaagt gcgtgggtca ccttatcaaa caatggagtg     90420
     acttacggat ctcgtattgt ttcaggcccc ttctcttggc cacaattgga gcaatttctc     90480
     tctcccgatc ggtacaacgt tgtacacttg tggcatgtat agcgtacccg ctgccgcggc     90540
     ttcttccacg tccgtgcagg aggttctgcg ggagcatcga catctccagg atagccatgc     90600
     gggtatttgc ccagtttagg tctgaattcg ttagtacaag agctttcgac aaacacaatt     90660
     ggcttggggt ggacgcacgg gtcgcgaggg cacattgtgc accgaatatg ctggcaagta     90720
     ctgcattccg tagcatccgg agcgaacaca gtactacact gatgacatgt acggcggact     90780
     cgttgtcggg tcgggtggtg gatgacatcc tggccgccgg tgcgtgaggg cagcgtaaga     90840
     ggaggttgct tgggtttgtg ctgcacaggg acaggtttgt gcaatttctg cgcgacaatg     90900
     gcctggagtg cagcctgggt gtcgtcgcgg tggtcgttgg tcttggtgga gggatggtga     90960
     gggcagctct tgcagcggac gtgctggcag ttgacacaaa ctttgttcgg gccgaaggtg     91020
     gtctggcagc gatggcaggt acggcgcact cgcatacgga tcggtctgac aacacgctgc     91080
     acggtcgtat cgctagggga cctccattca ccaggctcaa gggtcagtcc gtatttcgca     91140
     aatagagccc gcgccttctc ttcttgaatg gcgccccagt tggtgaaaac ggtcgcgtcg     91200
     ggtgtagctt tgacggtagg agcctgcggg atacgttggg gactgtaacg caagtcagtg     91260
     gcacaaagta accaaaccca tgggagatga acatacgcgg gagcttggct tggctcaggt     91320
     tctcttgatt tctgcatgac tggcgtggtg gtccggacag ttgagctcct cctcagagcc     91380
     atcttcatgc gcttaacgta tttggacaag ccatcgtgct tgccttcgtt ggaagggttg     91440
     ggatcctgtt gagtcgacat tttctccggt agtatcgtcg atctctaaat tcgcttgccg     91500
     gtcgtattca aatcagatca tgtgtggcgt cgcacgacat ggacagggtg actgctttgg     91560
     tggtgtcgga aaaaggtcga acagtgtaat gacacttttt gtgggcgcta tttaattcat     91620
     accaactggg atcggagggg acgttgtaga gaaattatag tggtggtggt tgaattactg     91680
     ggaagcaaaa gcgccgagga gcgactaccc agattggggg ggtaacgacc aagtgggtgg     91740
     aataaggtgg gaaacgaggg agccaccggt taagtatggc aggtcgcacg ggcgtgtacc     91800
     gtaaccgtag gcttgggaca cccgacaaga cggtgagatg ggtgaaaaac ccaacaggaa     91860
     gggtcgcagg gaattggaac agcctggggg caaatccagc ggatgattgg ctgaggggcg     91920
     gtcagatcct gtggaccggg cgtggatgag atgtccgatg taaagtataa ggtgtgtaaa     91980
     gtatgtgcag gagggaatgg gacgtgacgt tgtgaaagga tgggggatgg tggtggtggt     92040
     ggaggtggaa tgcacgctgg gagcggaaca aagtcaccgg ccaagatggt ggaaaattga     92100
     agattcacga cttgacgacg gggaggagag gaagataaaa agaaggcaaa cgaccagcgc     92160
     gagccgaacg tcaaatagaa gccgaacaga ctttctgggg gaaccggacg agcgagaggg     92220
     gggtgggtaa ggaagttgta tgtatgtaaa gtaacagtca agtaagagtg gcaggcgcct     92280
     aaagtagtag tagctaaagg gaatctaagg gaagtgtggc acatggcctc ccccgatact     92340
     taactctttc ctgttccgtt gtggttattt tcagtttgtt ttaattttcc ctattctctc     92400
     tttttatttc caatttttta tttcttcata ttgtcctttt cttcttctta tttacacctt     92460
     cgcttctctg atacatgctt tctagatttc acttcctgct ttattaagga caccaatgga     92520
     ccaaacattg acatgagccg gagcctctac taacaaagtc aaaactatgg aaaccaaacc     92580
     cactttttat agccaaccag tctattctca ctagaagact cgatactcag ctcctatcga     92640
     aaatcgatgc ctgtctccgt gaagaaaaca acgatcaata ccatggcagg aagctccacg     92700
     atccgagcgg aaacaaaggg agtaaagtag cagaaactct agaatcaaga ctcaggaccg     92760
     attaggcaaa gtcatcgtct ctgtgttgcc gataggccaa tctggtcagg agctggttgg     92820
     ttgatatacg cctcgacatc ctcatgcagc atgatgacca gcaactagcg ggcgaaccga     92880
     tgcgacgggg cgctttgggg gttggagtct aatgccgtgg caccctaccc actctggaac     92940
     aatgcccgaa cccaccgcgt ctcgcccgcg ggtctgaaga aggtcgcgcc ggaaggtgtg     93000
     ggtttttgcg actgttgtct cctgggaacc tattttgctg atccggaaat attatcagtt     93060
     tctatttagg atgctcctga tcttgagtac taattacaat agataaaaac atgacgtcct     93120
     tcatatccgc gtggtcggaa tcagacgctg attgaagatg atgtcagctg gagaatgagc     93180
     ggtaccaaag ataaccatcg cgtattttcc gggatatgct cctaacgacc aaagcccgtg     93240
     tattttacag tttgtcagat acaaccaaca gctccgaagc tgcaagaaga cgatagcgag     93300
     gataataata acgacgctct aagtatatag tcagtcatta acggctcgag gctaccaaaa     93360
     acgtttctgt gcatggaccg gagaggatga caactgactc gagcaaatag atcttaatcg     93420
     gagcaagaag ccttacgtag atggcggtgc cgcctatgat cagacaacct gctgcagcct     93480
     agcctggaga aaccgacaac atgatggaat gaatcattgg gggatccttt tccctggctc     93540
     ggttcccttc aatttcacgc cgggatagcg atgcgccatt caatcaggaa gccccatgga     93600
     ggaaccgaac atctacctga ctacctcctg agctgagact cacttcgacc gaagatccgg     93660
     ccgaaggaca gacgactatt caggagcaag acttaccaat ttatattata ttaactgaac     93720
     acaaaggggc ctactatccg ggaaccagtt cctagtgaga actcaaagga attgcagtgt     93780
     catcatagtg tcccaactgc tgctttcatc accgacaatc ccaacttatc cgataattca     93840
     tgcatagatt ctggtgtgac gatggcttcg gacatccccc tacgaagaag agaaataagg     93900
     gagcaaccat tgtccttgca tttttctcat tttaccagtt acttacaaag tagaaaccat     93960
     cattgacatc tctaactact tacctccatc acaacgaact actaacctaa gaagtaggct     94020
     aagtccctac ccgcgcggaa ttctagactc cctgaccaac tcctcatcac acagcgctga     94080
     aaccatagta cgtctccata ccgaggcatt ccgacagcct ggtctgtcaa ggttgtgtat     94140
     gtgtaaatac tgttttagac gcccgcagca ttccattccc atcccatcca tccacttaga     94200
     ccatgcatga tgcatgacac cacacctcgt ttccacccta ccctaccaaa gaaaagaaaa     94260
     tagaaaaaga aaataaatta gaaacggcaa cggcttcatg cagcctgtct gctgcaggcg     94320
     ccaactcaac acgctagaca ctgcctgccc attcctttgc cgtaaccgac gaccctgtaa     94380
     gtaactacgt atgaagtgtg tttgtatgta tgtatgtatg tatgtatcta gcggaagcgt     94440
     agcgcgcagg aatttgtcag aggtgaagaa aaacatgaag caaccgaaga accttaactt     94500
     gcatcgccga cggagtagat cggagaaata ttcacctacc gggttcgaag gcagtgaact     94560
     tgggtttttg ctccaccggt ttgtaggtac atcgttggag ggttggtgtt gggtgggtaa     94620
     gtaagtaagt taaggattgt ctttgttgtt ggtttcaggg actgggactg gacaggacac     94680
     atggcatgaa aatggtggtg gtgatgatga tggagatgtt tgtggttccg gcttgttatg     94740
     cttatcgttg gaaccgtggt tctggtttct tgctccttgc ttgggaggtg gtttcctttt     94800
     cattgtagat tcggaaatgc cgaccggaga ttgatggcct caggctggat tggatgtagg     94860
     atcgtcaatc attgactcct actactacta catagatact actcagaata gatcctccca     94920
     cccagaacag ctcatcattt caacatcgta ccgaatagct gggaataaac gataagagat     94980
     ggggaccaca ccccctcccc ccgtgccaaa cacccggtac ttactatcag cacttcactt     95040
     tcacattaca gccagccaac tgcctttagt agttaactag gcttaataac tagttaatac     95100
     aatctgcagg gctgaataat taatatacca aaaaacaagc atgctgaaca ccaccaccac     95160
     ccacctttct cagtcagctt caacacaaca cacacacagc tgaccaccga tctccgtgat     95220
     ccagaagggg agaggagcaa aaagagggga aggggggggg ggaagaaaag tggaaaaagg     95280
     gaagagcata ggcccaatca cattgcactt ccttcgtatg gacaaggccc gggatatcca     95340
     gtcccagcgc cgcggagaga acacaagaat gtcgaggggt ggatattcta ccggcagtgc     95400
     caggtgtcag aactcctgcc tttagaggaa tggtgaggtt tgtttagtgg cttttttcat     95460
     ctggagatcc actgtgggga cgcgtatgga gcttgtatgg atggtgtatg tatgtatgta     95520
     tgtatggatg ttaggattta cgggaggggg ataagtatta cttggttagt tacctagctt     95580
     gtatgggatg agtttaggca cggaaggttc tattgcttcg attaattgat tgattgattg     95640
     atgggtctca agtacagttg attggatggg atatcgatac tttgtacgat ctcgtgattc     95700
     tttcttatgt tacattgcat gcaattatca tttctactac cttatattat agtacccata     95760
     agtagctacg aaacaacact caattgatag gaccagatat cccaacaaac atattcagcc     95820
     tcattttcac ctcatatcac aactaagcaa gcaagcatag aaatatatgt caggctctgc     95880
     ttaaccaaaa ctaccacctc aaattcaact acactgtaca cctgctatca actcaacgac     95940
     cgacaatcat acacttccct ctcgacacca aggctatcat tcattaagtg ataaagatac     96000
     cacgaacaag cacccatcca aatacctaca cattcttcca actgtactac tccgcattcc     96060
     cctccaaacc aaaataacat atacatatac atacgctaga tactactaca gataatccac     96120
     acattagtat caatgctcta ccccaaccaa aacgaaacaa gaaacaaagt tcaaggcgca     96180
     tatttgcccg agtggatccc catccaaccc aacccaacca gttggttcag ttcaaactaa     96240
     gatagacatg tcaagcagtc aaacctggaa aaggtttccg gtctgatgtc ggtgcttact     96300
     tctatctatg ttgtctcata tatcatgtgt gtgtgtgtgt atgttatgac gaggctattt     96360
     tatcgatagt catgcaaggg attatattgc agtgtagaat aggaagaatg acaaattctg     96420
     tcggggaatt tgtgattgat tataaatcag atttggggta gctacataga tagctgcgtg     96480
     tgctcgatgt cttggtttcg tttctaacat gagttgaata ctatagtgtt gtctggtgag     96540
     acgtgcattc ggaactgaga aatcgtctag caactcattg ttgtatccgt atctaacctg     96600
     atcatgtata caatgccagc actataatta tgaagtaaac gcatagcgtc atgaatgacc     96660
     aatatagaaa ggcctaaaac cagcttgaca gaccaacgat ccttaatcta aaatctccct     96720
     aatctgcgtt ttgcagcttc gactcgatcg agataatatc atcttcctca tgcacctcaa     96780
     tcacccgatt aacctccgcc gtattgcgca tcaactcgac agcacccgca tacatcatgc     96840
     gcgaattcgg gttgcagttc acggggaggt agtagagcat gacgtaagga acggtgagac     96900
     ggccggaagc ctaatacaac aaacacaagt taggtcttcc tcgctaagtc tagatgaaac     96960
     aaggcttgtc gaaatactca cgagggtaag gggatagcta aggaggataa accgagggga     97020
     cgactcgggc agctcgtcgg ctagatcctc catcttggag taaacctcgc catcttcagg     97080
     tctgatctcc tggctcttac tatcgatgat atctgccaac cctgttgtca acgacccatt     97140
     gttctgagat atccgatgtg aagcgaacaa gttcgcgcga tagctgtgac ggttgtgctc     97200
     gtgatagata gaggataaga gagcggggtt atgtagcaac gacaggagac gggatcctac     97260
     aaatgatggc ctgcggatcc ttagcgcggg aggttcccaa gcggaacttg cgaagctttt     97320
     ctttggtctc gggggaaaag gaatatagtc gtgattcaga ctgcatggac ggaggctcca     97380
     ggttagcagg ggggaaaggg agcgggagcg cgatgcgggg caatgtccac ttaccatgtt     97440
     gtgataaggg tgatgcgaca gtaaggcgga ggtagaaaca ggatattcgg aagtgcgcta     97500
     gaagcaagag agtcgaaaat cggaaccccc agacgggatg tgagcgggga tggatggaga     97560
     tgaatttgac cgaagagaac gaaggaggaa caagcaagtg gtggtgctcc gcgttttcgg     97620
     cccggtggga tgaagagcgc ggcacttctc cacttcctct tcgctctccc ttcactttca     97680
     ttcaataatt ctcctccccg cccgcgcttg tttgttactc cgccattcac cctctcctcc     97740
     tcctcccttt ccctcatgtt cagtcgtctc ggtcaagtcg cccgccatct cactcgaccg     97800
     tccctcaacc tccattccac gcctaccttc acctcgccct ctctgacccc gcccctgctt     97860
     cgtgcgccat ctcccaaaat gacatcatcc gtcctcccga agaataagag gaccattcac     97920
     acggcggcat gcctgattat tggtgatgag gtccttggtg gaaaggtgag gagcgattaa     97980
     gttataccgg cgtctgctat tcagttgctt ttctaccttt tgaagcgtcg tgcataccca     98040
     ccttggtttt caccaagact gactgtttgc cgataatgcc agaccatcga caccaactct     98100
     gccttcttcg ccaagttctg cttctccctc ggcattcaac tgaagcgcat tgaagtgatc     98160
     gcagacgatg agagcgaaat cattgaggca gtgcgacgta tgagcgaccg ctatgatttt     98220
     gtcgttacca gtggaggcat tggcccaacg tccgtacacc ccctacgtcg attgcacacc     98280
     ccacacgagc atgaatactg catatggctt gaaagctgac tgatgaatga ttgtgaatcg     98340
     caaaagccac gacgacatca cctatgaatc gatagccaag gccttcggtc tgaacctaaa     98400
     gctccaccaa gccgcattcg agcgtatgaa gaagctgtcc aagccccatc ccatgcagcc     98460
     agacttcgat tgggacaccc cgtcacctag tctgactgcg aagttgcgca tggtcgagat     98520
     ccctcacgac gagtctgtgc ctttggaaga acaggccgtt tttgttgccg aagatatgtg     98580
     ggtgccgatc gccatcgtca acggcaacgt ccatatcctt cctggtgttc ctcgtctctt     98640
     tgaaaggcta ctcgagcacc tcaagccgaa cttgttgcct cgcttggtta acccggaggg     98700
     gaagggcatc tatcgctacc tgttcagcac accacttccg gagagtacgg tcgcccctta     98760
     tctgacggaa cttgctacac gcgttgcttc aaagaacatc aaagtcggca gttatccccg     98820
     gtggggtaat aagcgcaaca ctgtgactct agtcggcact gacaaggaat tcatggactc     98880
     gcttatcgca gaggtggagc agaatgtcga gggaaccaag gtaactcgag aggatgagct     98940
     tgaccctccc tctgacaccg aggagagcaa ataagtggaa cgctggcggt catagtatgc     99000
     ctttgtgcag acaatagttg ctagagaatt agacaatgac acgcttattc cgaatatgtc     99060
     atggtatcac tcggttgtat gggcgttagg agtccacgga cctgcagacg tgctgttctc     99120
     aacggtgtcc atacaaatat tgtgccatca gggacgcgtg caagtcaaaa atcaacgtac     99180
     cactcatcac tcactacaaa agtagaagtt gttaaggtta gaaaaccagc cactaaatcc     99240
     ccaaagacat cactaaggac ccaaccataa aatacgaacc gcagagagac agaagaatga     99300
     aggcttattc tcgaggacca caatttccaa aatcaaataa gattacccaa tagttcaagt     99360
     gtatacatga aggaagaaat cggacagact aagatagata tgcttattgc gcgccgctgc     99420
     tgagtgcaga atagggggaa cgaaaccaag gaaagaccaa aataagaggt gggaagagcg     99480
     aagacgggca aacgacaggc tagctggcac cgcgatatca caacgtctat acttccaaca     99540
     gactacccgg ttccttccca gggccgttgg agcatcaaca tgcagttatc tcgccgagaa     99600
     ggattcagca ggtgcgatca agcccgacat agagcaaatt cggtgaaaga gaacaaaacg     99660
     tatccccgat gcatatagga aagagatcaa atgagattga gggcgacaag taaaagagga     99720
     tcagcggctg ctgaatgtgc aaaagatctg aattgctcgt ccagcgcggc cgacaagacg     99780
     aagaggaagg atgattctgc agttccgaat agtaccacaa atgcgaaccg cgacaatagc     99840
     gtacctatat taatgcacag atctattgac aggctccgtt ctcgtccttt caaagatcga     99900
     gaaatcgtca aagaaaaatc aatcttccaa aaagtaataa taaacaaaat agaggaacaa     99960
     agggggaatc gaacgttcat ggagacgatg gcggcattag ggggttgaga gcagacatca    100020
     tctgagagtt gaggctcgta tggtataatg atcacaaatc aaaaaacgcg tgttgaccag    100080
     ccacatgttg cagcaaggca agtggcccgt ctctgttgct gacctctctt tccagccggg    100140
     agtgaatgta tgtgtttttg ctttccttcc gtatctcgac ctgtatgtat ttcttttaga    100200
     tccaacgcct gtcccattac ataattatac attttccaca gcagccggcg tcatcgccag    100260
     gctcgctgac gtccattttt ccttccgggg cgcgtgagcc gccgcccgcg ccagacgggt    100320
     acgatgacat ctctttgttg aaccgacgga tctcgcgcac gaggtcgtag aaagcgttct    100380
     cgacgttaat acgggacttg gcggatgtct cgatgaactt gcagccgaac tgccgtgcta    100440
     gagcctcacc ctctgtaaag taaagaaaga accgtcagcc acatcctccc ccggcaagca    100500
     gatgctgggc cgggaaaccc accttcttcg gaaacagccc tctccttttc taaatcgcac    100560
     ttgttgccga ccacgatgat gggaaagtag tccttatcct tgactcgcag gatctgttgt    100620
     tggaaagtca tgatttcctc gaatgattgg cgcgacgtta tcgagtagac gagaaggaag    100680
     ccttcgccgg ttcgcatgta ctgttcacgc atcgccgagt actcctcctg tccggcagta    100740
     tctaaaacgt ccaacaatgc cacctcctcg tcgataacgc actgcttgcg gtaggaatct    100800
     gtataaacac gatcgaaaca tgagccacac ggtcgggaaa gctacagtag agctcagcgc    100860
     ccaccttcaa ttgtcgggtc atattcatcc acgaagtggc tctggatcaa ttgaatagtc    100920
     aagcaagact ttccgacacc accaccaccg acaacgacga gtttgtattc tcttaagaac    100980
     tatatgcgac cgagaggtga gcgaatcgtc cattttccgg ggtgaggcag tgtgcggaga    101040
     tcatgagaga aagtcggtcg ggaagggagg ttgacaggag gcacatggaa gctaatgacg    101100
     gaaattggaa agcgcagcga caaggcttac cttggaagcc attctggtag gatctggcgt    101160
     gaattatgcc gtgagggaag ggaaggggag gaggggaaga gagagagaga agcggtaatg    101220
     gaagctatcc caacaggagc tgtgacagcg ggtcgaagga gcagcaacac aaatttcttt    101280
     tgcagaaaga gacaagacga caagagtcgg ggcccaggtc gtcgggggtt tcgcgcaaag    101340
     caaaggcgcc taaagggcag tccacagcaa cggcgggtct aatgattagg ccaagcttaa    101400
     agcagcagac tgggggggag cagcagcagc agaagtgcgt gtgggaagta ggatccaggg    101460
     ggggaggggg ggggtcgtgg aactttgcag gcaggcggaa ttgaaggcga accggcaggg    101520
     tttcggcgtg gtctgcagtt cgtcttggac ccaatgcgtt ctaagcgatc agggaatatg    101580
     gaaagtcgaa gggaactact tagaacacct tcgagaacca gggtggattc aaggagggaa    101640
     gataaaaaaa aaaagaaaaa gaaaaagaaa aagagggaaa gggaaaagag agaacggggt    101700
     ggagagactt tgggagggga aaggggagag ggagaggaga tgattaagga gagttaagcc    101760
     aactgaggaa cggaggtggg gataggcagg gcagcccaga aaggaggaga gagagtctag    101820
     atagtcaact actgaatact aactagtaat ggacagtcaa gtagtaagtg cgtagtattg    101880
     gataggaact tccacaagaa cacagagcaa gtcacaaaat gacaatatgt aaattattaa    101940
     ccgcgggata agcgccttga ttggtgtgga acacccctac cgacgatgtg aaaagagcgc    102000
     acttccatcg agaaattgat atgatgcgcc tgctgattgg aaggaagggg attcgaaggt    102060
     tcgccagaat taatctcacc acaatcacta acgatatgat aatcctccta gtgcaggagt    102120
     cggttaagca cagattgcta gtcgtatctg actactgctg ctgctactac tactactgct    102180
     gctgctgctg ctgctggtct tacaacttga ctccggttaa tggcacaaac tgtgtggacc    102240
     gaattgaaag gggggtggaa gacagaggga agatcaaagg gaagggagag agagacagag    102300
     agagagagag agaaagagag atgagcagtg ggtgtggcat taaccggcaa cgcgtgtgga    102360
     ttcaaccaat ccagccaact gtttaatttc actggtcccg gttggcccac ccgccgataa    102420
     ttaacctcaa tcgtccgatc gcaagatatg aacctgaaca gcaacagcct ggcctcgaat    102480
     ccgtgccagg tactccgtgt accccagata cacagcacac ccatcacaat cagaatggtt    102540
     ttctgtcaat ccttccttca tccagtgaga tcatctttga taggctactg caacggtatt    102600
     ctcgtgagtg gaggtccgat cattagggaa gaaaattgag tcagtcggtg ggaaggaaaa    102660
     tggttgcatg gtgaggtagc ctgaaaaaag gggccggggg gatcgaattc ccagggcacc    102720
     caagattaat gatccattgg gtctagtgtc gctgtccctc tctctctccc tctctctccc    102780
     tcccacactt gccaataccg tacagtaaga atttggtggt ttaataggat gaataaatta    102840
     gttgttccct acacagaact agttactagt attcggttca tttactatgt catgtataat    102900
     gaatgaattt cgtattgatg atctgaccca gcagatccca ccctccctcc gtaccaccac    102960
     ccagcactca ataaatggtg actgtcatta gctttgcaca gaatcacaat ataagctcga    103020
     ctccagtacg agccgttagt aaactatgca tttgattgac tccatgactt tgtgaaacca    103080
     ttcatcgtat ctctcccaga ttaatcttca ccagctccac cctacttttt tagcgccggt    103140
     cgttaatgct tctaaattgt ccagtgttct ccatcccaac tttttccccc tgagggtcct    103200
     ctcccctgct caccttacgc aacacagtaa acgaacgaat agcttccgga gtctaagcca    103260
     atcaccgtga ggcctgctgg gtggattcgc tcctctcttg actctgcgtc ccgctccggt    103320
     tccttgaaca agtgaactcc ttcggtccca gggtgcaggc ttacttacgc aagcactgta    103380
     agagaggcaa caaacgaact cccattgata ataagtttcc cgtccggctc agtcaaaact    103440
     cggaacgatc cattggacta aaggccttgg acgttacaat ttaatagggg aaaacggggt    103500
     agcttcccct agagggactt tctactggac gtgagccttg ctgtgggcgc gtggagagaa    103560
     aaaagaatat aataaaataa cataaaataa aaaaaaaaag agggtgagtg ggagtgcgtg    103620
     agtgagtgag tgagtgagtg agggtggatg agtgagagag catccatcat tcatggatcc    103680
     gaggtccctt gtccttttcg gcacaaccgt tttccttcta gaagggtaga aaactattct    103740
     cagccttaac agatgcaaca tgacagctcc gatttgacac accgagttac atcatcattc    103800
     gaaatattga gtctgagtct ggcttccttt tggcttcgac agcgtcatgg aattgtgtcc    103860
     ctggagagga ggggggggga aactgagtcc aatggagtga gtcgtgctcg actagtccag    103920
     aagaagccta aaatagccgc agaccgagtt taggatgttc tccacgcctc cactttttgc    103980
     cagaggtgat atattggtct gtgagaccgt ccgatcccat agcccatgtt actgctcaat    104040
     caccattggc gaatgaggcg gcgacctcga cacaactcct tgctcccctt cggtgatgag    104100
     cggagtaatc ccggatgata gtaccctcga gtgtcaagag atgacgtccc gcaaaatttt    104160
     aaccccggaa gtctgaacac atttttgcat ccttgcatcc tagctgcagc tggggagatt    104220
     ttgccttgct cccgtaatac cacttacttc ctgcagtgtc gtgcgttgat cctttcccac    104280
     cacatgcgct tctcattgac tctcgccagg gtcgtctttt cttatcttct gctgctacta    104340
     ccctggagcg aaactaaacc cacccgtgtt cccgagccat ggcacccaag ccacctcctc    104400
     caagtcacat tgcctgattt tgcggacaac tgctgatcgc ggaaatctct tccatcctac    104460
     cgactcatca catttgaaca gagccatggc tcggtttgga ggctactacc caagtctggg    104520
     taaccgaccg cttcagggac aaagatacat acctgcgggg tcgtcggggc ctgcgaccga    104580
     gatcggtacc tgtcacctac cctgactatc gtaccagtca tactccagac cttgtccatg    104640
     tgcctggatg cccaaatcag gatcaaacat tctcccgcat cgattaccaa gcgggcagag    104700
     cactgatttg tctgcgaaga tatcctaatc gaagcacata ctcacaccgc cctccgatgt    104760
     tcggtcagca gtgcgtgctt tatcttcgag tactagatgg gcagaccgaa atttccaatg    104820
     actagatcgc taagcccagc cgacaggcat caaacatgcc catgacgtgg ccagacaaga    104880
     aacggcatgc gacatcaagc catcacaatg agacttgcag taggcagaag tcccgcccac    104940
     actctatcta cctacgacac ccaagttcat atagctgggt ggggttaatt cagtcaatct    105000
     ctcccaattt gttcatcccc tccgtgacac atccaatgcc tccgactatg ccgtcaaacg    105060
     tcaacaataa ctttgttcca tgactggcgc atatcagaat gatctgcggg gtaccaagaa    105120
     cagacaggca tcgcttaaac ggtaaaccat cacactgact tttggctgac acaaaccctg    105180
     agccacaaag gggtcatagc tactagtcga tacaaagtga gctgcccccc ccttttcgga    105240
     tctcggatat ttacctacct tgtctatgtt cgactctctc caagtgagca cagtaggtat    105300
     tggtaagatt ccaaatcaac cgctcaccta ccgtaaggaa aaccaattat catgtgtaaa    105360
     ttgcaaatca tatggtctaa agtatttagt ccgcttcagg atgttgtgca tagacaactt    105420
     actactcgtt ccttttggcc cccaatgata tattatgcag gggtagatag tgtacttaaa    105480
     gcttgggggc cggccggggg tctccgctgt tgattccttg ccgtctgtct atctgtctgt    105540
     ctgtctccct gaagaaacct cagtggagag gaagaccaca gtattttcaa cctagtaatt    105600
     agctgcacat tgtgctcgcc tctttttaca tcagagcttt tcgtgtctcg ttcaagtggt    105660
     gttggtctaa cagatccctt ctttgaaaat atgccagtac cccagaaaaa ggcagtagga    105720
     tgttggagtg accatcttaa tagtaaagtt acttctgggt cagaccattt actaaacgta    105780
     cagtaagtga ctaactactt actcacattt gtagttcttt tgcctttcct cttatgagag    105840
     tagcatagtt atgtctgtat ttgcctgtct cgtttcctac cgtagttgcc tttcaccaca    105900
     attttatctt ggtcctagtt gcttattatc aagccggtca atggcaatta agcagcctgc    105960
     ttatctccgg gagttcatac aagccttcaa tatatagcat agaaaaaatg aaagcaaatg    106020
     tactccgaga tgttcatggg atttaactat tgctacgtac atgtctgact agctcctgta    106080
     tctggtattt ctcaggaata ttccctatca cttgtctcct taatcagaag gaaaaatgga    106140
     acagaaaaag gaaaagcatt tgaggtttgt tacttgcaag gaaagatcgc tgaaataaaa    106200
     gtcatggtta tcgtgccgtt gacgtaaatc aaaccgagaa gtcatcagat catatcgtcc    106260
     ccatgggtac tttgtgtgtt ccccgggtgt ttgggggtat tcaagagaaa attcgaccag    106320
     gatcaagaga ttaatggtat gaaaactgcc aggtagatag ttatgcccaa cgtatgaaat    106380
     ccaactagtc aagaaggata tcctgaatac aacttgaaaa gaactggttc tccggcgaat    106440
     gattcccagg tctgcatagt tgtgaaagta tcgtaaaaga gcacgtctcc ctgtttccag    106500
     gtatgccaat agcagactct acggtcatag aggagaggat tcaggatatt gcatagtcta    106560
     gttgagtcag cggttgagat atcttcgatg gcgatgagag tgggatcaca ggtgatattg    106620
     ctttgagaga ggagcgagtg gtaacggaag cagggccggc cgtgagaaaa gtgcggtatg    106680
     atcaagggca gggaactggt ctcagtgtcg tgggatgaag tctctgcgtt ccaggaaagt    106740
     tgctggagta tgccgacggt gtagctggct ggaaggtggt ggaaaaacag aggggatgcg    106800
     gagaaaagac tgcgtctggt gttctctgag atagggccag gggcactgat gagctgatat    106860
     ctattcggga gtggattcta tgtgagtggg aagttaaaga atcttgagaa acagagttag    106920
     cttacttggc tggagaggag accggacact gcttgatgtg atgggcttct tgatcctcca    106980
     tgatctcagt tggcccatcg tagggcagcc aacctgacaa ggtagtgctt ttcgaatctt    107040
     gtgaatcacc atcttcggct ttttcttcag gattgaagtc ggatatcgaa aggtaagaag    107100
     cgtcaacgct ctcagctttc tgcgcgatca gctcatggtc atgagtgtct gtaaatccgc    107160
     gaaggacaac tggtgagttc tcgtgtgcta gaccctgcac tttctccatt tcaacctggc    107220
     ttattgaggt tggattgaga ggcgtgatca tcatgccaca gggatagatg ggatcgactg    107280
     ctaccggcga tgaccagttg tacagctcag atataaaacg gtagcaccat ggacgcccgt    107340
     ttttgtggac taactccaat tctgggttag catcgaaaac ttcgcgccat ccatatatga    107400
     agcggccgtc aacagtatag caaggtgctg agtgccatgg tgtgactggt tttgaggatc    107460
     tcgggagaac atttatggag atcttggtta atccatttga tggatggatt gaaagacgga    107520
     tgtaacctga gtagttcttt atgatggctt ctgcaaaggc ctatagtgaa accacacgtg    107580
     ttagtgccat tcaatactgt tatgcttggt tagcgttcaa gttttgggtg aattattcca    107640
     ctcaccgcgc ctcgtgtgat catggctttg gcaacattcc ccaggtactt cttgtgtgcc    107700
     ttgcgagatg tggtaccatt ctctacataa agatgttcca ggtccttggt caagaacttt    107760
     atgtatcctc gataagtggt gcagatgttt tcgtctgact tgatcataac agcggcgtca    107820
     aatcccaccg gtgtgtgctg ttcaattagt tcctggcgaa acaccggggc caacctttcg    107880
     tacgtctctc cgtcaagttt gacgtcctca tggctgtgaa caaggtcgcg cagtctggcg    107940
     aactcgatat ggtcgtactt attttcagca accatttccc tcagtgcatg gccatattcc    108000
     cagacgtctc tgtcagaaac gcccaggata tctaccgaca gtcagtccct attttagcat    108060
     acaagatcat gagtactttc ttctcgactt accgttgtac acgaggccat cagatacaat    108120
     ggtgagctta gctccatatt catagacgtc actaatagca gcgcagagtc cgttaaggtg    108180
     cgcgagacaa atctcttcgc ctttgtcagg aaggcttccc aaagtcttat ttccctgatt    108240
     cggagacttg aaggggaaag ccggtagaat cattcggatc ggctgtttgg cccggatctg    108300
     agaccacatc ttggatagaa acataatgtt tccgtcgctg gtgcgatcac ttgcggttgc    108360
     tggcaccatg gtacgatacc gaccgatgat ttccatgatc tcaaaggcct ttagcagtgg    108420
     atcgttctcg tacttgcgtt ctgagacttg tgggtcgata gtcgactcca tagggaaaat    108480
     gtctgactcc atgggaacga cgcctgactc catagagacg agatctgact tcatatggaa    108540
     gaactctctc tccataagga aattgtctga ctccatagga aacatgtcaa tctctaaggg    108600
     aatgatgtct ggtccaaatc cttgttccat attggcgctg ttgagataca ggtatgtgca    108660
     ggtggtgttg tgggcatctc agaagactga ggcgtgaaga tttacacgtc tgtataacac    108720
     gaagtgagaa tgcacttcac tggctacacg ccgactaagc gatgcaaact catatcatac    108780
     tctagcttga gttcggggtg aaccgttcag ggaccgtgat gtcaatcatc caaatcaaca    108840
     ttgcactgtg ccggatgcag taattgattt acccaccgga accagtcgat gatagccctt    108900
     caggtaccat cgccatccac tatcattttc agagtgacga ggtgggtgca atgctctgct    108960
     ggcatcgtcc gtagaagata accgtgtagg cacatcgact cgagttgcta taaggatggt    109020
     gcgaataaaa gtaggctacc ataaaaagcc tgaggtttca ctatataatg agctgacggc    109080
     aataatgcag accgattgtg cccctcaagt cgcaaagaaa atgtcaccgt tgcatcggca    109140
     gcttaggagt gccgttactt atatataccg agccgtagat ccagtttgcg acacgcaatc    109200
     tccaagttac cttttgaacc aaagctgcca gttgcccacg ttaagttatt agcaaagctc    109260
     ttggatatat ataacccgat ctttcaacat ataagttgct gatggcactg gatatagttg    109320
     gcaacgggtg acttcgtatc atcatgtcgt tcctttcaca caaggaagtt gaattcttta    109380
     cgcttacttt gattcagata tgcagtctca tcatgtaata tcatttgacc atatcgtcta    109440
     aatctaccaa aattccagcc aattctaatg tcgctccacc attgagtgct ctttacaagt    109500
     ccacaaacat aaatgcgtat acactaagcc ttgcggtgca tggaagtcgg ggatgcctaa    109560
     gtgacggtgc catcagctat gctgttgagc cctgtatgcg atgtttgact tacctggtgg    109620
     ctagggaaaa tcaaggtatc tgcaatcaca acattctcgc gccgaccggc agcaaataca    109680
     accacctcag caatatcatc gggtgtaagt ggctcgcagc cgctgtagtg cccataagta    109740
     gtcagtattt gtccatgtgc ctttttactg tcagctggga gaacatataa gggatcctta    109800
     cgcataaact gcatctgcct tggccttatc tccgtagaac cgcacaacgg agaattccta    109860
     tcgaagaaca gttattagaa gggtcatgca attgacataa gcgaagtctt accgtctcaa    109920
     cctggccagg atcaatctca atgatacgga ttcttgtggc gataagctcc ttcctcaaag    109980
     catcggtgaa agatctgata gccgccttcg tggcacaata gatgctaccg ccagggtaag    110040
     cctcgcggcc agcaatactg ccaatgttga tgatatctcc gcgaccaccg tcggctctct    110100
     tcttgaagat gggaaggatg gcctgggtca tgttgatcag tccagtaacg ttggtcgaga    110160
     acatgacgtt gatatcctca ggtgcaattt ccggagcctt agcaactccc ttaacaaggc    110220
     ctctgcattt ctcttagcac agacttgtga gtagcagttg gaaaaagtcc tgactcacgc    110280
     attgttaacc aagacatcga tttccttgaa ctcttcgggg agagacggca cgaatttctt    110340
     gatatcttcc gggttgctca cgtccagctg cacaggcaac accttgacgc cctcaccgac    110400
     ttcctcctta atctccttag ccagctcctg cagtgaatca atgcgtctag cagtcacgat    110460
     gatcttcaag tccttgggag aagtgcgggc gaattccttg gcagtgcttc gtccaatacc    110520
     ggaagatgca ccggtcacga ggattgtctt gccttcaagg cgctttgcca ttgctgtcgc    110580
     cattgtgcgt ttaataaaag ctggtctgat tgcagcacga aacggaagcg gggtggatgc    110640
     ggagaatgat ccggatgaag gggagagctg tcgcagggat ctgagagtac tgtaataagc    110700
     ctggagaagc cgcataaaga gcctgtcagc tggcgtcgat aacggtcaag taagagagaa    110760
     aaggtttcaa atcggacgag gagacagggg ctattggtgg tttcttatga atcataggcc    110820
     gaaggtcggg atggcgtgtg cggggatccg gcgaggccat ttcgtgctcg ggcggggggg    110880
     cctggcctcg gctgatggtt atgccggccg gactggcttc cgatggctgc ttgtaaattc    110940
     tcccagcttc tgctcctccc ccgattctga atctgccagg aacgatagct ctttggagaa    111000
     cagctcattc ttgtattcga cacaaagcgc catcagtcac acaactacgc tgttgaatcc    111060
     tctatcaaca cgaatgcctt gactccagct ctcaaaatcg gtcaatagat gtctttcagc    111120
     tgaagtcgct caattatcga acgatgcagg aatcagtcgc cggatgataa gtcgaacaga    111180
     gacggtttta aagccattgg cagtaggggg gtttcatttt tggagcaaga aacagaatct    111240
     ttcccatcca ggcatgccat tttgtgcggc tagctaggcc tggcaaaagc attaatcatt    111300
     cacagccatg cagaaatatg aactagcact gatgatagac caccactgca cttgatcttc    111360
     acagaacaat ctatatgact ctcacgttag caccagtgtg ggcatatccg ttaattccag    111420
     atacactgaa acgacatgaa cgtaccattt cctttggcgg tagcttaacc gcgggcaatc    111480
     ctcgaagaaa aagaagccat agtcatcata tccgcaacag ctctgaaggg gacttagtaa    111540
     ggtcgtagtc aattaggcga gaaatggagc agcctttggc ctcttagcga tccacgacaa    111600
     ccacgacatc gtcttatggc cagtatgata agcggccatg aaattagaat cccgaagacc    111660
     gggctttgct tttttagaac gcatgaatat gccaaggctt ccacgcgttc ttaggtaact    111720
     agcttcgcat cgccatgcag aactagctta aacggctagg tcaagtccta ttctatctgt    111780
     ctgcgaccat tgactacaaa cacaaaatcg ggcacagtct tatgttggac aaggagtcat    111840
     tgtatccact tcctgaaggt gacgccaaac ggtacaatgc cacgggtccg tggagaaagc    111900
     tacctagtcg ccttgataat ctcgacatga aaggatcagt aggtggcata gctttgagaa    111960
     gtcactgggc atatgataac gaagatcttc cttcaggtac tttggtatgc gagtttcccg    112020
     tataggtctg gtgctggcga tcgttcgcta ccgaacgtgc tagcaaagag ttcaagagtt    112080
     caagccgcca gcccatccac tatgatgaaa gacaagacat cctgatttga acgaaccacg    112140
     gatttcaggg atctgcaaac tgcaagcgaa gagatcgtca tcccagtctg caaaccttga    112200
     gatcatgtgc tcggacgcgg taggcacgtt ctctggttgt tgcgcacgta tgaggtgccg    112260
     aaccctttgg atcattgaac attgacacct cgcatcagta agattgaaca accatagtat    112320
     ctaccaggtc atgtgtgagc acaatgctat gaggtaacaa cggtcgcgag catacagtag    112380
     gaaattcaag cagggtacca agcaagcatg tccgaagccc gtaaaccgaa gtcgactgtg    112440
     gagtgtactc cgttttcggc gaatggccgg cgctccgagg ggtgttgaag gcgggattcg    112500
     gaactcatgg tgtttaccac cagatagata tctagattcg acgtgatagt catttggatt    112560
     ctcagcccta ttcgaggaat tgtaattcat aagatggcgt ctaggggagg ttaaggttgg    112620
     ggtccaagaa ccaaggaaat ctggactatt cttcagccat gcaagtagag tttgagctcg    112680
     gaagtgactc cgatgctcgt gcggcgtttg acaaaaagtc ctgagaccat gacttggaca    112740
     gtcaggcatc agaagaagtt aaatcaacta actattgaaa tgctcttatc tccttgtcga    112800
     agtcctggca attgcctggg tcggagttaa gggcagtgga tcgtcaggga tagtggctgg    112860
     tcactcgctc tctgaccgct tcggtgcctt ctttcccttt tccctctccg gccgacgatc    112920
     atcactagct tttgacagtc ctccaaggcc ccagagtcaa ggcttctgtg ccaatgagag    112980
     agacctcatg ctccaggaaa gttcgacggg ctatctccgt gggccagaat gacattattg    113040
     acatttgaca caggtctatt ccaatgttga cacctctctc gtccgtcgat cttcgcatct    113100
     tgactacacc cttcagtcca aagcattgga ttcgcacgtc attttcatct ttccccgttg    113160
     cacgtacccc ataatatcta tcgtacaatt gagagttgcc ccttttgtga cacccggagc    113220
     ttcgcatgga ggtgcttcgt gaggacacat agtggggact tatccacata ttattttaca    113280
     ccaatgaacg aaacgccccc aggcataggc tccaagacaa atcctcagct atcgagacca    113340
     agcttcagag ccaaaaagca attagtcacc gggttgcatg gcaagaaaat ggaattgaac    113400
     gtcgggcagc ttccccgaac ttccgtaaga ggtctctgca gcgcttattt gctgcgcagg    113460
     tcacatcgac aagaaatgca cttttactat tcaatggtgg cgctctacca actggctggt    113520
     agtggacatc ctttgccgct tatagcttgc ccggcgcagc agtagcgcgg cgctatccag    113580
     cctcgtcctc cccctcccct ttgaacctgc atgggaccca tcttctattg atgatcatag    113640
     ccacattgtc gcagccgcac cgctgaattg ggatgagaat tttcaaagca gtaaaacaaa    113700
     ggaaccccga gttttccttc gggttccatt cccccggaat catgtatgtc atttgaatta    113760
     tcgagccacg aggagcaaca atggaaagca cgcccctgtt ctatgcagac tcgatgcgag    113820
     ggttgcacag cattctccac atgcaagctc ggagtccaca gctttgatgc agccaagcat    113880
     ggcaacggct gctggcttgc gacctggact catggtcctt ggaggcacga gtcatgcgaa    113940
     acacacaata tctctgtcta cgaaacaggc tctcgtatgg aatagtagtt aatatattct    114000
     tccttttgcc tttctcttaa acatccggtg ttcctttcat ctatgaaaga tggcaaagca    114060
     actaatgctc agacggatca tgcaatttca aattcttacc tggtcaaact tcggccatga    114120
     cgtgctctat ggactgatgt gatcgacggt tacaggtgag gaaaccgaaa atagaagact    114180
     atgactacta gtagtcgctt gcgcccaagg ttgcgagaag acagggacct gcgtggacaa    114240
     tagcacaaag cgcggacacg ctgcctatcg agtactcgag cctacgtcaa agacttcccc    114300
     aaatatgtcg atcaatcact gagcagatag tgatctatcg ttctaggaat tttccgacga    114360
     gtgatgaatg ggaagaaaga aaccatggtt gcggttgttc acgtttgacc aaaacgggtg    114420
     aacgcagagg ataaatgtaa gaaactggtg aacgctaatg aaaattctgc tccacagcga    114480
     agctgattgt tcgaactgtt gttgacttcc tttgcgacaa cccacgatct tagtatgcag    114540
     gattagcttt tatcgaggta cgaaactttg ttagggagga gccatccggg gtcttccgct    114600
     aatcggggac tgatgaaggc catcttttgc cctgctatgc atgctcccat atcctcgctg    114660
     ccttgatcat accctgaatt gccattgtta gccagaaacc aggcgcccag aaagaaacta    114720
     gttcatgcaa ggcattggac tagagatctc gtgttttttc ctcgcttggt gacccaccgc    114780
     cacgctgaac ggcagatcat ttcttatcct gttctatttg cagggatagg ataaaatcaa    114840
     cgagcgaatg aatgctcgaa atcgtgccat acacgtttta gtctacctag tgccagagga    114900
     cttctatgcc gctttaggct tgtgtacctc cactggcggc gctatccaca ccagcacggt    114960
     cgtgaccgag tctcatcaaa ttgaaaccgg tggaagaaca ttcttcaaca ccatctaagc    115020
     caaattgagt gagccaccca gctttctcca tgtggctatt gatcctggtc tgattttttg    115080
     cggcaccccg ggggctttgc ttgcgatttc ttaaggggca caggatgagc tggggataca    115140
     cgagccaaaa ggttgaaacg ggcattttgt gtttggcctt ccctcttcct agtggagcca    115200
     atctagccga atcaacggta ccgtacgagg gatattgccg agtccgtacc agccaagtcg    115260
     aaagagcact atactccagg agggaagttc tcaagacacc agggtggcgt cccatggatc    115320
     gaccatcgga gagagactcc agtgacaggg cgttgggtgc cattctgggt ctcgctctac    115380
     aggtcgccgt cttgattgac taatgtcccc cctacaagcg catccactct gccgtctgcc    115440
     cacgacacca gtggagaccg acagcttagt gccatagatc attactgcaa tttggaagga    115500
     gtccgggtca tgtagccaca ctgtgccggg caacaccgag ctgaaattgt ctactacgta    115560
     tactatgact ctccatccag ggctccccag cagtctagcg gccttcgcac gctattaact    115620
     actatcaaac tttgagctat tgcggggggt actcgggctt aattcgctga actgttaaaa    115680
     gcaggatccc cgatactttc cttttccctc ttttaccccg gcgcaagatc ttgaaaaagc    115740
     aaacctgctt caagagttgg cgttagccca gacactcctt cttgaaatct tgtcggtgct    115800
     tattcgaccc atgtggtaaa ccacgttccg gcctctaggt tcaagaacct ggagactgta    115860
     catctacgca gatcgattca ttgaccgcaa accaatgcaa tatcaacaac cgacgcttct    115920
     tcatcatcca tatcagaaat cacacgctct tttgtgcaac actcatctgc tcaactggcc    115980
     cactcctttg ccatgctgga tgaaatgatg ggaggcatgc tgcttccccg gactacggat    116040
     gatggtacag ctcgcggaca gcgagccctg gtagtgacag ccgtgcttac cggactctca    116100
     attgtcattg tcgctatgcg tatgtatgcg cgagttgggt taatgaaatt gactggtcgt    116160
     gaagattata tgattcttat ttctctggta cgtaccctga ttggggtgtc tgagttctcg    116220
     ctgggaaagt gccgtacatt gacattggtt gcatgtaggt attatcatgc acgtacctcg    116280
     gtcttgttgc tgctggtaag tcgtggccat ccgccagtga cctaaaatat ctctcttaca    116340
     tgctccagag gtgcattttg gactcggaaa acatgacgcc gatttgtctg acgttgttgt    116400
     gaaagagcaa ttgaaggtaa cattccccaa cactaatcag ttttgaacct atactgatcc    116460
     tctgtaatga agcgactctg ggccgctatc cctttctata atgccagctt gatctttacc    116520
     aaattttcca ttcttttcca gtatcttcgg atcttccccg accgccgctt ccggcttgcc    116580
     tgctggatcg tgtttggtat cgtggctact tacggaacat gggcagtagt cagtggtttc    116640
     ttgaactgtg tcccagtcgc caaattctgg aaccgcaaca tctccggcta ctgcctaagt    116700
     ttcgaggccg tctggttctt caacgcatcg atgaatatcg ctacagacac aaccctgtta    116760
     atcttgccta tgcctcttct gtcgcaatta caactcccgc gcatgcaaaa attcgctctt    116820
     atgggtgtct ttgctattgg tggactgtaa gtcatggcga tcgccagttt gtccaatgca    116880
     cgctaaccac cacactccag cgtcgtgatc acgagtatcc tccgtctatc cagtctgaga    116940
     agcgtagcta aaagcacaga cacgtcttgt acgcagcccc cattcaattt cttttctcct    117000
     cctcgagttt agactaacaa acgaaccaga cagtaatgtt ggcgctgcct attggaccgc    117060
     tgcagaatgc aacgtcgcca tcatctgcgc ctgcctacca ttccttcgtc caatcgtcag    117120
     tcgcatcttc cctcgtttcc tctcgaccaa cagctacaac cgctacactc gcaaccccac    117180
     catgacagcc agtcgcatga ccgccactcg gatgaccgcg cgctcgcacc ggcaaaaggt    117240
     cgagctttac tcccaggacc gcgactacgg catgtacacc atcgacgtca agtccggcga    117300
     agcgagccac gatagtgcgc tagacggaat cgcggtcacg acgacaacga tgattcagga    117360
     gacatcgaga aacaatgacg agtcgaccag tcagcgtcga ttggttgttg atgtctgatg    117420
     atctccgacc tttcctaatt tcgcacacac tcactatttc ccatacattc acgaacttac    117480
     tttcttctga taccacgatg catgatatat gacgctgcat cttcaacatt accccctctt    117540
     ttttttattt actctctgat cctgatatcc cacacctgcg tctcgtttca cacataccta    117600
     cctatccgtc caccttcgtg tacattcttc tcattcttcg gatgtctaat catcgacgac    117660
     tttatgncca tgctacaagc tgaacccctc tttcttcttg gttttatgta cattcaccct    117720
     tctttcgctc atctaacgag ctcccaacat aatacatctg tacaacagac attaatacta    117780
     aatagtagac ggaaaaccca gtagataaat cgttagaaaa atcaaacact actgataaac    117840
     caacctagcg cccccccccc cggataaaca gaatcccgct ctccacggtg tatctaccta    117900
     tctacccacc ccaatttaag attaataatt ctcacacgat catagtaatc tcccccctaa    117960
     ttttaatctt atcaatcgca tcacatcatg ccataatcca tctataacac tttcgccgga    118020
     tctagaacac cctcctttcc cctcctttgc ccctcttttt tcgcagcacg gtagatagat    118080
     actgtcaatg taaggcgaca atccagcagg gaagaaagtc ctttccgaat aatcctaggc    118140
     aggtaacaca attccaaccc atcaacatca attctctagc aagacccaat gtcgttatgt    118200
     gcttatcatc ctcccatgtc ctgtttacac cacttactag ctacaattcg ctcgagaata    118260
     aagtaatcaa caaacaatca cataaaaccc cccgcctcgc attaccaaaa acaaagcttt    118320
     actacattcg gtccataacc atgaatcaga cgatgatcat cataagcgat aaatccgaat    118380
     ttaaccgacg caatgcatag ctacgtaatt gtagctccta actaactagc tgtatgctaa    118440
     cttacatttg gtaattgttg gaatctggac ttaagaaaca tcccaccaca aggggaagag    118500
     agaaatccaa acaggcgagc agggagtaag taattctaca ataaattaac attgatcata    118560
     tcacgcaaaa caactaccct caaacctagc tgttacacat gaaattggcc agcttaatgg    118620
     cctactttat tagctagtta gttccaaaca gcctcatacg tgttattatt tcgcaggatt    118680
     cagtatgtga cgagacaaag cgaccgactt tgttttcgta acgaaacaaa atccggaaaa    118740
     tccgatccct tgcagtgagg ggtatgtgct agactactag tagacctacg tgcgaataat    118800
     taataagaat tacatgagaa taatagccaa ggagaaattt ttggggactt gaaaggccga    118860
     ggtcgggccg aaccgatctg gaaagggaat ctggcagtta agcttatcaa tcagtcaatc    118920
     agtcaatcaa tctgtggttg agagataact aactaattga tgggtttcag ataatcaatc    118980
     tatcaatcaa tcggtcgcta caggttcgat caagcaggaa tcttagcgaa ctagtttact    119040
     ttagatcaat aacagtcatc atatgatctt gataagtccc ttattaccga aatctattca    119100
     gttattccat gaccttacga acacagtcat ctcacccccg gttatcccgt aattaatagc    119160
     cttgtccacg catccgtccg ccggtacaga ttcaaacaag gtgaagggga gagtgagaga    119220
     gagaagaaga agaagaagag gaaataaaag tgtaacaaaa caagcctccg tagtctttct    119280
     tttgtaatcg cttatcccgc cagcgcttcg aacaaattaa acccaagtaa aaaaaagaaa    119340
     actatgtaga gaactttttt ttcccttaat agtgcacaag tcccgtgaaa ctcatcgtgt    119400
     tgcaaatggt atctcgtcag aaaaagtctg cgccaaatat gtgattgttg aaagagtaaa    119460
     ggtatagcaa tagcagcata aacagttcta ggacaactag atccatgatc attgttgtcc    119520
     taattctgcc aattcgcgct cctttgctcg cagcatctct ctcatctctt ccgcttctcg    119580
     ttgcaacttt aagcgacgct cttccctgat gttgtcgaat tccgatacac caggcagcaa    119640
     ctgtgaggga gggggagcaa gaggaggagc ttggtgagac tgatggtgct gacggctaag    119700
     ggcagcgagt gaggggtcta gacgcgattc gtcatggctg ttagggttga ggagagaaga    119760
     aattgaactg aggcgggcag gaggggaagg attgacggaa gacatgatcg gaggaagttg    119820
     gttggacccg ttctccagag tggttgggat agacatcgct tctgctgatg acgcggtttc    119880
     tgcaagggtg cgtttctttg gattacccga tggattcggc gaaagagatc gccgaccaaa    119940
     ctgagacacc ggagagtggc ttggagcgtt gatgcgatcc ggctctaaca atcttggtgg    120000
     cgggggatgg tgcggtaagg agacgggccc ggaactaaac ccggtaaaat cgacaggcgg    120060
     gggtgcaaag ccaaattgct tgggcgcggc cggtgaaatc ctgtctccgg acatcggtcc    120120
     atagtgatcc accggctcag agctgtagta gcggtagtga tcgtcgtgga cgcgagccaa    120180
     cgtcgctggg gaggcctcgg gcgaggcaga agagccattc gacgactgcg tggcagcagt    120240
     cggagagtgt tcccgcagcg ccggcacaac gcgttttcgc cgcttgatta tagtcttctt    120300
     cattgtggtg gggcgatagc agccgtggag cttgtaatat agacctaagt gaaatgttag    120360
     ccgcttcaag gctcgttctg atacccgaga taaggcaaaa gaacatacca cacgcattgc    120420
     agatcggatg gccattctcg tctcgtcgcc aaagcggggt cacagtagtt ccacaattct    120480
     gacacgatac caatatgttt ccctcggccg acgcaccact ttttccgggt acgtccggtt    120540
     cctgtgctgg caggggcttt tcgctatctg gattggcggg tcgaccccaa gcgtgcaccg    120600
     gcacagtccc tcgggcagag gacttgtaca cgcggttgtt gtaagctggg caaccgtcac    120660
     acccctcagc acccccagtg ccgttacagt tgcccccacc ggggcaagat cctttggagc    120720
     catgacagcc tccttcgcta tgggtgtgtg cctcgtgctg gggtgctatc gatggtggct    120780
     gttgctgcga cggttggggt tggacaggtt ccgtgctggt ctgtatacga ttccgctttg    120840
     tgggccgggc aacattccgt gccttcaaat acagaccaca ggcattgcaa atcatcgccc    120900
     cggtcggtga tcgtcgccat agcggagtgc ttttcgttcc acagttacta agtgttacca    120960
     aggaagtcag taccgcccag gtaacaaact aaagaagccc atggaaactc acctgcagga    121020
     atgtcctaga aaggaagtgt ccttctggga cttgggtgat gtcctttctg ctagtgtgtt    121080
     cgaggcagat tcggtcgacg gcagcgtagg ccgttcagaa tcgtaaggag taggtgtatg    121140
     tttgccatcg taggcatcgt aagcatcgta gcctcgagcc gcatcatcat cacgggcacg    121200
     gtcaacaagg tgttctcgac cagcctgagc agacgagatc agctgctgag cagcgtccaa    121260
     gtcctccgct gatggatgcc gcgcaaccat atcgggattt cgagggagcg atcgcaccgt    121320
     ctccatctgg gggattgatg ccagcattgc caacaagaaa tcgcccgcag aagatattcg    121380
     ttttccttct ctatctccca gtgacaaagt ccccagatca aggcaacttc cgagagtaga    121440
     gcgagtcact caagataaaa gcgtagtcga aataaggaga gggctttgtc gtgaaggtac    121500
     gtcgcaccac agtcgagggg gggcaagtaa tgtatcgtat cacaaagtca aaagtcggtc    121560
     aagatgacag tgcaggggga aggagaaaaa agaaaagaaa agtctaacga cagcctgact    121620
     gagaggcagg taactgcagc tagtgaaact cccagagcca accaggcgga accggagaga    121680
     cgacagaaca ctgatccctg acggtgaccc aagcgtacta gaaggagata ggggttctcg    121740
     gaaaagttga gcgatcgtaa agtcaaaagg cagagatcag taagcagcag tcaaactgta    121800
     ttgatgggca acagatctgc cacgaaatgc tcgtatattg gccaatccag aacgggatgg    121860
     tctgagtggc gatccagtcg taacggatag agtgccccgg agtactgggt gcggatgaac    121920
     aggtgaggaa aggtttaaaa aaagaacaag aggtgaaatc aaaggaggtc agatcgcgaa    121980
     tagatttggg gggggtggag gtgggtagga ggcaaaaaaa ggtacggaat ggaggaggct    122040
     cgagagagaa agagagagag aacggtctgg agagatggga tggatagatc gatcgttgtt    122100
     ggtgggaggg gaggacagcg gcgacaggac aagaaagatc ggcggtaaca gggcgatcaa    122160
     acaagacgga tggaatgtcg gatcagatat gatgaggggt gttgaaagag tagaagatga    122220
     tgaaaggggg atgaagggaa aggaaaggaa gggatttagg gggggctgag cggttggtgg    122280
     aggaagtggt gaatgagcaa gaaggcgaga gagccgagga agagattgat aatagaggca    122340
     ggaagtgggt aagtatggaa atggatggtg gtggtgatga tgatgatgat gaaggtgagg    122400
     gtgaccaccg tatgctgata accacgggcc agaccttttt cggacggttc tgtcatgaga    122460
     cgggcaaata gaaagtacca gattacttac caacacgcct ctcggtctgt ttttttcact    122520
     caactatttt tgaagcactc gctttttttc ttttttggga tgcctctgaa ctttttttgt    122580
     ttttgattaa tttctttttt tttttttttt ttcccttccc cttcgcttct tcgcgtgctc    122640
     tgtcggtctg tcaactttcc cagcagtatg gtctttttgc ttatcaggca gcccttctgt    122700
     tatcgatctc ccagggggat ctacgaccgg gggctattcc ttttccttct tctcgtcagg    122760
     gttttgcttt ttcctaccct gcaatctgta ggttcaaacc gatagtttga cggaataaaa    122820
     agtctgaatg tctctaaact tcgtttactt tctctctttc catccgctaa ggagggtgga    122880
     cagaattttt gcgcgtgaga gctcggtcgc gcagttccct cacccttttt tccctctttg    122940
     ctggccaatt ccaatcccat ttgcctacgg cctccccaga tcgaatctcc cgggctccac    123000
     cgcttcctat tacggtttag tgaactgggt ctaaggggca ctgcgccttc ccgaatcgtc    123060
     catagcgtgt ccgttcacga ataagcgtta ttcatcagcc tatcattggc gcaccaaacc    123120
     ctggcgcttc agtcagcggt attctaggca accacattgg ctgcttcgga gattctatca    123180
     cgatatcccg agcttccatg ctccgctccg acggtcacac tatgcactct ttcgttcggt    123240
     agtcggccat aacgaagcac cgccctagtg gtgctagctg ttggactagg tgaccagact    123300
     gcataagatg agcccgaagt cccactggtc cctatttggg atgttgtgga agcccgtaag    123360
     gctactgcct aagcacaccg gaacaggttg ttatctctcc gacgcggctg acgaaagagt    123420
     cccgtttgat ctatctcgct catgtgattg gattcttacc cacccaacct gacaacaaca    123480
     aagtaccttt ttgcctgagc cctcttttta ttttcctctt ccggattgcc gatttgctct    123540
     ggcgtatgta aaccatcatc ttctagactt tccataacct tccgacactg gctgcacaag    123600
     gcgcaaggcg cagctgcgtc tgactttttg acactctgac acgcctcctt ttttttctcc    123660
     ttgttcccac tcttctaagc atgcccacca gataaatctg ataggtacca ttcacaatag    123720
     taggatgatt ggatagtgaa gagaagaaaa gaggcaaaga gggggggccg aaagtatcca    123780
     tccaaacgcc gacctcctta tcgaaacgtt cgcttatttt ggctctcaac tttcgggact    123840
     aatctatttc tgaccatcta gtgaccatcc tgaatccatc ctcaatcctc cgtacggagt    123900
     aatccgtact gttagttaca atcaatcaaa atcagccgac tcatccgacc tatctatcaa    123960
     cttagaccgt agcgaagtaa tcaatcaacc aacagaatca acttgatcaa gcgccactag    124020
     cccccccctt agtcgatcgt ggcgtgatgt atgacaccga taacctgacc acctccccct    124080
     ctcccccaaa ccggccacaa catgatatga tatgatatga tgtgagatgg atatgatatg    124140
     atcacagtag actaactaac gctactacct acctgcttac tttcctgtac cggtaaagtt    124200
     ccttgccgat aacgctaaaa tcggcaacct gcgtcgattt aggtttcgac acatttgccc    124260
     tttctctctc ccacccacac cccctcatca gcgcggattt taatttgccg ccctacaccg    124320
     actcgggggt tccaacgcgc ggaagttccg ccctttcggg atactaaaaa agaaaaaaga    124380
     aaaagaaaaa gaatagggga aaagaactag tctgcttaag gagatacttg ttgtgaagta    124440
     tctagttagt ctgcatatgt gtgcatgtgt gtgagatatg acgacgacca catacatagt    124500
     ctaccaacga aatagggaac tcatcgtcaa gtttgcctga atacgtaagt aaatgaaccc    124560
     ggatatgacc ggaaatgaac gccattcgtc tggattgaca aagcgtgtcg tctgagcgtg    124620
     tcgcctagag tgtatacgaa tgtttggcag ttgttgcttt cgagttgaaa ggaaggagga    124680
     gcgagcgagc gaagcaaact cgggccccct ctctcgcaag gtgaggctga ttctggatcg    124740
     atccgttgat tgataagtcg atatagattt cttggcgggg gcttggcaag gggcttggcg    124800
     ttatagctgt ggacggaaat cttgaacgag gagatgattc tgactaggcg tcgggcccgg    124860
     gagtcgggct cgggagtaac ggcttacgct acgattaggt cgatcttgcg cgttaaaata    124920
     gtggaggaat gaaggggcaa cgacagctgc aatggaacgc agtgataggc tggctatatg    124980
     tgaggttcta ctgtctagtg tctggtctag actagtgggc gttgggtaaa ggcatacgac    125040
     aggttggctt tacttgatcg ttaatattgg ttgatatgtt taaaaagaaa tatacgatta    125100
     atgataagtc tcaacagaat gttccacaaa gcaaagagag gatgggggcg tgttctcaac    125160
     aagtgaagaa aagccgaaaa cacaagccgt gacctgagtg ggacggcgca gaggtttacc    125220
     gcatccggaa cgaacacaca acggccccat cttgataatc aatcgacctg gatagggtga    125280
     aggaggccca tcggtaacat atttgaaatt gcttatctcc gagctggggt atcgccatct    125340
     ccgaatcctg ggaccggaag agcatgccga accgctcgtg cttgtggtgt caacgttcca    125400
     atggagcagg tttgcccgag cgatctttgt tttttgatgc ccgcgccctc tttcttctac    125460
     ttgtgggggc gtgggatgga tggcttagtc caggacttga tcgagctagt cgagtagttt    125520
     gcatgttgcc tgagcggcaa gccggatcag ataactttac ccacacatgc tagcatggga    125580
     ctgtccgtgg tgattgtcgt cggagaagac gagtccatgt gttcttgtcc cacatgggta    125640
     gcttgtgacg gcgggacgcc gctgttgtgg tgctgtagca tcgctaacta gtactcagtt    125700
     tgtataccgt agtgcttggc catggtaggg gattcatatg gtgcgatgtc cgtctcagca    125760
     cccatatact tactagctgt catcacgcca cgcggccata ttatctagac ttgcgtttgc    125820
     ccacgtcaga cctcggctta agatttatta tatatcatct actacttatt atacaaaact    125880
     aaagggcatg aaacagcgcc atccggtacg aacagaccac tggccccaca ggacagccta    125940
     gacctttaga attttccaat gcacacatcc accgtttgag aaaagtaaaa gaaatagcgt    126000
     gatttagaat gatctggtgt catcttctgg ccggcacccc ggcccaaacc tgatcctttg    126060
     gtctttgcat tcccccatca cttgaatcat cgctgagaat taatcatcgc gctcgtcgat    126120
     catcaaacat cgcataagag ttatcttcgc tttccctgac tctcactcgt gcttcgaacg    126180
     cctcgtttgc agtcacggtg tcttttgttc tttgttagag ggagagaccg cagacgataa    126240
     tcaactctga gaacacagat tatgcgccat acaccatcac tccgttaaca gagaacagat    126300
     tttacaccgc atttagacct gctcggcgcc ccagccctgg tcgttttcac gcatgttgga    126360
     agggggctcg atggagggaa tgaactccag ggccaggtag cccaggccga tgaatccgat    126420
     gatggagccg gcaatgtacc gcaaaaccca gtcgtgcagc aggatacatc caacgaagat    126480
     gtagactacg caagtggtca actcattagc agcgatctac ggcaatcacg gatagtgtga    126540
     cttacaagca ccacgtccca ggaaagagaa aaggaaggac gcgtagcggt aaacgtagtc    126600
     gggaacgttg ggcaggaatt ccaacccacc gacaactaaa gccatggtgt aagtatgctg    126660
     tcatatgcac tatactgctg cctgatctga gacttactga gaccaaagag aatcacgtaa    126720
     atgccgacga tgatggagct catagacgca gggaaaaatt gcgagatacc accgagaacc    126780
     atcaacacgc caacggcgat gttaacaatt cgactgcagc cgttggaatt agagtacatt    126840
     tcaccaaaaa tgtatgcgat gcaaggccat cgtcgacgta caagatgtta gaaagatcca    126900
     ttttggcaag tatttaggcc taaggagctc ttcctgctaa tataaccggt cgtcgggata    126960
     taggtagggt gttcaacgac gaagactgag tatcggaacg ggtacaaagg ggagagtttc    127020
     tgtagataaa ctgggttagc tggagaatcc aacagggtga ggccaacgcc ggattgggct    127080
     ccggcaggct agccataaca gctacgtcag gtatggtcgc gcgagtgatg accactcaaa    127140
     gggattgtgg gcagcatgat aacacagcca gaggatggaa gctcaccttt gaagccaagc    127200
     ttctttgaca gatacgagtc ggaaggaaga gggcggaagg gaaaccaagg agatggagag    127260
     gctcaagcat cgtcgtcgcg ctgtcgcaag cagcgggtct gccaaggcgc tgagtagatg    127320
     actcagcagg tctcgtctcc ggagcgcccg caaatacgcg agatgaaaga cccatttcag    127380
     ctactatttc gggatgtgcg acgacattga ttctacaaag gagctactat gcggcattga    127440
     ggccagggga aggagctaga tgcactcgac aaatctcata ctattttttt tggtctgtcc    127500
     actgtctctg aaagacatgt gtagacttca ttgatcacga gggcaactca tacgtcatat    127560
     ctgacaggca gctacgatct gtccaggtat gacagctgtt gacgggcata ctttgcttta    127620
     aacagatgcc tgacggactc ccgattatgt accagagcaa aacggccctg cactagccgt    127680
     tcaaatcgcc atgagatctc cttgcctctt ctccagtctg acagccgaca atccattggc    127740
     tagtcggctc atactcatcg agtcgcgtcc taggtcggcg tagatagcgt ccaggtccgt    127800
     accaaggccg acattatcag cagtttccaa actgcgccca tcaataaaag gtgcaatgga    127860
     aggccacaca gcctgggcat tgttgaaaaa gagatctacg cccaggtcgc ctagtccttt    127920
     gatctccttt atcaactttc tcgtttcgtc tcggtcatta tgggcttttt tcagaagatt    127980
     gttaagatct ccatctgcaa aatgcagtca gttactggcc acaatcttac atgacgcact    128040
     catgcggtga aacacacgta ccgtacttct cattgacgaa ctctgccaaa tcacctagat    128100
     tcgttgcacc ttgctctcga tagcgattgt atcccccgtc cttgaggacc attgttctct    128160
     cctcccagct gctctcccct aatttccgta tatcatgata cccgacctcg ataagcttat    128220
     tgactgcgcg ctgtgtcagg tcgtgcgaga tagggcgcga tttcagcatc gcgtccataa    128280
     ccatagcaag tagtgtatcc ggggagctct ccaggcgtcc ctctgcgatt tcggtcccat    128340
     acaagggtgg gcgaccaaat tccttgacga ccttttgcag tttgggcttg cttgagaccc    128400
     tttcttttgc ttctccttca tcgtcttcct cgccttctgc gtcctggtcc tcttcttctt    128460
     caccaccttg ctctttcaca aagtcgacgt tctcgtcatc tgcctcatca tattcttcct    128520
     cttcatcgaa ttcctcatta tcttcctcgc cctcttcctc aaattcttcg tccttatacc    128580
     ccgaatcctc ctgaacctcg tcatcttctt caacggtgtt tgcagctgac ttggacgctt    128640
     tagtaggcgg ctgctccttt tctacctcga ggcttccttc accggtgctg atgtcagggt    128700
     ctctctgatc gagcttgcgc ttgggggcat cagctgcgtc ggtttcgctc tctacctggg    128760
     gcgatttgta cttcatcttg gtagagagct gctaatatgc gaacaagacg aaagtgacgt    128820
     agaaaggttg gagaattatt gtttccaaaa tcaattgagt taagatacag tgagttgtcg    128880
     tagttgaaag ttttcatgga taaatagtct ggggtagatc gtagatggct tctccgcggc    128940
     tatggcgtca tgatgaattc agacgctatg ccccgtcatt gaattgaaac aattcttgca    129000
     tgtaacgtac cagtaactag agcgaaataa ctatgctttt taagattagc gtgctaaact    129060
     ttatggtcta tcacaggaca aaatgttgtg tctgagtcta cagcttggct ttatccttcc    129120
     ggcgcagcgt ttcctggacc aacttgacag catcctccgc acatccaaat gaagcctgat    129180
     acccaaagcc accatggcca tagttatgca caacggacac tccgtcgacc ttctccgctt    129240
     caatacgcgg cccgccctca cggagggggc gtagtccaac accatgtctg atgatatcca    129300
     gaccttcgat accctgtccc ttctcgacca gctccgggca tagagctatg gcccgcttca    129360
     tgattcgaac agctaagttg ggatctggca gcggatccca ctggttcttc tgatacgaac    129420
     ctccaatgac agttccacca cctgctgcac gggtcatcat gtaaacgacc tcgtcctcac    129480
     cgtcgtcagt gccggaaata gacaccatct tacccgggtc attgcgcacg acgacaatct    129540
     gaccacgagc agggtagagc ttgtcatcga gcacaccgcc caacttcttg gacgagagtc    129600
     cggtgcaatt gactaccaca tcggcttttt ggcctgtgtg gtggccgttt gctgcatctg    129660
     ccacatgctt caggacggct cgtttgaaga cgacaccgtt tttccggcac tgaccgacta    129720
     gccagggtag gtagacggcg gtgttgatgc acactgatgt gaatttggat gcgttgtcga    129780
     ttccgggggc tagctggtcg gcggggatat cttggaactt ttggaggtta ggagtgttgt    129840
     cggtgaggga gagtatgtgg gtgtacgcac atcaggaaca acttccatat accatgggtc    129900
     tttttgcacc agttcagaga accattcccc ggttgctgat ccctgatcct ttgtacggtt    129960
     gtaaacaatg gtttctgatg aggtatgctt agtagtgttc gttaatgaga ggcttggagc    130020
     gtaccttgga agtgaatgcc cgcttcgggg tggttcttcg tgagctccct cagggcgggc    130080
     caggtgtttc gttcccatct ctcatggtca cttccggcct ttcccacact gtgaagggag    130140
     aacctcttac attagtcttt tgagacgtgt ggaccgatac acagctgagg gcctaccctt    130200
     ggaggacata cggaagataa ttggcgccag cccagggaga agtatactcg atgtcgtagt    130260
     caccgggcat gtgctttgca aggactgtaa tgctattcga ggcatcctgg gacagtagat    130320
     atgcggtggt gagaccggag acaccagctc tggtgatttt caaaatcagc atacgccggt    130380
     gacatgtgag cttgcgggga agcagctcct accccagcat tacaatgcgg ttgttagcca    130440
     tcttccgttc gagcaatgga gatcagatat tttcgaaaag atgctttgca aaagactcca    130500
     atggcacaga cgggcttata agcaagcacc caggcataca gataaagaga taggaataag    130560
     catgagtcaa gccaagagga ggggatgttg aggcacgatc cccgtcagtc aaattagtta    130620
     tcggaggccg atcccgccat tttgataagg actcgactcc tctttttctt ctcttttgct    130680
     cggacctcat tcggcgatta cagtaaggta cgggcggctt ccggtaaaca ctaacgtgta    130740
     attggtgtat atacggtaca aagtacatac ctaacggaac gcgtcccgac cgcggcttac    130800
     catacggacc ggctgacaca ggcttgcccg gcggtaagta taggccagga aaacaggtcc    130860
     ctatattgtg aatcggtggg tatggaaaga aaactaggat gatgatgtgc aggaaggctg    130920
     atctgccaat tttgttcagg ccacttcatc aggtatgcct gcatggccgg aaagatgtta    130980
     ccagcaaagc gccagggttg tctggcctga ccgctcccga acagacagat ccattgtaag    131040
     cgccgaggcg acggagggga aaggtctttc gtcatcggtg acagcctcac acccgtgcta    131100
     gccaatcata acaaacatat tagctcaccg cctcgtcctc ggtaaggaac ggggctgtaa    131160
     gagggtaggt tttttcctgg taaggtaagt taaagtaagt tgattctgta agtaacgggg    131220
     ttcctccgca ctctccgtcc gaacaagaaa agtctcgcct gtctctctcg cgtgtagatc    131280
     gtgtgttgct tttctctccc tctttccccc attattcact ctccattcta ctgcgccaaa    131340
     acactcgggc tgttccccct ttgactattg tgttgctccc cactttccct attgtcccgc    131400
     ctctattctc ctctgctcga cgaggctcgt ctgtgttccc cttgcgccaa atgagggccg    131460
     ttcgtcgggc agggctatac atcaaccatg gcggacgctc caaatggtgg cagaatcgtg    131520
     cccatagtca cgactgcccg tcagcactac tccagctctc cgacagatga aagcatggcc    131580
     aaaacaactc cgcagacgtc tcagaagacc aagatgcctc gcaatgcacg caacaagact    131640
     gcagaggcgg aaactctgga gattccttgc ctcaatgcgc tagggctcta tgctctcccc    131700
     actgagggtg atggtaacgt ggtccctgcc attgggcacc tagcttcaat tttggcctca    131760
     attgggttaa agaagcatgc tctccagtct atctaactgt ccatcgtagg caactgcctt    131820
     tactacgcgc tgtcggacca gacttatggg gatttcacgc acgccgacga aatccgtgat    131880
     cgtcttgcag accatatatc cgccaacaaa gactacttca tgagcttcat agccgcggcc    131940
     ggtggagagc gtcgagcccc tcgacgggct gcggctgcag ccgcccgaca atcttattgt    132000
     tcctcttcgt ccgctagccc ggcgcctcct tcagccaagg ataaagagcg gagctttgac    132060
     tccaaggtgg cagagtcccg gaagaagggc gtatggggag gagcggagga aattcaagct    132120
     ttctgccagg ccttcaagaa ggacgtttgc gtctatacca tgtacggtat tcaaaatttt    132180
     cgtgacgttc acgcccctga aggtgaggaa cgcgacatta tccatatcgc attccacgta    132240
     agatacctta tgccatggtt ctactttacg gttatctaac gggcctagga ctttcaccat    132300
     tactcctccg tgcggcatag cgatgggcct cacaccggtc tgccttgtat tcccaaagtc    132360
     ggtaaagaac gggaagcaga ggcgtcagcc gctgaaccca cagttgtcga catggctacc    132420
     ccctggaaga tctccgcaat tcaggagggt ctggggggta agtatgacca aggcgctata    132480
     gtagaaatgc tacagcagtg ccgcgggaat attgaccggg cgtttatgaa tctcctcggt    132540
     gaggatagca atacgtctct ggcagacgcg ccctcgtcca aggccatcat gaagtcacgc    132600
     ctccaagcat cttcgaggtc gtcgtctcct ttcagcgtcg gcagcaaacg ttcagcagat    132660
     gaaagtgacg ccgacgacag ccctcagccg gctgtccgac gtacccggac tcgtgagagt    132720
     aaaaggcgta tcctccctga tgtcatggtc gggattgagt ttagagacga tcagaatgat    132780
     ctggtctcgt tgcgattgcg agtcagccca gacactgtcg ttcccaagcc tgcagtccag    132840
     ccaagcaccg agcaggctga ggccagctct ctagagtctg caacggatag tcccagtctc    132900
     ttaccacagg acaggaaact caggatccgg tcaaaaactg tttcaagtga gacgtctagc    132960
     attccgaatg agtccagcga tgagcgaaag ccaccccgac gaagccaacg aatttccagg    133020
     actcgtccgg cgcctagaag tgcttgacaa ttacaatcta ttctgtggct ctccccttac    133080
     tctcatcttc acgtttcgag aacatcagtt tcgaatcaca aatccttcta cgcatacgac    133140
     attacgaccc catccttcac cttcgcttca ttgctttttt catcattgca ttacgagcgc    133200
     gttgggtgtt gatcatacta tcccgcttta ccattagagc atctgtcgac aatcacattt    133260
     ctcttccttt ccataccact ggcgacttgg agcacttacg acccaaatca ttttcctccc    133320
     gcatattttc accatctcca aagacatagt caatgacgac tttttgactt gacttacacg    133380
     cgaagcatac gacacatacc atctacatct tcatgaggcg ttattggacg gttgcacatt    133440
     gcataaatcc cgttaacttt ctaacttgca tgcatgcatt gggttggtgc acctttcgga    133500
     aaagttacct tctcatctat tgatttgccc tggcggtctt ctggagaata ctttcatctt    133560
     gggacgattc tgctgattat actgctgaac ggatcacaac gactttgatg atagaaggag    133620
     tattgtccgt caaacacacc gccttgcttg atatcaccgg ctattactga atagactggt    133680
     agaggtccgt tatttcttat tgctggactc ttctgtggct agttagctct tttactagcg    133740
     attatgattg agccatgaga ctcattcgcc acgaaaataa aaggcacaca tatcgagtat    133800
     accatgtcag cttctctcta gagcacgtag acgcatagac agtatcaagc gtacctcgta    133860
     agccaatttt ctaacatcgt aaagaatacc tagttaacca actacctgac aagccgagtg    133920
     accaattgcc aggactactc aaattcctac tccaacatca tctacatact tacatgagca    133980
     acaacaaagc aaacaatctc cttcgttccc aacatccagc acacaagatg taatgtaatc    134040
     atcaatcaat gctacccaac gagaccaagt attcttccgc ccttacggcc cataccataa    134100
     ctagtactct caaagaccaa accaacaact cacccataca taatgacaga caagttatca    134160
     ggcaccagac ccccaccccc tctttctctt ttccttcccc aagcatgcac acacaacaca    134220
     tactttctcc caacaatcca atcgtctccc aatgaacccc tactgagtac tcataattat    134280
     tatctattac acataatatt caattttacc cctccttctc ctcccaccat ccccactact    134340
     agtacttagt tccggtgtgg ctgaccgacc aataatcagc tagctataac aaacccgtca    134400
     ttttttattt ctattctctg ttgactgaaa tagtctaata tagacagttc acttcatcta    134460
     atcctcgatg gtctaacggt catgatttcc gcttgtcaat cccatctcgg gaacaagcgc    134520
     gggagacctg ggttcgactc ccagtcgggg agatttcttt ttgctttttt attattgtct    134580
     gttgtcattt attcttttgg ggggatggta tttgtaggat gatggtgctt tctttatttt    134640
     gggggtttct tgtacggtgg tatgttggag gttaattgat aagtttgttt gatttaaaag    134700
     ggtgttcgat gttatgctga gcgtggttgt tgtcggtttt ccgatgaatg agtatcggaa    134760
     agtaagacag gtggtgggtt gatgatgatt taaaaaggat ttttattagg gatttcttag    134820
     tttctcttgt tctattgtat gattattaaa ttcataggat agtagagact ggctatatgt    134880
     acatgactga aatgacgcca gagctggttg cttcacttcg ctagtatgta gatgtcaacg    134940
     agaagaagat aaagagaatg aggcatttgt ctggcttgct gagattgagg acaatgcgat    135000
     acaatatggt catttgacgg gcgtgaaatc gtgaagtgat gtatgcatat ctgtgatgct    135060
     tgctagtcca tagtctggcc ttctggtaaa tcccttatga catggtggac tgccgtggga    135120
     tagctctgtt tatttgcaac ccgatatatt taaaggccac gtggaggcct gctctctttt    135180
     ctgggagcac acatggagcg cacgtatatt tgagaggggg cggagctaac acccttcctc    135240
     gcggtttggc gcataccctc atctgggtga gagcccggcg tatggctcag ggcagtgttt    135300
     gagagtaaga tagtccaatc tcaatgctca tcccgtggcc attgaactcc gggtcactga    135360
     gctccgagta atggctgtat ctggccgcaa gcgaacacca ggtgagtaac aaagattata    135420
     gagttcatcc acataactgc tggtagccaa atcaccggct acaacggtgg cgtgcgaagc    135480
     atgtttggca gagtccagtg atcgcgtaga tagcttggcg acatccacct tgacctcctt    135540
     gcggaccata atatcgccaa gctgtgagag ctccgtcaac gtttcctggg agagatcgcc    135600
     atggggggaa tccgcatgct tgcgcggcca aagtttcaga acagaacgga tggaaggtgt    135660
     gatatcggct tccgtggcgg agctgctgcg tgcgtttgaa tagtacagtt ccctgcccag    135720
     ctccttcgca aatccatcac ttccgatgtt tgcgtcgttc agttgttgct gtgcgcggaa    135780
     gaggcgtagg ggcatgaagg tgaagtccgg gttcgagact tgagtatcca gatttccaac    135840
     agcgcagaat ggcagtagga tagagtttga tgcatcagaa tcagagaaca tccggcaagg    135900
     ggcaatgaga ggtctggctg agaatttcga ggccatgttg atatcgggag gaagtgcgct    135960
     ttcaagcgat gtcatcgcat ggatcagttg ctcgcggaag tcatcgatct ctttgttcga    136020
     ctgggctgct tcagatttca gccaagacaa gcaggtcgat atggtccatc cttccatgtg    136080
     tgaaatcaga tcgaggtgct gaatgttaat tcgtttaatc ggtaatgttg atgaaggcaa    136140
     tgggttaccg gtccccttcg ctgttagtac ctcaaagtgg tcggaaatgg tagggcgcat    136200
     aacaaatgaa acgaggtgga cgcccggctc gtaattgcgg cctccagtcg cgtaatctcg    136260
     catgtctttt agatgctcgc ccaacacagg caatggaatg tgcattcggc tggacaaaac    136320
     cgatgtgaca ttttcgaccg cagtgaaacg gaaacctgcg gcggccagtc gattcgcttc    136380
     ctgcttgtcc aaatggcgca ctgtgaaaag catttgtccc ttgctattgt ttaaccgaga    136440
     atatcccatc gcccgagaga agcgcgatgt cggagcagtc gtaaccagta catcgtcgta    136500
     tagctttccg agggccggca gaggctgtcg aacctcgtcg gcgaggtcct gagcggtaac    136560
     gcaaaaatgt cgcttgaaga gttcgtcgaa atcgttctgc aattcattct cctgatccag    136620
     ggcctcaccc ttggcaagaa agtgctccgt cgcctctttg tctgtctcga tccgacttct    136680
     cataaaaggg acaacatcct tgaccagatt ccagtgtcta ctcgctcgga atgcccaaag    136740
     gaaagcggga tggctccggg taaggtcgtc atcgttgaac gtctatatag ttgggggaag    136800
     attctgcatc agcacagttc gggaatgaat tagattgcaa acataccctg ccaacataac    136860
     gatcgacaat cttccggcta ggaagcaacg cgtgaggagt gaccatgatc cgcccagact    136920
     ggtcaaagaa ggcacaagtc aagacgagct gtcgagcttg tatgttcagt cttctccgat    136980
     ttccaccagc aactacggca cacgccgtca aaactccgca agcagcgcat gcctaacatc    137040
     cgttaacatc cgccacatca ggtaaccctg gacttcaaac ataccaaaac agaactgata    137100
     atgacaactt ggctccgcga aagctgacca ttatgcttca tggttgtgtc atgattgtag    137160
     tagtatgtgc caactgcagc agtccaatgc atgccggaga cagcaagggc aagtacacaa    137220
     ccgcaaatac cgcgtcgcca ccaactatct gtccatgtag ccctccaccg aaagaagacc    137280
     gtcaacgcaa cagtactagc aaacaccgcg atgatggtgg caccgacgat gtttgcaaca    137340
     cggtagctac agcgatagtt gctgataccg agctgaccga tataatgcat accgcatact    137400
     gcacctcctg tgagtacacc acccgtcagg attcggatat aaccggcttt ctcgctggct    137460
     cctatgctgt agaaggcaac aagcagaacg acaaccggga gcacaaagga tacgcccgta    137520
     aacgtcatgc tataaatgat ctgaaattgt gcttccccgt ttcccaggac aatggcacgg    137580
     tttccaatgt aatgcatgca ccaaataccg acaccgccca ttgttatgga ggaagtgagc    137640
     aatagatacc tatatgtacg gttagacagg cgcttgttgt tatcatgcag tgaagatatc    137700
     gtaccagttg tacaggccag acctcgacgt ccgtcggtgc agaagctcca gagtggtggt    137760
     acatcccatc acactgacta cgtaagccag gaagatgaaa ccacccatgt aagacacatt    137820
     gacatggtcc ccgtggggag ccctgtccgt gagcaacatt ctcggcgtga gaagcttgtt    137880
     agaaccaaat attacccgca agacattggc atggagaaga tgatgaaaga tccctcactg    137940
     catttgcgag catacaacac tggggaggtt acacaacagc agcaacgggg cgatgcatga    138000
     gggaaggcaa aggcagagta agcctaacag gggcaggcct aactagcaac atgcgggaat    138060
     tctttttaat ataacaatgg cattcagctt ccaggagctc cacgcggctg ggccgtacta    138120
     cgtattagcc atggttctcc aggtaccaga ttgacggacc gtaatgcaat caaggacatt    138180
     aatttatcga gcagactaaa gtgtgttatg tccgagtggg aaccacttat tgcttgcgga    138240
     ggccacagag acccttcaaa tttttacgtt ggctgtacgc gtccaattaa tatgcgaggg    138300
     ccccagaatg agggtctggc gctcttccag cgttcacatt gggcaatgta aactaaaatg    138360
     tcagtttcct tccaaggcga atcaaagtgt gatctgtgtc tgattggatc agaaccatcg    138420
     atcgaggttg caatcaggaa ccatggggca ttgagtttac cgggtcggtt ccagacttgc    138480
     agccatgctc ggcgagtcag aaacatgatt gaagggccga aggctatgat cagattagtc    138540
     caggaaacta aaattcttcc cctctgccaa agtcggttat tacttgtcga ccagatgggt    138600
     ctacgtttat ggctctcggc ggataaggac cgctaaagcc aaccctgtcg gacgagggcc    138660
     aagaaggttc agctgcgccg tctggctgaa ccttcgctct tctccgaaga taaaccagtt    138720
     ttgcactata gggtgagcca tgcaggacaa tttcatagct gggaaaggcc tatcggggaa    138780
     actgaaagat gattacgtat cttaatgtcg agcgtgtaga cttcccctaa tggcgagaag    138840
     cccgtcagca catcgttcgc aactccatcg gttaaatcat cctctagcca ctaatacgtc    138900
     acgagtcctc aacttaggta gcaactatcc agaggggccg tattgtagcg tcagcagatg    138960
     aaactcaagg cggaaccaga caatcagaac cgagcaccat gactgatggt acactctgaa    139020
     tcgagatttt cgacgggatg gaaaagggca gattcgccaa ttgccagcac ccacgcggtt    139080
     gacaaggacc ctgagtggtc agtggacgca gtggcgggct tagctcgggg cacgtccatt    139140
     gggaatcatg cgattcacag gcacgggtaa gacacaatca atctctagca gtggaactga    139200
     gaaggcgagc tggaacccga cggatgggac cagatggaga ccaccggtag cacgtttgaa    139260
     accagagtct tgcaccgttg gatgagctga acgtggccga gtgggaagta agagaggggg    139320
     aaagatccag gcggagctcg gagatgcact cccgttggac catcacgcgt gcactaggcc    139380
     acttcggggt taggcagcag ccccgtgact cagatcgtgg gttccttttc tcgattggct    139440
     aatcctgatc tggctagctg gccgagcatg aactccgcta gtccctttgt ggtcgccacc    139500
     cacacaacac tgagatcctc ttccagtgaa atctgtaagc gatggcatct tctctggcag    139560
     tcagtcaata tgtgctagcc gggctggcca ggaaattgga aagagtaagg ttttagacaa    139620
     ggatgtactt cctcctttgc tagtcagaaa ccttggtagg atattataaa gttaaacgga    139680
     cggagtaccc aaccatttca agtcaacagc gatgctacta tctagtagtt tcagtccagg    139740
     ttgaactcta atagagtcag tagaagtagt caaataacat caggtacttt tgccctcgtg    139800
     gaaatacaac aaaataagat gggatccgaa ctatgagcgt cgtgtcccgt cagcagcagc    139860
     agcagtagta gtagcacgag aacgcgacaa ccaattaatt attcgccaaa tccttccggt    139920
     taacccctgc cggatattcc tcctactaac cttactgcgt aagtcagaac tcaatgatca    139980
     actcgctcct tgtgttgact atctctatat caaagatgat gagtttctgt cctttgggaa    140040
     aaatccactg caaatttttg ttataactga gccagaaacc aaaggcccac taagtctgat    140100
     tttcacggaa gtagaatatc ctcccgagca atccgtgaaa aaataaaaga gagaaccaaa    140160
     caaccaagtg attgataacc atggaaggga atgtttccaa ttccataacc attccataga    140220
     aacagcgctg acccgctgta agcacatcaa cacacagtag cacaagcatg agcctgcagg    140280
     ctgcagcagc cagattaatg aatttgtcac cctttccgag ttgtgctgac agcactggcg    140340
     ctgccgccca actgatcgga tccttcattc ctccatcgca tatgtagatt actattgaag    140400
     tatctaggaa gatcctccat ccttctacag cccccaagaa taatagtaat tggtatgcag    140460
     agacagcccc agaccaggcc taacctagca gaccacatac atcctgattc ctccccgatc    140520
     aacacgctcc gatcatacaa tccagcttat tccgggatac ctcggcctca ctcctatacg    140580
     atccagccga gcagcaattg ggctaggcag gtccatgact agattaattc atatgacagc    140640
     caatatcacc caattaattt agtgggcacg tgcctcactg aaggattttt tctattgcat    140700
     aatagggtat agcctcggca cgcattccgc aacctcaggg gataagcaat aggagaagtg    140760
     aaacaagaag gcacagtagc acaacagtac agcactgcat aacatagcac ggagcagtga    140820
     aggtgcattc atcaaaaagt ggctgtgcgc acagtgcatg tgtagctgaa tgatggagcc    140880
     atgagccgtg ttgtggtggt cctctggccc actcctctgg gaatcctttg gtgtgccgaa    140940
     agatgtccgt actcggacgg ggctaatgcg gcagtaaatc ttgataaggt agatgaagta    141000
     gcaatccatg aaattttttg attaggggtg attttgatag ggaaagagta gtttggatga    141060
     taatattttc tgtgtagatg cgagaatctg agtatactca gtagaccacg gccacttgtg    141120
     gcatctgcac gtgttgtgat gcgtctagcc ggtaccttgc atgaaaactc cgctttgaca    141180
     atttacaatc ctggataagc ttctgatgta tctcaaacca tccctataat atagtattct    141240
     gtgatatgtg gtaacccccg tcgatattaa tattgtatcc ggatcaagac tcgaccaagt    141300
     ggctggaaga cctgcgactg actcgacgac ccagttttgt tcagaccgct tatttggcta    141360
     tgattaatcg gcgaggccaa tttcgaggta cacagtagtt aattatctta tctattcatt    141420
     ctggttgttt atccagtgca cagtacctat tggggggtag gctcctacac tatgcttgtt    141480
     ggtcaattgc caaatcatca cagcaactac tcaatttcta tctccatcta tatatagtca    141540
     tcatgggggc cactcattag ccagaaataa tggcggatat atagagctgg gggccaataa    141600
     tccaattgat tgctcttttt aggcaacaat aaaatactag tgttaaagaa ctgagtttca    141660
     atcttttgga ccaaggacaa tgtatcacct tacctacaga atgttatgaa tccctatccc    141720
     ataagctcat gctctataag gtaatgtgcg tagaagcact taaaagcata cgtgtcgaca    141780
     ctaagctact ctcctctccc ttcgatatga ttcctcctct tacgatcaat tgagagatga    141840
     atgcctgaga aaagagcatc tgatatatac gataatgaca atctattctc tatttccgga    141900
     cgattgatat attgctcata tttggggcca taactattag acaatgcgtg ttatttactt    141960
     atcataagag ggtacataaa agctttacca tccatactct gcttgaccag tattcgtaca    142020
     atcatcggga tctatttgca gccaccttcc taaatactcc cattctattg caatcacacg    142080
     tttattactc aattcgacca ttttcgttac atgcttttaa catgatagtc aagctgctac    142140
     ttactgtatg agcagccagg aacagcaaca tggaagacct taacgactat cttttccacc    142200
     agtgggtccc ggaggtttgt gagaagttgg ccaggcaaag taatagcagc tgcataactt    142260
     gagggagtat tcgaacctct gttcataccc gtgacagagg tcaagaagac gtatgatgtt    142320
     gtatgattag tctgaattcc cccccccccc cctccccaaa aagttagagt atggaaaatc    142380
     agattattag cacagaatct aaacgttcta agcaagtcgc agcttgtcaa ctggaccgaa    142440
     ctcaccattt ggacaagtgg gtattctctg tatataagtc ccactaggta cctattcaat    142500
     caaactggct attatctagt tatcggagta gtatataagc aggattaact agaaagccct    142560
     gctatattca cttcatatta catttctagt actatctatc tggagaaagc gaagcctaat    142620
     ctcaaccagg tacattgtga agctgtctac aattctgatc tgtctgggta atacttctgt    142680
     cgtatctccc cgtactagat acaatggtgt ccgcgaactt gaatattatt attatgattc    142740
     caagatcatt gggggggggg agaagccggg gttgctcagg atgagaatcc ggcttgtttt    142800
     ggaattaaac aggaaacagc taagctgaaa tatgggatgg tgtatatgca gggaaaatga    142860
     tatctaatca aattacatgc ggcatagctc ctctagtgaa ttgagattcg tagttatgtt    142920
     gttgtttgtt tacaccgaac gtatcaggat atttgagttc gttgtggata gtataccaac    142980
     ttgtttgcat cgaattgaaa gaccaaatta agtgcggtca cgttgtacta ctactacact    143040
     tgaagacggt agtttgctgt cttgcatttt ttattctatc ggcatcaaga tggtattata    143100
     ctataggtcg aacctaggaa agaccagcat atggggaata ctgttgagaa tgattgatga    143160
     ttcttctcga ccagagcaat gcagtagcat ttgtatgcct tggagatgct gtccctttaa    143220
     gcgcgttgct agtacttgct gcatgacgct tgtggtggtt atttaccata tattcattgg    143280
     gtgatgtacg acagactgga tatgtctgaa tccggctaag attgtgtcat ttatgctgct    143340
     tcaacaatac atagtataag tagcaagata cagggattta agtcgtcgat ttgctcttgt    143400
     ttgctgcgat gtctgatcag agtgtaaagt gacaagcaag cctgatgtca tcttacatta    143460
     gcgtatgata tggttcgata gagatagata tgcaggttac ctgcatacta gttgaggttt    143520
     tgattgaatc gctactatag cccaggaata cgaccataac tacatctaaa attgacaggt    143580
     accaccatca attctatata gatagtctag acaaggtgtg cggggtaaga agcccatcaa    143640
     ttagatttca tttgtaacta gcataaccat caaggtatcc ccttattatc atctatcaac    143700
     ggggaattta tgcaagcaga gcctggatct tctgctccag acccttgggg ttggcaccgg    143760
     tgaggtcgtc gaacttcttg ccgtccttga agagcaggaa agtgggcatg gcacggatac    143820
     cgagctcggc agcaacctcg gacagttcgt cgacgtcgat cttgtagaac ttggcgttgg    143880
     ggtaggtgtt gctgaactcc tcgaccttgg gggagatagc cttgcaagga ccgcaccagg    143940
     tagcgaagca gtcaaggacg atggcgtcgg tggagttggt aaccttctcg gcgaactcgg    144000
     ccttactgca aagacagtaa aattagtagt ggtctcagaa tggatagagg ggtagagtgc    144060
     ggggagagag aggggcgggg atgtctgctg gtaagacgat gagcttcggg ggagaaaggg    144120
     aaggaattgc acatacgagg tgatgtcgtg aaccttgtga gacatggtgg aggatgtgtg    144180
     agagaaagcg cgacggctgt ggatgaacgg agttggacgg aggaaagagg gcgctactgc    144240
     ggttctagtg gaagactgga gagagaatct agcggaggag gaggaagaga agaggcgtcg    144300
     ggaggccaga gtggatggtt taaaactatg ggaaggttga gacgacgatt agctccgaat    144360
     gaggggcagc ccagcaacgg aggggcacaa atcgaatttg tagtttgagt gacgttgcac    144420
     cgccctctga ctaatcaccc cggggcgtcg aagcctctcg gtcacagtcg aaggcaaggg    144480
     tcgcttctgg gcagtatggg cttaccaagt ggcgcctcgt gagagacgaa gacgggtttg    144540
     atttgtcagg ctaacagcag acattctggc tgcaattgaa tagtataatc aacagtaagg    144600
     tatattacgg gccggttggg caacttggtt ggtggaaggg aaaggggaag gagatgcacg    144660
     aaacggtgaa ggaagaaacc cccaaggcaa aatgacgtgc tcccgtcgct tatgaatcgc    144720
     gaccggtctg gacaggcgcg ctcggcctga ggcagcagca gcagcagcag ccgccgccgc    144780
     cctcggcgag tctctccgat cacctgactc aagagcggaa gaagatggca gtataattca    144840
     cgggtgtatt tggggagagg gttcagggag tcattcgtat caagttggct ggtttattgt    144900
     ctggggggta tggaaagatc catctagtga tatttacagg cagtaggtaa gcggtccagg    144960
     atgtcatcca tctctcgaaa gataacaggc cgcgatactc gagcatatag tacagtcaag    145020
     acattaaaca atagcacggg tggtaatcgt aataaggaaa cgtgaacagg tagattgtgt    145080
     cacaatatgt gcattgaact gaagaacgag aatgcttcga gtctatcaaa aacgcgtaag    145140
     tgcctgcgat cactacaagg cagtgatcgg ggccaaactc attcaaactt ccgctgatgt    145200
     gggggtatca acaaattcga aaagtaacaa tgcccaccaa caagaccaga gcacggacac    145260
     aaccagtgct tgacccgatg agagcgttga aggaatataa gcatggctac atccagcgcc    145320
     atgaaccctg aggaaatccg ccggggaagt atgaggggaa ggggaggggg gtttctggaa    145380
     ggaaaaggag cgacatagga aaggtctaaa cgagcgactg gggtatatac gggaaataat    145440
     caaataaaat gcatcgtgct gacatcagaa gaatctcgac acgggcaatt attccacgta    145500
     gtagcaaggg cgtcactagg atctacctct ggtgatcgaa gcaacgttgc gcacaggatg    145560
     gtccgttggc gacctggttc aattcgagcg cccattcccg tggttatcag acgtttcgag    145620
     ctcaaactca gcagagtgct cttcaatggg actgaattct tcttcggcac agaaggactg    145680
     gacattcttc aagagtcctt cgttggactt cggacggatt gctggagtca caagtacagg    145740
     tcgccgggca atttgatcat gccaggtctc ctctgcttgc tccggtacgc tatccatagg    145800
     cgagtccttg tcaggcgacg caccagctac atcagggccg gatttgagac cctcatcctg    145860
     attggtccca aatctgacaa gaggttcgct aaccggaacg tcatctccat tggaggaccc    145920
     ctcatggccc tcttccatga tgtttcgcga tgagctaagg ctggtgcgca gtggattgct    145980
     cgccttcttc tgagatatgc gacgtaagaa ttgtcccgac atccatgatc cttcggagtc    146040
     aatcgatgct agagattggg acaaaggaag attgtccggg tcaccttccc agctgtcgcc    146100
     tgtccaagaa tggtgaggat ttctcgggat gtcctggggt tctgacccag aactggggat    146160
     gggatactgg gtccccatgt tgatatctga catctcatct tctctctcga actcatccaa    146220
     cacctctggg atatcaggtg attgaagcct agagtccggt ggagaaaggg gctcgtcacc    146280
     gaagtgttcg gtaaacttgg actgcgaccg cttgatggta cctgacccca ggaatgtccg    146340
     aggagcagtg acgaatgagg gaggtgggcc agacgactgc gtctggacct tgaagaaaga    146400
     ttcatgagac gggttcgagt gctcaggact gcgttcatgg aaacgttcac gatagctgcg    146460
     tttgaggcgc gagctaccac gtcggaaaat agaagtaagc gtattaacac gtccgctgcc    146520
     atggtcagac aagcgccggt ctgagtctat ggttcgcgaa atatcggatg tggattctcg    146580
     gcctatgcca tagagttgcg aagaagttgg gctatacagc tcacgcctcg acggcgaatg    146640
     agacaaactg ctgccagaca ttcccatgtc ttgcgacgga gcgaagctac gacgcatcac    146700
     aagcttcggt tcccgaatgg agctatcgtc gatgttacca atgacatgca cactatcaac    146760
     ggactcgcgg ccacgtcgat ctgtgtcttt ggaagcacct ctcagccaag atccagaaga    146820
     attaccgccc aggaaggcat tggtttcgtt tgtccgagga gcatattctt ttgaccgatc    146880
     agatacagcc cggctctccg cgccaggccg accacgtgga gctaaagatg tgtcttcagc    146940
     ctcgctggat ggttcttggg gaacagcatc ggcttcggct tctgcttctg cttgccgctg    147000
     ttgttccgca gcgcgttgta acttccggtg aagtcttgct tgatcttcaa gttgcttgcg    147060
     ctccctacgc cggcggtccc tttcaagcaa ttccctgagg gcaccggcat ctaagtcgtc    147120
     ggctagcttg tctactctct tcttagaacg cgagtgctcg ttgtgcgtgg cataagccgg    147180
     tgtcttatcc ttccgaattg aaggctcaga cggcctttga ctcttagctg tcgacacccg    147240
     aggagcttcc acatagcgta tgaccggacg aggcgtccat gcagcaaaag tgttgacctt    147300
     gaacgtatag gattcgaaaa tatccgagag tgaggatgca gcagagtcac gcatcgaaag    147360
     actggtgtca gaacagtgcc gatcggagcg tcgactctgg gctccattag ccctgcgtgt    147420
     ctcaatggaa aactgctccc cgggtagcgg agagggacga cgaggaatat cgatcggagc    147480
     agaagccaac atccgtattt cccgttctct ggcaatctcg tacgccttgc gcttactcag    147540
     cttcttcttt aacactgccg ggccattctc gttacgcttg gatttcagca acgatgcaga    147600
     gcgagacaaa gaaggttgtt cgtggctcat ggtggagtaa gttgtgtagg catcggaatg    147660
     ctggcctgct cgggagaccg ggacccggtt ttctttcatc ggggtcggtt gctcactgtg    147720
     tgacgtaggt ggagggtact ggacgacagg agaagacgtc ggatgagagg catcgtgcaa    147780
     aaagctcggg acgacttcga cgggctgggc gtgtctgttc ttctgacgtt tggagtgctt    147840
     gcgggacagt ctgccgagct tgccgtcatc gaagctgtgg cgaggctctt gtgacgactg    147900
     gacatccgcc acggcaggtg catccagttg gatcgtatgc cgcttgttct tacgaccaaa    147960
     cggccatatc gccatggcgc ctggttgatg atacctcgtc ccgcctgatc agtcaaacgt    148020
     ggacactgaa actatcggag atgacgttga accgggtgac tggactcatc aggaaggacc    148080
     ggggaaggat tagacacgcg accagcaggc gaatctagag taaataacaa ggcacgggta    148140
     acagcctgaa ataaacaaag caccagacag acagggtgac tgaagaaagg aagagaagga    148200
     ggaacaatcc aaggtggtct gtctagagac ggaggcgaac cgagacatgc aaagcggtgg    148260
     gaaggactag ggtgcagcgg agcgtgtggg ttgttgtaag tagtagtgtg tgtgtgtgtg    148320
     tgtgtaggca gtggaagtag taagttcaag gatgatccag gcgctggtaa ttggctaccg    148380
     gagtagtgta ggtacgggac cggggggaag atcagaaggg gtcgtagcag gtgactattg    148440
     gtttagaacg aacgggtaat cgtagcagga aaggtagtag tgggaatcgg tttagtagca    148500
     atagtgagac cgggagccac gccacatggg gtggcggaaa aacagagata cagagggggg    148560
     caatctcgtt ttttcgggtc acaaacaaaa caaggagtag aaaggagaag agaaacagaa    148620
     aggagtggaa aagaggggac agggggaggg aggggaaaga agaaaagcga gagaggggaa    148680
     cccgatgaga tgagaaagcg aggaagatga agaaaggagg aagagaggga ggagaggaga    148740
     aagggagaca agacgacgaa gatgtagaaa gcgagagatg gatggtaagt aacgagcgag    148800
     acgagacgag cagaaaggta agcaagcaag taccaggtga tgagcccaac gaggaccgac    148860
     aacctgccta tctggcagcg gtttttccta cttgacagcc agaagagaag caaagcaaag    148920
     caaagctatt ctgcctacct cctagtttac cgactagtac caacttacta ttactttact    148980
     tactcactta cttactcact tactcactag tagacaaaac ggtcaaaagt cgagagcgag    149040
     ggactgagag ggccgagaca caaacaaacc cgcccgtttc tgaaccaggg gatctcgtcg    149100
     gttggttagt ggttacacac cgtcgaccct ccccggggcc ggccgtcaca gcagaaccac    149160
     ttggaaccag tccaaatcca ccaccgggac gcttgatttt ttccgttata ttttctgatt    149220
     attttattat tattgttatt ttattattaa cagaaggaga ttagttcgtt acgaacttac    149280
     ttactactta catacttact ccatacatac agctctctct ctctctcttc tgtctctgtc    149340
     tttttgcgct gctgttcagg tgatggatta tatgcatcaa cccgttcttc taattaacaa    149400
     ccccctccct cccctttctt ttcccttacc caccaagatg ttccttcgtc tctctactgg    149460
     atagaggtcc gtcccatttt agggtgtcta gaaggagaaa tgtccagcac atacctgcag    149520
     atgccgcctc ccaactctcc aacagaaacc cgttttatgt tttctttctt ttttcccctt    149580
     ctgtgtggtt atcatttaat acacatctag tctagttggt tcctattcag gagagagatc    149640
     atgcgggaaa cctgaaagac acaaaaatcg attgtcgaaa aaatttcttc caaatgtgga    149700
     gaaaagacca ctagtggcac ctaaactgcc agattgcagc ccaatccgat tattgttacc    149760
     agaaactagg ggcaacttca ttggtacctg ccttagggag tgcctagcca gtgaatgacc    149820
     catggtatct gccgtactcc acactccata cttagaaacc gaactaaacc acagcagcta    149880
     gtaatttatc cggatattgt tactgcacga cgcagcccac tttacagcac actcggtatg    149940
     tgcgagctcg gtcagtacca cctcaaaaca aggcgccaat caatacagcc tcagctcctc    150000
     ccggggaggg ggggcgcctt cggggcagga ggcaaggcgt tttctccctt gaagatcata    150060
     ttatctccta gaacatactt aggcagatac tgttattctt tcgagatcat tcttacttaa    150120
     cttcacgaga tctgctaatt aggacaaaat ttatcgccca tgatgtcatg ctaaagctta    150180
     ctcttccgac gactctcaca tacgagatcc atgcagcctg atcggaattg agtttatcgt    150240
     gataagagag aggaagcttt tgagaatgtg ttaggcagct gctccttagc cttttcggcc    150300
     gatgccaagg aaggctcctc tggttactat cgagggcgcg cgcctatgac atatatattc    150360
     agtgagctcg acatgacctg tatctagaag taatcacaac cgcggaaagt accgtgcaag    150420
     acctttccaa acctacctac atgagccgga tgcacgctca atacccccgc tcatcttacc    150480
     gacggcaata accgctcctc attcacaaag taccctggaa tactgagagc atgcatgatt    150540
     actcctcatg cctacatggt ggcttcgcag tatctaagcg atcgcacttc caaattacag    150600
     taagcacgat gaaagatttt caagtcccgc gcccgggcct tagctaagca gttgggcccc    150660
     atcctcgcga catgaggaat gcttagaggg gcgaaatgac ggtccaacgg gcttcttggg    150720
     gtggggagtc accgtcccca ggagccataa ccgcgatacg aaaatcttag cttggcttca    150780
     gccgagtgtg ttagagccga tgataatttt accagtcgat acgatcagag atccagacca    150840
     gcagagagag atacagtgta cttagttagg tgagtgggtt gtgttcgatg ctactctggc    150900
     agctagggat cggtacatga ccatcggtat ccaataggta tcactgctgg ttgatcgtat    150960
     ggagtaagcc tagtactcag caatgtctta ctcacctgct acaaagtact aaactacctc    151020
     catcggtctg gaattggcta acttttcacc attttgcgct cctccatcac ctgaaaacca    151080
     ctctcacaca atttacttag tcaggtaccg cccacatctt acaggggtgt atggactatg    151140
     gagcaccacg atgggagttc atgtttaact tcccgctccc agcccatcca atttccgctg    151200
     gccacaagct aataaattga caattttgac agccattgac aggtcgagta tgcattggcc    151260
     aaagcgtgca gcacccatca caataacgta aaccgtaacg gtcgaatacc cattgtcagt    151320
     tagggagctg ctgctcgcaa ttacagtggg gccatttttt tccgactaaa gaaccttagg    151380
     gtccaaaggt tgaacaccac aaaacttcag tcagtgcgat gtccgtcgat cactgtggtt    151440
     ttgatccggt catatattcg aaatgggcaa gtccgcaggc ctggacagaa tcgaactgcg    151500
     tcagtggctc actctagtca gctgcgatga gcggctcgac tgtcctgggt ttgagtgacc    151560
     tgagtcatcc accacgccaa accccggcaa cggaaataat ctcctcttgt ttactttggt    151620
     ccttgcagat tacttactcg gccccgactc tccctacaaa ccaactagga acaagcgagt    151680
     tagtgtctag cccactcgag tcttcaatca ttagttcgta ctcgaccgga aatgccgaag    151740
     tcaggcccat gcgagcccac ttacgcgcgt gctgcattgg attaggaaga gcgcagaaca    151800
     gtcgcgcaat tctactattg acctagatac tattcaatta ctacacaatg ttgctggcat    151860
     cctatcaagt taccctattc gggtaaacat taacgatctc tctcatcgtt acctatctcg    151920
     tgctggttag agcctgcgat tgtcatgaca tctgctagcc cggtgcatca tcagactact    151980
     acaaagtagt caccgatgcg ctcatactag tctcaaggtt gtcatttcgt ccactcgtat    152040
     cttcgtccgt tgagttcggc ccatcagccc ctcgcgatga tacacattgg ttttaagggt    152100
     catccagcgc aaatcagtgg accagtgttc ctgattactt agagacccgg ctagatctct    152160
     gtctcacgag aggcacgaga tggaagaagg agtgagacat tccgtctgac taacatccgc    152220
     tggaaagaga ttgggcgtgc acaagtggcg gctagctttt cctgccttgc atgtacggag    152280
     gcgagagcag gtggccgtcg gcccttgtta atggggtttt actcggagac ttcagcgtgg    152340
     cttaactctg tacagcattc ggctaggcag ggaaaggtag ccaacactcc cggtaccatg    152400
     gttttagagc agctctaatc aaacgcacag gacgcccaga gttttcttgg tactagtagt    152460
     ctgttttgtc tagtccggcg tccccctcgt tctagataga taactagtca tgcgctccgc    152520
     tgcctatgca tgtcatgctc catcggccat atggagcatc cagatgtggg ttttcgtaat    152580
     tatcattcag tcactagtaa attatcaccg aacactctcg gtataaacgc tcttattgat    152640
     aggcggatta atttcccttc taggaggggg tgtgggtctc cctaacatta agaagccgtt    152700
     gtgtatccaa ccaattctgg tacctgactc cccaacttat taggatagcc gggtgcgtta    152760
     ccctgcccat tttgtgttac atgctggact accgaataaa tattttgcag tgtcgccgaa    152820
     gtgtcatagg caacggagta tatatcatga ttgtgtatgg ctgagaagat accgtgcagc    152880
     aactaatgca ctgcaatata aatgtccatt ccaatccgca agtacatgca gtgtagaatc    152940
     agcactgcat tcaatacgtc catgcactct gcactccata cagaagagta gtactagtac    153000
     ttcaaccttg cgtcgcaaat tcttttaccc tcttttctca agtactataa acatcctgca    153060
     tgggtttcta atcaattgcc ctggcgacag ccaatataca actcaacacg ccggtgtagt    153120
     agccttctac tgccgggaaa attctgccca atatcgcatc atgttagttc acactatatg    153180
     atgtctaact agtctacaca tcccataata gtgcatgtcc tagttcctta ctataatacc    153240
     caacatctga gcttgtgatg accgcgaaca gacctttgtc aactgcatca tgctgtcgaa    153300
     tcaatgtcta tatatagtat cgaaatcatg atataacaca gctttgcagc atcaaccaac    153360
     cctttatcct tcatatgaaa aactatacaa ccactcatcc cgacatatgc atcatcggaa    153420
     taccacggaa agataccaat ttgacaacag agtcatgacc aaaaccatgg acgaccgcac    153480
     cacaccccca ggaaaaatcc agccatttca atacctagac caccagcacg aggcgcccac    153540
     accataaatc caacaaccag acgcagctac aatttaagat gcgcatcgcc aatgtcgacc    153600
     aaatcacaga cccgatatga catgtccaac tgtcaaggca accagacatt ttcatctaca    153660
     tacatacaca cacatacatg ctataacgtc caagcatcaa atccaaagtc aactgccagc    153720
     aatccagcca gtccagtcta tttccaacag acgttgaaag aaagacggaa aaaatcttgt    153780
     tttggtaccc ttggcatgga gctaacgtga agcccgggag ctgttgtaag gcaccacgtc    153840
     ggattgagct ggcaggcagg caggcagaca gagcaccgaa tacttacatt ttctgtgtgc    153900
     gtgtatgcat gcatgcatca gtgctttcta cgaaaactga ccacgaagtt actgttatca    153960
     ttatcatctt ctgatgcttc actttgttgt tcgcatattc actatactca tttactacga    154020
     actacctaca caggcaacta cccgcattac atgtggcatc aataaaaggc atccagatgg    154080
     acgattaact ggatggactc gagctcggtc gacgtcgttc cacactaaag tcaagtccac    154140
     catccgaact acggacaaag tgagacatga aaagaagtct agattcaacc agacccatta    154200
     gtctctaacg gacgtgcgcg ccacgttgtt gttgggaggg actgactcca taatctggtc    154260
     ccatatggcg tgtgccccat gtccgacggc tttcctgtgc ccaatataat tcagtcaata    154320
     tctgtcggga taacaccgga gttcagttca ttagagagat acggttgcga tggggatagt    154380
     accaacgcca agatccgacg tggaaacaga taaaaataaa agaagaggag ccatggatga    154440
     aaatgggcta agcaaaatag aagattggta ataatgggag aaaaaagcca tgcaataaaa    154500
     aaataatatg agctccgagt tcctgaccca ttcgttcatt caattgatcc ttgggacaga    154560
     catgatgatc gtgacattag gtggaaggac accatccact gataagcgta catgatagtc    154620
     caataaaaga aacaaaataa cgtgggagga aattttcctg cgggtgccga tagataccta    154680
     atacccacca accattccgc ggttggtctt cgagcggaat ccgtgggaat aatggtactg    154740
     tgtcgtatct agtggcatgc cccatttcaa catcaacgcc aataagcata ggagggaata    154800
     cgatttgttc tagccttcga agtgaaccat tgcagcatag caatataatt aatatactat    154860
     gaacgccccg aacaagaaca ataacaatgg ttataacggc aaggataatg ataaccagaa    154920
     ccaaatcatg tgcaaagtga taaaataaat agatacattc accccattcc catatcttaa    154980
     tttcatttca tcttatctca ttactgagta aacctctttc tcagccggtt cggctcgcgt    155040
     tccggaacac gatatcgacg actaacatgc cgactgagaa acttctttat ggaccaggac    155100
     tcatcgtggc ttttctccgt agtactagta gtagtctgtt tatcattact actattgtag    155160
     tagccagtta catggccgaa gaaagaccct cgtcgtttgt aaggttcagg attacagaaa    155220
     tccaaatcct cctggtctgc gtggcgtcgg agtgaggttt tcattgactc tgtgctcatt    155280
     tctccctttt ccctcactgt cacgcaggga aagcgtggtt gcaaacggag actaatgaaa    155340
     tggaagtggt ccgtgtcttt tttctaattg acgaacagcc actgacatac acacaccccc    155400
     tgtacgccac tagataaata gatagatgga tagttagatc aaatgggaag aatcaaattt    155460
     cctctttctt tctcttttct gcctggtttt tggtttaggc aataacaacc tggctggctg    155520
     gtggtccgct ggggctggct gcgtgttatg gtgttttcgg ggtcttttgc ggatttagac    155580
     cgagagagca ggcaggtaga caggcaacga agattctgaa ggcggggttg gttggtttgg    155640
     tttggtttgg ttcgttggat ggatgaatga atgagtggtg ggtgatcgat cgattatttg    155700
     caaggtttgt ttgttggggt catgcaggta tggatcttgt gtctcttgta tattgctaat    155760
     ttagacaagg gttgtaaaga acagtttggc gaatccaagg attatatgtt ttggaagggt    155820
     taagctccta acaggcaggt aactagatac gtatcatgta tgaggatgca aagcggcagc    155880
     aaagaggaca tatgtcaatt tacgatcatc agtaatacgg gcgaggagag acaattagtt    155940
     agttggtcaa gctgtcctaa gagagagact atgctaacta ctgaggagtt atgctgggaa    156000
     ctgggaagct ttcactccgc gggcacaggc accatactca ttgtgatcat tccgggtccc    156060
     tcggaggggc tgcgggacaa atagtgaaga ctgaaagagg gactcgatcc atggtttgcc    156120
     gacccggact gagagccagt agtgaagcag catggcggaa gatccagtgt tgggaccggt    156180
     gttccgtgag aaaaaagcac gtgtttgttt tattactatc taccccacta tagatgacag    156240
     gtggtggtgg tttgcgatcg attgtgtttc ttccagaaga gtccgatcat tagcagatgc    156300
     tctcgtttgt tttctgggga agtttgtgat gggatgaccc ccaagcatgc tatgagcatg    156360
     ggggaagcct gaaagattgt aacgattgac tgattgattg catgtcttac agcaggctga    156420
     ttcgtctctt cggacttcct tcgtatccga tggtatcgtt aattgataag cttacaagga    156480
     tccatcggct gacgtggaag agctccagtg aggacggctt gggtgaatgt ttgtccgtta    156540
     gttgctactg ttcactgtct tgagttatac gctcatactg gagcagcaga gatccacggt    156600
     tcagcgaaga cacaaaaata gttgacatgc tatgttccgt aatattattt gcgttgggaa    156660
     cgaaagctgg atgccaggtg ctcgtgtcga tctgttggac tttcggttct gtgggccatg    156720
     acacagatat actatcgggc tcggttggtt gcacctcacc gccaggttca gtactctata    156780
     agcggataaa catatttatg ttcattgttt gattcacacc gccaggtgat gggaagtaga    156840
     cgactcggcc aatcctctac cgatgtattg tctgatgtct ctgctcaata ggatatctgg    156900
     tgctctgaga gcaccctttg tgttgctggt ggtaaaagta tcgggcgcat gagatgaaat    156960
     ttagctactg ttctctaacg tagtagcctt attatatacc ttctatgtcc gcataagtat    157020
     gaccagccta ctagtaggaa gtgatctgat cagactttag cgtgctcatc ctgtattgca    157080
     ttatatacat atcctaccgt gtgattgaca ttttcctcga gtgcctcata tgctggtaag    157140
     tgggacagta gccaaggtta agtaaggtat ataatatgta aaatggctgg gcatattaac    157200
     aacccaagca tgttagctca ggggaagagc gccgggctca taacccggag gtccctggat    157260
     cgaaaccagg acatgctatc caatttcttt tttatatttt ttgtccatcg tcactagtcc    157320
     ccacttttgc tatatttttc ttcttctata taccttcatc tcccgtttac tatcattatt    157380
     caccctccaa ggcattttca acaacccctt agagctacat aaggagtgat aaaaataatt    157440
     tactcgctgt tgtagcttta actatccgtg attaagatca ctgtaccagc acgtgacgag    157500
     ctggccgccc ttgagggatg ccaagccggc caacacgcaa aggacgggcg aggctctcga    157560
     cgactgacca ccgccgcgtt gctgctgctg catccgatca ttactccctg accccgtcgt    157620
     tattatatcc tccatatcac cgacccccgg attgcgcaga ctggtctctt cgcatccgtt    157680
     ctttttctcc gaccctcccc ttcacgtcaa tcctctccct tcttctcacc tccccatccg    157740
     ggggtccttg tggccgccat ggcatcccgt aggtgtcctt gtgttgaacc ctcccccaca    157800
     ttgctatact gctcccatgc ccctgtcccc ggaattcgat cgctaactgt cgccccctct    157860
     cccgcctctt atatacagtc aagcagttta tccggaacgt gcgttcggcc aagacaatcg    157920
     ccgatgaacg agcagtcatc caaaaggaga gtgcggccat ccgtgcgtcg tttagggaag    157980
     agagccatga ttcgggcatc cggttagcat tgacaccgcc aacctctagc aacactcgaa    158040
     ccagcttctc atttatttgc acaggagaaa caatgtggct aagcttctgt atttattcac    158100
     cctcggtgaa cggacacact ttggtcaaat cgaatgtctg aagctactgg cctcccaccg    158160
     tttcgccgac aagcgcctgg gatacttggg gacgatgctg ttactggatg agaaccaaga    158220
     agttttgacg ctggtaacaa actcattgaa gaagtgagtc tgtattcaag gtcggcttag    158280
     ggtctcctag ctaatgtttt gcagtgacct taatcactcc aaccaatata tcgtcggctt    158340
     ggccctgtgc gccctgggca atatcgcctc cgtcgaaatg tctcgagacc ttttccccga    158400
     agtcgaaaac ctaatgtcta ctgcaaatcc ctatattcgg aggaaggcgg cactgtgtgc    158460
     tatgcgtgta tgtcgcaagg ttcccgacct gcaggagcat ttcctggaga aggcaaagac    158520
     tcttctgtca gacaggaacc atggtgttct gctgtgcggt ttaacactcg cgattgacat    158580
     gtgtgaagct gaggaggcgg aagaaggcca ggagggggtg atcgagatgt tccggccgtt    158640
     ggccggtggt cttgtgcgct ccctaaaggg gttgaccacc tcgggatacg ctcccgaaca    158700
     tgatgtctcc ggtatcaccg atcccttcct ccaagtgaag atactgcgcc ttctcagagt    158760
     actaggaaga ggggatgcgg cgaccagcga aatgatcaac gacattctgg cccaggtggc    158820
     cactaacacg gattcgacga agaacgtcgg caacgctatt ctctacgagg ctgtcctgac    158880
     cattctcgac atcgaagctg attcaggatt gagagtgcta ggtgttaaca ttcttggaaa    158940
     gttcctgacc aacaaggaca acaatattcg ttacgttgct ctcaacacgc tgaacaaagt    159000
     tgttgcaatt gagcccaatg ccgtccagcg gcaccgcaac accattctgg agtgtctccg    159060
     tgacccggat atcagtataa gaagacgtgc ccttgatctc agcttcatgt tgatcaatga    159120
     gagtaatgtg cgtgttcttg ttcgagagct gctcgctttc ctggaagttg ccgacaacga    159180
     gttcaagcca gccatgacga ctcaaattgg tatcgctgct gaccgatatg cccccaacaa    159240
     acgctggcac gttgacacta ttctgcgagt actcaagctt gctggtgcct atgttaagga    159300
     gcagatactc tcgtcctttg ttcgcctcat agccaccaca ccagagctgc agacctactc    159360
     ggtgcagaag ctttatctct cattgaaaga agacatctcc caagaaggcc ttacccttgc    159420
     tgctacctgg gtcattggcg agtacggtga taaccttctc caaggtggtc aatatgagga    159480
     agaggagcta gttaaagagg tcaaagagag cgacatcgtt gacctgttca ccaacatcct    159540
     caatagcaca tacgccacgc aaacagtggt ggaatacatc actacggcct ctatgaagct    159600
     taccgtgcgc atgtctgatc cagcacaggt tgagcggctc cgtcgcttcc tcagcagccg    159660
     gactgccgac ctgagtgttg agattcaaca gcgggctgtc gagtacgtca acctgttcgg    159720
     ctatgaccag attcgtcgtg gagttctcga acgcatgccc ccgcctgaga tacgtgaaga    159780
     acaaagagtc ttgggtgcac cgaccaagaa gcgtcaaagc aaaatcctga aagacaaatc    159840
     caagaagcct gccaagcagg ctgagcagga catgctcctg gacctcatgg gcggcgatgc    159900
     tccaccgacc agcccgacta ccaacggttc ccaaaatacg gctgatctct tggccgatat    159960
     cctcggcggc gattccagct tatcgtcacc ttctccccaa cctgcgcaga aggcagcagg    160020
     atccaccaat accagcgcta tcatggactt gttcaacact aatggaagca cgccctctcc    160080
     caaacctgcg gagcctgcat cttcaggctt ggatcttcta gcaggcttga gctcttctgc    160140
     ctcgcccgca cccactcctg cgccgtcggc gactcctgct catacggcct ttaacaagaa    160200
     cgacctctcc cttgcccttc aagtccaacg tggtagcggt ggaagtgcgc agattcaggc    160260
     tcgtttccgc aacaattcaa gctttggccg cttctccaat gttggattgc aagcagccgt    160320
     gcccaagagt cagaaactac agctaagcgc gatcaacaag gctgatctcg atgctggcga    160380
     cgaaggtatc cagatgctca aagttgcagc actaactggg gtaagtcaaa accaaccgcg    160440
     ccttttctaa ttgcctttga ctaatgtcct gcaggccctc ccacctaagc tccgccttcg    160500
     tctccgtatc acgtatgcca aggatggctc tgatcctgta acagaccagg tagactggac    160560
     cgagccgtga acggtaacca gggccttact ttcatgaatc cttatattcg ccttacagta    160620
     acctttcaga ccgcccatct aattttattt tatcaaccca attattgtac taggagggag    160680
     gatggaagca agcaagccaa ccaacccttg ggaggagact accagcggga aaccaacgcc    160740
     tacttgacca ttcatagttc ctcacattac atacatgcat gttcatacat acccggtcca    160800
     tttctagctc tccgttttca gcatttcttc ccttcgctat catgtcttct tcttgccttc    160860
     tatgtaaatg cttggtatgt tgctgaggcc taggagtggc cggttccccc atatgttggg    160920
     gtctaaaatg aaaatgttcc tgtgctcttt accacatttg tctcctactg tagtgataaa    160980
     tgtagctcgc ctgtcatagt caaccagtag aagtagtaag tagcaagtac tacttcagca    161040
     accaccttgc catgctcaac atatcgacga cgtgggctca gtcactccgt cctgttcagt    161100
     catggacacc cactagtagt acgctatagt atatactcta ctactgtaat atgaagacaa    161160
     gccagcacag caggcctgag aacagcacac accactagaa ttaaaccctg aaagccagaa    161220
     gtggaaatga tgaactcaaa acggtactat atatctcgga gttagaagaa atgccatcac    161280
     ggcgttaaaa acaaatgtcc ggtgagccgt ttgtttgcgc ttcagtgatg ccttgcaatc    161340
     cccaaactac catgattgtg actatgactg tacccaaagc cgggtgagac aaaggattag    161400
     aagttccaca cgtcatcgat aataggaatg aggcaaatcg acagggaccg gccatctatc    161460
     acagacagct gcggcctccg atgcactcgt gcctaatgag cagtgccggg gtcaaggaag    161520
     atttcatcag tctgaaatgc gagatgtgag acattaagct tttgtttgat aatgctggtc    161580
     gggaagataa cggttgatgt atatggtaac tagtagtagt gatcgttaat atttctcggt    161640
     gttgaacttt cctttgcttc ttcttcagcg atctctcctt ctatttaccc aggtctggct    161700
     tccaggcggg ttttgcaggg cgcgtatatt gaccaattcg ctcgaagcgc ttatgcatcg    161760
     aagaggatgg tgtggctcgg atgagttggc ctcagtggga caaggcgtct aagctgcagc    161820
     cgaccggatt aaggctgctt gcttcgccca agtttgatcg actctactga tcacattgtc    161880
     caggcacaag gacgcctata gcgtttttta ctggctgctt catgatcgcc tcaggcagta    161940
     gataagtgat tgtgatgtga tacttggcgg tcatggctcc tgagtactgg gctaagatcc    162000
     ttccctcgtt gtaactttta tagttcaaca agcaatgctg gttactgttg ggtatgaatc    162060
     ggcaaattta ttgataacgt aaatgaagta cttggtggat gcctttatcc ttatccccac    162120
     catcttctga gcgttgggct gcagaggttc cacttagcaa tctcgcctga tggcaaccat    162180
     aaagtaggct gttcacctga ggaaagggct tcgcaaggtg gtgtgaacag tagctattac    162240
     ttgtttctgg acggctttta tgcagtcatc ctcgactgct ttgtttgacg tcttgagtcc    162300
     aagatcgaag gattatacat tgatgcctga tatgacacct gctatccggt ccacactcca    162360
     ggcgggattc tacgcctatg catgaccttg gtacatttga ctatgcagtg tcagccaggg    162420
     cttcaacgcc tcttactcca atttgctaag gatttagatt gtagatcgtt ccagaaattg    162480
     cccatagtgc aagcttatgg tatgtcagat cagatagatg caggatacag aacagcgggg    162540
     gccatagcct cgcttctggg ggagtttaca ctgaagacgg atgagctcgg agatagccat    162600
     gtctgaaagt cactatcttt cagacgctct gtagtatatt cgcgacagag tgactcgaga    162660
     agatgtatcc cattgtagat cgcatggtgc atcaccgaca aacttgatga tgacgatgtc    162720
     aggccgacat cacgtgtaat accgtattgt gacccccctc atctcccctc acccgccgtt    162780
     cagtgtctgc acctttccga aaacagacca atacctaagg ataccgcgta aggaaagcgt    162840
     aatagagtcc tgaggccatc agcagcgtcg cgcggttcct cgttctttct gtctctcgct    162900
     ctctctctct cttcctcttc tctttcttcc tcatcattct cttgactgag caagcaagca    162960
     atcaacgctc atcaatcgcg attccattag atccagcatc atcatcagtt tcatccatcg    163020
     agtcctctcc gttggagaaa caccatttat atctagatct ccgttcgatc tcattggtgt    163080
     cgggggactt tctcgcaaca accagtgatc gttgctcgcc ttgccaggga cttctggttc    163140
     gccaattgat tgctgcgcgc atcgcggccg tccccagtaa tacctgccct acgaccattt    163200
     gcctgctctc tactggacgg taagccaata actcaacacg ccccatccat ccccagcgtc    163260
     gtgggccacc ggaatttgat ccaatcgcct ggtcggtcgc tccctcttta attgttggtt    163320
     ttgctgcttt tcccagctgc gcaacgtgcc acactgccag tctgacccac ggttacttcc    163380
     gtgttgcatt acccgcgtca catcccgccc cgactgttcc cagatcttcc gcgctggaaa    163440
     ctgtcaagtg cgcatggctt gctgacgtga ccactcctgc agtcgcgcgc gcgccccctc    163500
     taaactccct ccacacagag ccacaggggc ttgcccaaaa aagagtttcc aggtttctgg    163560
     gtgctgtatc ctcttcactg gctaatcaaa tcagatcctt ccatttagaa gaagaaagaa    163620
     aataaaacaa aaaagagaaa aaagacatac gaaaaagaaa cgcgcaggaa atctcaagaa    163680
     cagacaggca agacagattt aaagtacttt agaaacaata acaaacagaa acgcctgctg    163740
     cgaccacaac cccccctcca ccctcctcgt cgaataatag atcccgccgg tccttgctca    163800
     cgacgctaaa gcaggactat cgcagaagca ttgccaatcc cccacacgcg caactacgcc    163860
     cgtctttccc cgttcaggct gtcgtgaagc gaatcgctgc ccagccagac gcaccctcgt    163920
     tgtccttggc gcggctgtat catagcgcgc gagatcgaga atccaccgcg tgctgcacgc    163980
     agctctgacg tggtttgcca acagagcagt tagagacaag cccccgttct aaatccagta    164040
     tctctgcacg ttctcagaac agctaaaaat catgtcgtcg acctctccct cgaaggaacc    164100
     ggaggtggaa cccgaagttc aatcgggtga agaccaggaa caaatggata aggaacaaca    164160
     agacactcag gcgcagggtc agggagagtt cgaggtgaag gagcaggata gatggctacc    164220
     aattgcaaat ggttagttac gttcccttgc agctttctct ttttctgatt tgcgcgtacc    164280
     ttacgtttat ctgctggtca accgcctctt gccctactat ggtggttcac ccaccccccc    164340
     cttcaaccac cccctagttg ctttatctga tcatatccgc cggctcttct gtataatttt    164400
     ttgtgacttg gattttcatg gctcggatac agcctacctt ggccctttta tcgttcgtct    164460
     tctggttgct cgcacattac ccatcataga agctcgcata ctccccccca atgtctggaa    164520
     gtaaaagacg cctgatcact ttcatctatg cttgcgactc ccgcatttat cacagttgat    164580
     accaaattag gatactaatg ttgcaaatca agtggcccgc atcatgaagc tggctttgcc    164640
     tgaaaatgcc aaaatcgcaa aggaggccaa ggagtgtatg caagagtgtg tgagcgagtt    164700
     tatctcattc atcactagcg aaggttggtg cgaccacacc tgctctacaa gctctttcac    164760
     tgacggagtc tcgcacattt gtccgtagcc tccgagaaat gccagcaaga aaagcgcaag    164820
     accgttaacg gggaggacat tctattcgcc atgacctccc tcggctttga aaactatgca    164880
     gaggccctta agatttacct gtccaagtat cgcgaggtga gacctgtgca acgtccctaa    164940
     tcatgttgcc tctttttcgt aacaggcgac attgagtttc atgacgtatc cggacgctaa    165000
     tgattcctct agacccaatc cgccagaggc gagcaccaga accgtccaac aagcagtgga    165060
     tatggtgctg gcgcgcccgt aggggccccg ggacctgccg gtcctggtgg ccgtccaatg    165120
     gcaccaggtg cagggtttcc tgatgctgct gacagcgcca acaatatcat gaaccaaagc    165180
     ttggacccgt ctgagcagga cacttccgct tatggctacc ccccgatggt cggccagccg    165240
     cacaacggca ccgctggtga atcttattag tatgctattg tgcgggagaa ccatccgctg    165300
     gacttgacga ctatcccaca gcaagggtct tcttcggaat cgaacaagaa gagaatcgaa    165360
     catcagcctc acctcacacc cacagaggct agatgcccct cgtctccagc atgaaaagcg    165420
     gctgggatca caggcccaaa cgacgaacgt tcccggatgt tactccctgt acagcaatcc    165480
     taataaagcg gtacgatacg atgggttact tacgggatat taacggaacg aatacgaatc    165540
     aagcaatacg acaggattaa cggagccgag agatagtttt actgatttgg tttgtttttg    165600
     cttctgattc ttcattttct cttctacaat cggctagagc accagccgac ctgccaggcc    165660
     cacttggcgc ctcagtcacc ttcatataac caaagcaaac ctctcaacat caagccaacc    165720
     aagagagagg ctgccatata ttctcatgct tacgagtacc aatatttatc tgcgcgttat    165780
     ggtgaccaga gaaaagggta ccccacctct ttgcttgggc cagttacatg taattattgt    165840
     ctgagttgag tatctattat tgtgtgtctt tgtcattgtt tatgcagagt atgggatact    165900
     gttcagaaga agaagacagg aacctgacaa atagaacacg gattggactt cactgtcccc    165960
     tgacagaaaa aaatcacgtg gttgcatttt aaccgtagaa gccaagtctt aagttaccgc    166020
     tagataaatc ctgtacgaca gacaatagtt catgaatggc tcacgctgtg taacgctgaa    166080
     cccccttatt acgtactcaa caaaaacgag ctatccacca tataaacaac gggacgatag    166140
     aaagaaagaa gaaggaaaaa atcaaacaca aaaggtcatc atcatagtca tcatcatagt    166200
     aatgaaatgc caatctaagc aaccagagaa agataccacg actcgctaaa tcaacagaga    166260
     acccaaccgc acgttccacg cacgtggggt atgatgtgaa atttatccat gcatccaccc    166320
     cccatctaac agaagatctg acatcggagt ctcttgccag tagatctgac gccattcatc    166380
     ctctaactct ggtagccctt ccatggccat aggcagcacg ggctggtcca gatccgtgaa    166440
     ggagaagagt tggcgccagt cgagagattc gcggggcgcg tcggcgtcga tggcgtcgac    166500
     gacgggggtc atggtggcgg atggcggagg tggggggatc caggcgtcta gatggtgatg    166560
     ttgttggggc tgagattgag gttgagggtg gctgtggtga gggcttgttg ggaggtggtt    166620
     cgtggaggag tctggggtgg ggacttcgaa gggaagaggg cggtctgtcg gggttgggtt    166680
     ggggggtctt ggtgtctgca ttgctgtggg tgcggaggtg gaagtggtgg tggagtgtag    166740
     ggttgttttg agttggtctt gagggttgct gaagcggcgg ggtggtcgtt cgctggtggc    166800
     cattcggagg tcttcttgga ggcgtctgga gtcttcgaag aggcggagga tggtgtttgc    166860
     gtggaaccaa tagcttgcta gttcgcggag ggagtaggag gctgagtcga agcggcggag    166920
     ggcgttgatt gctaggacgg ggttggagaa gcggagttcg acgcggactt ggatcatggc    166980
     tgtgaagagg gtgtggacgc cggagtacca gaggaacttg aggcggtcgt ttaatcggag    167040
     ttcttcgaag atggaggtga tgactcctgc ggctgcgctg cagatttcgg catcgtgcgg    167100
     gccgtagtca tctgagtagg cggatgctcg ggggtgtggg cggtggagga ggatcaggaa    167160
     gttgttgtag gtgagatgga gcatggcgga ccaggggtcc atgtcggacg ctcggagacg    167220
     tagtttatcg ggcagcttca gggaccaatt ggcgagggct tcgtcggctt ctaggaggac    167280
     ggctttgcga cgctctgcgc tcactcgtag tccgaagcgg cttcgaacga tgtacgagat    167340
     cattactgag agctcagtga aatggatcac gtagtcggat tggacacgag gtccgcagcc    167400
     ctcgaagtca gagattgtca atggagacac gtcggagtct tctaggtttc tgttgtcgga    167460
     agcagtcagc ggccgatcgg gagggtaagg agggggctat ctgcttacat tgcctgcggt    167520
     cgaccatacg aaagtgatac cataacgtcg aattgcacta taatgtgcca tagcctcctc    167580
     cacatccggc gatcacggga gacaaaccgg ctagagatag gatttcggtg cattccgagg    167640
     ccagtagcaa tcctggcagc tacacccacc cagtagtgcg cattcgctgc gacatcatcg    167700
     tcggcaccat ccgagtgcca agtcaaaagt agagcagctt gcaccaggat atcgcgatta    167760
     cgctcaatac gtgaatcaaa cagccacttg gcacgacgga agaaaatatc cttgagggca    167820
     tcgcgttccg ctttgggacg agtgacatgg gctcccacta gcagaatcgc ttgtagcagc    167880
     aatatcgggg gaggatcagc agggtcccgg ttgcgatact gcgccatgaa caagtcctcg    167940
     tcaatgatag gataccctgg gttgacgtgg tcaaagtaag cttgcaccag ttcatctgct    168000
     agggccggtt caggcaaagt gagagcatcc atgaggagct gatcatggcc ggtccttaac    168060
     tgtcgtcgcg gaatctcatt gcctgcaaag tgatagacgt cgtcatcctt gtcgcgttgc    168120
     tgacggatca agaaagacat gttcgacagc tcatggccca cgtatatagc tcgcacaccc    168180
     cgacgaatct cccgactgcc cgattcttcc tcatcgatga gcttcactag tcgtttctcc    168240
     aaatccgcgt gggagtccga ttcggccgag acatcctggc ccgcgggacg gttatatgtc    168300
     ggagattctg cagctgaccc ggcgccatta tggggagggt ggtgattaac attatgatta    168360
     agcgtttgat gaagattatg aagacttgat gcgggatgtg cgacaggtgt tgtcacttcc    168420
     ggttggacgc cgcgaaaggt ggtggtgaaa gcgtcaggtg gggttgtagc cgtgagaggc    168480
     agagagtgtc tgtgtgtagg ctcagaagaa gcaggaggtg gtcgacagcg gatcggaacg    168540
     gggtcgagga ttgatcgcac cgccagacgc ttcttctttt cgtgaatccg acagtcggtc    168600
     tttcccgcgg aacggcaatt ggagcatggg aggccgacga tgcgggcatc gcatcggact    168660
     ttgcgccgat ggcagtggac gcaggctgcg gagcctagag gggaattttc attagaacca    168720
     ggagaagaat agcagatata tgccaagtcc ttcatagaca ttgcagagcg tacctgactt    168780
     gcgcttagtc accccattcc cggcgggtga atgactgctg tgcgctgcgg aggtcatcgc    168840
     cgaaacatcg acacagatcc aagggtccgg agactcgcta attcgtcatc tcttatccga    168900
     gagatctgag ggagagagca taaggtcaga tcaggacatg atctacccac ggacagaacg    168960
     attggagagg agaatgaaga agacggaaag aagaaagagg agaaggagga ggagaaatgc    169020
     cagacatgaa gaggagaaaa ggcgggaaac tcgaattgct ttgctcggca tagctgtgat    169080
     tggccgataa tgggcaatcg ggtggggctc atccagggcg ggtctggggg agtcacgtgg    169140
     cggggttgct gatcgattcc attgaatttg ttttaagacc ttcgatgctt tttctcctcg    169200
     tcttctggaa gcctgtcatg atccgccgtt tgcttgctac catcctgccc atggttacct    169260
     aaaagcatac ctagtctaac tacccacgct caggaccccc tccatgtctt ctgccctgca    169320
     tttgcgtgac acccggtgtc ttcttccgtg cgcttatcca ctccggggat ccaccctggc    169380
     gtcagctccg ttatcagtcc gcctatcgtc cattcctgtc tttctcactg gacggttggt    169440
     ggaattcctt atcaacatcc attctcgaga taaagtgttt gacaaaaatg tacggctaaa    169500
     gcggagtcat ggtcctaata ttgacttctt ctgcattgcg gacaagttgc cctcgggact    169560
     tttctaagtt cacgccaatt cgcattctat caagctttcc actccctttt ccaccgtcca    169620
     gatcttgact accttcaacc ccacagattc aatcaacgta gtccagtgct tctccgtccg    169680
     ttcccccgag gcaattgaca tcatgatcat gtcaaggcta gtcgtctcga aatgcgcgtc    169740
     gagactgggg acaacatact cgttgatcaa cagcttactg taccctggtt tcatggctgg    169800
     gataaggttg gacaggatct gaccgcacac atcgtcaggc cagtcatgta gaaccgaatg    169860
     catatagtac acgcgtgctc ctgaacctta tcagcccaga tcttcaaatt atcagagtaa    169920
     atgtttcata gacatacctt tcaccggctg ctccgtaaag aaatcatgcg ccattgggtc    169980
     aatggataca tgcaagtccc tcacagtttc tataacctga ggcagatcct gcaccacaag    170040
     gcgcccagac acctctggcc acttccgacg gaattcagat acatcgtgcc cggtgctacc    170100
     acccacatca accaagaaga cgtccttctc gctcagttcg gtacccttaa ttaaccgttc    170160
     ctggactggg tagaagcctt tgtccatcca gctaggtcgt ccctgatggt acaccgacat    170220
     gtggttgccg aattgtttgt taagggtagg gttcttttgc acacattcga agaagtgttc    170280
     gtcgactcgc tgtcccagct ggaatgggga cttggtggga tcagttggat tgcggaatcc    170340
     agtctgttta agaaaggcag ggatagcgta gatacctggg tataaccaag ccgagctggg    170400
     gattgacatc aacgttagta accagtctac gggcgccttg gtgtcactca cagtgcgggg    170460
     aaagcatctc catatcgttc gacacttagt gtggtcgaga ggttcgtcgc gatgtactcg    170520
     tcaggtcccg cttcagtgat tacgctcata gatgccagat gtttcatgat gcgcgctagg    170580
     aggcgtaagt aaaacacaac tctacctacg caatacatgc cacgaatgaa actgaaccaa    170640
     ccagtaagta cttacacaac aagaccggat cactctgtgt tatcactgca agctctgcaa    170700
     cggactttgg cttgtcccga gataactcgc tcaacacacc tatagctaga gccgtttcaa    170760
     tagcggcgtg cagagtagcc tgcagcagaa accgtttgtt agatcccagc aattatgcac    170820
     atcaactcac aataccgtcc caagctctca cgtaacagac aggacttacc gtagtccagc    170880
     actgcctgac aatcgcctct cgcggggtct ccagcgcatt agccagggat ctcgcagcat    170940
     ctcgtagcct taacctttcc accgaattct ccagagatat ggatttgtgg gatgcgatct    171000
     gatcgatgag agtcgggaca gcatcgggtg catttggtga aatggcaatc gtatccacgt    171060
     tcacgtccga cttggaaggc ccatggccat tggaatggat gccatttgta tggtggccat    171120
     tagtatgata tccgttggta tgatcaccat tagtacattg ctcaacaacc gttgagacgt    171180
     tcgtataagt cattctgtag ttatcggggg tatgcttcgg ggtgagttac agggaatatg    171240
     taaggggtct gttcgaatgg cgccatctac ttaataaggt ccggcagccg gacgaaacga    171300
     gcagcctatg taggcttctc gccttgcgct tttccatagc actacaaaat agcccgcact    171360
     ataatacctt tatgacgctt agaacaatat agttagcctc tattgtcttt tgtgcctact    171420
     gtggagctaa gtcaaagaga taagctagct gctgccacct ccactggtca tttatctcac    171480
     tttcaggctg cccactctgg tgacctgcag tagagtcgct aatgtagcgg cgacgcctgg    171540
     atagactcca cttcctggcg aggggtagta atggccctag ttagatactt gtactgcccc    171600
     cggcagatga tggaagttca taccgatgga acggctaggc cgcaaaagac gcgggctaca    171660
     aaaaggcagg ctcatatcgt tttaattcac tggcgagaga tagagggcct acagagctct    171720
     ttctccatgt tctcactgga caagctcgcg cagtggataa ctagacagga tgatttagga    171780
     cggaaaagca attttgagga tacccacaag tgagatagca gcggcaatat aacgctatgt    171840
     tagcctcccc gccgatattt tgtgggtgtt cgagactgga cggtgtagta ccttagtgca    171900
     gcacttccac taacaaggtc acggaaatag caatataaat aggcctggct tatatggaga    171960
     cggagttcgg ggatgggcat ccgctcataa gatagagtcc cgccctgacg gcttcgcacc    172020
     aaaaagcaat tagcgcactc ttataaattc cagtgctgcg ccgtatcctg agactaattt    172080
     atctcagtag gcagactcca gataggattc gcgagatagg tgtcgtgtaa gtgcagagga    172140
     taccgatagc tcccacaatc gccagaatcg aagtttggaa aattctttga tcttgaacca    172200
     gaggtagcag gcatcaggga aacgagaaac tcccactctt gccacgggtt tcagagagcg    172260
     tagtactgcg ccagtactgc caggagcatc cgtatctcaa taacaaaagc ggaggtgccc    172320
     ctgagacgga caaaggttgc tttcaattaa ttatcactgc gccaacggga ccgctgtctt    172380
     gcagggatag ttgcatagcg catgacacca cacttcgcgc cattaacatc cataggcccg    172440
     ggcctgcatc gtacttttgg actgccttcg tgcaactagt ctagagttgg gtatccgacg    172500
     gatgattcat taacaaatag gaaatggctg aatattagca ccacggtacg accttgtagc    172560
     aacagtgtat ttggctgttg ggcaactctg cggtgccaag aacatggtgg atcgcctagg    172620
     ccagacaagc aattctagcg actcttgatg ttcagcctta aatgttgctg tagggggggg    172680
     gggtttgata tccgtatttg ggggcgcttt caagttgcgc acggatgcta tcatttgatc    172740
     gtctatctca aggaagaaat gcaacctcaa gaatcaccga ttagctgaga tacttcatcg    172800
     tagaggtgcg acttctgtta ttaattaatt tgcgcccagt agcgtccaaa tggacaaaga    172860
     aggcagcgtg atccactagg ccttgtagta tacgctaagg atagaacggt gccagatggt    172920
     gcgtgacgcc ggcgccgtcg ctggtggaac cggactccag gcagactcgt tcggaagtcg    172980
     gaactgtggg aaggtcaaaa agctcggttt atattgggac ctgttctttc atatgattat    173040
     tcccttcctt gaactgtctc gactaataga ctagtgttca agccactaat ctcgatctag    173100
     caatgaccgt ctcctgctct ttccaacacg gaacgtctct tgaaccctgg aatgtcgggc    173160
     atgttcctta tcagggctca gctctaggct gaatttgatg ccacgctctt gaacaatgcg    173220
     cggaagtgcc atgccccctg tgctgctatt ggtttgcttg cttagcgatt aattggacaa    173280
     tctcgatggt gccatccatg atgtctcagg tagtggtagc atggatatta tttccggttg    173340
     atgtttcgat gagtccacat cactctggat ctaggcgtct cgactctaga gtctagaatt    173400
     agaataatat aaagattgga gagcaaggga ttctcgacga aactctgcgg cgacttcgga    173460
     tgcacgagat ggtccgtaac cggcctggaa gtgacaggga ttctgttgca cagctagtgg    173520
     actaattgac actaggggaa aagcaaatta tgttagagta caatgaaaga actgtacgta    173580
     aaccccttaa gttgggcctc tggatagccc aagtagccca gtgagcacgt tttgctggaa    173640
     tcatatcagc gttggacctt ctgatgtttg tgacattcga ctacttcacg ccaacgcaca    173700
     gctgtggatg ttggacacgg agcgatgact gctgtatctt cggaatatgc ccaccagact    173760
     aagggcccac gaatattggc tgtcttttgg accatgacta gtcttgcaat tctagctgtg    173820
     gcagccaggc tcttcatccg tatcaaagtc ttgcgcaacc caggtgcaga cgactggttg    173880
     atcgcaacgt caatggtaag tcgattatac tatttctcag gtccgactgc cacagttgtt    173940
     ctttttgttg tacattctga cggctgttag tttttcagca tatcatattc tgtagtaacc    174000
     acggtcgacg tcgctctagg ttacggaaaa catgcagtcg tcatagcaga tagactagaa    174060
     ctcgttctgc tagtcaacta tatcaacttc gccttgggca taatctcctt cgccttaccc    174120
     aaattagccg tggctgccct gctgagccgt tttctgaatc cgacaacgat acaacgcgcg    174180
     atttaatggg gattgacggg gtttgtggca ctggtgtcgt gtatttgcat cttggtgctc    174240
     tttaccatgt gcgatccagc gaaagctctt tgggacacgt cccttctgtc aaagggcgcg    174300
     agttgccgga gctcgtggat ccttgtggac tatgccatct tcactggagg tatgtgcgag    174360
     tatgattcaa tagaaagata agtctagctt aaacaacgat agccatatct gcctttacgg    174420
     atctgtattt ggcaatttat ccgacagtca tcttactaaa gcttcatatg tcgatgcgga    174480
     aacgattggc gttgtgtgca gcgctgggtc tgagtgcagt gtaagcaaga actcaagaag    174540
     ctcatcgtca tcagtattag ctaagaaaca aggctatagc gcttgtgcaa tggcaatcat    174600
     caagtgcatg cagctaccag gtcttgccga tctcagcgat acgacatgtg agttgttctt    174660
     gatgcaaaac tgtactaagg ccggatgttc actgacacta tagcagatgc cacggccgac    174720
     cttgtgatat ggacaaggta agccaccatg tgttacttcg tgacaccaag cccttattga    174780
     gcagcaattc cggatattga caatctcccg gcagtatcga atcaaacgtc gtgatcctag    174840
     cctcatgtat ccccacgcta caaccgcttc tcgaaataat tctcggaaag cgcagtctga    174900
     gaagtaccgg cggatatcag tacaaagaga gcagtaccca attgcccgag tctaacaagt    174960
     ggagcagcaa gcgatctgga caccggaaaa gtaaaggcaa tatgatgatt gcagacattg    175020
     gcagccagga tagcatcttg cagataggtg atgatcacga ggacgaaagc cattatatgg    175080
     ggcacatccg tcgtacagat aaaatcactg ttgtgtacga aagtgtgaca ccacagccag    175140
     gtggtggtga taaaacaaat gaccctgtaa aatagaagag ttacactgac ggtgtttctg    175200
     gcatgctttt ttgttctccg ccttctttgt gtgttggtct ttcattaagt gcttgtagtt    175260
     tttccattga ataggcgcaa agttgtatga gcccccagag atttttttga gaagctgaag    175320
     tgcttcatcc agaataagtt tagacgcttg ctatgatgat gtgttagcat gacggttcaa    175380
     cactatcgag cctaaatgtt gcgttgcttt cataccttca tatcgctacc acaacaaaaa    175440
     atcttccata tgcgattatg tacgtatgca agtccagggc taatggtctt gcatgtacct    175500
     catgttccgc agttgtattg atcatccaag aacgaacctc ttccagtttt cagcgagctg    175560
     ccgaacgcct tgatgtaact cccacccgcg gatattgcag atctgcctag caatttcctc    175620
     cagcaagtca tccatctgtt gcccagccgt atgcagatcg ctctcgatga gtattctatc    175680
     atcaggcaaa gccttgataa cgttgatgac cttctgtgac gaaggtccgc cgaagtttat    175740
     cacagaagag aaggagaagt agacgtctga cggattagat tgatgcagaa attgcttcaa    175800
     tggctccacc ggcccggaat aagaatgcat gcagatccgt ggtgggaatg ggagagactt    175860
     ttcatctgac tttgcaggct tctgttgcat tcgttcatcc tccgcatcgc tctctgcatg    175920
     cgcatctgga acactataac gtcggcgtct ctcccgtcgt gaggcgttct ttcgctcatg    175980
     gccagaccaa agggccttca aaaggtcaaa gaccgcccca tgagcttgaa cgctatgcac    176040
     agaaactggc cgctgaagtt ccccagctag ccgcaactga gcctccaaga cggctttttg    176100
     atgcgccaac tgaacacgat acggcgaaag ctgtctacct tcccgagatc caggggtcat    176160
     tcgctcatcc cgagtttctt tttcctcctc ggtccacgcc ttgggaagcc taaacgcacg    176220
     atcaaggcca acctcaccca caagagaacg aggatacgcc agcaaccgtg ctcgagattc    176280
     cgacagcaac tctgacagcg gctttggatc aggtaacgac aggatgaagt catcatctgg    176340
     ctctggagta aggaccttct tatagtgcag cttcttcagc tcaattggtg aggtactttc    176400
     atcggtcttg ggcgaaccag tcgtatcgtc gatgatttga tgcgagaacc atgggtgcca    176460
     gccaaagcac ggtagcacag gccctgttgc cgaactttgg gcggagtcct gaccctgggt    176520
     caaggatgta gcggtctgaa gcaccaagtc ctggtcctcc ccgcgagtgg acatgactgt    176580
     taatgtcaat actttcattt gggggatttc cgcaatggat gacatggtgt cagtggggtg    176640
     acaatgggcg tcgaacaccc ccaagtgcca aggaaatgca tcgttctgat ccgtctcaga    176700
     catggtgcat gtgaaaaaga attgatcgga aagccgaggc ggaattagag tgccaaagcg    176760
     aaaagaaaaa tgattcagag gcagcttggg gatgtgttga ttgacaaaaa gtcggatgat    176820
     gaatggagag agagctaagc tgtgacgtaa ggaaaagccc gccgatacac acgcgatacg    176880
     tggtgtaatg atgccttggg caggcaacgg acatcgagca tcacatgctt cttcgtcgtc    176940
     ttgcttctcc gcattttggt tctggggatg cagtcatgat ttctattccc tgcatggaca    177000
     ctgcagggct attccttcat actatagcca tgccacttga tttctatata tctagtaaga    177060
     aaataaatat ttccatgtat tcaactccct cctttgatct tctatagcct acctcatagc    177120
     tgccctactc ccctcatctt catgtcctct atctccgcct tcttgagtct tcccctcctc    177180
     acactctttt ccctccctct cgccctgttg gcatgcttca ccaccttcct ttccatcata    177240
     tttctcctcc tacgcttctc tgtcatctat attgagctat gccttgccat aatcacaaat    177300
     tacttcgtca tcccaacagc tgccaacacc tccctcctca acttctccgc atctgaaccc    177360
     accaccccag cagcctcaac aacacccaag cgtcgctcag tcgaccacag cttaaacaat    177420
     gggcttctca ctgccctcgc aacatatcgt ccaggctaca atcctccccg tcgaacaaac    177480
     agtttaacca ccacaacctc cacttcctca acctcccaag acactaccac tgttccactc    177540
     tatcgcaaag atgaacccgc aaataacgct ccctctgccc tcctaactct gatcagtggc    177600
     gacgaaggcc gcgactttga aggtctaggc ggctggcgct gtgcgacaac agcaaaagca    177660
     gcagcagcaa caacaaccac aacagcaaga tacccagccc atcatctcct ctcagacacc    177720
     gcctccccct caccaaatat caccaccagt gaatacgacg agagagcatg gctatccatc    177780
     aacgagagac tagaactccc ctcccaacct ctattatcca tccgaaacaa cagcaacagc    177840
     agcaacaacg aagctctcga atccctccct tggagacatc ggcaaatggc ttcaaccagc    177900
     ccgccccccg gaggcagtaa taacctcatt cgcagtcccc gccatcacca tcgttccgca    177960
     accacctcct tactatccac tagcctgtcc cctaggtctt cactgccaga cgccgttccc    178020
     caccacggtc tagaccatcc acagcgtagg gctacctcgc cactactatc acaacagcaa    178080
     aatagtacga ataccctctt ctgcacgccc tcgcccactg ggaagtttcc aggcgcatcg    178140
     atccctcggg tatcgagccc tactgaagga tcagggggat atttttcctt gcgacccggt    178200
     agcacgagca gcacgagcgg gtcaacaaca ccaggtgaag agcgacgatc gcctagaccc    178260
     tcggccaagt ccatggtgca ttaccccgcg ggcgtgagat atcgtcggag gagtatgtca    178320
     gggccgaata gtggggtgaa attgaccaag gcgtcgtcgg gcacggagcg ggcgttgtaa    178380
     ttgatttatt atggaacata ctcatctgat ggtgttgatt gcgtgagata tttctggata    178440
     tggtattctt tacctcatca attttgggtg gatctgacag cgttacgttt acatcgtcgt    178500
     agcgatttac caatcatgac acagatattt tcaaattctc tatgcttgcc atgttctcat    178560
     catatgtcta cttctaccgt taaggtatat acattccacg tagtccatga tcgacagata    178620
     ctatttgaga catcgcccga tctttaaatc aaaaccatca atgtttactt gctccacaaa    178680
     gaacaagttt cacaagcaaa atgaacaaaa cccgctattt gatgacccaa cgtaacgtaa    178740
     acacctcttt aaacagaaaa gaagactttg gccgaaagaa aagagctaga ttagactgca    178800
     caaagaaaca gagctctatg aggcgcgatt agctctctcc ttctgagcca cctcctccat    178860
     ctcagccaaa acgatgcggt tgaagtcttc ccatccgtct agatagatat gatggccgga    178920
     cctcttgata atgaccacct tagctgagcc attgtccgct tcgcgttcct ccactgttgc    178980
     gttttgcaag atacgctcct tctcttgatc caacttagcc tttgcggcta gcccgccctt    179040
     cacgtccatc caatcgtggt caccgtacat gaagattatg gggagaccgt tctcgcgctt    179100
     gggtgtcgtt gagggggtct gagagggggc cgagttggcc gaggaagatt caagagtaga    179160
     ttgggatgtg gtagctacag ctgcggcttt cgcagactcg aggacagcag atgcgggtga    179220
     cggattttgc tggatgaatt gacgaccgac gccctcgatg cgtcggatta gcggactgcg    179280
     ggcgaatgcg cccggggcga gaatgtacga tagagcatac tcgccgctgc cgcgcatgct    179340
     gaagatcgaa tacgaatagt catgcagaga tttggcctcc tctgccggaa gatgggagaa    179400
     acgccgggat gtccacccgg agaccagacg cggaccgagt ggtcccgccc atcgcaccag    179460
     gctgaagggg gagatgttgg catcccaaag ataggcgaac cacttgggaa ccatgcgccg    179520
     gggcggccga tcttgggaag cgccactatc tgtaggggaa ccctttagca aaatattgtt    179580
     atcgcctttc tgaagctcag ttgggggaac cgaagatgca gattcggcga tattgcgctg    179640
     gttctgagtg agctcattcg ccatggtcga ctcgtttggc gcaggcatct ctgcccgcac    179700
     agcgtacggg tcctctggga ttccgacggg ggaagcaagg ataagcttgt tgagtcgtcc    179760
     cggatatttg agagcgtatg ccacggccat gtagcctccc aaactatggc caagtagtgt    179820
     gaaacggtcg atgttgcgct tgacacgcca ctcttccagc gcatccacga accaggcttc    179880
     tgcttctttg atggcctcct cacgctcctt cgctttgata cgaaagggtg gtcgcgtact    179940
     gcggcccatg cccaggaggt ccagcgcatg gagttgccac cctttcaggc gactaagagg    180000
     ctcgaaattc ttatagaaga accccaaacc agcaccgtat ccatgaagca tgaccagatg    180060
     ttgatctgct tcttcaccaa tccgctcgac agagaactcg ttcagagccc gattcttccc    180120
     gctcagctcc accatactgg agcgccacat tcgggggccg tatggatcat tggtagaact    180180
     ggctgatacc tcaccctgtt gcgtttgatc ggcggactgg agactgcccg tcccgccaga    180240
     gacactgctc gttttaccgg tttgtagatg ggttgggggt tgatgctgga ggtaagggag    180300
     gtgggaaaga accctgtgtt cggctgtggc ggcgggtaaa gacgcccact ggaagaaaac    180360
     ccagtctcag tcacccatgc gacacttgac tttgttcctc agtaaagaaa cgtacccatt    180420
     gactgaagcc ttccctgtag cctaggggaa accaggccaa gggggcagga gttgcgctgg    180480
     ctccgcgagc tgcgtgtggc gtactctctc ggcgagaagc cacgggttcc tggctgcggc    180540
     cccgaaattc gccgctgggc gagttgaacg actcggatgc catcgtagat gtagacgacg    180600
     agcgtctaga atccgtcggt cgggaagaag aggaaatata tcgagcgctt tcgaacgagg    180660
     tccaggaacg tgagactggg acctgaaaag aaagcgaagg gagtcgcgcg gtcgacacct    180720
     tgtcgttagg aaaatcggag tgacagaggg aagagccctg tcactctctc ggctgcaacg    180780
     gaaaagaagg gagtatttaa aagacagcga aggggaaata gattaaattc tctcttaggg    180840
     gggcgcagtg gaaagagtaa gaaacaggtc agtggaacaa aatgagaaac ggttgaggca    180900
     acgccaaaga ccgttaaccc cgatccgaga tggagttaag caacaggcaa ccaatgttga    180960
     tgacgctgaa ggtgaggacc agaaaaacct cagaaaagaa tgttcagttc ctaacctgca    181020
     caattgaaga ccctgactgt caaaaacagt atatacttgg aaaagagagg cagaggattg    181080
     aacggggggg agagatgaaa gttgagaaaa gctgaaagtc cagcggaagt ggagcctcaa    181140
     ccaagtgttg gccgatggaa tggatgacga tgcttcactc tttcttgtct cttcttctcc    181200
     ctctccgtct ccctctctct ccatgcctct ctatcttcct caaaacctct tctctttcca    181260
     tgcgatgaga taacgccggg ccgcaaaggc caaaatctac cactgtgttt ttgaatttca    181320
     cctgcgattt gaacctccga ggttaattct tgctccctct attcttttcc gtccagacga    181380
     acccgatctc cctgcctcgc ctttcttctt ctctggcttc cactccaaag ctcaccatgg    181440
     cttcagcaag cctagaccaa ctggttaagg gatctccagc acccaacagt cgccttgcat    181500
     cttctgcgac atcctcctcc gaatcattgg cgcctgcatt tcactcccat cctccctcta    181560
     gcgatccctc ttccccgcca cggtcgtcaa cccccgatcc actgtcgacc ctcccctctt    181620
     ccccacccca gatatacctc aatctcctca ttctcgagag ctccctgcga gctcagtacc    181680
     tcgctcttcg ggaacgccgc cgacaaaata cgtttttcct tctcttgctt gccgcctgga    181740
     tcgcctactt tgcctacgcg ctctttctcc gcccgcgcga agatggccgc ggcgtcggag    181800
     gatcggtcta ctgggtggtc gaaatgggag aaaaggtcgc cctgatgggc ggcgtggtca    181860
     ctgcgctcct ggtctgggga acagggcaat gggaacgtgg agtttcgttg gccgcggcgc    181920
     tggctcgccg tagccaaccg cggcctccgc accatgaaca ccaagatcgt ggtcatccga    181980
     ggtccctggt ggcaggagct tttctcctac ctttctttcc tatttccatt ctctgcaccc    182040
     tttttcccgt cccccgtggg cgatttccac tacgtcgagc gccctgcgtc cgagagacgt    182100
     ggtagtcggc agcactacca gcagtactac aaccacgacg cggaatcagg tctggtacag    182160
     gaagacctca gccccggagg tgactacatt cgacttcttc tactgccgaa gtcattctcg    182220
     cccgagttcc gcgagaactg ggatgaatac cgcagcgaat tttgggataa ggagaatgat    182280
     cgtcgtgctc agctgcgcca gaagctgcgc caaagggagc gtcagctagt ccagcaggat    182340
     ggcggctggt tctggtggtt cgggttgagt tggaaggcgt cgcaacgccg acgagtcgct    182400
     gccgcaacga tcagccgacc cggcgatgct gacaaggtcc aacatcgctc ccatcaccac    182460
     caccattcgt ccagcatctc aaagctcgcc cttgaatcca aatcgccctt gcggcgcggt    182520
     ggaccacgct ctgaatccca ctcccgcacg ccgtcacgca gcactacccc cgtagacacc    182580
     gacgaccgac ccccgtccag gtcgtccgtc agtggccgtc cccgccgcgg aagcacaagt    182640
     ccaagcactg aacaacacat ccagcaatca cggaagaaga aggcatccaa agccgccact    182700
     cgtggtctgt ctcctttgac gcaggcccaa atccgagagg gcgtgcgcac tccgtccttt    182760
     tcgtccgacg actcttcttt catgggcact cctagcgaaa aggagaaacc caaggacgag    182820
     agtgttgaat agcggttcca ccatctttat ttcccttaaa cccattctgg tctaatttac    182880
     caacttctcc cccatatgtc tattgtcaat attataccct ttgaaagcac accacgaaga    182940
     caaatactat ctcatctcga tgtacttacc gccgtcgtag ggggggtgtc gaaataaagc    183000
     tcttctcttc tcttccattt ttcccgttcc atgcattgcc gatttctgct ttatacattt    183060
     cggtgtcttt ttcctcctct tcccatctcc aattgatttc tctttataat accccatcat    183120
     attatagcag atttatagtg cattttactc taaattttcc gtttttggca tcagagggta    183180
     tatgcggtcg actgagtgga tgtttcgcat cgcatcgcat cgcatggtgg tttcttttcc    183240
     aacttcccct cctattcgaa aagagattag atcagagtcc gattagtcct tgtcctggat    183300
     agtatataca catgcatatg gggtcctttt ctttcttttc tctttcgctc ttttgctttc    183360
     ttcaccgtac atgcactcaa ttgtaataca atcagtggtg gacaggctag actacttagt    183420
     cttgagtagg taaactcaaa tcccaaccag tacctgcgcc ccggatgtaa gggatatgca    183480
     agataaaggg gcaactagtg aacaaaagca aggtctaggg gaggggtcca aaaaaaagaa    183540
     agtatacttt agtggcaatc cgtagtctag actattctct gagataattt tcttgataac    183600
     gtaatcaacg gtcggacggg ccacacggtc aggcgggcca tctggtaata ctatacaaaa    183660
     gatatctttt taaacataat atatctctac catccaggtc tagaagaatt agatttcttc    183720
     tatatagatt ttaaataata taaataatat ctatatacct tctaaaaatg aatatacttt    183780
     tacttatgga cttatcatat tacaatatct gtatttatat gtattatata agaatctggt    183840
     ttcattatca aagtaaaaat tctaaaaatc tgaaaaattc atggaatact tattcttata    183900
     tatataaact atctacaaag ttagagcttc atagaagtag tactggttga tatataatag    183960
     aatcaaaaag acatctttta tatgggattt caggatggcc cgcctgaccg tgtggcccgt    184020
     tcgaccgttg attacgttaa ccttagtccc ggcttatcat aacatatcag gaagcctcta    184080
     gtgtcagggt ctagatagga agttgttccg tagacattga tatgagaaat gtatgatgga    184140
     tggcatttcg atcaaaatag agatgcacat ggagaaggaa atagacaatt agagacaagt    184200
     aatataaacg ttgagtatcc gagacgccga actatccttc aaaacaggtt atatgtattc    184260
     aggaaacata gaggcaagtg taaagaaatc atgcgcatga gtcagccgtc acgtaggtat    184320
     ccatcccatt tctctaagtc gtataacgtg gttaaattga gtttttgttc tttatgatta    184380
     gattctgtag acggtttcgt cttcctcaag gtacctgttt cgaagaagtc attagcactt    184440
     atgtcatgtt atggatagaa ggtttcaggt gcatacatta gttcgttcct ctcgttcata    184500
     gccctcaggg cctggattgc ttctccgcgc tggaagacgt gtgactcgcc cagcgaaggt    184560
     gtgctgcgca gcgcagtgtt cacagctcca atgagcgatt cgacgtcggc ggtgtcaccg    184620
     tgggtgaata gtcgtgtgcc catcagggga cccagtgctt gcctgaagac cgtcaaacga    184680
     gcgggctgga tcggttcaga tgacacagta gtgttctgtg actgcgagtt gtcggtctgc    184740
     gactcgacga gctgtgacgc gggtcgagat gaagccacag acatacggga ctggctttgt    184800
     gtttgtgtct gcgtgcggga tgtttgacta gagcggaggc gttgaccgcg gggactagca    184860
     ttgtacaagc catcgccatc ctcggagacc gcatctccat ctgcgtccat ttctgtgtcc    184920
     tcgttggtgg tagaacgtgc gttggctcca cgggatcgga gaccgcctct cctggttgat    184980
     cgaggagtgg cgctggatgt ttgcgcagga gtgttgtcgt cgtcatcgga gtcagagtcg    185040
     ctgctctcgg agtcttcgtc gaacgaagcg acctttctcc ttttgcggcg ctcgtcttca    185100
     acaatttcct tgaacatggc gaaccggagg atagactccg cgatcttggc gtcgcgctcc    185160
     tcgactctgt tggagaggcg tgacttggcg tgagccgtgg acagacggat caaggtttcc    185220
     aaggtacgag cagtgatggg cgatgttctg cgctggttac cggacaattc gtcgtttctc    185280
     agagcagaat atgttgcgac aatgtggtcg gcggctccct tggtcaggac gggcttgaca    185340
     cgagacttgg cgtattggat gtatttctta atgaaaggaa tgctcaaaat ctcaatgttc    185400
     ttgctcttgg accggctcat gtgggccatg ccggcgtgaa gcatgacatt gaacttctcg    185460
     tagacatctg taggctggtt cgagtcctgc gtatcctcga ggccgacacc aagcgtttgg    185520
     tgaagctgtt cgcggacagg agcaccctcc tcagtgccgg gctggcggta gcggtgcata    185580
     cggaggacgt gctctgacac cattctgtct cttgaatcct caatgtcatc ggtcacaacg    185640
     aagagcaaat cgaaacgcga caacagagaa tcaggaaggg caatgttctt gtgggggtct    185700
     ttgtgggggt cgtattgtcc gtagatcgga ttggcagcgg ccaggacact gcatcgggcg    185760
     ttcaaactcg tgtgaatacc ggccttcgca atggtgacag tttgctgctc catgacttcg    185820
     tggatagcca cacgatcgac atcgctcatc ttgtcaaact catcaataca gaccacaccg    185880
     cgatcaccca gaaccatggc accagcttca agtctccgct cgccagtttc cttgtcagac    185940
     gtgacggcag ccgtaagacc gacaccggaa gatcctcgac ctgtcgtggc aattgcaagc    186000
     ggggcggtgt tcaagacgaa acgaagcagt tgagacttgg cggtcgaagg gtcaccgacc    186060
     atgagaatgt tgatatcacc acgcaagtgt gtgccgttgt ccaggttctt ctccatacca    186120
     ccgagcagca tgagcaggat ggccttcttg atgtaatcat gtccgtagat actgggcgcg    186180
     agggagtgcg acaagagttc gaaaacgccc ttcttcttgg agaccttatt gatgttgcgg    186240
     atgtcggtgt cggtaatggt ggcctgtgcg attcctccac cagattttga agacaattgg    186300
     ataatgttat tcgcaaggac aagcgtgcgg aatgtggcag acgtagacga agcgtttctg    186360
     ttacccagag agcggtacac tccgacaagc tggattctgt cacctggctt agcgcgatca    186420
     accagatcat cgtcaacaat cacatccaca ctccgaggca gctggccagc cggggctctc    186480
     tcgggcattt cttggatcga gatagtctga tggtccatat acgtggagaa accgtattct    186540
     gtgacaagct aatatgacga agactattag cctcaagata tcggcactgc accaatcgaa    186600
     cataccgggt tcttctcctc gtcttcctgg ggataaatgc tcatgctcgt tgcaccactg    186660
     gcggtcatcg tcgcatccat gtacttcctc gtaaggaact tctgaccgcg ctcgctccaa    186720
     tgcacactct gaataatctt aggtcggacc aaggagcact tcgtgacgat accctcgagg    186780
     gagatcattc gattcaggtg ggaggaaccg agcgtcctag ggttgcagga atattctccg    186840
     aatgcgccga caaagccgca atggtagttc taggcactgt tagaagccga acgagcaacg    186900
     tggatgtatc aagtattccc ataccacatc gtctcccgtc tccctcgatg gcctattcgg    186960
     caaagtcttg atgatctctt taagggcctt ttcaaaggca tcggagtatt catatggcga    187020
     tgtgagaagg ctgtaagcga ttagccaggg cgtctgtatg agtgtgcgta tgtttcctac    187080
     ccatcggcca tttcacggtt atgcgcacgg atctcatcaa tgctaacctg cgcaacgtat    187140
     aggcattagc ttcgggaacg tatatgctgt atatatgtct gaggccttat gcatactatc    187200
     aatcgacgca acccccgatt caacatcaac aagatatcag cccgataact agtagcaagt    187260
     tagtgtctgt catggtgtcg tctcccaagg tcgttgagaa tgggttggtg agcaacggac    187320
     ctgcgcgctc tcgcatcacc tagattagaa tcaagttagc ctatgtgatc cattggaacc    187380
     agtctgtcag agcttacttg ggtcgagaaa ctcgacggcg gcacgcactc gatcttgtgc    187440
     ggcgtcgtca aactgtccct ccatggcggc ggactttccc acggactgct agtaagaaaa    187500
     atagaggggg tatctggtga taattggcaa tgaggcgtga aaacaaaatg cagctagaaa    187560
     ggtggggtcc ggtgggagaa aagcaagcgc ggagaaatgt cgaggtgatt tttgatgctc    187620
     gttgatgggg aagaaagggt gggttgccgg gaggatcttt caggttgcca tacgcgacag    187680
     ctcaatcggg taatattgga gcgcgtccgc cagaaggacg cgtgcgaccg tgtcactgta    187740
     tatatgagtc agcggtgcat aaccctacat agaatacctg cattactacg actttatgct    187800
     ctgacaactc ataacaacag cagtgatgcc atcttcttct tatctttctc actttacttt    187860
     tgaattgctc gcatctgtca acatgcttaa atctctcaag tttaattcac agcgctacaa    187920
     tcgtaaagta ctcccaaagg aaccgcagct tctgaatggt tatagcccaa attcaacgcc    187980
     ataatctgtc ccacagcgac cccatagtaa gtagcaaagt cttgcagggt accatagccc    188040
     aaggtaaatt gagtcatagt acaggcagta ttgtcgcaga tagggatctt caccgtctca    188100
     cccgtctgaa ggacatcata ggggccaggg ttcagagcgg caatataccc agtttgagcg    188160
     gtctggttga tgacagactc gaccgtgatg ttgaatcgtt cgttggcgat cttctgaatg    188220
     gtgtctccag gcatgatcgt atatacgtgg ggaccactat cgatacaagt gttggtggcc    188280
     tcggtattgt tggtgctgaa gcagctcagg tcatctggga aggtcggttg agcaggaatg    188340
     cgaagcacct cgccagcata gatgaagttg ggatcagcga ggatattcag ccgggcgaga    188400
     tcacaggttc ccacgccgta tttggcggca atggctgata gggtgtcgtt ctcttgaaca    188460
     gtgtaggtct cgttcaaagc ggtgatatct aggtttatca ctgttccggc ggttgggagg    188520
     gctgtaggta gtgcgaagag ttagcgtagc taggttggct gaggtaaaaa tgaaaataaa    188580
     aggacaacaa accatcatag gtggatgctg gaagagcgac agccactgct gacaggctga    188640
     gaagagtagc agcgagcatg gttttgaact tcagctctcc aaacttgttc tcaaaggaaa    188700
     tgatctgaca ttcagatcaa aatctgtctg gtgcggtaca agccctattt atataggcca    188760
     aagaagcact tcgaagtcaa aggatctcaa cccgcccact tggcgcaacc aagctaccgc    188820
     caggccaaag acatcactat ccagaattgg tgcccatgac cgactcgaga aagccatgcc    188880
     cccgattcct tggtcattgg gcgcctccct cgccttttct tactcggacc agcatagctt    188940
     caacactaag tgccagcgga ctgaagctat aacatggaga ttttgaggga tgccgtaccc    189000
     ttccacatgc cccagagcat gaatgccatg cggggacttc cccacaatga cctgggcacg    189060
     tatcggacaa atggaattag tacggcctca tccgaagcat gggtgagtgt ggcctagtgc    189120
     aaatgtcaaa gcactaaccg ctagaccaaa accgataaac cgctcttggc tagccaggcg    189180
     acggagagat atctgtccca acagtaaata gtgtagaggt attagtatct gtgcggctgg    189240
     acgcttcgga ggtcgggggc gactgtaact tccgacctcc gtcggctttg ggacaagacc    189300
     tgcccttggt tgggcttggc caggtgagat tttttcatga aactcagact gtccgatgtc    189360
     acacatgcga gcaatatcca tgaacttcgt catggtggct tcatgagtaa gccagtagtc    189420
     gtaactctaa agaaaggttt gttttacatt ctgatattga aggagagaag tgataacgag    189480
     attagatccc ataacagctg taataataca gagtgaactg aaatgatttt ggatggataa    189540
     tacggaatcc tcctatcctc atttcatgat aagtgggttt aggtcttcga aatcacgaat    189600
     gtgtgtacat accatccttg gccacctcgt cttatgtttt gtctagtaga caggcgtaag    189660
     gtaggcgctc aacttccaga gcatggcctg gatagaggtt gcgttctgtt cgcagaccat    189720
     agtgttgttg tcagtccagt atgggcgcga cggccaagtg caaagctcct ggacttcgcc    189780
     cttgtgctcc ccagaagtaa cagtggcatt gattctgaca ggtactacgt cttcctctac    189840
     ccacttgatc atgtgggcga aattgtcccg agggaaacca gcattgggtt gctcatcgtt    189900
     ggttgcgcag tgggctgcac cagggacgag atagaaacgg taccagtcgt tgagtttctc    189960
     attgccctca gcaaaagaga ggtcaggata catgatctcg cgaaccgatt cgtggtagtg    190020
     aatggatccg gtcgggggaa cactgctatc ggcctctcca tggtaatgaa gcagacggcc    190080
     tcccttggaa tggaaggggg tcaggtcagg aagagtggtt tgaagagagt ccatgtattt    190140
     ggtcattcct tcgatcatcc atgccttcag gtcatcattg gtgactcccc acatgtccaa    190200
     atccgtgacg ttctgccaat ttaggaattt ggtaatccat tctccgttgg agttgggaga    190260
     tgtgatcgtc caggaatccg tggtgctgtc gtagacagta gtgtcgccaa agccggcagt    190320
     aggctggaaa gggaaataca cgaggtcacc gtttgagtct ttctgttggg tttggaatca    190380
     tgtcagcgaa gtttggaggc agagaaactg tgggtgtcgg ggaaatattc ataccagtcc    190440
     agttagaagg tcttgaatca cctcaatatc tttggcatta atggttccat tttgcgcagg    190500
     ggtggctgaa gttgtttgcc tcttgctccg cttcccatat cccaagccaa ggctagtggt    190560
     cgacccagcc tcgcagtagt acgacttgcc cagcattgag gatacattga aattctggaa    190620
     acagagatcg ctacgagcaa ccactccatc aatcttgccg tccatgccat cacaggcatt    190680
     gatcgttgcg ttgatcactg tatcaaacac gcaagaaggc ggataatagc cgatagtctg    190740
     gatctggatg ggaggagcga tgtgattcac ctgctgctgg ccgtagcgca tagcaggggc    190800
     accagcaacg atgccatcgt acaattcggg ggcacgttgg gcttggctca ttccctcacg    190860
     tccaccttca gagcaaccga tgtaataggt gtacaacttg gtaacgttat ttccgacgtt    190920
     gaagaagttg ttggtaaagg cctttccaat ctgggtcatt tcggcaatgg cctggtatcc    190980
     ccagttgtat atggcaggcc agttggcagt tccattgccg agaatgacaa catcatcgaa    191040
     gtcagtgcca ccccagtaag ggaatccacc gtcggtgtag ccagtggcag ccccaaaggc    191100
     gacccctccg gcgatatcac ctcctcctga gccgttgttg atctcatacg cggaaccacc    191160
     tgtagcgagg aatctgttct ggaaaaggtc tgggctcggc atccaatatt ggacgactac    191220
     gcggtcatct ccgttctggt ggctgtaggc aaaagatact tcacagaagt tgatggtcaa    191280
     atcctcccag aaaatggaat cggtgaggga atagttgcgg tagatactag cagatacaga    191340
     gctagtgtcg atggtgattc cagaaggaat gtcatcgctg gcagtaggca gaaccgacgt    191400
     gacatagtcg gttgtacaca cactgttcag cgatgccgca gatgcgacac cgacaagagt    191460
     ggcagcagcc aggctgtaca ttgcgaatga agagaaagga cgggccattg agcccagaag    191520
     aagcaattag agataggaca aaaggaatta aaagattgtt attgtaaaaa tataccagag    191580
     agaactgggc cttcaggaca ttattatacc attgggatca tagcaaggta atggttcatt    191640
     tagttcagta gaccccttac tctctagtgt aactagggca cttacgtatg tctctatata    191700
     ctaacctctc tgcgtgaaac actggacgcc gatcattgag tagcccatcc cccataggag    191760
     cttgatgagc agtagttata gtattcatct cgaatgccat tgttgagcct aggcaaactt    191820
     ctgacagcat aagccttgct gactctcaaa gatacctcct aaaccgaggc catctagatc    191880
     aatgacttac ctgaagacca tacttgtctc taattgtatg ttgtatgtat gatctcagct    191940
     gctcgatggt tagtctctct cttaatatag tagtgatata tgaatgatga agatagactt    192000
     catgatctgc gcgagacccc gaggacccta tcctaccata gagtttgaat gcgagacccc    192060
     gaggagttta aacacttgat tacctgtgag tggctaataa agtctccaag agtcgacatc    192120
     ttcggagatg tctcttattt tcggactaaa cacatcggcc ttcggccatt gccagtcgga    192180
     gattcgggtt cagtttcctc aaatgggctg gcttttctat catcaggcag aagacccttc    192240
     ccgaggccga gcggcaattg agctttttga gacgtaatta gagtagccat agggcactgg    192300
     taaggttata gggtgaagaa gtttagatcc tgttagtctt atctgtcatg gaggggccct    192360
     gttagctagt ttgtagatat ggtaacaaca gacacaaact tgaatccctc gtggcgggaa    192420
     agaaggccaa actaccaaac aagtcggaat tgataccaaa aggaagtgga ttgcaggatt    192480
     tcccctccct caatgtccat aaatacacgc ataaagcggg gacaacatat ccccttccag    192540
     tactaacatt catgagaaca acagtagcat cctgatagaa ataaccacct actaataaag    192600
     ttcatcttcc acactagcgg ttagatcgca atcgctatgg ttataagcga catcggtcag    192660
     gatgaacccc tcgacgattc acagatcgac gaggaatgtt tgtgcggatt gatctacttt    192720
     gccaggaatc agacgtgctg ttgaggcacc agtactcccg acaccatcga atgatgacca    192780
     agcatatcca gctttctttt tcgcttcaac catacaccca gcagtctcaa ccactcctcc    192840
     ccctggatgc acgttgaaga caacacccac ttaaccctac aatgtctcag cctatccctc    192900
     tcaccactca aggccttcct caaagaagtc cgtacctatc ctcgcaaggt ctccgaatcc    192960
     accatctcaa tctaccgcac gcaatccaca cctcgagata tccactggat gcccgtcgcc    193020
     actcgcctac cccgggacat ctccaccatc atcctgaacg agaacaagaa acagaagatt    193080
     ctccaggata taaccgagta cctacaccct cagggcagac agcggtggcg atccaggcga    193140
     tcaggagaag cagaagatag aagacgagaa ggagaaactg caggagcttg cggacgggtt    193200
     ttcatcgtat ttgcctaagg attgattcag tattgctgat gtccaggggt tcctgttgca    193260
     gtataaacgg gagcctgaga aggcatgtga gaatgttgct ggttgggttg aggaggattt    193320
     gggcgtcgat gatgaacaaa ctactaatac tgaggaggac cgtgacaaat agaagagggg    193380
     atggggcctg ctcaatgctc aagaggaaaa tcaaaccact tatcaccatc aagtagttgc    193440
     ttgtaactga gcatagcagg gctcggctct atgaaggact ttcaggagaa aaagtaggat    193500
     attctctata gacaaacatg gtcgcgcaca atttcgtctt acgacttcgt ttttcagtat    193560
     attaataata taacaaggat gactgcctcg caacacacca gtacagcatt ggcatcaatc    193620
     taacttgaac tcctcagtat ccggactttg tacccctccc tcccctctac ctgaccctac    193680
     tctaacctta gcaatccaca gcatgtaccg ggtacacgct cggttcagcg ctcagccgca    193740
     aatgcccacg ccaggtgccc ccatggctga actcgcagca acccacagtg gtaccgctgt    193800
     tgtgcagagt agtcacacat ttctccactg cggccagaat cgtctttttc tctgcggtcg    193860
     tatcgcagtt cgaccccgtt gtcgtcgcct tgtacgcata tcccagcacc ttctccccgc    193920
     tgacatctgt accataggtc aaggtgcacg agtccgcgtc cgacttcgac ttgatgagac    193980
     ccgccaaaaa ctcccagatt tcaagcccag ccttgactgt gaagattacg tgggaggcaa    194040
     ctttcgctgt agtcacgact ttctgaatcg taatgcccgt tcttttctcc aagtccgtcg    194100
     tgtcagatgt gacattcgcc cattgccagg cgtagtcggc gttgatgacc ttcaacttca    194160
     ctgtcatatt gccagcgcca tcatcccagt ctgcaacgat tggtgtggtg atcacatcat    194220
     atgctgtttc attgtctcca gcaagacatg gatcaataaa cccgcatgcg agaacgccac    194280
     acaggacctt gctgagcttg accattctcc gtcggtgtag cgatgatata aagcacagag    194340
     atcaatgata aggagacaag caagctgcag gaggttcatg cacactaaag agaattgctc    194400
     agtcaaaaca gattcagtgg gcttatggaa caagttggac gcttccgtac cttgggatga    194460
     gtgctggaaa taacaggtca aggagaaaga aaaagtgagt gatgagctga tgtagaaagc    194520
     aggaggactc attggattgg gtgctttata tacctttgca acctggagga cacaaacctt    194580
     gccaatactc gcttgaaagt ttccaatctc cagaggtgta tatcaaaggc tcttgaggta    194640
     tttggttcac gctagcgagt caaaggatca gctcgctagc ttgatttgta tagcagattc    194700
     cgacgagatc aatcctgtcg cctttaccag cgagaataga taagaggagg gagcactctc    194760
     caccaccata ggaagggcca tatcaatcgg ttttgctgcg tgtgtccgcc atgccactca    194820
     cgttagctat gtcagttcgc attagattaa tcgtcatatt gcatttagtg atgttattgt    194880
     agaatgtaca acttgtaatg gtcaaaaggc cgaaaagttg aagtttcgcc tgacctgtgc    194940
     agaaaactga agcgatacaa agtcccactt cagggagccg acggttcgga aggcacggcc    195000
     ctcgttaccg atgcggaaag agctcatatc ttccttctgc ctaatgatac agtgtctagt    195060
     cccaaaccat gatcatagcc ggtgaacatg tgctgggttg attctggtga cgcggcctta    195120
     tgaggctaga aaacttaagc ttctagtttg gatggataga cggagaaatt ccgggatatt    195180
     cgacagcctc atggctacta gcagtagggc agagttagtc cctagggtca aaatggaata    195240
     gttcaatttg tataagcagt ccttcgtgag tccctgcttt ttcgccccca ctgactagtt    195300
     gctcgcatga ttgaggtaat acgtaacacg tgaaagtaag tctgtccagg ttatcgagtg    195360
     gataacattg cagtttcttt tgatcccatc gttagcgctg acgagaagcc gtagtactta    195420
     cgaaggtttt gctgttacct gatgtgggtt acaatcgagt caactcccta gaataacgca    195480
     gtagaagata ggggggtgtc aatggtgagt atttggaagc tagaaatggt ggtgatttgg    195540
     atattaggat caaagcagga ttaatgggaa agcgaccaag ctgtcacaga aatcttcatc    195600
     catagtgtac aattccaata atgatcagat gctatgcttt gactatacta ctatacattc    195660
     acaaatctct ttatacatat atacatactc gcccaacttg aacatcccac cccgtttggg    195720
     gtacatccta gaaatacact ttcaactcaa cgagtctcac cctcgccttg agggatttgc    195780
     ccttcgtctt gagggtcata tatgtcctgt tcggcggcat caggagtatc ttctccttct    195840
     tctgcctcct ctgctatcca gtcttcttcc tcttcttctt tttcttcttc ttcttccatc    195900
     tccaggtcct cctccagatc gtcgaactca tcttcatcat cttccacaag actttcatcg    195960
     tccatcaatt cctctttcgt tccgagttcc ttgcctcttt cctcaagcag cgtctcggcc    196020
     tccatgtcgt attcgtcggg gtagtcgagg gtctttctga acggcgaggg tgcaacatcg    196080
     gaatcttgct catcatcgtc cagctcagag ataccaacgt tgagcggagg ctcatcaatt    196140
     ggattcgaag aggcgtcctt tgattcgact cgaacattgc tgctgtcttg ctccgcctta    196200
     tcaccagtcg gctcaacccg cgacttagac ctagtcaggc cgccaacgcc aagaataccg    196260
     cctgtccata catagcgatc gcgtccaagt tcatcaacca tctcgccttt ctcctgccga    196320
     cgccggagga gcacaccttg gaacttctca cggaggtaag gcagtctagc aacggctgcg    196380
     attgtcttcg gcgccgcatc gtagatagct tgaaggtccg tgcctccctc gtggatgctt    196440
     cgttcgcgaa gtcgcctcaa tgcagcagcc agatatacca tggacacgta cgtgggctgc    196500
     atgaagtccg gctggatttt gctccagtag cgccggccca gtttgcccag tacattaggc    196560
     ggctttgcac gtttgggatt ctccatcgca tcaatggttg aaggcacacc cggcggtcgt    196620
     gccccatatc ctcgacgaag attatcccac ccagggaagt tgggcatgaa cttatgttca    196680
     aagacagtga aagcttcaat ctgatcggac aatctgtcgg aggatgcaag catctgcaca    196740
     aatgtggacc aattgaaggt tgtcatggag aagcctgcct ccacatactt tgctataacc    196800
     tcggagatct tcgaaacttc gtttccataa gccaaagaac gcagatacag tgagagcggg    196860
     cgagatagca tgaagcggta cgccggtagg atcgggtctt tctttgtcgt agctggctcg    196920
     cttgacgtag cctgggagga atcgggattc accacgagtt cggcatgaga tggtaagggc    196980
     ggtgtaactg ggttaagttg acggctaagc cactcatcaa tatcagggga agtgggactg    197040
     gctatcttca aagcgcgggt gaaagccaag ttccagcatt cttccacctg gtggtactgt    197100
     tcagccttca aatgtgcgag catcaaggca gacagcaaac gaagaggggc gatatcatgg    197160
     taattttctt cgtcggagtc tttaggtgca tgacttgcgg tatagtcatc gaaaagcctc    197220
     cgagccgaca gataagcccc cttcatacca taggcagaga tcatatattc gtagtaaaca    197280
     gcagggaatc ccttcctggc agacattcta ccagaaccca gcaaggggta ctttgtcgcc    197340
     aatttggtag agtggtaatc cgcaagagtc tctgcgagga acttctcaga gttttcgaga    197400
     cgaatatttg cgtggttgcc gacctgacca ccctgtgcca aaagttgtaa atctcgctgg    197460
     atctgactct tgagcacgag gagcctcgag ccaagtcccg gctggttgaa tctgtcttta    197520
     atttcgcgga agatgatgtg caccatatcc cgattgcgat ccttcagata gccatacagg    197580
     atgactgcgt agtggaattc agtagcgtaa acgcggcggc ctctgtggag tgccctgagg    197640
     atgcgacggg cagaatccgt ctggcctata agcacaagac tgagcatgag agcagaataa    197700
     gtcatatcat cgggctccaa tcctgcggca tccatccgcg agcgtatcct tgagatagct    197760
     tccaggtcca tccggaaagc ataattccag agtaggatat tccacattct tacgcgagaa    197820
     cccttgacgt cgaggccgag gcaagtctcc gcaacgtgct cagccatctc ccactcggag    197880
     ttgttgcaat aagcctccac aactgtatca atcatggggg cggttatctg cacgttatgt    197940
     tgttgggcca ggctgagcaa atcgcggaca tgagtgacat cgccccggtt agcacaaaga    198000
     cccatcatta taccgaaagt gtgcgagctg ggctcaacac cctcctcaat cattttcttg    198060
     aacatggcga aggtccctga aagatctcct gctttggaat aagccgtaag caggatgttc    198120
     caacatataa tatttggttg aaggttgaac tcttctgaaa ttcttcggaa ttgacgcgta    198180
     gtcttttcaa catcgccgat tctggcgtaa acatagagaa gcggagccac gagtttgcgg    198240
     cttcgcggct tcccgtggtc cgaaagaaac ctctcgaata catgctggac gttatccaca    198300
     tcaccggctc tcgaaaaaac aataagcgcc tgcctgtaga cgtcctctgt cggtttgcga    198360
     tggaattggg aaatctcatc gaggaagtat aagataccag ttgtgatctc gaacgaagca    198420
     agacgcttca acagcttagc cagaagcttt cggggtggag tttcttcttc catctgccaa    198480
     cggaaattcc gatataccac gatagatcga acaaacgtcg atcggtgctc tgattcttgg    198540
     aggatgttga taagatcaaa ataattccgg gaagtgacca tgtccaaatg attgaacttt    198600
     tgcagtagtg ctagtagggt ctccgtcgca gtagcttcgg caaattccgt gctagaaaat    198660
     acattgttga gtatgaagcg agtagcatga cgtactggac tgtggagact ctgatcttgt    198720
     aaataatcag caagtgcaaa caaaggctta tgcacggaag acaactgtag ccaaggcgcg    198780
     acagcgtgcc atagtgagtt gtcgcccaac ggcctcgatc tccaaatatc ttgcacataa    198840
     tcccatcgtt cagagttcac aaattgtgca aaacagtatg cccagcatga gacgccgcgg    198900
     ccacaggaga ctgcttcgcg acatatccca attacatccg aaaaatttcc cgtggcaata    198960
     caagacttgg tcatgtgcaa ataatcctca gaagttcggg actcggtagg cagagagttg    199020
     aggagtcgtc tggcccttct gctatcaacg tcacgctcag agctgccaat tcccgccagc    199080
     aatgcagaag tcaggtcaag agggtgacca gccttcgaaa aaaggctcca taatttatcg    199140
     gaatcttcga tctcctcctt atccaataac gctcgaagtt cattcttggc aatggcgcgg    199200
     tcttcatcgg caattatttc agcagagtcg tcgagcatgt gagcctcagc gtccaccctg    199260
     cggtctaggc taacagcctc tgacgagtaa tttctggaaa ggccagggac ggccttcctt    199320
     ttccgtcgcg ggacaagcct tctcggcgaa cgtatcaagc atgtcgctat aaactcctgt    199380
     gtgcgggggg gatagagaaa gtcgagaacg ggggcccgcg ggtccgtggc tgtccttccg    199440
     gttgtcgagg tggcggttga agtattcgac gcggatcttt gcgttgcctg taggaaaacc    199500
     aaaagctccg cccctgcgct actgaattgc ccaagagttg aatatatcga accccgacct    199560
     cgaacagcgc cgttgggatc ccggaagaaa cgccgtcccg cgttctcaag acatccggca    199620
     gcccgttcca gcattacctc gagaaattgc ggtgccaaac cctgaatttc accgaaactt    199680
     gactgcgatg cataacatat cgggatcaaa gctggattcg atgccaattg aggtcagtgg    199740
     gctgagcatg caggaatgtg cagggtgcta agggagtcag gccataccac gcaaagcaat    199800
     cttgtgcacg aagctcacag cctgccgtta gatggctgct cctcctggta agaatcaaga    199860
     gaagatcctg cttgagagga aacaaaaccg acggctccaa gcaagaaggc cagggggtgg    199920
     ttgatggccg ggaggttgac gtgggataat tttcgagatg gccgagcagc aagctttccc    199980
     gatgctggaa aagagaatcc cgcgaaatca gccggggatt tgtttggccg agacttgacc    200040
     acctcagccc gcactcgttc gggtgggaac accaccatcg ccccgagctc ccaccccagt    200100
     cgtcgaatat tgctggcacg atggagatca ccgacttcat tttctcccag agggaggaga    200160
     gtctcttgac gggaaactac aacgcttatc gagcacacac gactcgcaag ttgcacagcg    200220
     cccgcctgcg acttggacag accaccccca aacgcagcaa gtacattgcc aaacgacctg    200280
     tgacggcgga agatgtgaac agcaatgtgg agtatgtctc tgaagtcatc tttgacgtat    200340
     tcctttaaac actcatacgg ctgggtcagc tatggaaatt gtactaacac tccggatttc    200400
     ttagatacgt ccacacccta ctcatcagcg ccgaacgggc atgggcgaac gcaatgcaca    200460
     tgaagaccac tcactcggca gacccatcgg ccaagggggt tagcggtacg actagggggc    200520
     acattatttc gaaactacgg aaggcagtta catttgcgaa gcaattggtg cacgttctcg    200580
     aggatcaaga aacttctggt gctgcagaca ctgatgtcct cgaagctcgt gcatatctgg    200640
     cgtccctctt gggagcatac ttcttggaga agcgcaattg ggagcagtgt ctccaaaact    200700
     actccgtgtc aagagtgatc tatgcagctc tgggtcagca agtcaagaag gacgccttcc    200760
     gagaccttct ttccggcact gtcgacccca gtataagata cgcagcatat cagttgaagc    200820
     tcccgcggtc aaagcccatc ccgtctttgg ctcttagtta tttcccatcg gacgcgacca    200880
     tcaggtccga agttgagaag ttggacccca actgtctgaa ggaggatgca gcgggcactc    200940
     ggaggaccgc tgacggggag gtgcagcaac tccctggaag cgtcacatgg agatcgcata    201000
     cagttggctt ggaagatgcc gcaatctcac aggctcttgc gtccgcagcg gcagctgagt    201060
     ctcgtctcac tacgtggctt gcggaaggtg agggcaaaaa cgcctcctcg aaagataaag    201120
     ccgctgccta cgataatgtt atcatcgcca gtcaagatgc cgtcgatgct acaaagactg    201180
     cgatcgatga ccttgccgga gagggagttg acccgagtga taagagaatg caggctctgc    201240
     aaataacgcg gactgctgtt aactatgatc tggttgggtg gagaatcgga cggaaccgtg    201300
     tcctttgcgg agacaacgac ggcgtttcat tcgaatctgt ctcaaccaag ttacccaaga    201360
     gtgccaaggc tactgccaaa caggacgatg ctacgggtaa gaagctggca cggctgcgcg    201420
     aaagagtcgt cctgtatgat tctacccttc aaagtatcga gttcattctt gagcttcccg    201480
     gagttgccgc ggatacggcg tttgttcgcg aattagatgc aaagcggcgg tacttccgtg    201540
     ctttaaggta cggcagcgca gcccttccat accgataacc tgctaactgg agtctttctt    201600
     agatgtctga ccattggacg gtcgcacgga atcctgggca agtctaccaa tgccctcgcc    201660
     ctatttgcgc aggctttggc ccttgtcaca gagaccgcac ggtcgccgca atccttgact    201720
     gaaacggaag gaccaccgag gctggatatt tcccgtagtc aggtccagac tctggagctg    201780
     accttgaagg gcctggttgc gcaataccgc ggtttggtga ctttggagaa gatgtccgct    201840
     gaagcacagt caaaatctgt aactcagcga cccgcagtcg aacgtctaca cgattttgcc    201900
     ggtgatgctc tggatttgac caacattgtt ccttaccccc ctcagatgca gccgattcca    201960
     gtgaagcctt tgttcctgga cgtggcttgg aactacatcg agtaccctcg tcaaagcacg    202020
     cctgctgcag acaacagtca ggctcaaccg gaaccacagc cggaagagaa gaagggtgga    202080
     cgacgcggct ggttcggctt tggtcggtag cctgctagtg attcaggctg tggaagggtt    202140
     taatttctcc acctgcttca tttccatgac atagtgtgta atatgctgtt gcatgtcagc    202200
     acctaccagg tgtatctagc gtacatagta aatctgatga tgacgatact gcgaccaata    202260
     actcgcttac agcagagtga atcttaacaa cgtattccat gtgatctatt gctgccttta    202320
     tacaaattgt gttggtttta atctcaaaat gatagattga gagtatatag ttgtgccttt    202380
     gttgcagcac tctgtgcggc gcactgaagg acactttttt tttctgccac cgcctaaagt    202440
     tacagttttc tccgttgacc ttttcaggac tgtatgttct taaatccgct taaatccgga    202500
     cttttttcag cgaggttcgc taggttctgc cgcctaaagc ggtctaaaag gcggtaaatt    202560
     gtgaggcaca atcgttcata gggcacatcg cttgtagtaa attagatgtc gggagagaat    202620
     agttccccat actactgcta tctatcttgt acattgaaac agccaagatc tccttctatt    202680
     ctctacactg tactgatagg cggagaacca tccgggcgtc tccgactaca tccactcgtt    202740
     ctatcaactg tcaaagatgc tcagttcccc gtggaaaccg cacgggccaa ttctccggat    202800
     aagccgagcc acatccactc ggaagtttga cagccggatc acctttctca agtccagcaa    202860
     atggtacgat ggcaatttgt attgcttggc cactggtaac ctgcgtcgtc atacaattcc    202920
     aatggcccgt tagtggtcgg ctcctccggg cattcatttt attgaaccga aggtgtggaa    202980
     agatgattga tgtggcgtat gaaatattaa taatctgtgg tttgcagatt acctcgctac    203040
     ggttcatgca gtctagatga acaaggtttg ttgtgagctt catgggacgg atacgatgat    203100
     gcagcttgtc tttgtctatg tagtattcca tggagaatgg attctcgaat gcggtactgt    203160
     aattagtatt aatattggat ctttgggata cagatggctt tggatgaatc accactggta    203220
     gatatatatt cgaagcgagc actatgactt ggaaaatctc aacaggcacg tgcttcacaa    203280
     aacatggtca ggaaactgtg gagatgacca cctcacagcc tagaccacat tataataaag    203340
     tgttttatat tgacaatcaa tctaagaaat gacggaacat cgaacacacg atatccaaag    203400
     ggttcgtaat acaattgcca ttcattcaat atggatttga accgttctga ctattgagcg    203460
     ggaatgtcac ccgctttccc tttacgagat cggtacctgg tgctagtgat tcaagctagc    203520
     cacaatccgc ctagtgactg ctcaaaggag caagcgctgc ctgacaattg gctgcagcgc    203580
     atgtgggatg ttgccaaacg agccattctc gtcagaatcg ggacacggat gtacagcgtg    203640
     gaaatacgcg cgggatacga gcgatcatcc aggggcagct cgactttctc tccacatcag    203700
     ccatcctccc gtgcagattt gattccttcg agcaagggtt tgcttaagat tcccacgtaa    203760
     gcccacaaac tgcagggtgt cagtcaccaa aaattattct cattcgacca gctctctcta    203820
     atcctagtaa tatactagat tccctattat tgactacatt atactcctgt ttcctgcaga    203880
     atcaattctg ctccgtggaa cctcaagact ttttaatcat aatattctgc cgatcctgca    203940
     catcgggggc ttcctgcggc gccgtactgc cagactccgg cgttccggcc aatccagagc    204000
     gagtttgcct gccctcgcca ataattctgc cccgaaatta gagttgcgtc tcccctggat    204060
     tcgctttcct cttcttttcc ctccgccgcc gccgctctcc tcctcctcct ccctccgtct    204120
     tctccttccc taccccgttg gagaccgtta taccgaaccc aattgatcaa ttgatcatcc    204180
     gacatggcct ctgtcaacgg gagcttcgtc tccccctcgg ctgatgccgt cgtctccccc    204240
     aggctctttg agcccaccgg tctggtcgcc tctgtcctcg agggcttcac cgtttggaag    204300
     gccttgttga ctctgttcgt tgccgctgtc atctacgacc aatgtacgtc ttctctccaa    204360
     gccaatgccc cgagaatcgg gcaaaatcgc gactcaattt taaccattta tatagtccgt    204420
     tatctctggc tcaagggctc cattgtcggc ccagcatgga agttgccttt catgggacct    204480
     ttccttcagt cggtgaaccc caagttccac gaatacaagg ccaaatggga cagtggtgaa    204540
     ttgagctgtg tctccgtctt ccacaagtaa gtaatgcttt tgcgacatgt tccgggtgtg    204600
     cgcggaggcg catgactcga agaggccaga ttttaactta tctgcttata ggttcgttgt    204660
     tatcgcatcc actcgcgaca tgtcgcgcaa gatcttcaac tcgcccacct acgttaagcc    204720
     ttgtgttgtg gacgttgcgc acaagcttct tggtgccgac aactgggtct tcttggacgg    204780
     caaagaccac gttgaattcc gcaagggtct caacggtctt ttcactcgcc aggctctttc    204840
     cttctacctc cctcgcatgg aagaggttta caacgagtac tacgcccgtt tcttgcgcat    204900
     ctcgaaggag aacaacttca agcccactcc ctggatgccc gaattccgtg agctcatgtg    204960
     cgccgtgtcc tgccgtactt tcgtcggcca ctacatcacc gaagaagcta tccagaagat    205020
     cgccgatgac tactacatga tcactgctgc cctggaactc gttaacttcc cctttatctt    205080
     gccttacacc aaggcctggt atggcaagaa ggctgccgac atggttctgg cagagttctc    205140
     caactgtgct gccaaaagta aggctcgcat ggccgcgggt ggagaaatct cctgtatcat    205200
     ggacgcgtgg gtcaaggctc agcaggattc cgccaagtac cgtgagaaga tcgctcaggg    205260
     tattgccgtc gaggccagtg acaagcccgc ccaggtcctg cgtgacttca ccgattacga    205320
     aatcgctcag accgtcttca ccttcctgtt cgcctcccag gatgccacta gtgctgcctc    205380
     tacctggctg ttccagctca tggccgaccg ccccgatgtt cttgacaagg tccgcgagga    205440
     gaacctgagc gttcgcaacg gcgatatcaa ggcccctctg accatggagc tgcttgacca    205500
     gctgccctac actcgtgctg tcgtcaagga gactctgcgc taccgccctc ccgtcatcat    205560
     ggttccctac ctggtcaaga aggacttccc cattaccgag aacgtcaccg tgtccaaggg    205620
     ctccatgatt atcccctcgg tgtggcccgc ctgccacgat gaggaggctt accccaacgc    205680
     cgactctttc gaccctgacc gctggattac tggtaccgcc gaacagcaga ccaagaactg    205740
     gcttgtcttc ggtaccggac cccactactg tcttggccag acctacgccc agctgaacct    205800
     gatggccatg attggcaagg ccagtatgga gatggactgg gagcacactc ccactcccga    205860
     gtcggaagac atcaaggtct ttgctacgat tttccctcag gtatgttttc cttgcgctat    205920
     atcgattcga gttgaaagct aacaaagccc aggatgattg cctgcttgca ttccgtcccc    205980
     gcccttaagc gttcctgccg tcttcgctaa agacgtcagg cgctgcaacg tcagttatgc    206040
     cggattctcc tgccttgctg aaaaatagca agcgcctgct tcgtgactac gggcaccctc    206100
     ttctgtcctg gtgatagaat ggctgcaggc atttcttctt tgcctttctg aaatgtaact    206160
     acttgtagta ttgtttttcc tttttctcca atactttctg aacctttggg atggggagtt    206220
     gcggacggtc gaccccttga ggtatggcca ctggcctctg tctgttggag gtatcgacac    206280
     cgcggacaga gtgtctggag taacatgata ttgaaacgat ccaactgcgg tcgtccgctc    206340
     ccgcgatgag cgacgcattg aaggacatgt catttttaga ccacgctacc tagaattaat    206400
     aataataatg tgacacccga gctgctagcc agggaataga ataccatcac tagccctatg    206460
     tgaaagttgt agttgaatag gcttattccc atacaaactt caataacccg tgtctggatt    206520
     cacatctagc cctcgctatc actactacaa cccttcacta aactacagcc atcatgttat    206580
     ataaagccca tcccttcccg cttcctccca gactttccta cttccaacaa gctactacat    206640
     aagctcccac actcgagata agaaatatat acaatactat atacccaaca agaaaaatgc    206700
     ggcatctctc caagcatata ctattcctca atcggctatg ttcaccggaa atccactgcc    206760
     gatagcaata tatccatcca aaccctacat caagccaaga tgctttctca cttactacac    206820
     ccgttatcta taaaacaccg aatatctcca acaaacttat atacaataca ccatatacca    206880
     aatagcaaac caaccggcat gctatcgctg ccgtctgcgt cctagtgcct cagaacgaga    206940
     cgaacacaaa gaaggcaggt tgggctcccc tagtgaccac tcacacttac ggcatatacg    207000
     gaataaacct acatattctg ctcccacccg ccatctgcat ccactaagcc actaccctgc    207060
     caaatatgat ggcatctagg cgcgggagca tatctaccag caagtagctt ctacgctagg    207120
     tggatgtgga agcatatgtg gtttctgttt caggaccata ctgttcagag atggttgtaa    207180
     tggaacaaac catggacacg acatgttttt agaaactggt tgggtggctg ttgaggatga    207240
     ggaacaataa cattgtatat ggggacatat ctctccgtct actctgcacg tagacgcgat    207300
     ttattgttct tggtctactg gttagcacgt tgacactgca tgtggagaac gagacggtgg    207360
     acgatgagga tgaggaccgg agcattcatt gaagtcgtcg cttcgccgac gatatatcat    207420
     atatacgcac tgccttgcaa gagagcaaga gagtgaggga aagagtctta gatgctcttc    207480
     ctatttctgt ctcttccttc cctctcatac ggtgattgct ccaatgtgaa tgcagcgaga    207540
     cagaacagcg cggtcgatat gtcagacgta tctatgctga aatattacat cataatggaa    207600
     tggaagggca catctttgcg gctcttatat ctgggatgct gttatatgcc atggaaaagg    207660
     cagccaacgt ctatggacta tatgacgcct gttcagcaga tccgagcttt aatgccggac    207720
     cgcatatact gcccttccag atctgttctt ggaaagtaca ccatcacgga cttcacgcta    207780
     aaccctattt tggtaacggt agatcggctt ggagactctg ctctttttct ctcgatctac    207840
     aagggcagtc caatacctgt atcttgcgtt cctccataca gtcggccttc ctgtccttgg    207900
     gttcaccata ctatgtcgga tgcaaagacc gctacagagg ctcaagcatc cgcgttggag    207960
     cagaaacgga cttcgaatta gcattcgagt taaggtccgg taatcgagat attttggctt    208020
     ccaaaattgt tacaggccac acccctccga acgaaaccgt attggcattc ccaattagaa    208080
     tgccagctat ttctggatca ctaccgtcac ctttcatctc gaatcctgcc atataatcca    208140
     tgctaggtgt aacaaggtat cacagacaga acatggtgga ggcctatggt aatctacata    208200
     gtcgcatcat atctgactgc gcggtttctt gctttcatga tcaggtggtg gttatttgtt    208260
     cgagtccgtt gagtacggac ccatatatct gaagcaactg aatatcctgt tagaaatgat    208320
     aaggtagtat gtaaaatgaa gcctgtttag ctttaaactt atgctaataa cttatatatt    208380
     cagtcccctg acctatatct tactggacag atctagctag cattgttcaa gataagattt    208440
     cttttctcca ggtcacttcc tagagacgct cggacacgca accagtcata ctgtgggaac    208500
     atataatgga cttctcgaag ttcaggttac tagagatcgt gaaactggga agctaatcac    208560
     cacctgtgag catagagttc ttggctctag ccagggaaca ctctttactt ccaagattga    208620
     cttaggagcc ttattatatg atcgcgtggg agaaacacac ggtatgtatt ttgcaggttc    208680
     tgaacagaaa aatcagacat tcttcatata tattggaaag agaatggttc ttgggcttaa    208740
     agagattctg tggctatacc aggccctgcg gaaattgctg taatactctt atcttacaat    208800
     ttataaaagc ctgtattcct tcctggatcc tgtattcttg ccattgttct aatttcaagc    208860
     aatctgcaga cttagcattc gaaataatcg ggtcatggta gttgtagaaa tagaacatat    208920
     ctagatagtc ccgaaggcgg tcaacactgc aactgacatc acccgaagcc ggacttccat    208980
     ccgtcggata tcggctgtca ctctagcata tcagctcgac aactttctgg acttgcctcg    209040
     atctccaacc cagacatatc aagtcatctt tctctggggt aagtactcct ctactcacga    209100
     gccactgtac aatttagaca atagacacca tataatctca aaccagacac taacttccgc    209160
     agaactccac caactacctg ccccattcgc gcaacagcac cagcaccagc accagcaaca    209220
     acctcacctc caacccagtg gacgaaaacc aacaacaatg gcctctctcc tccccctccg    209280
     ccgggcaccc acgtccctcc tctcctccac ctccaaacaa tctaccctcc tcgtccgctc    209340
     cctccgagcc agcaccacca tcccctccac ccggaccttc acaacaagat cctccaccct    209400
     cctccccaac accatcacca agagaaccac cattaccccc atttctcgcc ctcatcacca    209460
     cctcctgatc tcctccactt ccatccgcca aaaaagcacc aaggacaacg atgcccccac    209520
     cttccgccaa tggggctttg aagacgtacg tccctaccta cctactacca taacccccca    209580
     cccaactaac caaagaatag ataaacgctt ccctccccaa cagcccgact gaaaagccca    209640
     tcattttaat cgacgtgcgc gagcccgccg agctctcctc caccggcatc atcccctcgg    209700
     ctgtgagcgt gccgctcgcc tctcaaccgg acgcactctt cctgactccg gaggaattcg    209760
     agacgaggtt cgggttcccc aagcctggtg tgaaggggga tgaggagggt gccgagattg    209820
     tgttttattg taaggcgggg gtgagggcgc gcgccgcggc gcagttggcg gagcaggcgg    209880
     ggtatgaggc aagtaggctg ggggtttatg atgggagttg gttggattgg gcgaagaagg    209940
     ggggtagggt ggagaggtgg gaggggaatg ataattaatc ttgtcttcta ctaggtatgg    210000
     atggtagtag gtactgattg tgtgggtaga tgatggttgt atgtgtgccg ggttgggctt    210060
     gtatatattg tatgttgcca tagtactact agtatcatca catcaaatgg gttcgtttcg    210120
     aaagtgaaca atcatcacta agtactacta gtagtggtcg gtataaggta tagttagctt    210180
     ctactatgct ctgcaaattc gaacaaacaa tcaattcaac tagagatcca tgattatcat    210240
     taacagaaaa acaaaaacct aggtatcgac cacgctttac ttttccaacc acctcttctc    210300
     ttctcttctc tctctctttc ccccctttca tgtcatgtac aggcatcttg cttttgattg    210360
     aaagtcgtag tcatttctca tgcaatgctc ttttactttt tcttcatcaa atcctgagaa    210420
     tgcacccaca taaagcagca cttgtctcat catcgcggca atggaacttg agatcgctat    210480
     acaataccac gataatggca tgctgaaacc cgctaccaag cgccatgacc ccgccacgct    210540
     gtactcaagt gagtgcccag agctggtgat ccaagggcca tgcatggggc tgggctcggt    210600
     atccgggcta cagagggaac tggtaaggcg atcatgggat gtcaaagaca ggcttgagct    210660
     tcttgacgag accccactcc tccatcgaga catcggagcg gtagaactcc ttgagggtgt    210720
     cgatactggc acgggagatg tgcgagtaca gggtgtcctt gtcttcgagc tgacggccgt    210780
     acatgggctg gttgcttccc tcgatcttga cggccacgga gggttgaccc ctcttgcaga    210840
     cctggatggg cttgtgatca cgttcgatag agacactata tgcatgatta gaatatgtaa    210900
     agtagggata ataacggggg aaaacttaca ctctgccaag gtcgatgatt tccttagcgc    210960
     cagtctccgg gttggccttg actgccgcaa caggagtgtg cagacgcaga cttccttccg    211020
     caacatcaac accgatgacg atggggtcct tcttgttgaa cacagccacg gtcttgagta    211080
     cgcaggggaa gacagcaagc atcttgctct cttccttgcg gcgctccgtc agctcagcca    211140
     tgtgcttggt gaagtcatcg aacaggtggt agatgatgtc ggcagtgaaa atcttgacac    211200
     cgacttcatc ggcataggca gctgcttcct tgtccacctt gacatcgaaa cacagcataa    211260
     cggcgtactc cttggccttc tccaacatgg taccggccat catgacatca cgcttgtaca    211320
     caggaccgat agaaatgttg gcgacgggaa tcttggagac acgaaggaac tcgagcagag    211380
     cctccagaga tccgagagtg gaggcctgca cgctgacacc acgctggtcc ctagagacct    211440
     tgctaagcag gttctccaga tcggacatga cctcttcctc aatgtcctcc tcgtcgtcat    211500
     caggtccgac aaccatcaaa cgagaaccgg caatggcctg ctcaaggtcg ttggcggcaa    211560
     tcttaacacc aagggcagcc ttgacctcct tgttgtgcac gtactgcgac ttaagacgca    211620
     gttccttgag aggagccggt gtcaacaacg ctcgaatatt cgtagatata ggaccgttta    211680
     gaccgcacaa aacgattcga tcaccctcgc ggaggatacc gttcgacagg actacgtcaa    211740
     tggtagtacc gagaccctca atgaccttca cctcaagcac agtacactca acctcggaca    211800
     ggtacatcag ggagttggtc atacgctcct gggtaagagt ggtcaacagc ttgagcatgt    211860
     cagggatacc ttcaccagtg tgggcggagg tgggcacgag agaaacgttg cgggccatgg    211920
     acttgttctc gtagaacagc tccgagttaa aaccctgttc ggcgaacaag agcttagtgc    211980
     gctccaaacg ggtgcggaat tcgttctgaa cgcccttgtt ctgcaaggcc aaactctctt    212040
     ggaagccgtt gttgtcgatc ttcttccagc cgtacagacg atcaatcttg ttgagggcga    212100
     cgatgaaagg agtgcggcga tcacggagca gcctcatgga ctcaagagtc tggggctcaa    212160
     gaccgtgcat gatatcgaca accaggatgg cgatgttaca aagggaggaa cctctcgaac    212220
     gcaagttgga gaaggactcg tgaccagggg tatcgatgat gagcagacca gggatcttga    212280
     actcaaactg gccgtctttg ttcaccacgg cagtcttctg acgcagagca tcaacaggga    212340
     agtaagtggc accgatctgc tgcgtaatac caccagcttc accttcctgg acgtttgtct    212400
     gacgaatctt atccagcaac ttggtcttac cagtatcgac gtgacccaga atacagcaga    212460
     taggagaacg gaggttgtcc ttggagcgcg cggccatagc ctcctcgtgc tgcttctttc    212520
     tccgctcggc ggcctcggcc ttgcgctgag caatagcctt ctgtgccgcg gactgctcct    212580
     cgtcctcaga gtcctcgtca gaggtctcat cggaatcatc ctcactctcg tcttcctcat    212640
     cctccttgga ggcaggcttc tcggcagcct tgccattggt ggcgggcttc tcctcttcct    212700
     cgtcgctagg agcatcccag ctgtccttca cttcctcggc atcagcagcc ttctcccagt    212760
     catcgagctc gctctcttct ccgccagcgg cagcagcagc ctcagcctcg gccttggcct    212820
     tcttctcttc ctcctccttt cttctgcgtt cctcttcagc ttcacgctgg gccttggcgc    212880
     gggcagcagc agcctccagg tcatcctcct gcttcttggg tccacgcttc ttccggttct    212940
     cgtaaacagg gcgcttcttc tcggcctggc cctcttccag accagcaacc ttaccaacac    213000
     cagccgcaag catctgctgc atgcgccgct cattgcgctc cttggcttcc ctctgggcct    213060
     tggtgagcag cttaccctcc ttacgaagct gctccttctt ctccttctcc ttctccttct    213120
     tcctttggcg ggcctcttcc cgcttcttct cctcttcctc ttcaatacga cgtctctcct    213180
     cctcagcggc ttgcgcctcg gctaacaggc gctcctcctc ttcacgctgc tggcggagag    213240
     cctcctgttg cttctggata gcaagcaggt gtgcagggat cttcttcttc ttgccgccgg    213300
     tttccggaac gggggcagca gcgggggcgg gggccgcctc tgccttcttc tcaggctcgg    213360
     ctttagcggg ctgagccttc tcagcggggg cagcggtctt cttcttggca gcctagatga    213420
     taaggtggac ccatcagttc gacacgatca tgaaacgata gaaaagctgc aaaagcgcaa    213480
     gaaacatacc tgctccctct tacgctgctt ctcacgctcc ttcttctccc tctccttctc    213540
     cttcttggac ttcacacgga agccaccctc ctcctcctca gcgggcttgg gctcaggcgc    213600
     agcagcagcc ttcttaggct tagcctttcc ggcgaacaca tcgtcttcat cgaaggtacc    213660
     ctcctcaggc tgcttgctag cgaaatcggc atcgccgttg gcctcctgag tggcatcctc    213720
     accctcaacg aagtcattga ccggctttcc cttcttcgcc ttcttgttct tgttcttcct    213780
     caaagcggcg agcaaaccgc caccgcccat gccagcatcc tcgtcggcag gagcaccttc    213840
     ttcagcagcg ggagcttcgg cctcgccacc ggcagcaggg gcagactctc cgagctcagc    213900
     ttcccagtcc tcctcttgcc tcttatttcc cttcttcttg ggcgccatat tgataggttg    213960
     aggattcggt cgacctcgtt tttattcctt tagatggata tgtggatgga tattacccta    214020
     tgtggattaa aaatgaaccg ttagttaagt gaatagaaag gtactatgtg accgagcgat    214080
     gttggcagcc aatgtggatg aatggtggtg gtgcgcacta acaatgaggt atcagctttc    214140
     tccggcccgc gcgatctgcg gaaggcaaag agtggcaaaa gatgagcccg aaaagaaaaa    214200
     accttccaaa agggatcgtg aagaatggga agaaaaagaa agagcgaaaa acaagcaacc    214260
     gttttccccc ctggtggtcg ataagatcca aaggttggag actcgatgag gcgggaagga    214320
     cgagttgcct ttggggtaat aagaattttg ggccgggcgt ttggtgggga caatcgccgg    214380
     attattatgc gagaggccgc cggtggcccg cgctcttatt gttcacggcg ggcacacaat    214440
     aatcaccttc atagtattaa cctgctggct gcattcaatt tgcgtcaaat attttgcatc    214500
     tatgtacacg gtacaattct atatatatag cttggtgtca aatattatcc ttcacaaccg    214560
     aaattggtag atacccttag acatccaccg ggaggatccg ctgcagccat ctcataacgc    214620
     tcgcaaccgc atcgcttgtt tcccccagtg cgtgtctagt caattccgca aagtgctcgg    214680
     ggactccctg ctccggacgg attcctggag ctgccggacc accgagcgtc tccttactta    214740
     gcatctgcat tagatagcca ggcccgcgta tgagcaagcg gctgagaacg tcaccgtcaa    214800
     tatgcatttg agatggctga gggtccatca gcccgaccgg gttgcgctgt cttctcctct    214860
     tgggaataaa tgggcagatc atgggatcgc ggatgcataa gtcctgcagc aagcgtagaa    214920
     ggcgccactc cttctcacca atagtcaaga aacgatagac tgtgccattc atcgcagtac    214980
     catagaatac ttgagaggta gtggaaagag gtgacttatc agagccggag ctcagcctca    215040
     tcactgatga gggaaggtgt gcttcgcaca gagctgtggg tagcatcttg ttggtctctg    215100
     tcacaccatt ctccgtcaaa aggctcacgc gcccacctct gctggagcag aggacaaggt    215160
     tcaacttccc accaatataa acatgggcga gaccatcatg cttttgacga tcataagcat    215220
     ggagtgttaa cttgtcttct gtggccttga gcaccatgag tgattctctc gacgtggtca    215280
     tgtagaggta cggctccctg gcagttatga ggaccgccgg agacaggaca gagtatctag    215340
     ccgctcggac ccatcgtgtc tgcgagaatt ttggttcaag tggcacgatt tcatggccag    215400
     tggaaaccat caaggtgaac gcaccgtatg gcgcaattgc gaaaaccggc ccctcaaact    215460
     tgtggatata tttcacagag cattcgatcc gcgacggttt cgacggatcg cggtatgcct    215520
     gtaagaatat gactcggccg cgctcttgct gatgtttgcg agaagtgccg atgacaataa    215580
     agtgatattc ctcgtcccct tttctgggcg tccactccag tatgcagctg atcttctctc    215640
     ctgctgcacc ttgaggtctc cacggccggg gatcgtcttc caaaggattt tcgagggagt    215700
     cgatgagcga gttctgcatg tcagggtcga taaactcgat gaagggccgc gtgtagcgct    215760
     tgatggggtc tgcgtctgtg tcgtattctg tctgggaata aaccactatc aagctcttga    215820
     gatatcgcga ataagctaat ctgctagcgc taccgggcaa gtcgatcctc cttggaacag    215880
     tcttcgtccc ttgctccaag gtacatatca tgagctgtcc atcggcgacg cagaaaagcg    215940
     tgttggaaaa tccatccatg tcttgactcc cggagctcga gatggaaaag ctatgaatgc    216000
     tttttgggtg atatgcaggc tgaaggatgt tagtgtttgt gatcaaaatg atgggcttat    216060
     gtcactcaca ttattctggt cagtgaccca tatcctctga agtgagtaat cggccagtct    216120
     gccggtgcaa gatgcctgcc agaacccttg tccacaagtc aataaggcga actctccctt    216180
     gccctgtact tttaccgatg tgtgccctag gtgctgcggc gctacctggg ttaatgctgc    216240
     atatcaggcc aattagcata ggaattaatg ggttgaactt gtgttagaac aaatctcacc    216300
     aatgggggag tcaatactct ccctgtccag taatagcccg aatggaacca ggataccgct    216360
     tcgcaaaccg catagaacag tgcacatttt cagtgattct tcaccggcat ttttgatgat    216420
     agcaatactg tcaatggctc tcgatatgtc gttctcattc tcgacgttga cagtggcttc    216480
     cagtaagaaa gagatgcttt ctgataggcg atacaccaag atccttccgt tgctcgtgcc    216540
     tacaaacaga aacagagacg agtcaagatt ttccatgatc atacaaatcg gctcatgttg    216600
     aatcaacgag ggcgtagcga catcaagcaa ctggtgctga ccatctgatg tgagtttctt    216660
     gaagtgaagg cgtacttcat cttgcgtcct aacaacagcg gcgatgagtg aggccggtcc    216720
     atcaacagca gccaccacaa tagtctggcc aggaccgact tcagagcgat agcccggcat    216780
     ctctggggtt gcgccaacgc atactgtcct gtctgtcacc tgtatgatag cccccgatac    216840
     agtgcatcct gctgccaggg tctgtgtgct agagtcgagc ccagattctg cctcatcaat    216900
     ggcgcaaagt tcttctccaa aatcagcagg caagtacaac agaagtgagg acatagggtc    216960
     agatgttaga acaaaaacgc ccccagtcga tccgtctggc atggtccata tatctctggt    217020
     tccagacagc tcctccagcg caacaatgag cccgatttgt gcttcaacgc cgtgccgcag    217080
     ctcaactact gcacctcgag agaatgatga agcagagcag acaaaaaggc gatcgcttgc    217140
     aatatccgaa ggtgtcgtat cctcactctt cacaacaacg gagtcggtga caggggtcca    217200
     attcataaat ttctggacac accgcggatg gtcacgagcc ttctggacaa atagcccgcc    217260
     atcacctgtg gtgcccgctg caaggagcag gtcaccacct tcgtagccga tgtccagaat    217320
     gtcaaatgct gcatcaacat cacagcacag ttggcccaaa tgtgcctgat tctcgagctc    217380
     accgtcagtg ccaattccta agtaggttat ttcaccgtcc tcgcgacaga ggtaaatgtc    217440
     atcatgcttc tgattgtaca accagttgcg caacggcctt gcccatctgg tccagagcgg    217500
     tgacttctga gattcttttt catagacagg gagcgggtat ctgctaggga gtctttgagg    217560
     gtcaagctta ttttggtata ccgttatcga tgttgtcgtg acgagcatga atgaagaggt    217620
     cttagtcaat ggaatcaaca ttgtgggaag cctatcctcc agcggcaata cttttttggt    217680
     cacccgtggg gtagcctggc gtaaagactc gttggcatcc cactcgtaac aaacagcctg    217740
     tgtcaactga tcctgagcaa ccaatagtag taaagtaatc ttgtcaccgt cttcagactt    217800
     tggatacagg aattccatgg caatgatatc gccttcaacg cggaagaagc gctcctacaa    217860
     aggatcacac aggttagctg caattcagta tctaggatca tccaaaacta tacctctgct    217920
     atagggtcta gtctattttg ggtcatctgt gcttggatga ccggcggtct cttcaggacg    217980
     aagatcccaa aatagtcact tgaagcacta acagctaccg cacgagacct gcaaaatctc    218040
     tcagcctatg atcatcataa acaggttcat gaagcggcat accttggttc cacagcaata    218100
     ttccggccga atcgttcaaa agcactgaca tcatttggca gcggccgacg atggtagaca    218160
     aaatggccac tcgcgttcga aaaatataga aatactagct ctttcgaagc aaggctaaga    218220
     accaatattt gtggaggaag gtcctggcgc aagtccgagt tcgcgcgcag tgtcgaattg    218280
     ctcgccccaa gcttcatctc ctcttcccaa ggcaattcgg tgctgacatt aacgaccttt    218340
     gctgccatga tacatgagtc gaagtcactt ttggtagtga cctcctccaa gtgaaccccc    218400
     gataccgctt ctttgatttg caaatgccgc tcacccacga agacgacatc attttggtct    218460
     ttgcttctga ggtgcgcggg gaggatccac tggatgatag gactcgatac tagagtatgt    218520
     gacaatagcc caatttttgc ctgggatgca gaatatatgt tctctgtctc gatgtccata    218580
     gaatctccgg tcgccgaagt agttacggct aatcctgcac cgcttcctga tgtagccatg    218640
     gtagctacta ttattgactg tggggaaagc agggcccgta gaatcagagg gaaaatatct    218700
     cttgccaaac gaaagaatga gaggaggaca cgaaatggaa agaaagaaag acgcgaagat    218760
     gaaaaaggaa atcaaaacga gaggatatga cagccgacca acggtgtcca cagctgcttt    218820
     tcgagggatc ccgactcctt attctgtgga gctgaaaatt cagggaagaa tggaaggggt    218880
     ggtctctcag aactatggtt tgagaatttt catgcttagg atgatatgag aaagcaattt    218940
     catgtcagga aagtgctgag acaccagagg cgaagtgaac acagaacgca gtgctactat    219000
     gcgaatacaa atcaaagagt aattccctct gtagaaatga taccgctatg caaaaccgaa    219060
     agctagtaaa gtatcagcaa actgcaatct atggaagact gccacagggc aaggattcgg    219120
     gacttacact ccaaaggtat cttatgcgaa cgcttgcggt ggtgctggtg atatgcactg    219180
     agacggcttc tcgattctct taaacaccat atggttgtcc aaaagtttat gtttcacaat    219240
     gaaaaagcgt ttatgggaca cagacagcgg ggaagtagta tgtcgaatta aacacgatgg    219300
     ccagcagtgg aacccaagcg gtttgcggga aggtcaattg aatatgtttg gttttagtat    219360
     gatgccatcg gcccactatg agtttgcagc attgtctgca gctatctttg cgaaccagca    219420
     agataaattt gcaaggatga cagaagttgt tgcttgcgaa taaaccgaca gtgactctgg    219480
     gactcgtgaa gacctcagcc agccatgtaa gaagttctgg aggggcagtg gatcgatcat    219540
     cgaagcctcg cctgctcgtt cgggcggtcg gcgatacaga tcaaaccaag caaatcacag    219600
     atcacgggac acagacctgg tgtgtggcct gaggcggcca cgcgtccgtt ttgggtttgg    219660
     ccatggccgc agtcacctcc ggctttgcat atcgcctatg ttatcccata gatatttcgt    219720
     tgcctagatt gcggtgctgt cggttaatct ggagaagcta gggccggacc ggaattgaat    219780
     actgggcgtt gatttcccta aagcaagctc tgacctggcg agaggcccgt tcatccgttg    219840
     catccaagta tagactactc attgttaacg ctatacatcg ggatacaaaa ttaatttata    219900
     tcgtcaaatt gtttcattcg gaggctggcc tgcagagact caaattttat acacaccagt    219960
     gttctgagat acactgcccg cctcaacgat ggaccagcca tctgagaata acgagccaga    220020
     ccacatcacg gagacaagtc tggaaacaga gcagaagact gccgccgaag ccgaggccct    220080
     tgagtcagaa aggctcaaga atgctgagct cgaaagacgc agagccgaga aagaaaaggc    220140
     cattcgtcaa gcatgcgact tgcgcgattt tgatgcacta gtctcatatg ctacctcaga    220200
     aggcggcttc ctcaacgatg atgtccggcg aactgcctgt gagaactacc ctataacgct    220260
     cacatgcact ttctgacgtt ctatcagggc ctatccttct acagtgtgat cgacgtggac    220320
     ccaattttga ttttgcagga tgggaacaac tacctgcaca tagtgacgaa gaacaagttc    220380
     agcttgatgt gaacaggtcg ttcgtctact accctgaatg taagtcaccc tttttatggc    220440
     tctcggtggt gtctaacttg accaggctct gaccaggagc tatccatcaa gaaggatgag    220500
     ctctccaagt tgatcaagca agtcttgcgg tgctttccca tgctctgcta ctttcaaggc    220560
     tatcatgata tcgttcaagt cctgctatta gtgcttggtg gccaaaatag tgctgctgct    220620
     gttgcacaaa tttcccttct ccggataaga gattacatgt tgccgtccct ttcgccggcg    220680
     ctgaaacatc tagagctgat ccctgcgatc atcgaaaagg ccgatcctgc attacgacgt    220740
     catctcgccg aaaccaaacc attctttgca ctcgctgcga ctctaacaat gtactcgcac    220800
     gatattcaag aatatagtga cattgcacgc ctttttgact ttctgctggc ccaggaaccg    220860
     gtagtctcca tatacctttt tgcggccatc atcctctcgc gcaagaaaga attacttgag    220920
     ttttcagtcg atgaaaccga tatgttgcat tttaccctgt ccaagcttcc aaatcccttg    220980
     gatcttgagg gtctgatatc ccgcgcgatg cagcttttcg aagctcaccc accggaaagt    221040
     ctaccatttg gggcctggaa gcgcattcca gagtgcagtg tgctcaagtc ttcacgggac    221100
     cttgtcagga tccaagcacc tgatgagaca gtcggcctct tcgcgaaaca agtacggcat    221160
     ctacgttacg aggagcggaa ggagaagacc gttgctttct tgtggaatca cagacggact    221220
     atcggctccg tggcagtgac gatatttatt ggtgctatgt cgttctggat caagaagagg    221280
     ggatttgaca atacgatatg gtcgtatgtc agtagattcc acggggcttt gcaggcccga    221340
     ggttacattt aaccttatgt caccattggg aaaagacaga aaggcaccgg ctcacaaaaa    221400
     aatatgcttg ggaaatatat gtaatattac tgcacacgaa gaaatatgtg ataagaaagg    221460
     aaatataata gttttgagag atgaagaaca gcctcagcac acagattagc cagtagaggc    221520
     ggacgcacaa aatgcgaaac acagcccgcg tcagcccgtg ttgaatagat ggacagtctc    221580
     cacatggtgg ctagtgcgtg gctttcccgg cagccgctga ggtgtactct tgcattcccg    221640
     catctcccag gaaccgagag ctcaacaacc acctttgaaa acgaacgtga gctgcccaaa    221700
     atggcgaacc agggctacga cgtggtagtg gacgttgacg ccgaggtaag accccgtcaa    221760
     cagtccgcat ctgtaaccat agtctactaa cagcaatttc cagggcgatc tcggccatac    221820
     cgacctccaa gaagacctcg aattccaccg ttccagtaag ctagctggcc ttgagtacca    221880
     acacctcatc ccaatgcaca cctacttacc tccattatct cagacttcga aaatgaccaa    221940
     cgcaatgcca aggcccaaca agactcggcc cccttcctcg gcggcggttc atcgcgcggc    222000
     cgtgaccgat cccccggcgg cacaccctcc aagctcaact ggtggtcgat ccactactac    222060
     tcgcaattct tcgacgtaga cacgaacgaa gtcctccgcc gctgcgtcgc agctctttac    222120
     ccgcgcagca acttcctcga cgtcctagaa ggcaacccag acctctacgg ccccttctgg    222180
     atcgcaacca ccgtcgtcgt catcctcttc ctgaccggca ccatctcgca atggctctcc    222240
     aacaatgacg acgagcactt cgaatacgac ttcactttgc tatccggcgc cgcgggcttg    222300
     gtttacggat acacgggcat catccccatt gcgctgtggg gtgcgctgaa gtggtttggc    222360
     agctccagcg cggacttggt tgagtcgtgg gcgctctatg gatactcgaa cctggtttgg    222420
     attgccgtcg cccttgtcag ctggagccct ttgacggcgt tgaactgggc tctggtgggt    222480
     gttgggttcg ggtggactgt cttcttcctc ctgcgcaatc tgtacccggt tttgagtgct    222540
     acggatgcga aggctagtaa gatcttgctg attctggtca ttgtgctgca tgctgggttt    222600
     gcgttggcta ttaagatctt gttctttgcg taagtggttc cctactattc tcccttccgg    222660
     tgtgattatc ttactgtgag gggttctgac taacgtgata atttatgcag acatggaagc    222720
     cctgtttcga agaagaacaa ggaccatgat gacgacgatg atcacgacga cgacaagcga    222780
     cggatgttcg gtggttggta gaaaagaaaa ggtgctagat gtcggtgttg gtatcggtgt    222840
     cgtttccgga tgttatactg ttcagttgct gtctttcccc tcacatggga ccatgacatt    222900
     gctccggcag cattatgtca tgtcatgtct cgacttgctg gtttatgttc tcaagtgttg    222960
     ttatctctga tatcgtttcc accgttttgt ctgttgaacg tttttcctct tccaagccat    223020
     gctgcatgtg tatgtgtatc tactaagaat gcgacgagag ctttttttga attttacagg    223080
     ttgtgctttg attgcaactt cttcccgagg agtcaactat agacatttga cttcggctat    223140
     aagtaatgat tcatcattcc aacgccatgt agaaaatctc ccacgttgca atcgtatcgt    223200
     aaccccagca gctcttttcc ccagcaacgc agaaaaaccg taataagata atcgtctatt    223260
     tgagcttctt cttggggcgg agctggttgg tgtgaccaca cttcttcttg cggcagttgg    223320
     tggcacgggg gggaagacgg gcctaatcgg aggatcaatg ttagtggggg aaatggttcg    223380
     ctaggcggga ctcaaaagag ggcgggatcg agtcggaaga atagaaaagt agaatagatg    223440
     gatggacgta cgtagcactt gcggcagatg gacttctcgc agttgtactt ggaggcgaga    223500
     gccttaaggg agggctcgat gataccacca cggagacgga ggaccaggtg gagggtggac    223560
     tcctatagtc gagaaaaaga acccgtcagt caaactatat ccccaatagt caagtcgcat    223620
     cgaatgtcga tagtcgtgaa acgttcatga atgcgaccgt gccgattgat cctcccctca    223680
     aacccaagta gtatgttgtg gcgccccaac cgacccgtat cgcatcatgt tcgtaaccga    223740
     ctatccgagc agacgaaatc gacgtataga tgattcgcgg aaccgtttca ctcatacctt    223800
     ctggatgttg tagtcgctca gggtgcggcc atcctcaagc tgcttaccag cgaagataag    223860
     acgctgctga tccgggggga taccctcctt gtcctggatc ttggtcttga cgttgtcgat    223920
     ggtgtcgctc gactcgacgt cgagggtaat ggtcttaccc gtgagggtct tgacgaaact    223980
     attaatcgga gaagagcctg ggtcagtttc cttatttcat tttcgatgat atattcgtgc    224040
     catctttcgg gattcgaccg taattcgacg ggtggttgcc aggggacttg gaatgaccta    224100
     catctgcact gcagagacgc ggaaaaaacg acatgttagt ttgcgacttc agggaacacg    224160
     catttcgcat tcacgaatga agagggtata cgtactggct gcggttttcg ttgttgctgg    224220
     ctgacgatcg gctgaaaggt cggtcggatg aggcgatgtc aatttcacga tttctcgctt    224280
     agcaaaggtg gaacggaccg cacgtgatca gggtttaggg cagtccggcc gcgttcgggg    224340
     cctctccgca gtctccatag cccgtagcct aactactttt acatcatcca tttagcatca    224400
     tgcatacgtt ggaggctgtc cgtggtccgt ggtccgtggt ccgcggtccg tgttgtgatt    224460
     gtgctttcat gatgctcgat ctaacactac tgttcaatga tacaaaacaa gcctccctta    224520
     caaatttgta acatgcagag aagcctacga ccatatatga ctaacgatct cggaagtttc    224580
     tatttttgat gtttatatac tactacttca aggccgggac ccaattggct ccgtttccca    224640
     gtatatatga tcgccaagct caactttact cgccctcctc cagctcagac atactctctt    224700
     cgtcattgtc tgaatccgta ctggactcct gagagaattc catgcccatc gatccaaagt    224760
     actcaacccg gcgctgctct tccagccacc ggttgatttg attctctgct tgtgatacag    224820
     ccctgatcaa tgtagatatg gaaacgccga ctaccttggc agctgtctcg tagaaggccc    224880
     tcgcagtatc cggaagatca gattcggttc gataccgcgt gtaagagcat cccggccggg    224940
     gagtgtccag gtcatccttt gcaatgactt gtcttgctct taattggctg gtggacgcct    225000
     tgaccaattc atccagagct tcctcatctg ttagttctgg agtaggagct gtggcctggc    225060
     tttccccagc acttggacca gtcggaaaga gctctgcgag gggatttgat actggaacac    225120
     tattcagcac tgagaagaaa ataatgtggc atatgtctca cctttactcg catcaagcca    225180
     attattctcg taccaatcca tatactcgtc gagctgggac ggcgtcatgc tgaagacgtc    225240
     tctctcagtc accaatattt cctttccctt gccaagctga cccgcaggcg tctctcgatt    225300
     gtcaaaatgc ctctgtattt gtgaccaaag actccaatcg atcacttgca ctgtgggctc    225360
     ttctatgttc gtgggatatc tttcaacatc gtcaaatggg aatagaagct tggtggagat    225420
     gacaactaga gcgaccagtt gcagctcggg cagttggagg ggccttctcc ttccagatat    225480
     gcttgtaggg aattcgaagt tgaaccctag aagatgctgc aactttttcg cggctggata    225540
     aatatcgact ggaagtaggt taacgaatga gaataattga agatggggcg ccgcatacga    225600
     ggaagcgcaa gtctcttgac gtatttatat aacaagactg gccagttcaa agatggaaat    225660
     tgcatgttga atttgccatg ataaagcagc agaaggtccg agacagctcc gtgaagatgc    225720
     tcggcttgga gtagcctcta tcatatagtc agatacagcc atctatttct gacatatcat    225780
     aggcactcac cgtggtctca agtatggaaa tgaactcttg tggtagtcta tctctcatct    225840
     cccgaggaat atcctttaca attctgatga aaggaacctc gccacgcata accatgctaa    225900
     acattcactt agcccttgta acattcaaag tggttcatgc ttaactactc accgataaaa    225960
     atccccaaca cccaccggca gcctcattaa cagagcacct agatagcaca gagcaatgct    226020
     atcaataagg cgaggccatg tagcctgcct tcctctgaac ttgatgtcct cggcgccatc    226080
     aagccccgag gttacttgcg aactgaagaa ctcgggctcc tcatcttgct ctgaaggatc    226140
     attaatcttt tcggcgtatg tctccaatcg gagcgcccaa aggtcgcgaa cgacaggcta    226200
     tgcccgcatc agtcagccgc ttcgttagtg gtttcccaaa gggggctatg ccatgcatac    226260
     ctcgaactgt gacggaaagc cgcggtgatg gacgagcgcg tgacattgct tccagaggat    226320
     caattggtag acttgcagaa acagactata cgcctggcgt ccccggtatg ctgcccgata    226380
     ttagctgatg tggagagcgc gtcacctcca aaccatgatg gtaatggtga tggtgggtgg    226440
     tgatagtagt tatggtaggt taggggctct cttactcttt tgagacttct ccgcagcagc    226500
     cttctttacg cgacttgtcc ggccttgtgt attaaagtct tcaggatctt cttcgacttg    226560
     acgtccctac gcggtgaatg ataaatgagt gggctgatcg gtcgcgtgtg tagaatgcgt    226620
     gaggggcgcg gagaggggaa gatcagacct cttgttgatg accccgcctg cagaaccaga    226680
     ggccattatc caggtaatac cgtcgttcac ggcacccttc ctgcccgcaa acccctcggg    226740
     tgatgtactc catccagggc agcgctcttc attcttcctt gtccagagga tgtggaggaa    226800
     cagaaggcct gggtcttccg gagcgggtca gcgcagctac cagaaatcgt taccagtcag    226860
     attttttcta ccgttgatgc aggtcccgaa aaagtaatat ccgcatcgcg ccttatcgcc    226920
     cactgcgtag cccttgattc ttgcgataag gttgcttctt cagtgtttcc gtaggattta    226980
     tgcacgcctg tctcaggata tcggatctat actagtatgc tgcttatctt gtctacaaat    227040
     gacattggag tatattgggt cgggagaaaa ggtagttatt ttttattcgt caaactatcg    227100
     tgaaagtgct gaactcaaga actgtttctc tgacaaggca ggatttatgc cgccaaatta    227160
     acgtgaccat catggccggc tcagcgtata cccaaggcta aacagacgga tataagagta    227220
     cgtggcgccg tagctgccca aaaggccgta tcatccacct gaccaagggc aaagccgagc    227280
     gaggctcttc aaatacacca tggatgacag agcagttaag ggtccataga cacaataatt    227340
     tagttgccct tgggagcctc cttgacatcc atgcagacct gctcgcccat ggaggacagg    227400
     atggtgacgt ctgaaaagga aaattcgtca gtaatcttgc caacagccac ctagccaaaa    227460
     cggacgggtg ttactcactg cagtccttct cctcatcgtg gaacatgcgg cggatacggt    227520
     cgcccacctc accttcgggg accttgacgt cgtccttggt gttaccgttc tcgtccatca    227580
     gggaaaggaa gtcgtcgtca gtaacgtcaa gctatagctg tgttagcgag tcaagatcac    227640
     caagaccgtt catgttccaa actactcacg agctggtatt ccttgcggta gacgttgggg    227700
     acgtccatgt tgtgggtgga gggggacaga tcctcaagct tcttgccagt gaagatatcg    227760
     atggcaacga tgtggacctt ggcgtgaccg tgcttgccag tcttggaggt ggacatctca    227820
     acgatcttgc aggggcggcc cttgataaca acgtgaccgt tcttgcgcag ggcagagcac    227880
     tgcatgggga aggtggccga ggcgccggcg tcggcggact cgaaggtctc gtggtgctgt    227940
     taaaggtgaa cattagcgaa ctagcccatg attgaaatta tagcagatgg tcggcgagtg    228000
     tagcaaaata tgcaatgtct gcaggaacga ggggggttgg gtggggggca gcgatcgaga    228060
     tgcgaggccc cgaagacacc caacccaacc gagcaagcag gacaaagata ggccgcaact    228120
     gagtagaccg ggaagttcgc agaaggagag ttaacaccta cctcgtcagc catggtgatg    228180
     gatattaggg ggtatgaggt aaaaagtgaa agggagaggt gaggaggatg ttggaattga    228240
     ggaggagatt agaggaaaag gaagagaaaa aagcgaagga aggacgaaga gggggacaca    228300
     ggcgaaaaga aatcgacaaa tggactgcga aaaaaaggca ctggttgtgg cggggttttg    228360
     tggtcgctag tcccagtcca gcctagtctc ggacaaacca cgtccgcggt tgctgcagtt    228420
     cgccgtagca tctcggcctg ctattccacg tatactccta accattatag tagcagtagt    228480
     tatctactgg ttatctcctg tcgacaatat cagcctggtc tcggtcttga tctccatctc    228540
     ctcgaatgtt cgccgccctg taacatctcc cagtacccat ctgtgttctg ggagaacttc    228600
     cctcacccct ctacctcacc cctcgatgaa cccggggagc tctccgctat ccgcacgctt    228660
     ctccgtgccg gcctcccaag atgtggctag accgcatttc gggccatgcg acgccctccg    228720
     gtccccaatt cgatagtcgc agcagctctc ccttgcctcg aaggacctct tctcgcttgg    228780
     ctccaacccc tcagaacaat cgccccgcgt ctagtcgcca aggttcagcg ttgtctctct    228840
     tgtcgacccc gaatgattcg tctacctccc tctctgcgcc tgcgcgaggc gaaggatcct    228900
     cgccaaaacc gagtgctaca agaccccgcc catccgatgt cgctgatccg ctcgaagtct    228960
     tgaatgggat cattgggaaa caaggcaaaa caagagacag ctctccagcg tccgtcgcgg    229020
     aactgaaacc cccggagctc gtggaagaca ttgattttca tggactcagc ctggaggact    229080
     ttatcgcgga agaagaccaa ccgcgaagag cttggcaaag cgatgtcggt gcccagacca    229140
     tccagcaatt tgagaaagaa agggacaaat tccaggacct gcactcggca atcactggct    229200
     gcgatgacgt ctccaagtca gttgaaatgt atttgaatga ctttcagaat gaattgggag    229260
     ctgtatcggc agaaattgag agtttgcaat ctcggtctat acagctgaat gcgatgctcg    229320
     agaatcggcg gaatgttgaa cagctgcttg gtcctgccgt ggaagaaatc agtttgtctc    229380
     cgaagaccgt ccggttagtg gcggaggggc ctattgatga gaactgggtc aaggccttga    229440
     atgagattga aactcggacg gctagcatcg aggccaaggc ctcaggcacc aatagtagca    229500
     agtctatcga agatgtgcgg cctttactgg gtgatatcaa gaaaaaggta ctgcttccga    229560
     tatagattca ctttacaaac cgactgacaa actacgtagg cagtggaacg aatcagggac    229620
     tacctggtct ctcaaattcg agccctacga tctccgaata tcaatgcgca gatcatccaa    229680
     cagcagcgac tagtcaaatt taaggacttg tacggctaca tatcacgagc ccacccaact    229740
     cttacgggag aaatcaccca ggcgtacatc aatacgatgc gatggtatta cctgtcgcat    229800
     ttcacaaggt atcaccaagc actcgagaag atcaaggtct atccgagtga tcggaacgag    229860
     gtattaggag gggacccaac ctcacataaa acaggtgcgt tcgggcttgc cactcggtgg    229920
     atgatctgac tggtactaac tggcacaggt aatatcgttc ccggcggccg agctggttct    229980
     gcggcgcacg accccttctc tctcggcagg agagtcgaca tacttagggc gggtaaccaa    230040
     atggcgatat cttcctactt ggcagaggag gacaatgctt tccacgggct cgaaattccc    230100
     ttccgtaact tcaaccttgc tctcctagac aacgtttccg ccgaatactc atttatgacc    230160
     gagatgttct ccacattggg ctttcaacaa atatctcgca aggctgttga gatcttcgaa    230220
     ccagtcttca cccttgggca gaccctgacc aagcacctga tcgaacagac tacggatgcg    230280
     cttggagttc tgatctgcgt gcggttgaac cagcaagccg cttttgaatt gcagcggcgc    230340
     aaggtgccag tggccgactc atatgtcaac ggaaccaaca tgcaattgtg gcctcggttc    230400
     caggtcatca tggacacgca gtgcgagtcc ctgaagcggg tagcagcaaa caccggccgt    230460
     agtgcagttt ctgcgttgtc tcttgccgga ggagacgacc tcaacaagtc atccgcacct    230520
     catttcctca ctcaacggtt tggacagctt ctgcacggca ttttggtgct gagcagtgag    230580
     gctggggatg atgagccggt ttccaatagt ctgggtcggt tgaccacaga gtttgacaac    230640
     cttctgacga agctcagccg gattggcggc gacgccaaac ggagggagag gtttctttac    230700
     aataattact cacttgttct ggctattatt agtgtaagtc gatcgatccg ccgcggatac    230760
     tggtgctgac ggatgcagga tacccatggc aaactagcca ccgaacaaaa acaggtttgt    230820
     gctgcattgc cactggaaag gatcggacta acgctacgta gcatttggaa gacatgctta    230880
     agaacgtagg taagcgtggc tagttgatag acgttcttca tagaagcacg ctgggttggt    230940
     gtctagatgt gccattgtat attccatcgc cgattacggc acgcccaaat agtctactgt    231000
     acgacaatat aatccataga agcgactacc ccatataata gaaaagagaa tatttttcaa    231060
     tcaaataccc ctgatccaca tttgaaatcc atgttccgat ccccaccaac caagtatcct    231120
     gccaggaaca tcccaaaaga taacgatagt agcagagctt atcggcatcg gcgccgatgc    231180
     cgactccgcc cggcgtgggg aacaaccact taagtgcttc tcctcacccc aacaacgcac    231240
     ccccgtacaa tgcaggcatt gtcacaacga ttccactgag ccacccagtc tcaatggcca    231300
     ctcgtatcct ccgttctctt cccaatagcc gtcttctatc gcggcgcgcc ttctccagca    231360
     ccgccgcctc caaggccgac gtcacacatg cggtaactaa ttcctaccag cacccatcca    231420
     tctacattct cgactcagac acaaacagca atctaacaca tcactgttaa ggttataggc    231480
     gcaggggtcg tcggactggc agttgcacgc caactcgcca tgaaggaggg cacatcgacg    231540
     atcctactcg agagacatga agcgccgggg acggagacga gtagtcgcaa ttcagaggta    231600
     ccattccaga tttcgattat gccaatacga ttatactctc atgaataaag ctaagcaatc    231660
     tttttataaa taggtcatcc atgcaggcct ctactacggc accgacaccc tcaaaaccac    231720
     cctctgcatc aaaggcaaag agctcctcta cgcactctgc gcccaacaca acatcccgca    231780
     ccgcaacacc aagaaatgga tcgtcgccca aaccccagaa caatgggaag cctgtctccg    231840
     cgtccacgaa cacgccaaac gaatcggcgt gcccacacgc atcctagggc aggatgaagc    231900
     gcgccggcgc gaacccgaag tgcgcgccct cgcaggcatc gtggagagcc cgacaaccgg    231960
     catcattgac agccattccc tgatgaccta tctacagggg gatttcgaag accgcggagg    232020
     ggattgtgcg ttcatgacga aggtgacggg cattgaaccc gttgctgcca gcgaaggtgg    232080
     cggataccgg attagcgcag tatcagcgga cggaagcgaa acgaccatca cggccgagac    232140
     ggtgataaac agtgcaggca atggggcatg tgcgatcaat aacatggtgt taccggctga    232200
     gcggcatcgc aaagcgtatt ttgccaaggg aacgtatttc tcttactcgg cttcaacgcc    232260
     gaagacgtcg gtgctggtgt atccggctac gttgccgggc acgggcggtc tgggcaccca    232320
     tttgaccctt gatatgggtg gcaggatccg gtttgggccg gatgtcgagt gggtggagga    232380
     cccgaatgat ttgaagccga gtccgacgcg gctgcagcag gcgttaccgg agattagagc    232440
     gtatttgcct aatgtggatg ttgaggcgat tgatctagac tattgtggga tccggcctaa    232500
     gttggggaag ggaggggcgg tcaatacggg caaggggttt catgattttg tgattcagga    232560
     ggaggaaggg tttccagggt ttgtaaattt gttgggaatt gagagtccgg ggctgacgag    232620
     ttgtttggcg atcggggaga gggtgaggga tatcttgtac tgagcttgaa attatcccta    232680
     tgtatataga gcgtagctgt atgggcatac ttttcacata tcacactaaa attcatatca    232740
     cgaagtggag cctgcagtag taacaacacg catacaaaga ccagacagac agacagacag    232800
     accaaagaat cgccaccaca gtctagacaa ggctacaagg cttacttggc agttccagca    232860
     tcgaacaaag acctcacata accaaggtca aatgaggctt gttccgcagg cttagcatgg    232920
     ctggaacacc atcagagacg acgcgttgga ctccacctct gattaagctt ctccatcggc    232980
     tacgtcaaga ctctgggcaa aatagatacc cttttaagaa acgcagcatc ttttccaaca    233040
     ataacgttgt aaagtagaag gatcatatta tctatctata acgagaaaga ctgtacctga    233100
     attgacatat cacatttcgt ttctatttcc gtcaaataca gtaaagtgat gaggagatac    233160
     ggagggatct ggaaaggaca atcagcgagg aattacccga tgcggaagag acgggttgtt    233220
     tgccacgcct tgcaaagcag atcccccaac tcaaggtcaa agtccagacc cggacttgga    233280
     tcgacgggtt acgcgtgttt gtgatactgt gagtacttat atgttatctt ccttttcatt    233340
     ccgtagtgtg atctctacta tcatagttta ttttatcata ctacatgaaa gattgaattg    233400
     actatttcac tttatacttc tctctctctt cacttctctt ctattacata ttcatctgta    233460
     ctattgctat ctactatcta ctatccacta tatactcatc caacatgacc acccacctac    233520
     aacaaccaca tcaccacaac ttccacccac acacttcctc ctacaacccc taccacccct    233580
     acaccatccc caaccacgct caaaccaaga aacaacgctc acgtccacac cgacgccaac    233640
     gtcaacacca cccctccaca aaacccccga acccctccgc cctcaagacc ccctcctctc    233700
     catcaccctc caaaagcaac cgctgcttca cctggctgct ccttccccca gcaagcaaca    233760
     ctcacatcgc caaaaaccgc tcttctttca gcagctaccg ccgggcacca tgcaaaatcg    233820
     ccaaccagcg ggtgttaggc gtaggcacag tccagctccg agtgcagagg gcgccggacg    233880
     accctcgcac aaataccctt gtgctacatg acgtgctgca tatgccgaat gcgaggtgca    233940
     atggcattag tgtggctaaa tatacggggg agagtgagga ggagacggcg tcggaggggg    234000
     ggagtagtgc tggggagagg gcggttgtgg aagaggttga gaatggtggt ctggtgaagg    234060
     tgaagagtga gagggaggat ggggaggggt tgtggtttgc gagagggaga agtaggggag    234120
     gtcagggcaa gggtgagggt ggggatgatg ggttgagggt tgtgttggcg ggggagaagg    234180
     agatggagaa ggatgatggt gctggtaaag gaatcatggg ggtggttgct tcgaaggagg    234240
     agttggagat gttgaatgag agggttaaga atcggtcgtg ggtataaaat attcccactt    234300
     tgtggatcat catattgtac ataaattggt atacatgctg tcgtatttat aaatgagatc    234360
     gtaacgcagt tgatggcttc ggttctgatg tagtggtcat tccacatcca tcagcacatc    234420
     gctcatgata tgcagcacat acgaaaactt ccgtacgctc cacttccccg tatcctttag    234480
     cagtcccgcg tagtcgagca ggatgcggcg ggctgcttga tagcctcctt ggatgggaac    234540
     accgcgtagg tataccgtgc cgccattctt aatgaattcc aacgctggtt cttcagacgg    234600
     tgggaaaggt tgaccttttc gaggctccat gaagctagtg aatccctctg ttcccacttt    234660
     ctgccaatca atatcgtcga aaagctcgat ggagttcccg ccccgctgca tttcagaggg    234720
     atttggcacc atgaagacgt aaagacccag caccagtgct gcgtagaaaa gagaaaacac    234780
     agagtgaaac attgtatggt ccgatgccct gcggttcgtc atggctcggt agatgtgtgc    234840
     cgcatgcaag caagcccgtc tggcagccgg ggtttgcgac catgctgcaa tgtcatcgag    234900
     tgctttccga gcagggcctg ggcctgaacg accagctgcc atgtcgaaga tctgagtgtc    234960
     tgctgttagc gtcatgcaca tgttgtgcca catgacggct gcgttggggt tcagtcggtc    235020
     gagcacgtcg ccatatttgc ttgtcagctg gagctgaaga gatggtagac atcttgcacg    235080
     cccgtccatg gcgtatgtgt tgcacggggc gaaggggtag ctggcacgat tcgaaagaag    235140
     tcgataatag gcttctgaaa gcctcgactg aaccattgct agcactgcat acatgcagaa    235200
     atcatctacc gggctgtgaa gtgttggaac gtcgacattc tccgatggca tcagtattgt    235260
     aggcatcaac ctgactttgt cgctgtcgct tagctgcatc cagcgagtgg aggaagtagc    235320
     tcgaaagagc gcttcctcac acgggagtat catttggaca gagtcaggca cgatgatcgg    235380
     acttgtagac atgaatgatg agtaccaaga gtcaagtagc aatagtccag ttataagcct    235440
     gtgatgtcag cagatgctct tctgcatgat tgtgcaacta accgtttcac tgattcgacc    235500
     ttgctccagg ctttccaccg cgtttcagta ttaggaattg catcgaataa gttcgcgcca    235560
     agcacctgcc cttccctagc tgcaaatagt ccatgtcgct gcgcaatcta ttcatgcgtc    235620
     agtcgtattc tacgagatcc atgagatggc ataccgatat gagattgaca tagagcatct    235680
     ggcactttac gaggtgctcc ttttcctata gaaatcagta taagccttcg tttcgcggtg    235740
     atttacctac ccctgtcatg gcagccaggt tcagaaacag aaaagcagct gcgaatgtag    235800
     acactgtgga caaagaaccc tcaaccccca cagaacactt ggacaaatct gctgtaacac    235860
     tctcgagcat cgactacgaa aaattagcaa ggcacactgc aaacaggctt tggtcatacc    235920
     gagaagttgt tgacgacaaa gtttaacgtg cctttggttc ccaacaggac catgccaatc    235980
     agacacatgg catagagcaa ggatggacgc gcatctttcg cagaaaatgt tgggacatgg    236040
     ataaacggca ccagtgggtg gaagtcgcgg aagaatagat ctagtgccat atctaggatt    236100
     tccgcaggag gaaaattgga gttgttgcgc ggtggttggg taaaaggtga cactgcggta    236160
     ctctcagacg aacgcatctg aaattgacct cggctctgac tgaagattgt ataaagacgc    236220
     tgcctgcatt cttcatcgac gccatacctc gacccctgca tgtaacctga cgggccgctg    236280
     gaagagtggg ttggcctaag agcaaagaca ttgtcctctt cgctgtaggc tatatcgtgc    236340
     cataagctgt tcatgagccg cccagtgttg ttggatggag caagccaata gcgctgaaca    236400
     cgggcaaacc gttcaattgg aatactgcct ccagagctca agctcatgct accaatagat    236460
     ggtcttgatt ctgaggaagc aacagctcct cctaacatgc cgagattaga atttccccca    236520
     agatctattg atccttgctg tgagatcgag tctccctgcg gttccagcca gaattgcagt    236580
     atgtcgttat gcaatggatc aagcatagtg cctctgtagc attgttggtc cggaacaggc    236640
     acatcattcc agccaagata ctcttgatgc tcacttgcca tgacttgatt ggctattggt    236700
     tcggtgcgag gctgatgagc cgagacattg gcaaggaagt ccaaggaagt cgactgctga    236760
     tcgagagccg cagaaaatgc cgaattatga ggtgccgacg aaccatgctg gagcgggcga    236820
     gcactctccg caccgatacc aaggacgtag ttctgagtat ccgctgtcat tgttgacgac    236880
     cgatcagctg gggcctgatt ggtcggtgtg gcaggaagac cagcacctgg tctaaccgcc    236940
     gcattggcag ctggttggtt gtgtccccta gcatggcgac ttaggacatc actgcaatta    237000
     tgttagcaag atacagtgtg atttgttcaa ggggtgaaga tagtccacag cttaatacct    237060
     tcgtgagaaa cgcttatgac agacattaca ttcatagggc ttctctttag tatctactag    237120
     acgtcagtag gatgcaacaa tatgcaggtc ggttgactta cgtgagcgtt cgtggcgctt    237180
     gaaatgctcc gttttcttga aacgtcgatc gcatatggta cactttcgca ataccatgat    237240
     ggtatttctt tagatttggt atatgagatg gctcaaatag tcaatctttg gcgggacatg    237300
     atgtgggcaa tcctcacctt ttcttagacg aagaaaaaga acagagatgt gaggggagag    237360
     catcgcaaac atatccggct acttgcagcc ccggcctgac ttagccccga tcgggtaagg    237420
     cgtgggtgcc gaactgccgg agccgtgggg cagccatacg gataccagat tgatacacag    237480
     tgcagccaat gagaggtacg cgattactgt tagtcatcgc atctggaaaa tcctggggta    237540
     atcgcccgta ttgcactgtc agttggaagg cttcttatga acgttgctaa gggtccatga    237600
     agcatcttaa tgagatactc ttggtggaag agttatcttc aaagactctg tggtgtcaaa    237660
     gttcacattc agtaccccca agtagactca ttcattggct cttcccaaac gacttttcaa    237720
     gttgatgaag cggttaagaa ctagtgaagt tcttacggca tcactgcttg cctgcttcac    237780
     tggagtcctt catataggct agaacatcca tcataaccag gaacttcagc agatcctctg    237840
     gcgcctgcgt ggccttatat aaagccttct gctgatcttc cttccctcaa gacctccttc    237900
     agggtctcaa ggacagatag ccacaattct aacccaacat actgatatca tgatatttta    237960
     taacaatatt ggagttaaaa atactggaaa atgcaccata tgcaggtact ccactagatg    238020
     ctttgccttc gcaaaacgcg agccctccat acactaagac aaacaactcg aaagacttcg    238080
     actctattcc cgagacaata caccaataga gcaccggcag agtcaacaaa tgttataaaa    238140
     aaagcattgc accaatgcga agactcagac ctcgcattac ccatgaacaa gtccttctgt    238200
     tccgtaccat aatcccatct actataagcc catttcaact ctgatgctgc taggttcgga    238260
     ccagatcttg cacggttcac agtatcttat ctagctgtgc agaggtccag cagtattcaa    238320
     gcttagtagg aaaacgggaa gtactgaaag gccttaaggc ctgcgatatg ggaaaagccc    238380
     gctaaagagt ttggatgaga ctagtctcaa tgggtaggat tgtactgctt atctagatta    238440
     ttactacact ataccctgga ccccgaaatg agtgccgctc tgctacgacc tgctttactg    238500
     cattccggat gtagaggggg gcagagggaa acacgttagt atagtagtga caaacggcca    238560
     acttcagaat aagtcagaaa atgcttccgg ggaagctcaa ggcactgatt gagtgcaaaa    238620
     taggccatag ccctgctatt aaaatgcagg aggctatcca gatgattgcg tgggtcaaga    238680
     agcaccttta tcgtaataat gatgtcaaca actatatgtg agagactctc ctacttagct    238740
     tatattgatc ttgtcatgat gtgtctaata ggatgtcaca ggcctattct tatgtcaaag    238800
     atggccccga tcatacatca gctttgccga gtatgatgcc gctaactggg tcaatcactc    238860
     gaacaggtgt agcggagtgt ctccactaca tctgatgaca atgaaccgat atggtctgtt    238920
     ttataccata ggcgggacaa aaccccttaa gctaagaggg ctaataatag tttgaaagtt    238980
     tgtaccaggt ctgtatttgg atttaccaaa tggctgccga taaaggcttt gaatgaccag    239040
     caacgcgtcg aaacggaggt tcaaagaaaa cactcccctt taagataaaa gtctctatag    239100
     gaagccccaa cctacaaatg tacatatcga gtcaattttt agcctcgctg ctcttgaaat    239160
     aggaagaacc gtagtatact agcattatcg cttatgattg ttccctggat atggcgacat    239220
     ttggggctat tttagattga cttcagtcag caccggagta cagctcattg ccatcgagat    239280
     cttttgagca ccatatgctg gtcatattca gcacagggtg cagcccgctt ctgcttctgc    239340
     aagtgtactg gccccgttgg cgcttccaag cgtgatggaa ctctgacggc aaattcgtgg    239400
     acgccttcgc gcatatgaga caggaaaaat ttggcgtaag cagccgccgt ggcagcggca    239460
     tattcctgcc attgatcgtt cttatgtgag tcggcataat cgcatattcc ccgaataacg    239520
     aggcagtcgg tggtggttct catgactcct gccgcctcca tctcaacaca gatcacattt    239580
     tcctggccca ggcggtctcg gtatcttgca tctcgaacga gttggttacc agatgcgatg    239640
     aggccgtaga aaacgtttgg gccgtcatgc tgtcgagtcc tcggccgtcg actgccgatg    239700
     cagttgtcac aagttggttc cgtctcaacg tgcacatcac ctgggtcgaa tagcatgtct    239760
     ttgcctgcgc ctgggtatga gtattccggt ttcattgagg caatcaaact aagatcgtca    239820
     agaagcgggt ttgaagcgga ctcgaaggaa atgaagccat tagaccggat tttcgtaatg    239880
     actgctcgta gatagggcgg tggttgttgc ttctgtgctg tcatcttaaa ctcagagttt    239940
     tggatccatt tccccatatc gccttggatc acgccggtac cgacgacaac atcaccaaga    240000
     cgtatatcgc gggctgccga aggcactccg cctccgattc caaagaccag acagaacttg    240060
     agacgcggga aagttcggat cagatgagaa gcaacattag tggcggaatt cgtgccataa    240120
     tcatcgtgtg gaaggccggc agcaaccaca ttgaatcctt tcatccgtcc gagacaatag    240180
     cagttaggat catttcggtc tttttcgagg tcaggatggg gtgaatcgaa caaagcgcgg    240240
     acggcaagaa gttctttaga cagtgcacac acaatgccta cctcgtagtc ctcgtgagta    240300
     attccttcag gcggggacct tgacaaaggc aatcgcccgg gaccattggc agtggcagaa    240360
     ggagccaaga ttgttccaag tcctgagtcg tggaagtcgt cgtctgagtc ggaccccgaa    240420
     tcatcatctg aacacgacaa gacatcttct tgttcaggga agccagtgtc attccaggtc    240480
     catcgcaagt ctctgttgta gccaaataat atcgcgccat ggctccaacc gcttggtcta    240540
     acggcattgt gcttcggtat tcgcttccta aagtgcgagg gcaagacgac ttgtgccagt    240600
     tcggaatgaa ctgtctgttc cgggcatcca atgcatttgc aagctggagg accattgcct    240660
     aggcaattgc accatatcaa attgcgggtc agccggaccg ggctactatg tggatttccg    240720
     aaccgatcga tgatgtttgc aagatcatac ccactgactg caaggtagga ctttccttct    240780
     ggcattctgc tccaatatgg gcatagttgg ccgttatcaa ccgggcgaag gatctcacca    240840
     aaccccgtcc caaacagcac tgccgcacga acatctctgg ttaactcaac ccagctcttt    240900
     cctctagttc ccaatttaca aaaccgagga tacaacgggt cttcctgggt cgccaaatcc    240960
     ttgaaatccc acccttccag aattccccgg gccattttgc gagacgctgc gccctctgtc    241020
     cccatgatct ctgcttgatg atccatgatc ttctcaagca tgctatacaa acgatcgacc    241080
     ctgtctttaa tctgtacagt cggtaaagtt gcctcatttg gttcgctctg tttcgcgtgg    241140
     tacagtgtca gacataggtt atcagggttc aacagaacct ccattgcaga gctgggagtg    241200
     attgtgttct ctgggacttt gatatcggta ggagttaagt ggaatgcaaa gccgagtgga    241260
     ccagtcctgt tgaaatggag cgaggcaata agaaggtgca atagagcgca ggccccattc    241320
     accaaccacc ctcgttttcc tcccgcatcc cacattacca cgtattgcct ggcaatccac    241380
     gacagctttt caatgtactc gtcccgaatt agtcgatacg gtaagtcttt gttgccatat    241440
     atagctggat caccccctgt aattaatcta cctgccgcga taaaagtgtt gtttaagctg    241500
     cagcgagagg atggtggcct caaccaggac cgattgattg aataactggc atccgccgtt    241560
     cctagtgaca agtcaggtgg tgaaaccctt ttgttacaag caataatcat gctatgacgt    241620
     accggcatag cattttgcgt ctgaacacca accaaggata tgccggctgg actccaaatc    241680
     ggccagtgtg atgtgtccga catgagcctc aatgccatcc agatacgaaa tgcgatctcc    241740
     atgaacgtta tatcgtaggt gccatatcat ctgatcctga tcccgaatgt actttgtcgg    241800
     gatcaataag ctagaaaatc ctttgataaa tagtttatca ctaaagatgt ccacttgctc    241860
     tgcttgggct agacccgcca agatattgag cgggatttca aggccagttt gttctctgga    241920
     gcggtatggt attgggaagc ccatcgccac tgtcgggtaa cggaacaagt cgtgccagca    241980
     ttgtcccagg gaaggcgggg aattcgcttg ctcctgatcg tcaactttga aatcaatagt    242040
     gcatgatact cgtgtgagag ttggtgtttg tgaagtcggg attgatgctt cttcaacgct    242100
     agtgttgctg acgaatggtg tgcagtacga tatcctggag tcgtggggag agcaacggag    242160
     aacagagcct agccaggcaa gttgctctcc aatctctgca attgaaccct ctatcccagt    242220
     gacttcaacg agaaactcct tttcatttgc ccaagctgcg agctgtgtat tatctgggag    242280
     ggtacctata gacatgataa gcgcccgcgg gtgccaatag ggggaaagcg tacatctgtg    242340
     ttcatagccg cgctcatcaa ccagtgcagc ttcgactagc tgaaggatat tggcaccata    242400
     tgaatgccat gtctgatgga ggtattgcaa gcaagtcatt gcttgagcat cctgactagt    242460
     ccctgtaatc gtgattatct tcccaaggaa gccttcttta cttatatcgt actcctgctc    242520
     tgcgatgaaa gatacgggat cccatttgag aaggtatact acctggtata ctgttggctg    242580
     gtcatatcga ctgactcttc gggatgacgg gagggtcttc aggattcggt cgcgaatagc    242640
     atcttgaaca tttggctctg ctgggtgcaa ctgaagtttc ctccgaagac ttctaagtag    242700
     ccattcatac actgggctgc cggtgattaa cttcctatag gtcgcatatt cagggagatt    242760
     ctcatcgtct tcaatcagta tatcttcgtc actgtctgaa ttctctgccc cgctgtcgaa    242820
     ttgtgggatg gcaagatcat catctgcatc ctctagattt tgatcccaga gatccatgag    242880
     gtcgcctaat tccattttgg tgtcgtcttg tcttgacaca tgggtttcag tctgatcttc    242940
     taagtatttt actctcaacc cattcgcaat ttcactgtca ggatacttta tcagcatcta    243000
     catgaaggca atgaccaagt cttggggaag gacgaactct ctatgtcgac ggatgaatac    243060
     catgatatcc ctgtgtatct gagtcgagcc aaattgacca aatctcatag caaaagcttt    243120
     cagaagttga ggaagaatgc cgtggattct ttccggaaga ttttgggcat cttgatcata    243180
     ctggactttt ctgaacaaat cattcaccaa ttcggaaata tagctctcct tatccgaagg    243240
     ggaaatgcca gacctagctg tgtagataga ttcggtgtct tcgctatagt cttctgcttt    243300
     tctcgggcta gctgccgccg gaggtgaaga gaatctctcc tcaccagaca ctatgctttg    243360
     aacatcgtga acatattctg tacggtattc ttctccgcgc agaaccttct ggtgggtagt    243420
     agaagcgtat ccggaatctg ttggcggtgc attgaaggta ctttccttct gtcgactcca    243480
     tcccggggtt ggattgctgt atccacttgc atcggtgctt cttgcttggt ttgacgggga    243540
     catcgcacga acggagaagg atgctacacg tgtataggga atttaggagc gcattccaga    243600
     cagattttaa gttgattcga aaaatcttac cagtgtgtat ttttttctct agggctggaa    243660
     ccaccaaaag aagctccttt gcataggccg ctgccgcagc tgctgcatat ccttgccatg    243720
     ctgtgttttt gtgagagtcg gcatagtcag atatgcctcg aatggccaga catggaaggt    243780
     tatccaggag acctgcggct tctagctcaa aacaaagtac tcccagctcc tgaccaattc    243840
     ggtctcgaag ttggccgttt ttcatcacct gaggtccaga tgcaatggat ccatagtgaa    243900
     taacaggctc ttcgtgctct cgatcacgtc gtaaaattaa tttggatcga tcgcaatccg    243960
     cacacgaatc gaatccgata tgttcatatt caggttggaa cagaaagtcc tcttctggcc    244020
     gcgcgaactt ttcagcggcg gcaggaggaa gtttctcctg catatcggaa aggtaactgg    244080
     cgacgtgacc ccccatacgc cctgacaggt tgtgattcac ttggagggca gctagagcag    244140
     ttgacagaaa ctcagggact tgatgtgaag attcgtccca gctcaatact ttacccaaat    244200
     cgtacctgat caaccctcca gatttgccta tcggctggct cactacaaca tcgcctaatc    244260
     gaatgtctgc tttgctgctt ggtatgccac caccgattcc gactgaaaga taaaagcgga    244320
     tggccggaaa actagaggat acctgcctct ctagcgctac agatgtcgta gagccatacg    244380
     tgccagctgg taaacaagca atcacgacgt tgtgatctcc aacccttcca aggatatatg    244440
     tattgggatc gtttggcggc ataggcaacg gtggatgtat ttcatccaac atcagtttcg    244500
     caactgccat ctcgataggc aagacgcata tccacccgac gttgtattcg tcgtggcgtg    244560
     gaggtacttt gcggttctga tgggggtgag cgcgcatgtc gcgtttcgat ggacttgtgg    244620
     gcatcatctg tacggcggat ggctgccaga ccacagagca caagcgggga gaagtatagt    244680
     ggatataaaa aggtagagat aacagggaag gaggatgggc tgtacaatga tcagaccctt    244740
     gacatagtaa gaggctacaa tggaagacga tagttttgct ggccgcatat tgttggaatg    244800
     accgtcactt tgggcaagag tgggcggggt tgagggcgag gctgagcttt atcccgatcg    244860
     atctgcctga gatttcccaa ggctgaacga gacgagacat cttttttaaa ctgtataaca    244920
     tttttacata tacaatcaat tattcttcat gggatggctc tcgtccggat tttcattgcc    244980
     ccaaattcct ccttcgcatt gtctcccaat atctctgcga taccacttcg taccgccgct    245040
     tcccttctcc gtccgggaag ctggtcttgc tgtctggcgc cctgcgcgcg aaacgccagc    245100
     cagctgccgg tagcgcctcc caagatgaag attcagagct gactgtctca gcattgcaga    245160
     tatacgcaca ccttgattta cctaactaag ctttctcgtt gtcctcgagc catttccgcc    245220
     agagttttat catcatagta cgcttccagc tgcttcttca atgcttcttt atcagccttg    245280
     acttgactga gaatctcctt gatgtttggg tatgcggaga atttgtccta catagatcat    245340
     cagctcggct tcaaccatcg tgcggacctg aatacctaca ggtaaagcat cccacacttt    245400
     gggatctgga ccttgagctt tgaatgtccc acaaccagtc cgtgcatatt cggtgaacag    245460
     aaacgaccgg ctactttcga ccataatggt catttgatct acaatgtcag ttacctgttc    245520
     caaatgatgt ttaatgccat tgtcttactc tctaagatcc tccgaggatc gttcacctgg    245580
     ttgcgcattt catgcacata gtcatcgctg aagttgccgt gtggcgtatg gctgacctcg    245640
     atactacctc ctccgggcag gaattcttca gaacgtccga gtccgcttcc atacagacac    245700
     gcaagaaact cggtagccga gttgcggtga aaatacggag gacggaacgt gttggacgcc    245760
     acatcccatc gtggtccaaa ccatagaaag tcggctaatg gcgttactgg gtctttagac    245820
     ggggcagtca atacgcaatt cacagacggg tccgtgtggt cgatggatgt tgcattttga    245880
     gaggcgaatt tggtcaggtc gtactgtaga ggactgtcag tatcgtgttt gtctacatca    245940
     cagaataatc gttgcatacc ttgtagggta tgacattccc atgccatgcc actaaatcga    246000
     atgggctgtg accctgctct atgacgctat attgaccatt tgccttgttg acgatttccc    246060
     agtcctcgtg gaggttctcg tcaatatggg ccacgggatg aagaaagtct cgtgggttcg    246120
     ctaatccatg accacctaag ggtcctaaat caggtaactc ccaacgagaa ccccatatct    246180
     cgacgatgta cccgcgggca acattatgct cggggcccaa gcggatagtg aagcgtactc    246240
     cgcggggtat gacacagact tcgccgggtt gcaggaacag catccccatc tcggtctgta    246300
     agtcgagaat tcccagctga gccacgatca gaaagtcgcc gtccgcatta cagtatgctc    246360
     ggtggtccat gtctgcgttg atcatgaaga catagagtgc aatgccttct cgcagatttg    246420
     ggtctccact tcctcccaga gtgtgcaagc catctacaaa gtcaagtctc tcatcttctt    246480
     tgggcagatg gaacggtgcc cattcagctt gaccagcaaa cgttgtcact ttgggattaa    246540
     gtgtgaggaa gcagttttcg atatctgatt tgtgctcgca gtcgttcctg tagccatctt    246600
     cacaacgtca gggacatttg cttgctttga agaacgaatg ggatccatac tgtgtgcagc    246660
     tgccggtctc acccggtaca tataagtgct aaagttggca tttctgggtg ctgtgaaggc    246720
     cgagtacgtg aggccttcag tgtacagacc aaaccgcggc tcttgtgggt tgttttggcc    246780
     ggctggcaag gtccctggga tgacttctga ctgaaagcgg ttcccaaatc cagccatgta    246840
     ttcgtatgga tcattgtcgc gggtaggctt ccgcgtcatg gtgtctgtgt aatggaacac    246900
     tttcctcagg tctttgatgg gccttcgctg gttggctgtg gatgctggca tgatggataa    246960
     actatgtgat atccggaaag tctatggagt tcaaacaagg gatggatgga ttaagacatg    247020
     tgtaattgag agtgtatgga tataacagca taagacgccc ttaagtataa gatggcaaga    247080
     acagctgatt aacataattg agacatacgt caatgcataa cctgagggtt ggataggccc    247140
     ctcatgatcc catgatagct gtcgacgtct agaaagatgg agtatgtgga gcaagacagc    247200
     atagtcgggg ctagctgatg atgtgcgagt atccatggcg catgagaaaa gacccacatg    247260
     ggtaacagcg aggtggaagc agttcgaagg agatctgaaa gtgtaccagg tttcatagat    247320
     aacccaagag tactgactat cctcactgac cccttcccca cagtccactc cccccaatgc    247380
     ggggctaccg gctccgcgaa tgtggagcca ttcctcgatg gcatctgggg ttatgggaca    247440
     ctgccatata agcttatttg aacttggcag agatggggca tagccatagg tatctatcat    247500
     ttagttcgta ttactatgct aagagtatgg cccagggagg aatgcatata tcttgaatcc    247560
     ctaatcgaca gcaagaacat cttccaccat tctcgtcgac gcacccaagt aattgacagg    247620
     gtcatacagc tggctcagac gctcttcgct catttttgag gtcacttcag tctttttcat    247680
     caagcactca agcagtgact ggttcgcctc gatgctctcc cggcaagcct cgtagacggt    247740
     gtcatgcgcc tgttgccgtc ccacatgtgg tgccagcccc atcatcactg cctctgccac    247800
     aatcaatccc ttagtggagt gaagattctc tagcatcttc tggctgtgga cacacaagcc    247860
     agatagagca aattgtgtct gggatagcgc tccgaccgca atgacaaagc tttccgggat    247920
     agctacccac tctaggtgcc aaggacctga ggcacgctca aagtcagcga ccatgccgtc    247980
     aagaaccagc ccagcgtttg atcgaaggat tttcgatgcc gccaaaataa cttcgctcga    248040
     tatgggattg cgcttctggg gcatggtaga ggaggcaccg cggtgcggca caaatggctc    248100
     agatacctcg cccagctcgt tggaggacat gatgatgatg tctagggcta gtttgcccat    248160
     tgatccaccc atcaacgcca ggaaattagt tatctccgct attccgtccc gagcaacatg    248220
     ccaggtgatg ggaggatccg taagacccaa ctcctctgcc aaagctttgc gcactcgtag    248280
     tccatcatcc ccagtcccca aggatgccat tgatccagct gctccaccaa actgaaccaa    248340
     caagcagcgg tccttcagct gctctaggcg ctccagatga cgctgaaaac cggatagcca    248400
     taccgcacac ttgtacccaa aggtaacagg aagggcatgt tgaaggtgcg tacggccagc    248460
     cattggtgtg tccttgtact tgacagatag tccacgcagc gtactgataa cctttttgag    248520
     gtggtgctca acaatatcta aaccctcttt catttgcagc acactcgcaa ggtccatgat    248580
     atcctgggtt gttgcccccc aatgcacgta ctttccagcc tcgtctccgc atattgcaga    248640
     tagctgacga accaaaggaa gaatagggta accgacaatt tctgtctcat atcggagccg    248700
     ttccatgtcc agcttcgatt cgcggagctt ccgagttacc atctcaccga tctgtgatgg    248760
     gatcacatca cagcgtgatt gcgctcttgc gagggcggct tcagcgtcca tacaccgctt    248820
     gatgtacgct tcatcatcaa atactttgcg aatttcttca gttccgaata atgtccggaa    248880
     gattcccgag tcaattgcac tgacggaccc gatgtatctt cgagatacaa taggggagat    248940
     ggagatccgc ggacgagtga tacgacataa ctgcgcaaat gaggatgctg acatggtaag    249000
     gggagatgtg aagtgtgtaa ggtcacaagc taaagtcagt taatgctgta tatgatatcc    249060
     gcgttgagta ctggagagca agccgtttaa gctcggcttc ggaatgagcc atgggtgtat    249120
     gttaatagag cggaggtgcc tggaattgcc gacagatgca tgggggcagc cccgcaagaa    249180
     atgtggggtt ccgcgtatgc cttcatcatg ccttcaatcc ctcgacttct gtgaacgtta    249240
     catgtggtac agcacaaggt ctgataggaa aatcatctaa aattactatg cgtgatatgg    249300
     aaattcagtg gttaccactc ctcccaggat atcagaaaca ggaccgtttg cgtgccatcc    249360
     cacaatggac aaaacacata gacacacggg tccgggacca accgtagtct atgacgatag    249420
     aaatttagtg agcactgatg tagtacattg cttgcacagc ttgataatag caacgttatg    249480
     tgtgccgtga atctcacgct gctattataa tgtgcaacag ccaactgaat gcggcttctt    249540
     atcaggatgt catagattgt cgcgcgaaat cacatgtgcg gggccataaa catttgacga    249600
     cgaaacaacc tggtccatta ttgtcttttc tcgagctacg aagtcaactg aatcccaatt    249660
     tcaaccacga cgaaacctca gatataccaa ttgtcggtgg cggccgcatt tgacaggttg    249720
     agcccacagg aaaagctcta tgctcatcat atggcgaggt actacacgtc tccattcgcg    249780
     aacgcgcagc aatgatttct aacgtcttgt atttaaggac tgcctaggat ggcacgagaa    249840
     ttatcctccg tcaagtctca ccagaagcta atggcatttt cgacttcatt atggacctct    249900
     acaatacctg tgaagggaac tgggaacaac ttgctaccaa aactggagtc ggcattctgt    249960
     tgttagacga gttcctagac tatgctgcta gatttttatc caatatcggc aattacttcg    250020
     tgagaatctg cctgtttact ggttgaattc ttctcatttc tctagggatc cggtgaccag    250080
     aaattcacac ctgatatatc tggagaagcc cttaattttc tagcatcagt atcttcatcg    250140
     gcgagtaaga tacttgagca gatcaagcct gacgacagta agtcacattg tcgaggtgac    250200
     aggagctaag acagtgaatt acagtcgcct acaacatgta tcttcagctg ggtgttgatg    250260
     ggcttcgggg cctcgagaat tacgatccta cgaccaaagt aaaaaataag agtgtttgaa    250320
     ggtattgctt accgatcgac agatattgga acaagcacat agtcgagtaa gtctatagct    250380
     gacttgtatc taggcacact atgccatctt tcgacatctc tttcgcgaca gtggcgacct    250440
     ctatacagtt acaaaggatg tggagaagaa tagcttgacg gtcaaagttg accgatcgcg    250500
     cgtaatctct catggcaaac catcactggg tcgcatgctc ctaaaacttc atatctatcg    250560
     ttgcactgct gacgtctcca actgccgccg cttctatgag aatctatcaa ttgttgacga    250620
     cgaagctctg aaatggagag atattcttgt ctccaaaaaa gaccctcctt tggtgtttag    250680
     ccaagcaaac acctacctcg tcggtgatga cgtgaagata aaggagtatg aacccacagc    250740
     tcagggagtt gtgcaaagct gggctgaaag aagcatcgaa taacactttg cactcagcat    250800
     acaacacaac caaaaacaaa tgcataagaa aaactcgaaa catggtaaat tctactaata    250860
     aacctagata atacgcccta ttgcataatt attcagacag actgcgaaat agcagtggtc    250920
     cggctctctc cttatagcaa taatgcacaa gagcgccaaa actgacaagg cataaaacca    250980
     ctattaatag tcattgcgca tattggcatg tctacaagag actatccgta accatcgtgt    251040
     tacttacagc cactagttcc gaacctaaac aaagattacc cagatgtatt gtagtacatg    251100
     acttatcgtt tcgcagattg caaagaatga caatccaaac atcttgcatc gttatactga    251160
     tatctgtggg atattccgat ccgctgcaaa tgccctaggt tccggcctac gcagcattgg    251220
     ggacattcca caaagaccag atatttcagt atgcgcctac gcatataaag gagtataata    251280
     atcctgtcgt ctagtttgca agatcataaa tctaatcaag tcctttgttc gtttctatag    251340
     agttagctta cctctctcag aattactgaa gaggaactct atctactcat aacggacaaa    251400
     attgaatcct aaccaagtct aaatcatgcc gtactacgtt caccttcaag agcacgtagt    251460
     cgacgggatg ctggaaccca tcatgcgaaa gtactacctg atgactgctg caaatgccac    251520
     tgcggccgag aaatttcttg tcggactgca gaaatatgcc cggacaccga acacgcagat    251580
     gtataatgct aaggcggtga ccttggagtg gtggaactgt aaagtcagtt cagccggtac    251640
     catccggtgg atctacaacg aaatgattgc cgaaaggcct gagaattaca actatgtgca    251700
     agaattgacc gactgctgtg atacaatcct tatctccgat ttggaagcag tgaattggcc    251760
     aattcttcca gtcaatcagg aaacttcaca agtaaggacg atttttgatc accactttaa    251820
     tcggttttga tggagtcttt atcttggtgg ccaagaatgg tttaggggga tatggtcacg    251880
     tggttgtcgg tttcccgatt ctcttagcgg tagcatgtat cgagaatgac cagaatgcga    251940
     aataattatg cttttgatct tgagtggcca gagtagtcca tctttaccct cataatgtag    252000
     aacccaaaaa atattgttgt gaagcaggga atgtgctacc ccagatcgag accccacaag    252060
     atctcccgag tcggagggaa agtcggcaga gtcaaggctg gccaggaaca tcggcgagtt    252120
     cacccgattt gtcttgccga tgccagtccc gctgtcggaa tcgtaaaata cgccgtcgtt    252180
     gtgacgggat ctcccaattg ggcgattatc taatcaatca tcgccgccgg gggaccctga    252240
     attaactgac tgacaagcag aaagtaacta cgaaacaatc cgtgcattgg gggataccgg    252300
     tggattcgga gcacgtttga caaggccatt ccggtccgat cgcgtgcctt gatagcgctt    252360
     ttgaggggaa gacccggggt gagttcaaca gggggcgcgc ggacaccccg caggcagaac    252420
     gtttctcccc cccacaggcg tacgaggcaa tacgacccca gcggtgagac agtggggtcg    252480
     gcttcggaag gcggcaaagc gatgctggaa gtcggcggcg gataatcgct tttgtcggct    252540
     gcgccatcat gctcactagc cgaacggcga gctacgcgat gctgcagagc cggtctggcc    252600
     taggctgagc ttctttttat cgctggcctt gtccgtcctt ctctctttct cttctttctt    252660
     tctttcccca ggttttgact ccctccgcag atctcaattc ttttgtcaag gctggtcgac    252720
     aaccatgtcg cggcctgttc ctgcggtgtt ccgccccatc tggcggcgga atttctccgt    252780
     ctcaactgcc aagcgcgcaa tcgataaact atgcccgtcc gctcaggaag cgatcaagga    252840
     tatgaagggt tcttcgaccc ttcttgtcgg tggtttcggt ttcgctggtg tccctactac    252900
     cttgattgat gccgtgcgtg accgcccgga catcaaggat ctgactgtcg tctccaacaa    252960
     tgctggtatg cccggtgttg gtctcggtag gtctactcca ttgcaattga acgactactc    253020
     agttcgtaat cggtctaacg gataatgata ataggccagc tgctggaaag caagcagatc    253080
     agcaagatga ttgcctcttt tatcggtgaa aacaaggtct tcgagaaaat gtatctcact    253140
     ggtgacctct ctctggaatt gaccccccag ggtaccattg cggaaaagtg tgccgctggt    253200
     gccgctggtg tccctgcctt ctatacccct gctgcttacg gaacaattgg tatgcttact    253260
     tcaatggcta ttattcaatc cctgaagtca actaacagtt aacgctgaaa agtgcaatct    253320
     ggtgaactcc ccgtgcgtta caacaaggac ggtagcgtcg ctatcaagaa cgcccccaag    253380
     gaagaacgcg aattcaacgg aaagaaatac atcctggaag aatcgatttt cggtgactac    253440
     gccctggtta aggtccacaa ggccgacaag ctgggtaact gccagttccg caagtccatg    253500
     aacaacttca acgaggccat ggccaagaac gccaagtaca ccatcgtcga ggccgatcac    253560
     atcgtcgaag ttggcgagat tgaccccgag agtatccacc tccagggcat ctacgtcaac    253620
     aaggtcatcc agagcaccgg cgagaagaag atcgagaagc tcactttcgc caaggacccc    253680
     aacgagatgc tccaggctgg tcagtcacca aagtcaagtc ccaggtttta tagcgcagat    253740
     ccgctaacaa tgtcgatgtt ataggttccg gtgatgccac tgcccgtcgt gaacgtatcg    253800
     tcaagcgtgc cgccaaggaa ttcaaggacg gcatgtacgt caaccttggt atcggtatgc    253860
     ccctgattgc tccttcctac gtagaggagg gtgtggaggt cgtcctccag gccgagaacg    253920
     gtatcctggg tctgggtggc taccccaagc ccggtgagga ggaccccgac ttgatcaacc    253980
     ccggcaagga gaccgtcacc ctgggtcgcg gtgcttctgt tttcggttcc cacgagagtt    254040
     tcggtatgat ccgctctggc cgcattgacc tgaccatgct tggtgctctc caggtcagcc    254100
     agtacggagg taagctcatt tcccttcaca ccacaaagtt ataatgaaca atactaatat    254160
     ctaatcttca gatctcgcca acttcatgct tcccggtaag gtcaagggta tgggtggagc    254220
     catggacctc gtttccaacc ccgagaagac caaggtcgtc gtcaccatgg taagtcacaa    254280
     tcctttactt acatccacaa cgtcgaatgt ccattaacaa tgaaacagga acacaccgac    254340
     aagaagggca accccaagat tctccccgag tgcagcttcc ccctgaccgg cccccgctgc    254400
     gtgtggaaga tcatcactga tctggccgtc tttgaagtca gccccaccga gggtctgact    254460
     cttgccgagt acgccgaggg cgtgaccgtc gaggagatcc gcagcaagac tgctgctcct    254520
     ttcaaggttt ctgctgatct gaagcctatg ctgtaaattt attataccac ttttgtgctt    254580
     cgtgcttcac acatcttgca tggttgttta tagattgtga ttgttgtata taacgttgat    254640
     gttgatgact ggttggttgg ataaaggaaa ttcaaaacta gattcatgat atacacacta    254700
     ctcattcctt aaacaaaaac ctcatacaca taatacacgt atacaccatc aatacaatag    254760
     ataattgatg gagaaagaga aaagagaaag aagagagatc aatgtcccgt cttcgaccta    254820
     ttaaccgacc ccgtcgtccc cttatgtgtc ccctcagcag gattcggcgc agtaccggta    254880
     ttcatcctcc tcgcggcagc gacattcggt gcgttgtagg cgatattacc acttctctct    254940
     ttttgttctt cgtcctcttc ttcctcctgt tgggcccatg cattctcgta gtcgtcgacg    255000
     gggaggtcgt cgcggacagc gccgtggact ttctttggtt ggaggggtgg ggaggcgatt    255060
     ggtttggagg gcattttgtt gatgcttctc gacggaaggg ggaattattg ggtttgttgt    255120
     ttggtggttg gttaatttgg gggtgatgct tcgtttgtaa ggtatggaag gcaagtgaga    255180
     taagattgaa gatgggatgg aatggaacga ggaagaaaaa gagggtagtt taaataacca    255240
     agtacatcag tagtactgaa taacgtaggt tcgaagaagc gttatgatga gatcatgagc    255300
     tatagagtat catgttgtat ggtaagatca aaattcaatt tgtacggatc cacaaatatg    255360
     cagtcttgtt aacatgattg agtgagtgat ataatggttc tttgtatgat cggaggcgaa    255420
     tatacttcat gctatatgat gggatggtga tggcgtcatg gcgatgtaag atgtgcatgg    255480
     tttgaggtac tctgtaggat ccgggaattg agctaatatg tagagcataa ttctacaggt    255540
     taacgatcaa ctctgaagtg tttggctgga agacttttga tggaaagaat gctgcggctg    255600
     gtatgggttt ctgtttggta gacggagcgg atgggtgcat accttcccga ttagggaaac    255660
     atagcacgag gttcttggct cacttttgta atgcggtatt ataatcgaat gcttgtggcg    255720
     cacagcttga agatttggct catgatatag tactcgtttg gtcattgtag agaaatagca    255780
     tacgattagg ccattgtaca tacagcatat agttcctcct ttagcaaagt agactcaagg    255840
     attcctccat gataaaataa gcaattattt gtaagtaaac cacgcgggag atataacgtt    255900
     gcggcgtccc agcgaccgac caagtttata atcaataaaa tagtacttgc atgccccata    255960
     tatcaattgt ctaatggact accaaagaaa ttgttgttga aagctcacag aaggtgcacc    256020
     tcgccacaaa ctcggtttct gcataccagg gaactcatgg accgcttctg ctcgagcgcg    256080
     ctgatactgt attgcttcga aaacaggatc catccgtgga cgattctctc tggcctcacc    256140
     atcgaatcca ctgccatatg caactttggc cggcgatgaa ccggcatcta tcgggctgtt    256200
     tggtatctcg atctgatgta tccgtggtag cgtaggcatg tcgcgatagc cttgaaactc    256260
     aggcatctgg tcttttggag atacagtctc cggttggtat tcagactgtg aggcagaagg    256320
     acgcttaacg gcttcaggtc ccgaagagtg tcgtgtcgaa ccatctccat cattgctcaa    256380
     acaatcattc tgccagtcac ggatgtcctg gacagtgtgt agaggaaatc tcttccaata    256440
     gtcggtgcct cgctttccga ggcgggaaga tgatgatgag tacgtttgtg gcggactgcc    256500
     gctattccta tgcctgcttg aacgatcttg gcgtccctga accgaagcag agagctgaga    256560
     atctgggatt tgggcgagta gattcagaag cagactttct gtttcatgga gacgatgctc    256620
     caaggcttct atataacctt ttgccgggcc actaagaggt ataaggttga tacacttcaa    256680
     atttcagcag ttggcgtagc ttaccgtttc aactgttcgg gccagtcgca cggccgattg    256740
     tgctggtcgc attgagtaca aattggcctt gcaaattgga ttgcatgagt aaaagtctga    256800
     agtaagaacg agggacctcc tacttactta ttcccactgc actagaaaca catagactgt    256860
     tagatgggaa gaatcacgag gatcaggtat aatctcacct tctgtttccg aaaccggcag    256920
     gaattacaag ccactgtaat gcgagacact ttgttcggct ttgcaggcgc cattgttgac    256980
     cggttaatag tttgaacgag gagtgacgca gtaaagtatg cagtagattg accggctccg    257040
     ctcggggatc aacgtagtat cggccagagg gcaggattaa gagggcgctc gaggaaaagc    257100
     gttatggagc agcggattgc cgccatagaa aggctaagca actcgggtcg atcgtggctg    257160
     ccgcttcggg ataagcgcag ggacggtgga gacctcttac ggctgaacgc ttagccgacg    257220
     cgtggcttcc tctgtgagca gtgcctgtgc ctgtccttga gggatcaaca atcaccctgc    257280
     tctgcacacc ctattatcta ctcagcatct atacattata cgcgttggtg gttgtggcat    257340
     ccatagtagc cagtccatcg cagaacggca tatggagacc aggctaggaa gccggcctgt    257400
     gcggtagcca ctgattcggt atagtcttga ttatataagc acatcagtat ccatcactgc    257460
     ctccatatca tactagctcc atttgcataa gccaacgaaa ataaactact cgctaatagt    257520
     gtatatcaaa acgtgaaatt acgaggcatg aatacagtcg cgtgcggcga aactatggcg    257580
     acatgctcag gacaaacctt cagcctgagt aatagccgga gcggggaagt atatagagca    257640
     tcaagatgcg gggatcaaac gagtattgat agtcagagat tcgttactca ctccagctcc    257700
     tactatcgtg ttttgggctt gcaaagacac aatgactaca gagacaacta cttatcgtat    257760
     cgcatccatc ccgggtgacg gcattggcga ggaagtagtg cgagcgacca ttgaagtgat    257820
     taacaagctc gctcagacgt taaatacatt caacattgaa ttcacgcatc tcccatgggg    257880
     cactgaatac tacaagcaac atggtcggta tgtatctgaa ggttacttgg acactctgcg    257940
     acaattcgac gcaggcttgt ttggctctgt gggacatcca ggtatgaata ttcgatcctg    258000
     acacgacaaa cagtcacact aactaatcct agacgtaccc gatcatgtct ccttatgggg    258060
     cctgctatta gcacttcgca gtccattgca actatatgcc aacgtccgtc ctgtgcgcac    258120
     ttttcccgga accaagtcac ctctgaccac agctgtgaac ggcattgatt gggtccttgt    258180
     gcgagagaat tccgaggggg agtattgtgg ccaaggcgga cgcagccaca cgggtcagcc    258240
     atgggaagct gcgacagagg tggcgatctt cacacgagtt ggtgtcgaaa gaattatgcg    258300
     ctttgcattt gaaacagcgc gctccagacc gcgtcgccac ctgaccgtcg tcaccaaaag    258360
     taacgccatg cgccatggaa tggtcctttg ggacgaggtc gctgaggagg ttgcgaaaga    258420
     cttcccggac gtcacctggg acaagatgtt ggtggacgcc atgaccctcc gcatgatttc    258480
     gaaaccggag tcgttggata ctattgtggg aaccaatctg catatggaca ttctgtctga    258540
     cctggcagct ggcttggctg gttccatcgg cgtggcacca tccagcaacc ttgaccctac    258600
     ccgcaagaat ccctcgctgt tcgagccggt ccatggaagc gcttttgata tcatgggaaa    258660
     gggcgtggcc aacccggtgg ccaccttctg gtccgctgca gagatgctag cttggttggg    258720
     tgagaaagat gctgccaaga agttgatgga ttgtgtcgag aaggtgtgcg ctgctgggat    258780
     tttgacaccg gatctcgggg gctcggcgaa tactcaggga gttgtggatg cagtttgcaa    258840
     agaaattgaa cagcagttgg cttcatcgta agcaaacata cggcaactgg cgtttttggc    258900
     ttgacatttt gcccgggttt cttgtcctgt gtgacgatac tgggaaagac gtggtgtaga    258960
     tgcgattatt ttcctgtcaa gcatagcatc gagaaggttt catagtcaga ctgcaatgtc    259020
     ctctagtctt gcttcataag ttctgatagg aatcatatcc tcgagaaaca gccttgtttc    259080
     ataataagct acagctagat aactcctgcc tttccctgct tctagtgtgc ggtcacctcc    259140
     agttagtagc accaaggtca tgtcacagtc atatccaaac acgatacaca ggtctatctt    259200
     ccaatctggt acatatcctc taggcattta tgccgtggaa cagggtgctc acttcttgcc    259260
     aataatttca gcaagcagta taggctggtc agcattagac atccacatca taagagtcaa    259320
     ctcaccctct gacggttgag agaccagaag tgggtcatac gcctttatga tagcaggccc    259380
     tcctagagaa aatcaatatc cagggattga tattcatagc atcagaaatg ttgatggtgt    259440
     gtggtgcccc atctgtgctc catccatgac taagcaggca cccggatttg cgtctcgcag    259500
     ttcaatccga gatccttgac ttcaacgcca acttctcttc catgctctct ccttatccgc    259560
     gacggcagca tcatgatccc acgagaatgg agcctccgga ccttaccaat ggcccatccg    259620
     agattggttc cctgactgcg cattccaagg atgagagcca atttgtcggt agctccagtg    259680
     gcgtctactt catcaatacc gtccgacggg ctttctccga aagtctagat ccgagtggtt    259740
     catcgcctgc tcaagacttc ccccagcccg aggatacctt ggtaggcagt gatgcctcgc    259800
     ataagacgtc cccggttgca ctgcaggatg accagtttcc gtgccgatgg gcatatgatt    259860
     ccgcagtggc agcggtcttg gggaacgctc ccccgcttga tacagctcgg gaactcatga    259920
     tggtgtactt caaagtttgg catcctttgt tccctttcct acatggccct acttttttac    259980
     aggccatgga gggactctat tcagaagatc gccaggagcc agcccgtaac gaagcgatgg    260040
     ccgatcaccg acatgtttgc tggacaacaa tcttccagtg tatcttcaat ttggccaatt    260100
     ctgtccatcc ggagatcaat ctcccgctgg agtctcggat tgaatcgccc agcagcatgc    260160
     attctctcct tgggacgctg actagtaaac atgatatgtt gtccttgcag gcacttcttg    260220
     cttgccaact atatctgctt gcaaggatgt ccctccggac agcctccacc gtaggtggct    260280
     gcatgctgcg ttccatgctg cacgctggtc tccatcgctg tccgtaccga tacaaggagc    260340
     tcacaaccca cgacagacag ttgcgcaaga ggatcttttg gtgtgcctac gctattgatc    260400
     ggtacctaag ccaggcactt gggctgcccc tcggtgtgca agactcggat atcgacgtct    260460
     gttcacccaa tgcgcctgaa atccatatac caggaatgtg caatagatcc catttcgtcc    260520
     ggtctacgtc gtatgctgag caaagggaac accgctccca gctcacaagc aaccaacacc    260580
     ttgaaaacac ctcaccgcat gccttctcag cccacagcag ctcctcagcc gaagaagccc    260640
     agcaaaaccg ccgcgaactt gcctttgcaa gctacgtcga gtccggcacc ctgacaggac    260700
     gagccctcga gctcttccac aaatctatta ctgtgcgctc cgtcccacgt agctccgttc    260760
     tattcctcat cacagacgtc cataaatggt ggaacaatct ctccatcgag acacttcaag    260820
     gccaacaaca acaaccacaa ccacaacagt catccaccga ccaaccccca tcatcctccc    260880
     cagcagcaac aaccaccgcc gcattcaact tcgccccctt cttcactgtt ctttaccaac    260940
     atctcatcct cctcatcaac cgcccctccc tctccctcag cccttctacc cccgaattct    261000
     gctccggact tcaaacttgc atcaatgccg caagggagat catctccgcg ttaacgacgc    261060
     aacaagaaag cggtcaatca ttcttctggc ccggtttcct ctctgctgcc tggatgtcag    261120
     gtctcgtcct tgcatttgca tgccaactcc gccaatacgt cctgtccaag ggagctcagt    261180
     acgttaccct cccccgatct tcttcctgca caattgtctc acaaaacccc cctaacctgc    261240
     atgcacccca cacccgccca acctacctac caacccaccc cactaacaac cgtaaaccag    261300
     agaaattacc aaatgtctca caattctgca caccatgtcc acgcaatggg acgcagccaa    261360
     gcactgccac agggcgcttt cccttctatc tcggactatc catgaaaata ccaccaccgc    261420
     aggtgatcca tcatcatcac ctaacaaacg acgaaaagta gtagtagatc ctcaccagac    261480
     taccttcttc actcccatta actcgctatc cacgaccaac ttgaatgaag aatatgcaag    261540
     aggacgggca ggaaggagaa cccctgctac tgctactgtt gcaacaacat ctggcctgca    261600
     tgaacctact aacactagta gccatgtaca cttgtctcac gaagatcgtt tgttctctgc    261660
     ggagggggtt agtactacga atgataataa tggagatgcg gtgggagagt ttgatttcgg    261720
     gattgtggat ctgctggaag ggagtaactt tgatgatctg gcggatatgt ttgggcagca    261780
     gtatccttct ttttgagggg tcgttgagta tactacaaca tgatgttttg agtatatatg    261840
     ggcaggggag gatgtatgat agtggatatt atgaggtaca ggaaccgtgt aaatacaaat    261900
     agttacgtct acaaaataga aacggaggtc cacatattac gtagaatacg tgagaaagat    261960
     cccgtgagga agtcataagt ctatattaca ctcgtgtcat atcgtaggat acgaggtagg    262020
     tagtatggcg gggataggaa gagaaaagac gtcacaactt cctccctctc gtgacatgaa    262080
     ataagagaac catggcatcc gaacaacttt tcatctccgt tcccagaatc ggcccgcctt    262140
     cctttgccca gcgccctctt gtatcacgtg cactataaca ttgacaggga aagaaccctc    262200
     aaagcgccct tcaagaggaa gtaggagaaa ggaaaagaga cgggaaatcc ggtcaaggtg    262260
     atgtcgctcg ctaatcatgg accgataaca ccactaacaa agaacttttg ggaaccgagg    262320
     gatatcagga ccaggaggga aagagaagag aggtgttaaa aaaaaaaaaa aaaaaaaaaa    262380
     gtggaaaggt tagggggtgg gtaaaatgga aaggaggtgt cggataggag gaaaataaga    262440
     ggtgaaatcg ttaattcgag taaaagaggt aaaagaggtc atcaaaaata ggtgggagtc    262500
     aaaaaggtcc gacatggcag actgctgaaa tcaaaccacc ggtgcaggag atgagacgcg    262560
     gatttacgcc ttgttctcct cggtcgaggc ctccttctcc gcctcgggct tggcagcctc    262620
     agcggcagga gcctcggact cggtgccctt gttcttcatg tactcatcgt aaacgctaag    262680
     ggcctcatcg accttggcgc gcagggcttc ctcgtcctca agcctacaat aatatattag    262740
     caacaagaac tgacagtcaa atggagcaga agggaaaaaa actcacaggc tgagcaactc    262800
     ggtgttgtcc atctccagaa gcataccagt gatcttacca gccagctcag gctgctgggc    262860
     ctggatcttg gggtagagag cctcgccgag catctgcttc tgctgggccg ggggagcggc    262920
     acccagagtc tgagcgttaa caccaccagc ggcaccctcc tgaggaccag cgggcgcagc    262980
     agcgttctgt ccgcgaccac cctggccagg gcgcatctga ccctgctgaa caggagcacc    263040
     acggccctga ccgtaaccgg gaccgccacg cataccctga cccatgggca ttccggggac    263100
     ctgaccacgg ccaccagcgc cgcgtccgaa ctgcacctga gccatctggg ggtatcccat    263160
     gccgttaggg atgccaccag ggccctgcat gcccatgggg ataccctgag caaagttggg    263220
     gggaatctgc tggttggggc ccatgccgcg accaccctgc tggccgggga agggaccggg    263280
     gtactggccg gggcgtccac cggggatacc catcaccata ccgggctgag gggggaaggc    263340
     catgccgcgc tgaccaccag ggatgaagcc ctgctggccg gggccgtaga agacagcggg    263400
     ctgcatgtaa ggctggggca taccagcggc agcggcggcc tgctgctgtc tgatggtgtt    263460
     gcgagcctgg atgctagcct cgagctggct gcggcggaca tccttgcgct gggcaagggc    263520
     aacgtagagg ggcttgccgt tgaccattct ctggttcatc tcggtaacgg ccttggaagc    263580
     ctcatcgggg ctgctgaagc agacgaaacc gaaacccttg ctcttaccga agggcttctt    263640
     gtcagacttc ttggcctcct tgtccttctc ctcggaggac tcgctgggct tctcctcggc    263700
     cttctcagcc ttctcagcct caggggtggc ctccttgtcg ttctccttgt cagcctcctt    263760
     ctccttacca gcagagtcgg gagactggtc gcgctcgacg ttggtgtcgc gcataacctt    263820
     ggcagaggtg atggtgccgt aaggtccgaa gagctcacgg agcttctcat catcaatgtc    263880
     atcggtcagg ttcttcacgt agaggttgac accctggtac ttggaagcct tctccaggcg    263940
     ggcagcctcg tactgcttgc gcagctcctc ctcacgctcg tgcttcttct gggcacgacc    264000
     gacgtagagc ttctggctgc ggatctcctt gtcgttcatc tcctcgacgg cggcctgcgc    264060
     gctctcgtgg gtagagaagt tgacaaaacc gaagccacgg ctcttgccct cctggtcacg    264120
     gctgagggtg gcggaggtga tctcaccgaa cttctcgaac atcttgcgga actcatcgtc    264180
     atcgatctca gagtcgaggt tcttgatgta gacgttggtg aagttggcct tcatctcctc    264240
     gaacttgctc tggcggtcct tcttggagat gtggtggccg acgaagacct tcttgtcgtt    264300
     caacagcatg ccgttgacgt gcttgatggc gttgttggca gcctcagcag tctcgtagtg    264360
     gacgaaaccg tatcccttgg agttgccgaa ctcatcctga gcgaccttgc agctgaggat    264420
     gttgccgaag gcagcgaagg tgtcgtggag agccttgttg tcaatggcgc tgtccaggtt    264480
     cttgatgaag acgttgccct ggccagtctt gcggagagcg gggtcacgct gggaccacat    264540
     gatacggcag ggcttgccct tgatcagagt gtagttgagg tcttccagag cacgctcacc    264600
     atcggcggtg ttgttgtagt taacgtaggc gtatccaaga gagcgtctgg tgacggcatc    264660
     acggcagaca cggatggagg caacctggcc gatggaagag aagagctcgt agagcatggc    264720
     ctcggtcacc gaggggtcga gttcaccgac atagagggaa gccgagtgag gctggttggc    264780
     agcgggagcc ggagtagagt tctcaacggc agtgacctcg ggggtggtgg cactgggggc    264840
     agcagcagca ggagcagggc tggcctcagc ggcgccgttg acgttctcgg cggcgggggt    264900
     ggtagagacg tcggcagaca tttttgtggt gttactgttg gacaagaagg aaaaaaagat    264960
     gtcagcacag tgttcgatga tgaagatacg agagagtgtg tgaggagggg gagggggaca    265020
     agctgtaaca ggcgaccaac tggaggattg gaacaaagct ctcaagcaac aatgaacgag    265080
     aacaatcgca agacaatgaa gcagagacaa atgatgacag cgggagatga gcaaggggat    265140
     aagataaaac acagaggcag tgtgggcttg tctgatggag acggggattt ccttcccagg    265200
     cggtcacact atcaccgtga tagagccagg caagggaagg tcgacagaga gaggagggga    265260
     tggtggagga gtaatgatga tccacgcaac aaaagtacaa cctcaattta gacaccgaga    265320
     aagaccgtca agacaacggc tgctgatatg aaaggaggat gggaaagtga agcgaaaaga    265380
     cgatcacgag gaatgaagaa tatgcggttg agggaaaact tccagatgca cgcacaaaac    265440
     acgcgcgccc acacacacac acaccgcaca acttttcgga ggcagtggga aaaagtcaca    265500
     gtagggcccc aacacggaac aacgaaattc tgatggacga aggggagggg ataattactt    265560
     tggttttttt gttctttttt cccgtttttt taggaggttt ttttcgagga gttttcgaaa    265620
     aagggagata tgaaaaagga ggaagaagag aaaaggatgc tggggataga cagcagagaa    265680
     gggttttatg gatttttttg gggaaggaag aaagaaggaa gaagagcgga tggaggagga    265740
     agagaagaga cggcgaagaa tgaaaatcgc cccgaaaaag accttctttt ctgactgtga    265800
     ctgacggact gaaattctgc ctgccttttt tttttttttt tatctgaaaa aaactcaaaa    265860
     cgataaaatt ttcttttgct gtctttgggt cggcaggtgg cgctaaacct aaatagtcta    265920
     tggtcctcgc cgcttgaacg gtgcttcacg gaaatggtgg gttccttttc gggctttaaa    265980
     ctcgagcggc aaaaaaaaaa aaaaggaaaa aaaccaaact aacacattga aggatcttta    266040
     agttacatgt gcctcaggca ttaaaacgag actaggccac catcaggcag tcaatcaata    266100
     atatcgccat catccatcca tgtcattctt tcaccatcca ttcatggttt cattgacacg    266160
     ggagcttgga acagcagcca cagtgtgtct gcagaggtcg ggccttcaat caacaaagaa    266220
     tccctaacaa agcgaaccag tctcgaaaca agtattgatg aaagctatct atctggttgg    266280
     tcgaagctac ccctcgcaat atgaacaaag ccccgagacg aaagcaagtg tagtagatac    266340
     caggactcga gctagaaata gcactcatcc tcggaaaaat agacacacaa tgaaacgcgt    266400
     aatcaacaac cacagcaacg accacagaaa aaacaggaca catggatcac caggacgcct    266460
     cagctatgct actcatgatt attcactaaa tgcgctgcat gtataattgc atcgaccgat    266520
     ccgggtcatg caaaatctcc accctcttca gctcagatca aatccagctc cggaattgac    266580
     cgcatacaaa agcttctccc ggaggatatt ggcgttggta taccggggca gcttgagaag    266640
     attcacgcag gtgcttgtac tggggagtcg ttcttgatcc tcgctcgagt ctcgaatgct    266700
     gaatcgagga ttgagatggc tgaaacccaa taaaggagcc cgcggggtcg atgtcacaaa    266760
     tcgaagcact ttctgtcttt cttcgttgga catcttctcc atcacttccc agaacagctt    266820
     gacggtggga tgctcttctt tgtcgtcccc gatcgtgtat actcctccgt aaagcgtgtt    266880
     gcgtcgcaag tcggctacat caatgtctcc tgaatcgcca ctcacaagcg tctgcagctc    266940
     cgtctggttg aacatcgaca gccacgacgg ctggatgatt tgtcccaggc cctggaggaa    267000
     agcgttggtc tgcagagcag gctggacttg aagccggtag cgagcaatgt aagagatata    267060
     aaccaaccgg ttctgattcg taacaggtat gtctgaccca tggcttttca agtctcgggt    267120
     agtcgtacgg ttacccccgt cgggaagcgg tatcgtgtcg gtgacggtga agttcaacga    267180
     gaagtcctcc acatcgcccg gatagttctt cagttgcaac tgcagcatcg gttagcagct    267240
     ggcacacgat ttcaagaaca ccactgttca cttaccaatc cttggtatag cccctggtcc    267300
     agatccttca gatcgttcag gttggcgcgg taggctgtct cgcgctgggc cgaacccgtg    267360
     ccgcccgtca aagcccactt cagcaggaag aacggggcaa agttgacatc caccaagatg    267420
     ccctcatata gacactttcc aatgatacgg cctaggaatt catagcgcct aagtagatca    267480
     cggacgttct cgttccattc tgcagtgttc tcgacaaagc cgagctgtct cagaagctct    267540
     cgtcgctgct caaccgcagc cgggttcgga tagagcaggt gctgatcgtt ctcttcaaat    267600
     agatttagat cacttgtcga tttaaaggct tcactagtca cgctcgtgag gaactctttg    267660
     gtcacaccac caccatctat accagcttcg gttgtattaa acttgtcaat gaacgtgatc    267720
     tgaatgggct ccttcaaccc atcccccaac tcgtagaact catcgaatgc gtctttgaag    267780
     atgctctcgc gcctgatatt ggcatggtgc cggctcagta tatcttgcac agcaggacgc    267840
     ccatcgatca gacggcccat tgaggcttgc gccacagaca tgcgccaggc atctgggtcg    267900
     atatacccct gtcttcgacg catttgatcc cgatagatga attcgcggaa gatctggact    267960
     ctcgtcggga aaggtatgaa gaaaggcatg ttgcggagaa tctccatcct cggggccaca    268020
     gcctccagct gcttccggcg agcagcctgt tgttggcgac gtctcagtgc ctcgatgcga    268080
     cgtgtcagtt gagcgcggcc ggtaccgatc aggcctgggg aaggctcgaa gtaggcatcg    268140
     ctcattagat catcctgttc ctcctcttca tcctcatctt gcagctggtg cctattctcc    268200
     tcttctgcta caacggcagg gatgaagcct tccatgtcga agcggcttgt catcaaccaa    268260
     tgcccgtctg gaaggaattt ccgccttgaa tcacgctcat ggatcatccg caagaggcca    268320
     gtgactagac ccttgaagta gtccagcgga attcccgtga cgccggggag gcctttctct    268380
     ttgttcttca tttcaatgtc cctcacgctt gcaatagcgt ccggtggcgc tgcagatgag    268440
     ctaaagtagc ttcgaatgcc cccagtgtct tgagtcgctt ctttttcgct cagatctgct    268500
     gagttccaat acaatgtgaa acctaggttc ttgagaaata ttgtcatatc tttgatgtct    268560
     ttcagtggaa gggcgctctc cttggtccag gaaactcttg tgttcgagga ggcggtgaaa    268620
     gaagactcgc tggaaaagaa ctcctcgtca tccataactt tcaaaacgaa agtatagagc    268680
     tcgaggaata gaagtatgat cgtccattct tcatcccttt cgacttggga tatctccggg    268740
     gaccgagtac cctgcgattc ctcggccggt ttcagcagag gcaacacttt cgtcgaatct    268800
     tgactaatgg cagcaaatat tctgctagcc tttgatgctt gccaaaagta tttgatcgcg    268860
     ggtattcttg agccttcctg gcctgtcagc tggtcactcg aagtcgccga tcccaaatac    268920
     aaccacatcc gaatgtcatc accccggcga gggaatactc tcagcagcgt cagagcgtat    268980
     gttgcaagaa tcttggcttc tttagatgca tccgattgag cgtttgccag ctcaccctga    269040
     gagagatgtg tagtgtgtag ctgagaaaga agccccgtaa tattactctg attcacaagg    269100
     ctaactagct gctccttgat gaacgggtgc agtggcgttt gttcaggcgc ctcgtcgtag    269160
     tcattagact cttccgactc taagcgccga gatatatgca cggcggtaga gttcagcagc    269220
     tccgatacca ccttcacaaa acctggttct ggagccggac gacctgtctg gcctcccaga    269280
     gcgcaacggt gaaagaatat aaaataagca agcagccaaa gacgggcatc tacatcttct    269340
     gcgctcttag gtcggtctcc gaacaacgtt tgcaacggcc ccaaggcgga ggtcagcaat    269400
     ttataattga tattgtttgc caatccatcc agacttccaa tatactccgg gaggttgggg    269460
     atggttagat agattttcgc aaaccactcg taggccgtaa gagtctcaga tgtgataggt    269520
     cgaagcaaag caagcacact ctcagtaagg ctatccctgg acagcttata cctcgtagat    269580
     attgattcaa agtctgttgt gagaatcacc ataaccgagt agtattcttt ggccagtcgt    269640
     gccatgtgct tcggtatcag ccccgtgaga aagacgagta gctgaaggag acgttgaacc    269700
     gcgaaaaccg gtaccgttgg cgacgtcact gaccgcaaga cacggagagt caaactcgcc    269760
     agtttcttca gcggcgtggt ccattccccc tcggtcgcaa tcgagggtac ttcatgcaat    269820
     gtcctctgaa atgcctcgga gaagtatacc agccgggcaa tatccccact gtcccacggt    269880
     tccaggaact ggaccagcaa acgaagctgc gataagcagt ccgcagctgt tccgtatcgg    269940
     agggatggtt gcagaacaac atcaggctgt tgggcgagga tctcaaagga gggaacatga    270000
     tctttgccct gcttcttctc cgtggtatcc cactcgttgc gccacgtcct gcgcgttatc    270060
     ttccggctcc gataacccct ccatgtccgt tggacgagtc ggctcgccgt caaccgctct    270120
     ctttcctgct gtctcgcaag ccgttcctgt tgggcaatcg caagagtatt ctgagggcct    270180
     gcgccgtgag gattttgtcg accagagggg tatgcggcga aagggttcgt attgcggccc    270240
     ccgaggttaa cctgccgtgg acggcgggag ttccccgtaa atgactggaa catagcttcg    270300
     tttagacgat cacgctgaga ttaaagtctg tcgacaagac tcgggcggac aaatgtgatg    270360
     gtcactgtag agatgaacag cattagtcaa gcgtctccat gccgcagccc acggatgaac    270420
     agcctaaaca cgcagtaaag cggaggtgtg tggaggatgg attgagcatg gcagctctct    270480
     ttgctgtctc gtcctgcagg cagtccggga tcgccgctga ttgcttctac ggccacgcac    270540
     cgtttcgcac cgaataccct tattgccact caccttgtcg ccacgccgcc catatcacgc    270600
     ttaataatgg tctgatggct ctaattatct agacgatgct ggaactcttc atctgcatgc    270660
     tgaggactga gagtaccttc ctagaggctg tctattctct tgtcgctata tagaatgtgt    270720
     ctatgaccta taagcgatag attttcattc catctcactg tagctgggtg ccagctagta    270780
     ctactactag tacccgtcgc aacactttat atatatatag taactactac agcccctcat    270840
     cgactgtgcc ttggaattaa gctacatact aatgatttgt atcatgtcat tccgatacta    270900
     ctacctacag tcatatagag gggttaactg ctttacagat tttaacacca gctcaaggac    270960
     taatatacga gtagcaaagt tgaggatgac aaaaacatga agtataaagt aacaatggcc    271020
     atgaggcccg aaaactgaag actgcgtgat attagatctg cacctacaat gcccctttac    271080
     agtatgtagt gtccttagtg atggatagta agctgcatag catatatttt tatgctttag    271140
     gtattcgaaa ggtagcgttc tactagtcta gaaggcttct agtaatacta gggctggatc    271200
     tcatgtatat cccagctcgt atcaccaact ctaacttaaa agcgtctctt cacgatccaa    271260
     actgcaggga aataacctta aatcccaatg cagaccgcat tgcaagacta gatcggatta    271320
     taccaatatt cccgaacctc atgaaatctg taattggtga aatctaaacc atttgctaat    271380
     atgcaataaa aaacccagag atgcgccgcg aaccaataca tgtaccaagc aaggtaagac    271440
     ccaagctaca cgccgtgtct tctgaaccgc ttgataccaa ggtagccctg tataaaactg    271500
     tgccctcaac atcaaatccc acagctactg tacatagaat acagtccaca caagccagac    271560
     cggcaaataa agcatgcaga gccgatcaaa ttcagtgatc gctacccaaa gagcaacact    271620
     atcagaacag catcgactca actccggcgc cgcgtcattt catgcctgat gtaaccgcca    271680
     aactgtgcat ggacgaaggg ggtatgtatg atatgcctca tcatgtccga aaaatccgaa    271740
     tgtctttccc tctggaggac tgcaacgact gcgatgccga ttattgacgc gcaggctgag    271800
     tagtcgatga ctgttccgtt gcggcctcag agtccagacg ctcctgttcc agaacttcct    271860
     gaccgttgtc cgaggcccac atatcgagat agtcctttcc gctgaaagcc cgttcaaggg    271920
     taacgatcct tccgcgcttc tcgacttctt tcgtgtactt ggatttcgtg ggaggcatac    271980
     gcttggtcac gaagggggtc aactatatca tacatatccg tattagtctt tcaatcccaa    272040
     ggtaaaagtc aattgaacat catagaaggt ataatcccac cttaaactga tccaaattct    272100
     caggcacaac gaaagtgcgg acttttttcc aatcgatcac atatgacccg ttcttcgcaa    272160
     agtaacccat cgatccggtc cggttaccct tgtagtagcc accaaggacc tgtttggtgg    272220
     tcaggcgcaa gcgcgccaac atgggctgcg agggcttgaa catggtgggc aggcagggag    272280
     gcaattgacg gtcggtgggt tgcggaggta acaagacgga gcgttggaca agatgttcgg    272340
     ggaagagtcg ataggaaggc tctttctggg cggcgctaga gaggagtagc tccgccccgc    272400
     caagaacatt tttcgtggtc cgcatcggaa aagtaaaaaa atcaacggct gcatcttgac    272460
     aacttcttgc ggtgcgtcgt cgccattcaa gtcattcttt cctttatttt atttcctggg    272520
     atttctctga atagattatc atttacataa aatacagctc aggagctgcg acacacgccc    272580
     atcatgcctc gcaggcaaac gcaaatgcgc ggtcccaaag accgggacca gtccttgcag    272640
     aaatcgaaga agcccgcacc caagaacaag aagtccggaa actacctaaa tgcatttgcg    272700
     atcgcagaga gcgaaaatcc tggaaaactg ggagtcaagc gcacccgtct aggcaaggag    272760
     gacgaacctt tcaaacgcaa gcgacacaat gctcgagatg ccgacgactc ggacggcccg    272820
     gattacagca agcgccgtcg cactggagac gatgaggcgt cggaaatgga ctcgaatgct    272880
     ggtagcgatg gcgaaggaca ccggtggagg attggtgagg tcggcagtga cgatgacagc    272940
     gagttggaca gtgacgaagc catgggttcc agtgatgagg agaggttcga gggcttcacg    273000
     ttccgcggca gttctacgat gaaaaacaaa ccgaagcaga aggccccgga acgcaaaaag    273060
     cgcactcgcg aaattaactt gtccgaggac gctgaagtat cagaggacga ggacgatctc    273120
     gaagacgact cggacgacct cggagaggat gcgatagacc tgactacggc ttgggatatg    273180
     aacatggcag aggaagaaga ggaaaaggct aagaaggcca agtctaagtc taagcaatcg    273240
     gctgagagcg atgaatcgga agaatacgac tccgaaagcg aggacagcga ctcggacgac    273300
     aatgacgatg aactgccatt atcgggagac gacatggacg aagatgaggt ggatgagcat    273360
     ggtctttcca agctacagag ctttgtcaac gctatgaaca ccgagggtac tacgaagaca    273420
     gcacgaaaga ccggtggaaa gcaggaacaa ggggccccta cggagttcgg tctgacttct    273480
     acgcgaaaac tcactattgc cgatcttttg ccatcaatta cagattctcg cctcaagagt    273540
     tccctcaagc atgtcgacgc tactacgacc tcaaacacga agacgtccgg tgttcctgga    273600
     aagctggatg cgcctcttgc aaaacgccaa caggatcggc tggaccgagc ggccgcatat    273660
     gagaagagca aagagactct tgaccgctgg ctggagactg tcaaggcgaa ccgccgagcc    273720
     gagcatcttg tgttcccttt gcctgatccc gaagcaaacc agacgcaccg gatgggtgct    273780
     gctgaaccgc gcacggatct tgaaagcact atccaaaata ttcttcagga gagcgggctt    273840
     attgaaaata atggaaagtc agcggaagaa caggtgcaag agtttgaaga actccaggcg    273900
     cggaaattgc ctattgagga gatcagggct cgcagggcgg aactacggaa gcgtcgtgat    273960
     ctgctcttcc gggaggaagt acgcgccaag cgcatcaaga agattaagag caagtcgtac    274020
     cgtcgtgtgc atcgcaagga gagagagagg cttgagcaac aggaacgaca ggctctctta    274080
     gaagccggcg tggacctgga tgaagaggag agggagaaga acgatcgcct gagagcagag    274140
     gccagaatgg gttcgaagca caaggagagc aagtgggcga agagcctgaa gcagactggt    274200
     cggaccgctt gggatgagga cgctcgacgt ggcacgcagg atctggcctt gcgggaggaa    274260
     gaactacgga agaggatcga aggaaagcgc gtcaccaacg gcgatgaaga ctatcttggc    274320
     tcatccagtt ctgagtccga agacgaggac ccatgggatg aagaggctgg gtcggatgct    274380
     gagaagcgca agatccgcca gaagcttagc cagctggaag gtgacgatga tgctgacaca    274440
     gagttgaagg ggccccacgc caagctcctt tcgatgaagt tcatgcagaa tgcggatgct    274500
     gcgcgtaaag cagaaaatga tgctgaagtt cgccgtctca atcgggagct ccacggtgaa    274560
     gagtcgcagt ctgaggcgga atccgaagtc ggtcgccgga agtttggccg caagaaggag    274620
     gaggcgaaga cagcaaagga atccaaagcg aagctggctc ggaatgaatt cgaagaagca    274680
     ccgggttctg atgatgaggc tcagcaagag gcggatcaag aggtcgacat tgttgttgac    274740
     cgtcccgcaa agaagggacc ggcagccccc cagaataagc ctcgtggtcg tcctcagaag    274800
     gaaatcgcag aagaagaaga tgctgctgct gtggaggaga acccgtggct cgtgcagacg    274860
     aaccgcaata accgtcgcgc catagtgaac gactcacagc aaaccgttga catcacgcta    274920
     gatgacgcga atgccagcag cggtaaatcg aagagtgcac ccaaagccca aaaggcatca    274980
     gcacctagca aaaagaaggt tgatgccgag gtgtacggta gcgacgatga ggagagcgtg    275040
     ccggtgcttc tcaagaacca tgatctggtg aagagggcct ttgcgggcga tgaagtcgtg    275100
     caggactttg agcaagagaa attcgacacc atcaaggagg aagacgatca agtgatcgac    275160
     aacaccctcc ccggctgggg tagctgggct ggtgatggca tcagcaagaa acagcaaaag    275220
     cgccagaaac ggttcctcac taaggtcgag ggagtgaagc cggaagaccg gaaggatgcc    275280
     aagctctccc gggtcatcat caacgagaaa cgggtcaaga aggtaagaac gacgatcagt    275340
     cgggctctag cgcgtgtgat ccttattctt attctgtgca tgataaacta acgtctgctg    275400
     tttcgtctag aacaccaagt acatggccac gcagctcccc caccccttcg aaacgaagca    275460
     gcagtacgag agatcgctcc gtctgccaat cggtcctgaa tggtctacta aggagacttt    275520
     ccaaaatgca accaagccac gcgtgatgat caagcaaggt gtcatcaagc cgatggaaaa    275580
     gcccatggct taatgtatgt ggtggtctgg ctactacgag ttggcagtca tggtgggtaa    275640
     ctgaatagac gagagcaagg catcttgcga gtctggggtc ttttggtggc gttattgtag    275700
     aattaagttt ggtcatgata ccaagtcatt ttaagatttc tccgaacgat ggggttattg    275760
     gttcagaggc tgaggctaga ggggttgttg tcaaggtgat gatttttgtg tcatccccgc    275820
     atcaaccgga ttgttcgtag catccgatct gcagaccagc actggtttca agttgtttta    275880
     gtgctggacc ctttttgcaa ggcattagtc tccggggttg gtcacccccc tttaaggttg    275940
     tcgaataagc agtgttttgg acccaagatg atcaggtctg gtgagtccct gcgccgtgat    276000
     actctctttc cccgatgcgg tgcggtttcc ttagattgca ggccacatgg acatcgagat    276060
     tcggtccgac ttggatccat ggatatgagc aagccactca gagagctatt cgcgtccctt    276120
     gcaacgacga gtgacagggt ggaatgccac gacgggcgtt ggccgggaaa aaatcagaga    276180
     tggagcattc aataataaaa cttactacat tgactttaac cttggcgtat aggtacattc    276240
     cttgatgcct ggggagcata cgcctcccag accaggtctg ggaaaggcag ccgtgagatg    276300
     gagaaagcca cagagaatca gatcgtggag catgagacac ttgaaaccgg tcgcaaggct    276360
     ggtcggacag ttttcaattt tgttcctttg gtcagaaggt gaaagatgag aaagtacttt    276420
     cgttcttagg aaagtatatg agccttggga gatgctccac ttgttctggt ttacccgcac    276480
     cttcaaacag cgacaagcaa gttcatccat cacccgttcc ctccctcctc ttctcttctc    276540
     ccccccttca aaaccactac tattagttta tctgttcaca ctagcaattc atccaagaca    276600
     ctatcaacaa tcatttgccc ctccatcggt tatgccgatt aagtacgatt aatctgcccc    276660
     cttcatcagc tgtctcaatc atccggctgc agtaagcttc ctctcccctg cacatacccg    276720
     cccgacttca ggcagatggt gctctgcatg cgcccccggc tggcagagcc cgaggatggt    276780
     gcattccgcc cccctcaacc ctgcattccc cgtgctatgt tttcgttatg cctcgaggcc    276840
     tgggatcaga caccacaaca ttgaccattg tgcagatcga cgcctcgtaa tacctcgttg    276900
     gcacttgttc cagcccgcca gtgtccgtct ggtatccctc tgcaccgggg ccggagtttt    276960
     gcccgggcct gagattccta ctggctgaga ccggaatcta tactcaacct aggtgagcta    277020
     tttcactgct atttgaaaat gtcttccgcc gctcgatctg cttctgttgt ttactatcct    277080
     ttcctgtccc tccctcatat actggagcct gtctctgggg tgttccgtac actcagttat    277140
     cagtccacca aaggagacct agagatccat cgttggcccc ttcatatagt atcattcttg    277200
     tggatgactc cgttgcgatc attcttgctg ttttctttca tgttttgatc cacctcctca    277260
     accaacccta ctggctggcc actttcatac atactagccc tttggccttg ggacgtgtgg    277320
     agggatttaa tccgtctact acacttttca atcttgatct ttcattctag aaagacggca    277380
     cagaccttca caatggagag gaaacacaga tggggctcat cgttcttgct aatgtggctt    277440
     ctagctgcag aaggagtata ctcagccccg agacgctcat cttcaactgc gtctccaaag    277500
     acgcaatttc caccaggtgc tgaaactgaa agaatactcc ctggtacaaa cggtgtaagt    277560
     gcaacgtgac ttaaccatca tggagtcgga ttctaattac cattcagctc tatccgacta    277620
     gccttgagcg cgagggtcat ccggtgctcc caaccccgac atcgacgggg aacacgaaag    277680
     atccttgggg acttgatggg ctgcttgaat ccttgggcga taccgcagac ctcccaaacg    277740
     aattattgag cgagtttcta ccaggctggg gcaagaatta tccagtgacc gtgccggtat    277800
     cagcgtataa accggccagc gcggaaacga ctagctcagc tacggaacca caaacgcagc    277860
     cggagacttc tgatacctcc acgccgcagg ctcctagcca aaacgtgcca gaggcgacaa    277920
     ccgactcttc ccaggtcagc agtcaagctt cgagtacaac aagcctcacc cagccttcga    277980
     gtacaacaag caccacccag ctttcgagta caacaagtcc cacccagcct acgagctcag    278040
     cgagttcagc ccagccttcg agctcagcaa gtctgaccac gactgcaagc caaacaacgc    278100
     aagcggataa ttctatcact tcaagtgttg tccaaggtaa gttttttcaa ataatatatg    278160
     ccatataata tctgacatgc cttggcgtta gcctcagtta caccaatgtc tggtcaggac    278220
     gtatttgtgc cattggcgac aaccccattc ccgcaaacca tcacagcgcg gaacgatcat    278280
     ccggtgccta agaaaggaat tgtatgtata cccgaacaag acctgtcaag acttgcctaa    278340
     cgaccatagg aaaatgtcac tacgccaatt gagacaaaca agttctacgc tggactcttc    278400
     ctcgggtcgc agagcaatac tacctttacc catccgtatg gtctctcatg ggcgaaggga    278460
     agcgggaatg ccaaaagtta cggaatggcc atttcccaca acgaggttaa tgtcgttgca    278520
     aatggcccca ccaacgccaa cattcctggc aatcccattt cgtactacat caatcccatt    278580
     ggcatccagc atatgatcct ttcagccaca gaactcaaca cctcaactgt gctgactgca    278640
     gagaacctct tgccattctc cgctgatgct gttctgagtc ctactcccgg gtcaagccaa    278700
     aggataacta ttcctcttgt gcaggggatg ggtttcgtca caggcatgta caacaaccta    278760
     cagcccctga ttcaaagtgg tgtatttttc agcaaagtcg tcactgcttc ctcgccccgg    278820
     attggcatct acaaatataa ggtctctctg gcggatggaa cagagtggct tgtttatgcc    278880
     atccctcaag atggaaagga tccggatttc cgcttggaat ctaacaccga cttccgtggc    278940
     ccaagtggat ggtctgggac cgttcagatc acgaagaacc cagcaggtga ttctggtgag    279000
     aagcttttgg acggatctag cggtgtcttc gctctggagg ctgctgtatc cgggtcggtt    279060
     caggacaatt ctggtacata caatctggca ttcgcgaagt cagggaagca gctgcaacag    279120
     actccactgc ttatgtatgc tctgccgcat cacgtcgaat cgtttgataa caccaccaag    279180
     ggccgcatga ccagcatcac gcttcggaca acgacaaagg gtaatgcaac tgctgtagta    279240
     ggagaaactt ggacgatgct ggagccgaac cttccaactc aaatgggttt cgacccgtgg    279300
     tcggtatcgg ccggtaacgt gaacaatctg agcgctgctg ccaaacaagt catcctatct    279360
     gtggcgccca ctgagctcaa ccaaagcatt gaccagcagt cagacctgaa tagcatgtac    279420
     tacagtggca aggccttgag caaatttgca actcttgttt acacagtgaa caagctaggg    279480
     ggtaaccctg acctggcagc ttcggctttg cagaatctga agaccgcctt ttctcgcttt    279540
     gtcgacaata agcaacaatt tccgttggtg tatgacagcg tttggaaggg tgtggtgtcc    279600
     tctgccagct acggaggcga ttctggcgct gactttggaa acacctacta caatgaccac    279660
     cacttccact atgggtattt tatccatgcc gctgccatta ttggctcgct cgactcgacc    279720
     tggctcacgg attccaacaa agcctgggtg aatatgcttg tccgtgacgc cggaaactcg    279780
     gccgcaaacg acccatactt cccattctcg cgctctttcg attggtacca tgggcattcg    279840
     tgggcgaagg gtctgttcga gtcgtttgac ggcaaggacg aggaatcaac ctcggaagat    279900
     accatgttcg cgtacgcact gaagatgtgg ggaaagacga ttggcgatgc cagcatggaa    279960
     gcccgcggca acctgatgct gggcatcctc cgacgaagct tgcacaacta cttcctcatg    280020
     gagagtgata acaagaatca gcctgcgaac tttatcgcca acaaggtgac tggaattgta    280080
     agtttctggc ccgaccccaa gtccgtttac acgcaactga caaggttcga agctgtttga    280140
     gaacaaggtg gatcacacta cctactttgg taacaacctg gaatacatcc aagggtatgc    280200
     atgtccttcg tacgtttctc tgtttcgcat gctaatatag tcaaaagtat ccacatgttg    280260
     cccctcttgc cttcgtctcc atatgtacgg agccaaaact tcgttcgaga ggagtggaat    280320
     gcactcttct cggccaatgc caccgatcca gcattgaacg tcactggcgg atggaagggt    280380
     gttttgtacg ccaacttggc actgatcgac cctgcgtctt cgtggaactt cttcgcacag    280440
     tccaatttcg attatagctg gattgatgga ggagcgtcac gcacgtggta tcttgcattt    280500
     gcagcgggtc agtatatccc tccaacttct caatcaatga tgttgctaac cacgtacgca    280560
     ggcttgggcg gaggtcccgc ttaaggacac atcatagcga ccaagcattt gatatattta    280620
     gtctgccatt ttggagtatc cagcgttcct tcacaggaag atatgcagtc tgtgctgttg    280680
     atacgttttt gttggcgccg tcttatatac ctgttcatat atccgactac cctgtgaacg    280740
     tagtgatata gatgtttatt aatgatttta cctacattgg cattgatagc aaagaagaat    280800
     atcatccacg attatcagat ttgtcggcag tactacgtcc tagcgcagac ggcaacagta    280860
     aacctggcca tttcctcaac accgccactc cgccgcaact gcgacgaggt aaatgcacta    280920
     gcatagcccc gatgttcccc aatcgtaaac ctgggcttca tttaagataa gaagaaaaac    280980
     gccgccgcct atagccttgt aacaaggctg tgtagcctcc tgataagctt atttattgcg    281040
     aacacaaagt gggatgtgcc ccaatcactc gggattcatg tgtcctgcag gtggggggct    281100
     gcgtgactcc gtttaaccag tacacacgta gtagttctta tgctaggctg actgatttgg    281160
     ggggctctga tgtgatctga taactgagat gcgaaatact actagtgatt actgtggctc    281220
     atggacctgc taagaccctt gactcaccct ctcatccctg taggtagctt aggtaattct    281280
     gctgagttga aaaatgccac aaacaagcca cagtatctcc atctctctgt tatctatatc    281340
     taagcaaatc taattttttt agactagcta gctaactaaa taactaactc accaactagt    281400
     aacttgttca acacctccga tccagcttaa cgatagagag aatgcaacaa atactatgat    281460
     tggtggctgc aaagcaaccg gtgaatggga gtgggtcaac cagcaaggga cgggctggac    281520
     gggaaaaagt gtgcacggat caagttgggt ctgctctaag caagttccgt gatccatctg    281580
     gcaacaacat atttcttcga ggcttgaagt taaaattctt ttagtttgtt gatagtcttg    281640
     atggcttgac tattcaatta acgtggctgg atgtctcagc cgctttttga ttgtgaatca    281700
     taccactgta tgtatgtatg tatatactgt atgtactgat tgtgtatgtg actgtatcca    281760
     atccgagggg tgtgccgtta gtcagagata cattgtaact agttaaccta caacttagca    281820
     ctggttgtat acgagcatca cagttactga ataagggaac tgattactag tcagctggtg    281880
     ctgtggtaat atcattaggt agttggtaat tcattgttgg tgtctcgttc gttgctgtca    281940
     tcttctcaat atctccggtt ttccaatatt agcattgaaa tcgggcgggt tgtactctgt    282000
     ctagcaacgt gttgcgacta tgcgggagac tgaacttaga ctctgcaagt ctcccagttt    282060
     caaagcccga taaccagctc accatcttaa atgcggtcaa acccaaccag ttgaacttac    282120
     aagtggttcc agaactttgt gtgcactgtg aagccagtaa gccgaacgaa tgagcatctt    282180
     acgtcaaagg ggggccattc ccctgaaggt gggcctgatc gtggcagtgc aaatgcatag    282240
     tgagtgggtt ttccaccatc atccggtgtc acggcagtcc aggaacctgg gaatttagaa    282300
     ttatcagtat tttactgtga gaaggaactc tggcacggtg ggggtttgtt tgattcagga    282360
     cggatgctag ttagctatgt agaattatca ttgctgacct cttcttcatt tcaattaaaa    282420
     ctgcatcagg agtcgagttg agattcagat tcagattcaa gtgattgaag gtggctggag    282480
     ctggaagcat cagagcatca gccccacccg gattagtccg ggactctcgt cacaaacagc    282540
     cgattcctgc tgctggtggg aagctcaggc tctatcgatc tatcctctgc attagtctac    282600
     atcaccatta cccagcatgg agaagctggt ccgcacactt gtgcctatca ctcttcacac    282660
     ccagtaaatc cccccatatc ccatatccca acttttcagt ccttcttttc cacaaacttt    282720
     ccttttccat caagtacgga atacttcccc aatcccattc cccggtcggc ttcgggcagt    282780
     atcctctggt cccaattgtc tcccgcaaag tggtcaacgt catcgtcatc caattcctcc    282840
     attctctcgt ttaaaagtac ccttcctgcc cagagtgtta agttaaaaag attttctaac    282900
     ccgtcccagg tagcattacg accatcacta cgagtaacta ctttactctt cctccaactt    282960
     agccccccca cccctgcttc catcacactg gcagctttcc actcttcccc ctccatcaat    283020
     ccctggaacg ttggatgatc tggattgagg ctgtgctgct gcctcctcct tttggtccaa    283080
     atccctcagt ccttggtcca ccagaattcc ctcaccaacc aattaccgtg gccagtggaa    283140
     cgtccggaat cgtgatcact gcttagcgac tctttcgact accactagaa tctgtacggt    283200
     ttggagtacg tagccaccat ctcttggccc ctgtaccttg caaaaactcc ctttctttgg    283260
     ttgatccttc accctggggt aaaaatctca acgtgtgcac gcgtcgcacg gttctagcca    283320
     ttccttatcc gccgtgtcca agcctgcaag gtggcttgtg ctgtgataat cctttgctaa    283380
     acgcaagcaa agttcagaga aagcctaccc acgcgacaag ccacaccatc agacttgctc    283440
     ctccatccga tcacgggggt gctacattgc caatcgactg ttcatttcga ttaagccccg    283500
     ttttccaaga gtcgactgga aaagtttaga tcagaagacc cagtcgttca tatcgcttat    283560
     atctctcaac ccccgtttgt tgtggttcca gattgtcgcc acaggacttg acatttccca    283620
     atgggtaagt gttagagaga gaaccatcgt tccttagcac tcctcatcca tgtttcgagt    283680
     cctgctccta cctaattctt aattcccgtt tccccacctc cagtttcttc acagctacgt    283740
     tcctcttatt caggtatcac agtccttcca ttcgttcgct tttctatctc gctttttgac    283800
     cctcttgctt gctatgatcg gcacggcttg ttgtctcttc acgcacactt agatcactat    283860
     actctttggc agtatatccg gtcgtttata agcttttcac tttccccact cctttgttcg    283920
     tttaaactgc tttgtcgtgt caactcgcct tcctttccta tttgtttttc tgacagcacc    283980
     gtccgcggcg aatgacaacc gttgccagcc tttgtctcat cttttcacat ctacccgcct    284040
     ggtcctatta ggtgccacgc tctgtagact gggctaacaa aattcccaac ctgcctttac    284100
     agcgaccaac aatatcttca agtcatttag acgctactcc tggggcccca aacggagaat    284160
     gacgggctta tcatcagaga atggttccac ggagcctgat gagagagcag cattgctcgg    284220
     tgacattgct cgcagtaact ccggcctccg tccgcgacag cagaagcttc actggtctca    284280
     ctggcctaga cgggtggctc atttgacttg gtcgactctc gttcgcgatt atgtcaatgt    284340
     cctgctcatt tttgtgccac tcggtatcat ctccggtgct ctccattggg acagtactgt    284400
     catcttcacc ttgaactttc tcgcaatcat ccctttggcc tctcttttga gcttcgcgac    284460
     tgaagagctg gcagctacta tgggtcaagc cctgggaggc ttgatgaatg ccactttcgg    284520
     caatgcggtt gagttgatcg tatgtacatc tctgactttt gtctgaagtc taatgtgtta    284580
     caatgacccg gcgctgacaa gaatcgctac ggataggtca gtatcattgc tctgaaagac    284640
     aaccaaatcc gcgtcgtcca agccagtatg cttggtagca tcctgtccaa cattctgctg    284700
     gtcctcggct gctgcttctt cgtcggtggt ctcaagtact cgcagcaatc tttcaacagc    284760
     acggtagcgt cgacaatgtc atccctgatg actgtttcat ctgcttcgct gatcattccc    284820
     gccaccctgt acgcctcttt gagtggctct aaagataagg agcaaagacg tgacaacatt    284880
     ctgatcctct cgcatggaac tgctattatt cttttggttc tctatgtgat gtacctttac    284940
     tttcagctca agtcgcatgc agagctcttc gaagcagcca acgatgagct caacgataca    285000
     gagaaccagg gtggcgaagt tgaagaagcc gaggaggagg agcatttgct cagtccgtgg    285060
     gcggccactg ttgcattgat tgtcatcacg gtcttggttg ctatctgcgc cgactatctg    285120
     gttggaagta ttgacagtat tgtgacgaag actggaatga gtcgcacgtt catcggtctt    285180
     gttcttattc ccattgttgg aaatgccgca gagcatgtga ccgctgttgt tgttgcttgg    285240
     aaaggaaaaa tggaccttgc cattggcgtt gccatcggaa gcagtcttca gatcgctctt    285300
     tttgtgacgc cattccttgt cattcttgga tggatcatga atgtggatat gacgctacac    285360
     ttccatatct tcgagacaat ggcctttttc atctctggac tggttgtgac attcctgatt    285420
     caggacggaa agtcgaatta cctcgagggt ggactatgct tgggaatgta tgttgctcct    285480
     ataccgctat attgtctcac tcacctttga gcttttatac tgacccatcc caggtatcta    285540
     attctggcaa ttgccttcta catttaccca gacgatgtca acgaggatgc cctattcaac    285600
     cactaatatg ttgttcaatg ggttgggcac cttattgagc tgctgcctat cagccgtctc    285660
     cgctcactat tctcattttc catctgtact ccttcgtcgt ctctccttaa tcctgtttaa    285720
     ctcgaaaatg ccgttgtaaa aagcgagcta gcttcctcag tgggtttttg tacagacatg    285780
     cccagttgac gttttgggca tttttcacgt tctactatgg gaggtgcttt ctttgtttca    285840
     gtcaagctgc gggccagtac caacgtatgc cgaataggct acaatcctgt atttcaatag    285900
     gctaagagcc aggttttcaa atgtcacctt aacaacttga gtctctgctg cggaccgaaa    285960
     aacgaattat taggaatcac gcctttgtca gtagcaccaa cctcagctag gatggtttgt    286020
     ctgctgtatg attcaactct tagtaaaact cgtaaataat tgtgtagaaa tcgtcacttc    286080
     gtcatcattg cagtggaggc atcgcatcaa attccttgat ccaatgaaac tcttggcagc    286140
     ggctgactca gccgcggatg tggagaggaa aatcgttcgc cggccatcca aggcgagaga    286200
     gccagattcg ggtcgatgtg actacctctt cccatcctcc ttgacattga ttgttcattg    286260
     agggcccatt atcacacacc atgccgccgc gtctcaacct ttttaccgca cgggcggttc    286320
     ccgttcttcg ccagtccgcc aacagctcgg cggcttcccg acgcagtttt gcgaccatcc    286380
     tcaacaccaa ccggccttgc gcggcctcga ccggccatgg cctgaaatcc ggcctgtcag    286440
     cttccgtccg gggacagagg aggtgcaact cctcgggctc tgatggtcag gatagaccca    286500
     agggcccgac cgaggaccct ttgccccatg ttagcgaaga ggccgcggag gtcagcaaga    286560
     tcatggataa gaagtgcgat ggtactcctg ctagtcctga gttggaacag ggatcgccta    286620
     tttctgaggt gcgtttcttt cttggatgtc gtgttgtggc tgttgctgct gcggctgcgg    286680
     ctgcttccct gttttgacgc tctccccgcg gtatctgggt ccttattgac tattgtctct    286740
     gcatagatcc tgcaacgtga taaagaggcc ctaaagcata tgcccaaggt catgcaagac    286800
     cagatgaagc gtccatccgg tagccgttca ttctcgacgt ccgctcgccg cctgcagcca    286860
     gaacttcagg gaaaggaatt ggacgatgcc tcggcgtcgg tcgttgccaa tatgatctcc    286920
     caggttaacc agcaggccac ggagctgcac cctggactca agttcgaagc gccccagaat    286980
     cttcccaaga ccgagaactt ccgcaagaga tatgagacga tagtggagca gttcactaag    287040
     ctgctgatgc aagatggcaa gctgagcaag gctcagaacg tacgttctac tatgcagagt    287100
     gaccttcttt tctttgacag gatcaggact gattttgact ttctgggtta gaccatggca    287160
     ttcattctgg atcacttgcg cactgctcct ccccctaaca tcaacccccg gcgccgcttg    287220
     ctcccgggtc ctcccgctcc tcagctccct cttaaccccg tcctctatct caccttgatt    287280
     gtcgactccg tcgcgccttt gctcaagctc cgtcaacaga agggtatcgt tggtggtggt    287340
     gtgtctgtgc aggtcccttc tcctctcgcg ctgagacagc gccggaggac cgcgatcaag    287400
     tggattattg atgcctctga caagcgtagg gatgctattt ttggccagcg cgtggctaat    287460
     gagctggttg ccgttgctga gggccgcagt ggagtgtggg ataagagaga gcaagtgcac    287520
     aagctgggtg tggctggccg ttctaacctt ggattggttg cgcgccggag gtaatgtact    287580
     tattttaagt ctattggagt gagagatggg aaaaagagcc atttctactg atgatatcag    287640
     agggcgttcg gctacattgt acctatgatg gtatgcagta ggggagctag agagatggga    287700
     tagttggatg ggtgttgtat attatctgaa acctgtacct cattttcttt gaccgttttt    287760
     gaaagcattt ggattagaaa atttacgcat aattgattca agatggaagg atcggatgat    287820
     atattggatt gtatctgaaa ttactgctag tacataacag aagatagtgt gaagttgatg    287880
     cgactaatga agtcctcgac tccggccacg agccaatgac acgggcgatg actaacagcg    287940
     ctagtcgcgg ctgggtccct ctccaatccc ggccaattct ggccccccgt aaagcagctt    288000
     atctgtagct tcaccgatca gcattgcctg cctactcgcg atctgtagga tgcacttcat    288060
     ctcctacagg tatctttcca ttggcgtgtt aagcggcatg ctacattgac agctggatcg    288120
     ggtgcaatcc ctgttctaga cgcgtgggga gggaaagtct aacgccgatc gggtatacta    288180
     ttcctgctgg cgtcccgtgc ttcataattc gttctccccg ataacgacca acgcactgca    288240
     gataactacc aggctagtat atacgaccat caactagcta gcgttagcgg cacgacttga    288300
     gaacgtggaa cgtcgcccat ccaacaccct cgcacaaata cgctggacat cctccggccg    288360
     ctgtctctgc tgccccgctc ttccctgcct ctttcctcct gtccaacacc gtgtcgtcga    288420
     atgccggcga tcgaacctgg gcacgcatcg cttctgcgag gggtgcctct cccgacgata    288480
     acgacgtaac cccaagcggc cagtctattg aactcggcca gtatcctgac acacctgcca    288540
     caacttcccg ccagtctcac gcgactcttc ctcctaccca gctgactgac ccggggtctg    288600
     aatccccttc ctaccatcgt acagaccacc gggaaggtca tcctcagaag cctacactgc    288660
     gggagaaacc ggttatcatc aaatattgga tagaagctct tcgtcgtcac cctcaccgcc    288720
     accagactag cggttccgcc gacaagatga agttctctca cagcatccag ttcaatgctg    288780
     tgccggactg gagtgcttat tatctggctt acagcaacct caagaaactg tacgtctgct    288840
     ctctcacaca ctctctcttt tctgtcctcc gccgggggaa tactcttctt atatcgcgaa    288900
     tgtcacatta cactccgaaa gtgcatgtta cattggcgga aattgtctct gttgaatggg    288960
     tccctctaac tgttgtccac tgttcaggat ttattcttta gaacaggaag tgcatcatcg    289020
     atcggccgga catgaacatg cagatgttga acaagcccca ttgctagatg gcggcagtct    289080
     aaacactgat gcgatattcc gtcgggctct agatgcagaa ctcgaaaaga tttgctcatt    289140
     ttatcaatcc aaggaggcgg agatattcac tgaggttgag gacgtcctca gagatgccga    289200
     ggaatatgcg cacagggccg atactatgaa tgtcgatccc atgagtgacg ccatgatcaa    289260
     gggtcgcaca gccagttcaa gctctaggca gcggccgggg agcattgttc gtcgggtgcc    289320
     atcgaaccag gaacggcgtc atagcgcatt cagtgaaact ttggccgatg atgatgatga    289380
     cgatgcagac agtgacgacg aacctgggac gctgtcgaat caatatcgac cgcagtcgca    289440
     tggcgccgag tctagcaacc cggatggtag tcgtacggac gacatgaggg attctgtgct    289500
     ctggggggct gattcccggc ttctgggcta cagcggtccg tccgcgcacc gcgggggtgc    289560
     acccgacgag catttttcgg acccaatcgt cgtagacctc tacaatgccg ggctctcgct    289620
     gaagaagcgg gctgttgcgg cttatgtttc catctgtgga ctcaagtcgt acatccagct    289680
     taacaagact gggttctcca aagcactgaa gaagtacgat aagatccttg accgcaattt    289740
     gcgtcgagag tacgtgaatt cggtcgtgtc tttgacgtat cccttcaagg attctaccat    289800
     ggaaaaggtg gatgacaaca ttcgcaaagt cgaggaggtc tacgcgaatg tcgtcaccac    289860
     cggtaacatt cccctcgcca aacgtgaact ccgtctgcac ctcagggaac atgtggtgtg    289920
     ggagcgaaac acggtctgga gggaaatgat tggcatcgaa aggaaggctc aggctgcgaa    289980
     cgtcggtatt cgcaggacgc ttcttggtgg agatgaggat ccttccaaag cacgacgcca    290040
     aggagacgag caggaagtca tgcccaagat gatccggacg ccttttggaa ccatccgaat    290100
     cccgcagtgg ctctgtagtc tgagtcttgt caccctcgtt ctcatcctgc ttgtgtttgg    290160
     cattttactt tcggtcccga taatggagaa gcctgaacag cagaattgtc tggccatgct    290220
     tgtttttgtc agtttgctgt gggctacaga ggtcggtttt atgccctgcg tctctgttca    290280
     tcgactgacc caagctaatt tcactgcagg ttattcctct attcgtcaca tcgctactca    290340
     ttcctttcct cgtcgtgatg ctccgtatca tgttgtccga caacaagcct cacgaacgct    290400
     taggccccaa ggaagccacc gccgctgctt tcagcgccat gtggacgcca gtcatcatgc    290460
     tgttgctcgg tggcttcacc atcgctgcgg cgctttccaa gtacgatatc gctcgtcgta    290520
     tggccatgtt cgtcctgagt aaagccgggt ccaatcccaa catcttgctt ctcaccaaca    290580
     tgtttgtgag catgtttctg agtatgtgga tcagcaacgt cgcctcgcca gtgctctgct    290640
     actcaatcat ccaacctctg ttgcgaaacc tggagcccga ctccagcttt gccaagtccc    290700
     ttgttctagg tattgctttg gccgccaatg tgggcggtgc cgcgtcgcct atcgcgtctc    290760
     ctcaaaacat catcgctttg cagaatattt atccgagcat gagctggggg acctggttct    290820
     tcatctcact cccggtgtgc attctgtcca ttgtcgccat ctggatgctt ctggtgctca    290880
     ccttcaaacc cggtcgtgag acggccgtcg ccatccgtcc cttgaaagac aagttcactg    290940
     gagttcagtg gttcatcagt attgtcacac tgtcaaccat tgcgttgtgg tgtggcagtc    291000
     accaactcga gcatattttc ggagacatgg gcgtaatcgc cattattccg atggtcctgt    291060
     tctttggcac gggtatcctc aacaaagaag atttcaacaa cttcctctgg acgatcatca    291120
     ttctggccgc tggtgggctc tgccttggaa aggcggtcac gtcttctggt ctccttcaca    291180
     cccttgcgaa tgcgatccgc atgcgggtgg aacatctcag tctttatggt gtgctgcttg    291240
     tattctccgc cctcatcctg gtcattgcca cgtttatctc ccacaccgtg gcagccctga    291300
     tcatgctccc gctggtacga cagatcggac tcggcatgga cgacccgcac cccaacctgc    291360
     tcgtgatggc gagcgcattg atgtgttcgg tggccatggc tctaccgacc agtggcttcc    291420
     ctaacatgag taagtcgccc tccactgaca agtaatacca agaaaaagta tgcatgtact    291480
     gacaagctac agcggccatc atgaccgagg taccccagac gggccagcgg tatctgcaag    291540
     tccgtcactt cttcacacgc ggtatccccg ccagcttgat gtcctttgcc gtgatagtaa    291600
     cggtgggata cgggttgatg tacattgctg gactgtgagc tacgttgtca cctgacaaga    291660
     tgtcaacgca gacttacatt aattgctttg ctttgctatt gcttttgatt tacgttgtat    291720
     gtggtggaac tgtgaaagat aatggggctt gatctgatgc tgatttagcc acgcggcgcg    291780
     atctggtccg ggcatgcttc tttagatcgt gcgttttcat ggtggatgtt gcttaaggtt    291840
     atatttgatg gatggtggta ccgattttac ttttttctct cttttcgttt ggctagatgg    291900
     tgaacgatag aaatatacca gattgatgct atagaattga aatgtgtagg gctatagaga    291960
     ctcaattcat tatcctgtac tagttatgat actgaccatt caatgaatat ggtagcatgg    292020
     tagaaaggta caggtctgta cagcacacaa cacagaaagc agctcttgca cctgctcatg    292080
     cataacacaa gtagaagaga agaaaacggg aaagaagcaa tatcatcatt catcaatcgc    292140
     gtaagtaaaa aaacaaccac aaccacaaga aaacagatct agaccgtatc gtgcaacagt    292200
     caagtaatga cataaacata tgtatgatga tgaaaccaaa aagtcacaga tcaaagagta    292260
     gtaagagtag tagtagtagt agtagtagta gtagtagtag tagtagtagt agtagtagta    292320
     gtagtagtag tagtagtagt aagacgaagg tatcgtatca aagcatcatc aagacaaaca    292380
     taagagagaa gagagactgc ggacccgaca acacaagcgg atagtaactt gaaacgagac    292440
     tgactttttt tttcccaaaa aaagaaaatc ccagtactct tctcctcaca gtacacactc    292500
     gctcactcag ttcctatccg catgaattag ccagctgtcc caagatgtag attgcgctcg    292560
     ctcgatgtca cgaactgggg tatatcagat aaatcataat aggaggggga gtattttgtg    292620
     cagttggggg atcaagggga aaggaaagga aagggtaaac atacaacaac ccaagcgtaa    292680
     gatcaccatg aatcttggcc ttcaactgca cctcaatatc cagattcaga tcgagtctca    292740
     accgcaactg ctcatccttg ccttccttct cttccccgcc gccgcctcca ccgaggatcc    292800
     cgcccacagc tttgccggca ctgcccgtta ctccgttcag ggcgttacct gctgtgttct    292860
     ggacgagatc gccggcctgg ccgacgccgg ggaggccacc caggggaccg ccgtcttgac    292920
     cctgttgttg ctgttggggg cgctggcggc gctggcgacg gggtcggtct acttgctggt    292980
     tgttgtccat gtcggagtag tcgtctcttt ggcggagttt ctggggaggt cgggagcggc    293040
     gtttacggtc ttgagagggt tgaggggcgc gttgttctgg ttcgggttcg ggttcttcgt    293100
     cggacgattg gggttcttgt ttgggtgctt tgtcttcttg ctcttggggt tcttgtttag    293160
     gttgaggttc tttttctggt tctggttctt gttcttgttc ttcttgtttg ggttgagggt    293220
     cttcgtcctc ttgtttgtct tcttcttttt cttcttcttt gggcttgtct tctgtggtgt    293280
     cgttggtgtc ctcgggcttc tgttcttgtc cttcctgatc accagtagga gggttctctt    293340
     gttgagggga ggaaggggaa gaggtagtgt tgttgttgtt gttctctcct tcttgggaag    293400
     ggttgttggt agaagactca ggctgcttgg actgatcaga catgatgaaa gaaagagaaa    293460
     gagaagaggg agcaggaaat caacgagatc taatacttca gcggcggtct ggggcacggg    293520
     gacgtacact atatagggct cggctggacc gtccaatggc cgggcaatat ttatagatgc    293580
     aggctagaag ttacccgcga aatacgcaag ggagagagat tgaaagtaaa gaagaggggg    293640
     ggaggcgacg tcagtcgatg tgtgtaaatg taagagaaaa tgagtaaaaa aaatagggta    293700
     agatgggggg aggatcaagc cagtatgtca tttgtgccac tcattctctc acgctcctcc    293760
     accttgcagg caagatgaat gaatggaatg atggatgacg atgatgatga tgacgtcgcg    293820
     tggctgggat ctttcatctt agtttgttct ttacgtttag tacatcggag aattattgga    293880
     gagatcgtcg cacttcggcc gggatcgcaa gggcatcgta atcttctgga cttggatggt    293940
     tgactggagg gtcattgttt cgctcctcca acgggggatc cactgcacga cgtcagtgca    294000
     ctcactcact gggtttagtt ggtccacttg caagcctgtc agactttacc cgatccctct    294060
     ccctgtctct ctctctctat ctacaaagta cagtaacggt tctggtctac tggggatttt    294120
     ctttgtcgca attttgcttt gagcgcatgg caaaaaatat ccccggtata tggcaactcg    294180
     gatacggttg ccgtgagact tcaagggata accgtggatg ctgtcgggag gtttcttgga    294240
     tcacacgcgg cgggcggcaa tgcagacgag ggttccatgg tccaaaagta tcacaatcag    294300
     ggaatgagta tccgaaagtc gcgatgaagg cacgttctac aatagagaaa gaatagaaat    294360
     cacaaaaaaa gagggtccgg gcaacgtgga ctcgatgacg atcactggct cgaccgtcat    294420
     cggctgactt gaggatcctc tgcgagacaa tgccgttgac tatgatgatg atgatgcagt    294480
     catcgtgata gtcgtcaaat taattaattt caagcatcat tggggagatg gtgcagtcgc    294540
     tcagccgctc catccttgcg cccacaacgt catcctccca tcctccagcc ctgcacgttg    294600
     aatccccaca cctccaaaca aacggccata catcattgct ggtcttcttt ttgccttttc    294660
     tttcttttct ttttctagag tttaggtttt cccttttctt ttccctccgg agtgtactcc    294720
     cttacttttc cctttttttg catgttcgat tgactatcaa cactgtctgt ctgtctgttg    294780
     tgtccgctct ccggccgact gacgaattgc cccatccagc aatcctaacg aagaccagtc    294840
     cttctgttct tcgcctcccg cattcggggt ccttttgtat gtaaaccaag tcatgccgct    294900
     ctgtccgcgt tttgccaatc taacagtcac tccgggctgg taggaattat atcaatccca    294960
     tccactacat tttctctcac accttaaccc cgccatccca tctttatact ccgttgacta    295020
     tcatcttcat ccccccacaa tccactatta aatcaacatg gctaccgctc aggctgagaa    295080
     accagccacc aaaacctttg ctaatgatcc cgatgatgtc tccgactacg attccgagga    295140
     tgactattcc gacgacgaca cccaacaaaa gcctcaacag caacagcaac aacaacaaca    295200
     acaacgccgc cgtcgtcgtc cccagcagca aaatcccaac gatgaagacg acacctacta    295260
     ttccgatgag tactcggatg actacgatga ctacgacgat gaagatgatg actactacga    295320
     cgacgaggaa gaagaggtcc aggccatgga acgctaccag cccaccacca tcagcagccg    295380
     cgacaatgtg cccgcacaac cgatcgcaaa cggcggcatg caggaggcgg aaggcaaaac    295440
     cggcgatgac tgggaggatc aagacggaat gaagttgaaa ttggaattga acttggatat    295500
     cgaagtcgaa ttaaaggctc atatccatgg tgatttgacg ttgtcgttgc tgtaagtact    295560
     cccctttctt ctgcttctga tcgatcacat tgattgcggc ggcggggaga attggccctg    295620
     cgtgcgggcc aaatgcatgc aatcaaccaa atcacatcac ttaatgtcgc ttgctactag    295680
     aacgtgatcg agatccgatg gttgacatga taccctttct ctttccagcg cataatttcg    295740
     cctctttgcc gcctccagtg cagcatttcg atcatgttca ccccgtcttt tctccgtcgc    295800
     cgaatcccga gcgatgttcg tcggttaacc atttatctac cggccgaagt ggttcgatgg    295860
     ttcgttcgat aaattcccgg gggaagagaa tggctttctt ttcttttctt tttttcgcca    295920
     cattgctggc gcgcgtgtgg ttgacggtcg gtcgggttcc tggcgatcgt tgcacttttc    295980
     gtccatttcg gccggcgctc gcaaaatcca tttccttttt ccatccctcc attccgttcc    296040
     gtttccgtta tgacgtttac gaaaggactt tcctcggtgc tcttctgctc tcaacaatag    296100
     cggttgtttt tgcaaatgaa ttgccttgta ttctttttct cacattgcca ttgtccggat    296160
     agaagtggcg actgcacttg attactgatg catgcgatgt ttctatctat ggtgatgtca    296220
     aggcttatct tgacccatct actccatatt cagtgtctgt gcgcacttat accattgttg    296280
     gtatggtttt gcttgatctt catctactta tagtaataag ggtatctacc tttggatttt    296340
     atctcatatt gtaggtcagg cttcctccac ttatagatgg tgtcggcaac gccgaccgta    296400
     gatattcgat attacaacaa aaaattagtt cctatatcca acatcatcaa tagccagtta    296460
     tctattaccc ttcaatgtac tagacagaac tcttgcagag cgaatgaact catctgacat    296520
     cataccagat ccaagaatat gcatcgcata ctttcttgca ctcaacagtg acctatcaaa    296580
     tctaatcatg acaggatact acaataacaa agctaatcca aggaatctga ttcacttgcc    296640
     gcacgaaaat agaacaacga taaaaacata ttaatcaggt agttctattt cggttcccag    296700
     aaatgcatgt gtcgttgcca ctataccctt gcgtagtgga acacggcaga ttaaagatcc    296760
     gtattattga tatgctgtga aactatagaa catagttcat gccttgctta taagaaaaga    296820
     tatctctgga cattaactaa cagtgtacgt ctatttcctt ggtatatcca ccgttgaatc    296880
     cggcgtcagg ataaaactta tatatatgat tgtaaattat gttgcaattc atgattctcg    296940
     ataggtctta tgatgagcat agacgttgtc tactacttct cctttgttta taagatagta    297000
     ggtaatagtg tgatacatgg tatttagcaa tcctgttatt ggtcgtaatt ctcagatggt    297060
     ttcttggtat tgtgaagtgg tcgtgaaacg attctttgta ggtatgcttg aggggaacca    297120
     tgagatagtg ggtgctcttg ttggtgatgt ataatacttc cattacttag tatcaccacc    297180
     atgttttgaa actaagatat cgaggcaacc agcctgtttg cgtatttcgt catgaaagat    297240
     accgctgggg gatagaatct aattatttca atatgctgcc agcggcaata tgttagtacc    297300
     atatcagaca tgatagttag ttatctgttt cacgctgtag ttgtttaagt cagtaaaaag    297360
     cagtccgttt aaaattcaca gctattgttc tgtactgata tcaaaccaaa tctgagttag    297420
     taattaattg tgctatactc aagtccgaag acctcaaata tatttggaga gggtggatat    297480
     agtctagcta tacgatatac tgtgagtttc taagaatagt aattcacttt attctgctac    297540
     atgttatagc tcgtagcctg ttcatctagt actcatatca gagaaccttg aagtagacaa    297600
     ctagtaattg ctcagagtga agtctcaact actaacagac tttaatgtct ttaattatat    297660
     agggatgccg atatcatttg ttacttgact aaaaaaatga tgcgataaag ccaatggaat    297720
     gcacgattgg ttggtcgata ttttgtggaa atcactgcgc atccaactaa tttgtaagat    297780
     cttcgccagc gtatacacat atcttgttat ttggtgggca cacagtgtag tatcgcatgt    297840
     atctacttgc attgagactt tcaagaaccg gaattcgccg ttttagatat gctgttctgg    297900
     caggggatga ccttatattt cagctaggtg taattgactg tgtcttgtct gaattttcaa    297960
     cattctgtta acattgctgg gtcgtagacg ctacaggata ctattcagtt gggtaacatc    298020
     cccagcgtcc accgagtgcc actgcagtgc agagaaaatg ataaagtgat gatttcacta    298080
     gcagattgag ctcagggtgc tcagaatata tagtagctaa aattcaattc catgacatag    298140
     caatctgagt attgagataa tcccaacatt cgctgaaatc cctcactaaa tgatatacac    298200
     aatgcagaat gataataata tagtagaaac cgaaggagca ggcaatttca cgtgtggcct    298260
     caatattggc ggagcgccag ttcctcggga agggtgagcc catcgcgatg ttgacgatcc    298320
     cgaggtactc ttggcgggat caaaaaggag tccgcaaact gccaccactc agtcgccgaa    298380
     ccccgcgcaa ccagcagcca gcatctgcga gtcaacatat atcaagcgcg aaatcccact    298440
     cgacaagaga acaaggaagg aaaggcaaga aaagaagcaa aacgaagcga aaatggcacc    298500
     agaccgctcc aacatctcct tcaccatcac ccacatgaac gccaaccacc aagactccct    298560
     agcagcctat ctccaagtct actgccacgt ctccgcccgc gaagccaaat ccgctcgtct    298620
     cgaagacatc accttatctg atctagtcat cagcgccaat ggcacacgct acactgtccc    298680
     catcgatcca gcaatgggaa gtttctccga gtcgcgatcc cgtctggtag ccatgcacca    298740
     ggaatgtctt gcgcgattgg gccggtccga catcaccatc aaagagtatc gtcggccaga    298800
     gggaatcgag atcttcctct ttttcgtgtt tgcaactgca ttggtggcgt tctctcggcg    298860
     cagtaacttc ctgcctgggt cgttgttcta cgaaacggtt ggactgggtg cggttccgcc    298920
     actggcgcaa ctgttctaca agacacagcc gtttgtgctt acggttatgg ccgggtcgca    298980
     tgtggtggag gcgagtttgt tcacggtgaa gaggttgaag cggcatgggg tgccggtatt    299040
     gtcgttggtg tggtgcgctt gggtggtgtc gaatttgatt gaggggtata cggtgtggag    299100
     gaggtttgat tgggtggtga ggcaggaagg ggcgaagagg gagcatggga aatagtcatc    299160
     tagcataggt agataaaatt ctactataat atactacaga gtacgaatca aaccataaat    299220
     gttgctctcc attcgactgc tccatattat tgctgatagt ggcttatcgc ttatcggcta    299280
     gcggacaatc gactagcggc ttactcatca aatcacggga ccacgctaaa ccaatcccag    299340
     actagggtag tagggcaact tccacaagcg agccacagtg cgaaattcaa cggaagccga    299400
     cgacaagcac tcaactcctt acgaccaacc caacgaccct tgcccgctgc gttcctggtg    299460
     aagggctgca ggattagagg tgagtttgtt gcaattaatc cgtcgtgatt tcgatccctc    299520
     tcgatttttc ccgcgtcgtc gacggtcggt gtgcgcgtgc aatctacgat cggtctcgaa    299580
     cttgaattgg aagatacaca ttccggggta tatcgaagag gaagagagaa aaagaagaaa    299640
     gattatcaga gcagttgttt ggtgcaaggg aatataagcg gcggcgacga cgacgattga    299700
     aaagaaagaa caactcaaga aagaattttt ttcttcgctt tctcgtccat acccgagttc    299760
     gcacacattt ccagcatcga gcatcgccac acacacacaa caccattcaa ttcaattcaa    299820
     atcgactcga caatcgcacg aacaaaccta agaccatcga cgcatcgggg caaaaatttc    299880
     tcgaagaggg attgacaatc accgacaaca gtctactgct tattgctact gtcttttgtg    299940
     gcgagcaatc cccgctaata cttctgccat ctacagtccc ctcgaacagc aaacatgggt    300000
     atctcacgcg actctcgtca caagcgctcg gctaccggcg cgaagagggc cacctaccgc    300060
     aagaagaggt atgcatgagt tcctattgtc tttcttactc aaccaactac actacgaaag    300120
     aaacaacgac tgacgcacgg caattcaaca gggcgttcga gaagggtcgc cagccctcca    300180
     acacccgtat cggaaccaag agaatccacc tggtccgcac ccgtggtggt aaccagaagt    300240
     tccgtgccct tcgtctcgaa tccggcaact tctcgtgggg ttctgagggt atctcccgca    300300
     agacccgtgt catcgttgtg gcctaccacc cctccaacaa cgaactggtc cgcaccaaca    300360
     ccctgaccaa gtcggccgtc gttcagatcg atgctgctcc tttccgtcaa tggtacgagg    300420
     cccactacgg ccagcctatc ggccgccgtc gccagcagaa gaccgagacc accgaggaga    300480
     agaagtccaa cagcgttgtg aagaagcagg ctgctcgctt tgctgagcag ggcaaggtcg    300540
     agtctgccgt cgagcgtcag ttcgagtccg gacgtctgta cgctgttgtg tcgtcccgcc    300600
     ccggccagag cggccgcgtg gacggataca tcctggaggg tgaggagctg gctttctacc    300660
     agcgtgctat ccgcaagtaa agaaatcata cacacaaaag cgaatagtta cgttgtgttg    300720
     ttaagttaaa agggctggat ggatcggagt tagcattttc cagaaaatta gctctgaatt    300780
     gatggatgaa tcagatgttc acactttcca gttccacgtc taagactatt gaagtagtca    300840
     acttgtagtt ccaactgtat cccgtagtgt aaagttttca ttataactta actagttact    300900
     tagtaggtag gtaccttgtt atctccgatg acgaaacact cctaagtaac ttagttaatt    300960
     taaacccctc ccctcatacc taccattgat gtaaccacac tcttcctgcc tatctatacc    301020
     tcacccccct ccctactcta ctactactat ctatcactac cccatacata cactcaccac    301080
     ttcacttcat cacaccccat cacaccagca acaaccaccc acctcataaa atggcacccc    301140
     caacaacatc accccccaaa accatcaaga catccctcct cctcctaagc gacacccaca    301200
     cgctgacccc cctccccccc atccacccca acaccagcac acccttccgc catccgctcc    301260
     ccgccacgga cctcctaatc cacgccggcg acctcaccaa agtcgggcac aagcacgaac    301320
     acctcacgac gctctcattc ctaaaatccg cccgggcgcc aatcaaactc atcatcccag    301380
     gcaaccacga catcacgctc gacgaaccat actacaagaa aatcggacac taccgccacc    301440
     gctaccgcac cgaccataca gcgccgtcgg ccacaagcgg gagcgataat gtgtccgcgg    301500
     ggaagggaac gcccggaatg gcgttaagtg atgatgaact aagggagatc aaggaactat    301560
     atacggggaa agaagcttgg gatgcgggga tacggtacct cgaggaaggg acgcatgtgt    301620
     tcaggttaca gaatggggcc gtgctgaggg tgtatgcgag tccgtggacg ccggagtttt    301680
     gtcaatgggg gtttgggtat ccgcggcagg ttgatcggta taatcctccg gaggaggagg    301740
     gggaggggga agagggggcg gagaatccag tgcctgatta tccgggcgtg gatgtgatga    301800
     ttacgcatgg accgccgtat ggggtgctgg accaggtggt gccgaatcat atgagtgtgg    301860
     ggtgtgagca tttgtatcgg gctgtgaaga gggcgaggcc gcgggtgcat gtgtttgggc    301920
     atattcatga ggggtatggg gcgacgagga gggagtggag ttcggggaat gagagtgtga    301980
     ttcagtgtga taaggagagg acgttggagg agaggtgtgc gagggtggat gttagtaagg    302040
     aggggggcaa tgggttgagg gttggggagg agacgttgtt tgtgaatgcg agtgtcgtga    302100
     cggtgcagta tcaggctatt aatgcgccgt gggtggtgga ggtggatttg ccagttgagt    302160
     aggatattac tacggtctga ggagttcggt tccagtatat agttgattta ttcttaatgg    302220
     ttggtgtcac tagatgttgg tgacagtgtg gtagttcact taacgaactg ttaatactaa    302280
     ttgttatact atgctgctaa ttctgcaagc tacctgtaca gtgatcaccc gggtatggca    302340
     tcaaacaata tacatgtaca gtccaacaaa cgagatgtcc aacagaaggg agagaagtga    302400
     agtaggtatc tcactaaaaa tgtatatcat gcctggatat gtcaagaaat gaaagtgctt    302460
     taaaaatgta ataatgttcc aaccaaagaa gagaagtata atgactgtgc aaccggccgg    302520
     attccaacgc tgcaatgcaa gacaatgccg atgtcgacgc tgaatgaaat agaatgcaaa    302580
     aaatgatgaa tgtccagaca ttatcaagaa gaaagaaaga agtccgcgag gtatcactcc    302640
     tcgcgcacgg gcgtctccgt ccggaaatct aggcggctgc ctttgcgact gacgcctttg    302700
     agcagactga accgcttgaa gactgagtcg cgcatgccgc tgctctggct aaccggactc    302760
     atcaattcag ggctgcgaac agaattgata ctactccgcg tcaccggccg ggggtagtcg    302820
     gtgattgaag gaatcgtcga ccacccgccc ttatggctgc tcacagatgg gcgatcatcg    302880
     gcagatgtcc cattggtttg agaggtagtc tgactcacgc tgtcgtgcga cttgcctgcc    302940
     gtgtcgcgag aagcacttcg tgtccgttgc ttcttctggc tctgggtctc ttcagtggca    303000
     ctggcgctta tcgacaatga cgacgcgtgc ttatgtagca catcgcctaa tcggctccgt    303060
     cttttatgat gcgtgtctcg cgactgtgta gtcgtccggc tgtgaatggt agctgcgtca    303120
     tcctgatcga cctccccatt gacgtgctcc tctgtggttg taccgttgac cttgctatcc    303180
     gactgtggct ttgggtcttc ttgcaccgta gacaccgaat tgctcgccac gtgattgccg    303240
     cgcttgaaag ggttcatgac gctgattcgg tggctgacag actgcttggc tgagtgcttg    303300
     cgactgtggt tcttccgcga cgagcgaatc agttcttgct cgggactgag cgcccgcgac    303360
     gcaggcggct tctggcgttc cttgacggac tctggagtgc tacgccgagg ccattgaggc    303420
     gcctgttcag tctctgctgg acgaagcgaa gagatctccg gcccgaaagc ctcctcgaaa    303480
     cggcgcgtca gctctgcttg cgtagctaga tgcgccggtc ggtggtacaa ggccagcgcc    303540
     tgcttgatac ccagggcatg gtcgatgagg gccactgcca gcgcattctt cattgggtcc    303600
     gccggcttcg gtgtcaccag gccaccctcc tcctcttcat gcgcatcaga caagaattgg    303660
     cggtaagcag caacgcagtt gggagtggct gcgtccaagt cgagcaactg ttgcaaagcc    303720
     tcgctgaggt tgttcaaccc cgtatcctcc ccggaggccg cccgacgctg caacattgac    303780
     agctcatgcg tcttgcgcca cgtccgttcg agcgccgtat gcaaaggcga cagtgcaact    303840
     tccttgacct caaccacctc acttctgcga aggatgttcg ggaaaggctc tgcagtggtg    303900
     taaaccgttt tctcaaccca ctgctccttg acatccacgt cacgaacgtg tttccgtaac    303960
     gttgagctga agtggcaggg ctccgacacc aggagatggt ctcgaacgga ctgcggaatc    304020
     ttcgaccgct ggtagaccgg atgatccacg tcgcgatgaa cactgacagg attgatgtgc    304080
     aggtactggc cctcataatc atgaacttct ccggaagaca cgacctgcgc agccgggtgc    304140
     tcccgctgca tacggtcaat gaaagagacc atacgctccg tcggtgcaca ctcaatgatg    304200
     aattgcttgt cgcgaagagt ggtagggaac ccgagtccct tgtattgcac acggaagtac    304260
     cgcgggaact gcttgctttc ctttgaaatg aggtcgtaaa tcttggccat ggaggcgtgt    304320
     gcccgtgaga gtttggcaaa atccaccacg atgtcttcat attgctgcgc gagttcctta    304380
     tagcacacca gggcatgcgc ccaggctttg ccatcctcga agtgttgaat gattgtaaag    304440
     taaagggctt ccttcctctc gaaagaagtc tgctccggga aagccgggtt aagcagctca    304500
     ggcaaagtcc gcttcggatc ccaatcatat agatcggcat ggaattgaag ggccagccca    304560
     gcctcggtga agtttcctgc ttcggcctgc acctgagcga gctcgtggac gtagcggatg    304620
     aagatatcct cacgacccat gtctttcatg tacttcatca gccgaagagt gtgcaggctt    304680
     tcggccatag agcctccttg agaggccacg aagaggtcga gcagctcatc caccgtcgcg    304740
     atcagtgcct tgaccgcact ggacaggtct tcgtcgtaat cagcagagtc ttcaaagtga    304800
     tctgacagtt ccgcgataaa cagtttctgc acgacacttt cgctcatgtt cttcctcttg    304860
     aagaggttat ccaagctgga tataacctcc gtttcgataa tagagagatc ctggttcaga    304920
     ccccattcgc tcagaatcat cgtccgtaaa atgtcgacgg ccacgtgccg taatccttcg    304980
     tggacactga ggcaaagctc aatgatgggt gctaccaggc caggaacata ctgtacctgg    305040
     taaccgccca atttactcag cccgtagtgc tctctctcct catcagtggt ctcccagccg    305100
     attgattccc agctggaatg cagcaggtct gcaccctgtt cccgaacatc gcccgcgatc    305160
     ttccagatgg cgcgtcgttt ctgctcgggg taggtctcaa gagcaagagc atcactcgag    305220
     acaaccttga gcaaagtcat gaagaaagtt tcccatagtc tcgtatcgaa cgtttccgca    305280
     tcatccgggg agggaaggaa tttattggtc aagatggttg ccagatactc caaactcttg    305340
     acggtggccc ggtggttgta gacatgaacg ctgaaccagc tttcggggta cgcttcgcag    305400
     ttgagaatcg agttgtgtac ttcgaaagcc tgtgtcagga aactggagag ctccaggccc    305460
     ttcagccggg gtcgcttggg gttgggtatc gtcgccgctc cagccagaac ggcggacagc    305520
     tccaccagcg cttcgtcaaa tttctgagag tgctttgaag acttcacctg gaacgggaat    305580
     gatttgctga agagcaaaga aaggtaggtc gtctcctcta caccgtcagg gatgatggaa    305640
     tagtatgagg acacaatctt cggcacaaac tcgtacagat acgggtctgg ttgtttcaac    305700
     agctccgcca cgatcgcgca acacagccgg acctggtcac ggtagaggtc cgatacggat    305760
     cctgtcgcac cccagtaagg tgccaaccag ctgatacagc tggagacgag actctttcgc    305820
     tccgatccgg agccaaagat ctctaagcga gtgtagtgtt ggatgagaac cagcttatag    305880
     agaatcagca ttcccgtgac atctttgcat gaatcgatga agctgagcgc aatcatgatc    305940
     gtctcatcac ggctgagtac tttcgagagc tccgggagcc aggtgtggaa atgctgaacc    306000
     acaagggttt tgtttcccac cattgcaggc gaggggttct tcatcagggc ctcgagcgac    306060
     ttgaatatcg tatgtaaatc ccggttgaat gtcgattgta ctctagtgat tccgataccc    306120
     tcctctttcg ctttctgctg cagtcgagca ttgatgatga acttaaggac atggcgtcct    306180
     accttgaacg ttgcacggag atttcgcgac tgctgagcat cggaactagc ctgaagaaga    306240
     cgtagatagc ttctgacgag acatggcgta gcgaaaggga agttgaattg gttgtcggcg    306300
     tagtgatcaa ctaatgggcc caggttgaac cgtcggtcgt gaacaatacc aagaactgtc    306360
     actagatcgt tgaaaatcaa gtcttcatac tcttcgttac ctgcgttttc caccagaatt    306420
     ccgaagagcg agtccaagac gctgctgagc tgcttcacaa tctcgatctc cggcacaaaa    306480
     aggacacgct tgagggtatc taatacttcg ttcacaggcc tttccctcca gttcaaaagg    306540
     ctgagtatta cctgatcctg cgaatattcc gtgctgcata gatgtgtgtc caatcgcagg    306600
     gtagccaaag gaccggtgat tgcctcgtct ttcgctgatt catttttgcc cagcgaactc    306660
     catggtagag agagataggc tcccttgccg ttctcaatat tcgacgtaca cttgtcgtag    306720
     gcatgcaaca ggagcgaatg agggccgtct cgcatgaaag cctggttgtc ccacagtggc    306780
     atccacgcaa gtgcaaaggg aaactcgggc gcatctgcaa tactcatgat caagtgcgac    306840
     ccagggatct ggtcggtggg gatgttgaga cgaatggttt ggttccaagg tgcaccccga    306900
     tcggctacgg tggtgcgcca tgctgtctgt gcggcatggt tggacgcgga gaaaacgcac    306960
     cgatcaacgc gcgcgcccga cgatgtgcgg acctcaagag ttagctggag gttatgaagt    307020
     ccagtatgcc ctggaaccgg aacttgacca gattgcggat gtgaaagcag tgcttctgga    307080
     gggaaggtcg cgtgacagat tgtcacgtaa atatcagacc gaggttttgt tggggcctgg    307140
     gagaagccca tcctcttcgt ctgaacgaca ttgtgcaagg atgtgggatt tttccgaacc    307200
     agactatctg cgtcggggtc cacatagggg tagaggtgga aatgcagacg agcagctcgt    307260
     tgagaacgca catacttgcc agtaggactc ggaagtaatg tgcgaacaac accatcaaag    307320
     ccatcatccc gaccctcttt gtcctcgctg tcctcagacg gagaccagat attgatcacc    307380
     tgctccgcgt ccttctcctg acgcagaatc tgcgagattt cgaggaaacc aactcccacg    307440
     gtccgaagct gagtcgattc tttaaccggt tggctgctag ccttttcctt ggcacttgcg    307500
     ttgcttcccg acgatggagg cgcagcttta ctcggctcct ttccttgttc gggactttga    307560
     ataccgcgtg gcttcgaggt ccacatcatg ctgcggcgag tcctgagact ccccttgact    307620
     gattgattaa tcccattttg ctgcttggta ccagacgagc tgtcccgcga gatggaagtc    307680
     ctcggctggg cggcggcgct gacgactgat gtagtttctg gggcgcgaac catgacgacc    307740
     atgtagagtc tcgggccgtt tgcagcgttg tcgccaatat ccgtgctgct taagtcggtg    307800
     aacagcgttt tcaatttggc gctctgtccc atacttgcaa acttctctgg cgaaggaatg    307860
     tccagcacgt atgtctcgga aaggggtgtg agagccccag tctctgactg ggagcacagg    307920
     tagacagcca atgttactgg cccgggcgca tgtccagaga cggcattgac ttcgagcatc    307980
     agatgatgga gcgcagcggc atctgattgc tgcatggggc tgctgtcgag catgctcatc    308040
     tcggactgta gcctagcaag ttctacggct gagtcctctc cagtgagcag acgccctctt    308100
     tgctgaggat ctctcacaat gatctcgcca cccagcgctt tgttgccgcg aacgagcttc    308160
     cagaccactt cctgtcgcag cgcatccttc tcttgtgcgg tgagcacatt atacaaaagc    308220
     tggcgccttg cgaaatcaag ttcttcgaca atcttcgtca tctcctctac cgtgacatat    308280
     tggcgggaga gtaatagctg atgtaggttg gtcgaatgcc attcgcgtag acaggaagcg    308340
     atttcatcga cgagtggctc ggagagtgag gtgggtgttt catcgccaat cttgagcatt    308400
     ggcacaggcg cggctggttt gggtgcatct gggtctcgag gggccacgtt gatgggggcg    308460
     agcggcgtcg aattcgtccg taggaagttc tgaggagagc gcgggctggc cgggcttccg    308520
     cgcccatctt cgtccagcct ctggataaag atctgagacg gctttccttt tttcgcgatt    308580
     acgacgctgg atacttcccc gaacgcgtgg tcatcatctt ggaaggaggc catgctgtga    308640
     cgcacatctc cctccggaac cgccgtgaaa gcgacactcg atcggtcgcc attggtaatc    308700
     gtcttctctc catcacctag cacttcgcgg atctcgacac aattccgggg aaagattccg    308760
     gaaaataccc tcgcctcaag ggtttggccc ttggagctcg tcaggcccgc cagcaaggac    308820
     ggcggcgcga cgaggtaacc acggcaccat tccccattgg caccaccttg ttcaattata    308880
     tacagctcat caccaagctc cagaggcaga tcggccgggg tagtcggctg aaaagggtag    308940
     atagcgacag cgaaagcgat tcgaggcaga ggccgccagg gcatatctgc gatcgaggcg    309000
     gcgctccaga gcacaccccg ccgcggcgtt cgtcacaatg ggcgttccga ggaatgaagg    309060
     agtaccgatg aagcggggcc gaagggggtg aggggttcag atctgacagt tccttctgtt    309120
     gattgatcgg ccgggggggg gcgctacatg caggtatggt atgagtagaa aagggaggaa    309180
     tgtagacgga gtttcgagat gcggaagcgc gaattcgagg tgtgccttgc gaaattggtg    309240
     tcgtgctaat taagatcaag ggggggttta tggagggacg actagatggc catcaccaaa    309300
     tgtgcggtta gcgagagaaa gatcccagta agcgaaacgt aggcgtgctt tgttggcgtg    309360
     tcaaagtcaa agggagggtc atgataagcg gaggagtaaa agccatccag gaggagcggg    309420
     tgtcgcaaag ggtctcagtg accggaaaca ccgtagcaat tggggccagc ggattcttag    309480
     tgaagtacta gtgaccgtag ctaaagcaag aaccgtgacg aggagtacac cagcaaattg    309540
     atttcctcca gcttcagtcc tccgacaatt ttgtcggcag gcccccctag cagtggaatg    309600
     ggagtggagc cgagggagtt gttcacttgg caggaactgt ggagaaggca cacagatgaa    309660
     acgaagggag gggggtttaa aggaggaggg gagggaggaa gagcttaccc aaagctaaag    309720
     ggaatataag agaggaaggg aagaagggga gggggaagga gagatgaaaa tgaatgaatg    309780
     ggagaagagg gatgatagta agagccacaa aaaagaagga gaaggagaga ggaagaagaa    309840
     gaggaagagg aggtatgatg atcgcagacc aaatgatgct tccattgaac aggagagcct    309900
     gaggatcggg gcgggaggcg gagagagaga gacagagaga gagaggcgag gacggcctga    309960
     ggctagaaca ctgctggagg gaaactcgac tagcgattcc ccgagcaggt tgattaactt    310020
     taattgatcg ttatattggc ttcgtcatta ctgatctcat gcttcaaaca tcggtaggtt    310080
     cataggaaaa ttgaattgag cttgtctacc actaactatc tctatactat cccacatatc    310140
     ccacgccctc cttttttggg gttgtgtcca aagagttgct tgtgcctggt ccatccagca    310200
     aacggatctg gcacactatt ccagctcatc catgggtcca atcccgaccg atcgagtaca    310260
     agccagtgaa agtggagaga atgctgcgtg tatccaagtt tcaccggcac gtttccttcg    310320
     ttcgatttat tttctttttc ctaggatcat ccatcccgtc agaaccgaga acagtaaaaa    310380
     gcaaggggac agtcctccct tccttccatt gcggtccgtg aacttacaat agctgtggga    310440
     tatagatagt agtaggactt aacttgggac ctgtccatgt gtccagaccg ggccctgacc    310500
     cccaatagat tgtcataacg ctcctcccat tatctactat cttataatta gatgatcaac    310560
     tcactgatta ctcgttacaa agtagatact aggcacggaa ccaggctgac atgttacttc    310620
     cacccagcac agacccagcg cgtggccccc ctgaatccag ggctataaaa cccaactaaa    310680
     ctaagtgagc gctactaaaa aaggttcgag atggagttgg agcagctgcc cgctgactgg    310740
     tccatcctga tgggccgcta aattggtctc cctcgctttt cttttttgag aggcgtttct    310800
     ctgtccctct tcggtgatga tctgcctgtt gccagtatcg gttcctttga tcgttcatca    310860
     ttactctcga caattgatgt agagcagact aactagctac tccacgctcc ggttatcccc    310920
     caatattata gatgtcaatc ttataggcca tcccttcata ttcgatggag ttcgctttcc    310980
     attctttcgc ctcacttgag agatctggta cagcgcccgc gctggatcga aatcttccta    311040
     aagctgcttc ccgtttctct caacgtcgtt tactctttcg tcccaccaga accaatgtaa    311100
     tgcgacctta gcagtcaggt tatcaattac attcctccct tccattgatc acaggctata    311160
     gatacatcaa ctggtataag tacttaagac agaaagcaag aagtgaagaa cacagggaac    311220
     aatgcaaaga tccaacccat gcgcccgttt gatgatgcgc aaaaagaaca aacgtcctat    311280
     cacatccact tcatccaaaa acccttgcca ttgacaggtg gtcgtcatga tgtgggaata    311340
     gaccctgaaa gggattctgg ccacacgagt cagacaagaa taagagacac cgctcttcac    311400
     ctctggaaca tggcgatggc gtcctcctta cgccactcaa gctccaactg gccttcgtac    311460
     accgcatcaa taactcgccg ggtccgattg tacgcttccc cataccgacc ctcgcactct    311520
     cggagcacct tcaacaccaa gctccgactc aggccagggt cgtctgcgtc accgaaatgc    311580
     ttctcgaccc gcttcttcag catctcaatc cctcgccgaa tttccttggc atcgtacgtc    311640
     gccaacacct tctttgccac tgatcgggag tggctaggtc ggctggcaat gtcggcgggg    311700
     ttgatgcccg tcgccactag attctccacc gactcaataa actctagcag cttgcccagt    311760
     ggtcggtgaa tgatggagtc gaggtaaagt ttcagatgct cctgcatgtc ttgatgcgcc    311820
     cgatcgcgcc accgctccag cacggggagg ctccggacat cgacctcctc gatgtagtgg    311880
     ttcatgtttt caatgagaag aatgtggtaa tttaagattt ccttatcttc cgggtctcca    311940
     gaagtcgctg ccgcccccgt gggttggccc ggcgcctcct tggcgatgaa cttgagcgat    312000
     tcccacatgg cgcggttgat gcgatcgtag gcttcgttca cattgacacg gatgtcgtag    312060
     aattcttgcg aaagcatgtt ctccacggcc gtggagaagt gggggaagac acgcataaac    312120
     gaaatcactc ctttgcgctt atttaccttg accttggtct cctcgattcc gcgaatctgg    312180
     tcatcgacaa atcgattgaa gaggccaagc aaccgggaat ggagtttctg aagggagtgg    312240
     ataataaagt cctgattggt gtcgtcatac tccgaaatgg ccttctcaat ggccagcaat    312300
     attccaattc cttgtctaca tgataagagt cagtccgtag tctcgttaga aagcacatgg    312360
     gagtttcagc ttacagcgga tcagctctga tggcccagtc cacaaggttt tgcatatcag    312420
     tcggccaaaa tgcgaaaagt tcgtccatga tctgctcaac tttcttggcc atcgctcggt    312480
     caggatcatg cagctgtttg gagccgaaac tgggtatcct gcgttcatcg ggagcacctg    312540
     acataactag gtcggggaag tcgacggtag aaagcgagtt gagatggaag aagtagacga    312600
     tgaaattctg ctcttccgag atcatatgca gggtctcttg aagcgtcccc ccaaatgctt    312660
     cgcacggttc cagcttgcca tgctgcttgt cccctgaggg aagccggaga cctgctgcag    312720
     ctctaatggt cttgcctcgt cgcactgtga gtttgcgcgc cgccatggta ataccttcag    312780
     attccttctc cttctcctgg tgagtaaaga ggagttcctg ctcctctcca ctaggcttcc    312840
     tcgccgcctt cttccacgcc aggttgttgt ctcggaaatc attttggtaa ggatgtttgg    312900
     cctgttgctc atacaggttg atgagcgcgt gccactcccc ggaactaact tcccgagcga    312960
     agaggatcac agcattatac tgccacaatt cgcgacggca gtagccacgg gcttcgctgt    313020
     cgagcttcag gggatccttc tgaccattgg cagccgcatc aattctcttc tgttccgcca    313080
     ccttgtacgc aatagccatg aattgcttaa gtctttgtaa gaacacgcga gcatgtgtgc    313140
     gatattcttc cttcttttct tttatcgcac gcatttggcc gatctctgtg tcggcataca    313200
     cgcccaggct gccatggtct ccggccgcat cggcaagccg cctcttgttg tgccagatgt    313260
     cagaatcaat catcaacatc gctttgtaca atgtagatag ggcgagttcg gtgtctcgga    313320
     ggccatcggg attgctcaat gacgactcct tcagagcacg aacgtcgtcc gaagaaatgg    313380
     aaagagtccg gagcagattt tgtagctcgt tctgaagcaa cttttggttg gccgtttgca    313440
     cctgtagacc ctgggattgc gtttcgatat aagccacgtc atcgtgcaga gtctgttacc    313500
     tttgttagca tatcactgaa atggtggacg atgaaaccag cgctcaggga tgcacgggca    313560
     acctacgttg agctcatggg aatacaaagt aagaagattg tccagctctt cacactccac    313620
     gactgtcttg tcgatgagtt tcgcaagttg atcaattttg ccctcctgct gttcaaggtt    313680
     accaagccag ctggtagtct ccacgcgacc aatctctcga cggatatctg cctccaaatc    313740
     ttcgatcttc ttttcgtctc ctagtcgtcc gttccagccg aggtcagtca aaatatcgtc    313800
     aaagtcaatg ccacgccctt caagaacggt agggttgagt ccgagtgctt gacaatactt    313860
     gattgtgttg tcctcatgcc gcctgcggcg acgatcatgc ggtgaaggag atacggatct    313920
     cgacctttct gtatcaactt tgacagaagc ccttgacgtg tctctcggct ctgcgagtac    313980
     ctcagtcgaa ccaatcgtag gctcaacagg agcagcttgt gtcacttcaa ctgcgggcgg    314040
     ctcgattctc gggggctcgg gaggaggctg cactgctggc ggtgctggcg gcgctggcgg    314100
     ctgcacctcc ttctcagggg atgacgatac tactggagga gtctctgctt ccggagtctc    314160
     cggcgaggtc accgtatttt cactgttcgt ccgaagcagg aatggagcag gcaccacgct    314220
     ggtgattcca tccggttcat cagcagcagc cttctgcttt ttcgcagctg ctagaagcct    314280
     ctcaccagca ccaccaggcc tcggcttgaa ggccccgtga gcagtggcag ctttgcgaaa    314340
     tgcgcctgca acatccttga cttgcttctt cttgatcatc gggccaagcc caggacggtg    314400
     tgcatcggga tcgttttctt ccacaggctc agtggcctcc aaatcgctag gaggcggtgg    314460
     tactgcagca gcagcagttt ctgctatcgg ctcaatcggt tccggatcct tcgtcaaaat    314520
     tgacagtgtc ggagctgtgg gcaccggcgc ctcagcagac tcgacggctg gtggggcttt    314580
     gctaaatgct gaagagcctg gcgtgagtgc tgctggaacc tcgacagcgg gagtattgat    314640
     ggggttgctc gggggctcag gctcctgtcg cgctgctcgt gcgggcgaac caatgggctt    314700
     ttcggctgct tccctcaagg gcgatctggg acccacgctg cttcccggac tatgcataaa    314760
     ggtatggttt tccccagaaa ccgacccagg agtagtagga cgaagaccgt ctgtactgcg    314820
     gctgggatga agatcatggg tacgaagtgt aggcctggac tcaggacctt tccgcccatc    314880
     gcgtgaggat ggtggacggg agtcagggag gggactcccc gacctggctt cttcaaagct    314940
     gccatttggc cgttcccgct gaccagcaac aggagcggcc tgcaaactag agggatagtc    315000
     cctatttctc ggttccggtg gagagattat gggcaccttg ggcaccctgg gttccgtggc    315060
     aagacgttcg gctgcacgtg gaggtggttg ttcgcgctgg tcgggaggca atggcggggg    315120
     gtgttgaggg gggctaaacg gaggagtacc gcttttacca gactggccag tagacggtct    315180
     ccccatctgg tcacgacttc tttgcgctcg taggacatgt tcctcagatg gtgctggtgg    315240
     tggtcgtctt ggtccatcgc gactgggcgc acggctagaa tacggtgact gaggccggct    315300
     gccctgtgaa gaggaaggcc gcgggggagg cagggccact tcgggacgcg gaggacctga    315360
     aggaggaggg cctttggggg ctggaggacc tgcagctgat ccaccagcaa gcagctgtcg    315420
     ttcacggtca tcgaagccga tcagagtcgg caccttgccg ccagtgtact ttctgtagat    315480
     cttgacgagg ctgcctatga aaaaatcctt ctctttggag gtccgtgcat gccagtagta    315540
     gggctttcca acggtaacga taaatccaac attggcagcc cactgcttgt gttgttgttc    315600
     taacggcgtg ctcgggacca aggcgttgta agactggatg caggagagat catccaacat    315660
     ccacgtcttg ccaatagaga atgagccatc attgttctcg cgcgccttgt gcatgcgcac    315720
     tctgcctgac cgtctgacgg cgacaataat cactcgaggt ttcttgttct cgggcggcga    315780
     attgggtgga gcgggggtgg acggatatgc cgcatcttcc aaaatgcgga catgtgttat    315840
     gtaggactcg accactagaa gagagagggg aacaagtcaa cctgacaccc ttttaggaga    315900
     ggagcgtggg agaaatgtac gtacacgagc catcgctgtc tttcttgcca aaacagctat    315960
     gaatgatccg ccgcttctca tcctcgaatt tctcggccct cgacatcgag gcatccccgg    316020
     ggccggcgtt accgccattg cgactatcac cagctcgacg agggtctctc tggggcggca    316080
     tctcgccagg cgggggacct cgcatgcgat cacgactact catggttgct aatcgatctc    316140
     cgaaagcctg gatcactcag gaggtgttcg gggatcaagt ggacatggtc gggaagacgg    316200
     gggcagggat cacacggagc gcgcgccgtg ggcgaggact gggatggtca gtcaatcggt    316260
     aagctccaac aagcaagacc gtaattcatt caaagagcag ggagattagt gaaaggcgac    316320
     gccatacacg agttggcgca gaaccgagtt ccaaaatcga cggaaggtgg aggaggagaa    316380
     gggagccaga gaggtgggat taggtcattc cttagccact aagctaccgt taacttggga    316440
     gggtgtgaga gcatgggctg gcggctgcgg atacggcacc gaacttagtc tcggcggagg    316500
     tggcagctgt tactatgcag ttataaacac acccctcgcc agaattgatg aagcggcaag    316560
     tatctatgct atatctatgc cagaatatat atatatatat atcttttact gcagttttcg    316620
     catttaggag agtcacagta cctgctcctg agtagacccc tataaaccac ccgacacatt    316680
     cgagctcgta cagcataatt atgtaatccg atagaggcgt atgcataaag cgggcacggc    316740
     ccacttcggt tgcctgtgca taagcaacta actgtcatgc aggatggccc gattccaatt    316800
     ttggattcag tgtaacctca cttcttgtct caaggaatct actacgagaa ttgcccagcc    316860
     gcagtactaa ctctggaatg cttcatatat cggtatctaa catactcatg cctaaactcc    316920
     tgttacggta ggctgatcca gcttattggt accactgagc ttactatata ctacgttgtg    316980
     caattggagg tgagggccaa actgagagct acaactgaga gcagcaagta aaatagatcc    317040
     accaccactg cggttttgcc atatcgattg gcttcccaag aacagcctgc tagtatgcag    317100
     cctcccttgt ataacccatt tcacacaatc tcacttacca tgcactcgtg ccgtcccggt    317160
     ctgtccgctg tgaggggatt caatgtcctg tagctgagca acaacgagta ttgtcagcgg    317220
     accttaatcc actactggta taggggaggg ataatggcgc acctaccggg ccggtgaacg    317280
     tcttcctctt ccctccccac cacccaatac caatcagagc aacaaaccct gcgagtacta    317340
     cactcgcata attcatgtcg tgtaccgtgg tcggtatctt tagaggcaaa caaaagaata    317400
     ccaatatgac tgccacccag acaacagcaa cagtattaca gaagagtcca aaatactttc    317460
     ccattgcgaa ggctcttctc ccaaggacgg cgtcacgccc acgaagcagc acgattgctt    317520
     gcgggactac atagcagatg ttgagggcaa ttatgactat cgatatgaaa ctgtcaaagg    317580
     ctgttgctga gccaatgtat atcagcccgt acagacagat gaacacacaa caacccaatg    317640
     tggcgttcag cggcatctcg tttgtgatct taacgaagaa tgacgaataa ggaagaccac    317700
     cagctcgagc gaacgtgtat gcaagtcgtc ccgcagtgag tagacaggac aactcggctg    317760
     cgcaatagaa gaatataacc catgcagtga aaagcgtggc cacgactggg ctggatgttg    317820
     cttgtaagta tgccgtataa atggggattg gggaagatgc aacagcctta agatcggttg    317880
     tgcagaaaag aatggctatc gcgtatggaa tacaggttac catgccagtc agcacggtag    317940
     ccatcattgc gcgggggata ttgcgaccag ggtttgggac ttccttttcg atgataaacc    318000
     gttaacagcg agctgaagaa cgaagccata tggcagcaga ggaacttaca tctgctatat    318060
     gggtaacact atcgaccgtt atgtatgcgt acatgcatgt cccagcgcct atcatgaagg    318120
     ctgtcccgtc actccagcct gtatggtttt cataggccaa gaacaaagtg tgcgcagact    318180
     gtttttgatc ttgcattgct aacaccgtta tcaaactggt gccgaaggtg agcaagctga    318240
     agatgatgat acaatcctct ataagtggaa taacacgagg caggtagcat acgaccacag    318300
     tcgagaggag aacgatcgga agatagataa gatagattcg ccaggcagtt accgtgacgc    318360
     tcggacggtg gacagtcacc agcccattaa tcatttgcgc ttctcaacag attattccca    318420
     gatcatacct agaagaactc atgtgataga atgaggaaag tcttaccaca gactattccg    318480
     ttggatgtag acactgtgca ccaggagatc atagtcaacc agccaacaac gaaagaaact    318540
     gcggcacggt gcttgggcgc tgaaacgatg aaagcaaaat gatatggccc tccgctagtg    318600
     ggaaatgcag atgccaactc tgcaagaccc gcagctatgg gcaaatggat agctaacgac    318660
     atctgctaga atgaggtagg acgtgcttac tgataaaaca acacgctatc gaagcaagaa    318720
     aaaggccaaa gaaagccgtc gggccccctc ccatcaccaa aggtatcgat aggataccag    318780
     cgtaaccagc ccatgaattg gtgatgctgt atcccaaggc caatgtcgac agaaatgaga    318840
     attgacgagg gagttcagca cgggcagtgc cagggctttc gttatcagac atctcggcag    318900
     ctgccttctg gacccgaggg ggaagactca gcaaagacat ctttcgtctc atcatatgaa    318960
     aagcaccttg aaaatgccac atgattatat agatcgtaag tactggtata aggttcaggt    319020
     tgagttctac taacaacaaa ttacaggtaa taaaattgac atgtggtacg caacgcgaac    319080
     tacattgggt gttaaccatc cgcgaacgaa taagatgatg tttatgatgt tcaggtcttt    319140
     agacatgccc gcaaagcacg atagagatct atcaactaaa gtggggatga ttgacttgtt    319200
     tagaaggtag ttgcattacg tccaggcttg ttgcacggat agtcatgcag gttactttgc    319260
     ctgcgcatta ccctactggg aaatgtagac ggcacaatga ttagtctatc ctcgttactg    319320
     ataacgcaga ctttccaaag atcttgggtt atgtcttcac gcaggcattg aaaatctccg    319380
     aagtcgcacc acggagctta ccgtctaggg cacgtgtact ttgtggcgag attaactttg    319440
     caatgtcgta caatacctag ggatatgtca taattgatca aatggagtcc agctatacaa    319500
     tgttcgcgat aaaggcaaga tagggcgaaa gatcaattgg gtggatacta atagtaaacc    319560
     aaagatattg agaactaagg agagagtatc aagttataaa caccacatcg atagtgaaag    319620
     tggaagacat atcaacccca acactcatat agactaacca atcaacgaaa accgcgcggc    319680
     ttcatctgcc gtagaggcga cattccgcac agtccaatcc cacaagtcgt cctgcttgtt    319740
     cacatcataa ctctcctcgc tggagcggat ctgcttcctt ccctcataat aaactccact    319800
     actcgacgaa gcctccttgc cactcgccag ccaagccaga ttagccccag acgcctgcgg    319860
     cagcctgata ttcggtgtcc ccagcatcac acgcaaaagc ggaataacac gagggaaaat    319920
     cacatgccag agaaagcgca agacggggtt cgcttcacgg acgagcccag tcccaggcat    319980
     gagaccagga tcaaacgcaa caacagtcca cgacttaagc ctcgcatctt tcgactcact    320040
     gagacgccga tgtagcgcgt acacccaaat aacgtttgca agcttgctgg ttgagtaacg    320100
     ctggcgaccg ggattctggg ctgagctctt tgtcgggtga gcgagatcct ccgcactggt    320160
     gtactttgcg tcggggaggc cggtctcttg tgccggatca tgtgtgccgc tggaggttac    320220
     cactatcctt gctgtgttgg cgaggtgagg aaccaggagt gaaaatagaa gggcgtggcc    320280
     gatgtgattg atggcgaagg ttttttcgta tccgtctact gtgtactcaa ctggaccggg    320340
     aaactgtagg cctgcattga ggagtaggta ttggatggga gggtatttgt tggtttccca    320400
     ttgctggacg aaggatcgga ccttggataa gtcggaaagg tcgagtcgga ggtagctgac    320460
     gttgctttgg cccagaagtt tgtttataga tccggcagca tctcgagagt cagatcgaga    320520
     tgcaattata acttgataat cggggaactg gcgggcaagt tctatggtgc agtaatagcc    320580
     cagaccggcg gtacctccgg tgatgaggat gcttcgcgaa taggacatgg ttgtcaaaag    320640
     gaagaatgag tttgctctct ttctctgagg cgagctgatg ccatatttat gtttcaatat    320700
     ctcggcgtta ggaacggaga tatacaatcc atgccatcaa aactatgacc ctatctaggg    320760
     ttggatgagg cagcaatgtt ccgcttcggg aatagcggga acggcaccgt cgatatctcg    320820
     aggcgcccat ctggaccggc cagtcatcta taagaccggc cttgacttga aaaatccgaa    320880
     gcaaatcgac gctgccgttc catgctagtt gatcataaca gctgtggccg agatgggctg    320940
     ggctgcaaat atcgcatctc cgtctcagcc ggatgacccg gccccatccc agttgctgca    321000
     ctatcttccg gattaccagg tcgtcatctg cagtgcctgc cgatatgctg tccagcctca    321060
     tgggatttta cgtcatctga aagagattca tcgcatactt cgtggccgcc ggcggaagta    321120
     ctctcattac gttgccagcc tttcccttag agagccaaac gatgtcatac cccccagtgg    321180
     cgctgatcag ttcccggtcc catacttacc ggtcgagccc ggtcttcaat gccagtcagc    321240
     tggttgcaag tacctatgtg cttctaataa gcgcatgcag tcccactgga gaactgtgca    321300
     tgggcgaaag gccgattgca ccacagactg gcgtacagtt cccctgcaga ctttcttccg    321360
     cggcaatcac ctgcggtact tcacttctga gggtgcaaag accaatcatg ctttatcaga    321420
     ctctgtgttt gggggccaca cacaagagtt atcagagaac cagctccacg caggcctgga    321480
     ctccatggac tctgctcttc tggaccacta cctccgacac acataccaaa gtttcacaac    321540
     caaccaagag acagacaaaa tatggcgcct ggttgttccg gaactagcat ataagaatgt    321600
     gttccttttg catggcctac tagcctgcac aagcttgcac agagcgcaca tgagctctgg    321660
     gcacaccaac caggaaaagg tattcctcct aagagcctac caccaccagg agattgctct    321720
     cccgcagttt cggtacgcta ttgagcatcc tacggaggat aattgccatg ccattctggc    321780
     atttgcacat ctgttagtgg tatactcttt tgccgccgat cagcctaggt gctcaaattc    321840
     aaatatgggc acggactcat tgttcctagt ggatcggaac agtggcgaag gcagtcaacc    321900
     ggatagtatt ctctgcaaat ggctatactt tctccgcgcc ggctgctcta tgctgtgtga    321960
     agtatgggag cagttgaaag aggggcccgt caaagcactt tcggaggcct gggacattga    322020
     cctaggtgac gacccggatc tcccatatct ggagcttttt atgtcaatga ttccaaacga    322080
     atcagctacc acacatgaaa ccggcgatgt cactgagacc agtctcgttt ggcccgaaga    322140
     tgtgacggcc atttaccgac aggctgccat tgaactgagc cgatcatttt cgtacgtgca    322200
     tgcccaccgc ggattactta ctacttggga tgttctccgc atatggccca tggaagtgtc    322260
     gctagaatac atggctcttc tccaccaacg gcacccggga gcacttatat tgctagcgta    322320
     ctattgtatc ctgttgaagc agatggagag acactggtac ttcgaagggc gcgcggcaat    322380
     gctaatctgc gccattcaga gacatttgaa gcccgagtgg catgttttca tccgagagcc    322440
     attgcatacg gttctaggag tacctgatgg tggccatttc cttggggagc tttagccgcc    322500
     cctacaagca gttgggggag cattccgtgt cagacggcgt agatttgata ttgcttccat    322560
     cagcagatta taccattcac gggattcgcc gctaaaaagc cgtatgaaaa agaaaaaatt    322620
     aatacgtcag ggattaacct tccggatgcg tcaattacaa atttgacttg gttttgactt    322680
     cacccttaat gggagaaaca atccaccagc cttcggtcga gtatctccag tgcctggcac    322740
     gtgaccatat tgtttcacgg aaccagagtc acgtgggttc catgtaaaaa gtcagctgag    322800
     caatcacgga tcgcgcatga ctgaccgcct ttgatctctt ctgctgtttt ttctttcttt    322860
     tttttctgcc tcgccgataa agggaaactt gaaaacatcc caatcaactt cgtcaatttc    322920
     acaatttgca gcgtttttgt cagacagtca tcatggccgg tcagaagtct aagcaggcga    322980
     agcccgccaa ggcgtccaag agcaaggaga ctgtaaggca atccgaccga cctgtttgtt    323040
     gtatagatag gcaatactga tcaagttcat gaattaacca gcctgctcct cccgctcaac    323100
     ttgtcgccgc tctcagtgct ttcttgagcg aatctggttt ctccaagacc aaggaagctt    323160
     tcaccaaaga acttgccagc aagtcgatcg actctgatgc gaagaatgtg ccgtccctgc    323220
     ttgaactgta ccaatcctgg gaaaagtcct ccgagaagtc ctccggttct agctcttcgg    323280
     acagcgacag cgacagtgaa agtgagagtg gaagcgagag cgatagcgaa agcagtgaca    323340
     gcagctccga cgaatccagc gattctgatg tcgagatgaa cgacaagtcc gagtccgaca    323400
     gcgatagcga ctccgatgac gaggaggaga agaagaagcc tgctgctcct gctgctaagt    323460
     cccagggcac caagcgcaag gccgagtcca gctcctccga gtctgattcc gaatctgagg    323520
     ccgatgaggc tcccaagtcg aagaagacca aggtgacttc cgccaaggaa gagtcttctg    323580
     actcggactc ctccgactct gagtccgatt cttcctcttc ctcttccgag tctgaagagt    323640
     cctccgactc ggactcctcc agcgacgact cctccagctc ctcttctgag tccgattccg    323700
     actccgattc tgattcggac tctgactctt cctctgacga cgaggacgac aagaaggccg    323760
     ataagaaggc cctgaaggct gctaccaaga cccctctgcc tccgtccgaa tctagctcca    323820
     gcggctcttc cccgtcttct tcgtccgact ctgacaccac cggaaccgtc agcaactccg    323880
     actctgcccc caaagagcag tccaagtctg cccagacatc ctactccagc agcgccagcc    323940
     ctgctcccgg caatggcccc cagaagaaga agcacaccgg tgctcgcccc actcctctgg    324000
     ctcagctgag tgagctcccc accgaccacc tcctctcgaa cgactacgtt ccctacgcct    324060
     acgccgagaa ggcctggcag gatctgtcgg tcacccgcgg caagggcttc accaaggaga    324120
     agaacaagaa gaagcgcggt tcttaccgcg gtggtcccat cgacatctcg ggtggcaagt    324180
     ccttcaagtt cgatgactag gtccgcgata ctattttaga gatggagacc agtttcgcat    324240
     cctgatatag ggggacaact aaaacatacc tacagctttt acatgctcga aaacatgggt    324300
     attcaaaaag ttttattcgc ttatgattcc atccatatag atctatatgc agcctagatg    324360
     ggtcactgaa tcattttcta cagcaaggcg ctactggagc ccggtcggat tgctttcttt    324420
     cagcttttct ttttgcttgt tgcttcacgc ttcttcacct gtatgtacta tctacttaca    324480
     tcatctagat ctttagaggt gttaaacatg tattcagata tccttgcatt ttcatgttaa    324540
     ccctagactt tgaagtattc gtacatgtcg tactcgtggt ggtagatcgt aggcatgagt    324600
     ctcttcctag gatcgattca gattcatcca tgcatcctgt catgaactac agtccccagt    324660
     ccagccaaag gactataccc agtcaacaat gcatggctca tgcgtttcca atggaacaag    324720
     tctcctttaa aacctctctg cgcaacatag cacggaagag agcacccagt acacacagca    324780
     tacacaagcc ccatgccccc ttcctccaat ataaaccaac atcctctccc gatcaacaac    324840
     tactctccta tcaatcagcc cgtctccacg cccccggttt ctccaacctc tcccacctcc    324900
     gatcccaccc cgtgatctcc tccgcaagac catcctccac cccgacaaac acaaacggct    324960
     gctgcgtgcg caaagtgata gaagcagtag tatcctcagg gcgctcgtag cccgataaat    325020
     ccaggacttt gtcggcagag cgggtgtgtg caacagtgtt ctcgagacgc acatcgttag    325080
     agagcagaag tggctcccgg taccaatcct gacaagggcc gaggaggtca tccgtagagg    325140
     cgaagtcaag gcgaacgacg ccatccgcga cgccagtgta gatagttggt gaggaagggg    325200
     agggcgaagt catgctgtag attgcaccgc ggtaggagcg ggtgttgtgg cggcgacggc    325260
     cttggggccg gctagaggga gggtgggcgg agaggaagat ggagatgtct ttgcggggga    325320
     aggcgatgct attgttggtt gcggtgaggg agaggcttga gaggctgtct acgattggtt    325380
     cgttgttttt gagaagggtt cgggaagggc gtgcatcacg atagctgtat gtgtcatgtt    325440
     tgggcatgcg taaatcaaag atcttgacta gggcgtcacc gccggcgccg acgacgaagc    325500
     ggtcgtggcc gaaggggtgg atgcagtaga tggggttctg gtccgtggta tcacggtagg    325560
     tcttttcgta ttcttcgttt gagcggaggt cgtgcagtct gagagtgtta gcatagagcg    325620
     tggaataatg gcaaatgggg tggttgtacc tgatagctcg atcaccccag gctgcgagga    325680
     agacttgtcc ggtgggatcg agtggagcaa tggcgttgac gttggatctg atggtcgtat    325740
     cgagattaag tctttcgaaa tctaccagct ccacattgag ctcacgactt ggtgatagac    325800
     cttgtggcgt gatggcggag atagtaattg catcgtggat gcgtcctgtg ccgactgcga    325860
     atagagaggg cgaaaggaac ttggaatact tgtggcgaga gctgatggtt gcattgttgc    325920
     tagaatcagc attgagacga gcaaatgggt agacttccgc ctctccagaa gtggtgctga    325980
     agaaagatat cgatccgtcg ctcaagtggg cagataagat cgggtccttt ccgtcactca    326040
     tatctgttct ctctatgccc cctccggaag tcatgaaccg ctgcttgtaa atatggcagg    326100
     cgatattagg gtcgatagag agatggaaaa gctctccgcg cgctcttgca acgactatat    326160
     gttcagtctg gggctccttg gaagggtgtc caggacgtag aatatggaca ccacagatgt    326220
     catcatggct gctgatgtga tcgagatcat tgaagaccac ccacttcccc tttgaattgg    326280
     ggccaggttc agcgatgcgc agaactagtt catctgccgc gccccaggcg agcacctcct    326340
     tccggtcgtt ccatgaagag ccattccaga cttcatacga gtccaaagca gggcgatatc    326400
     catgagtagg attgtcacgt cgtgttgaac tatgggatcc gaccttgact gcttctgagg    326460
     caggtacgac aaatcttccg acgactgcgt gtttgtctaa tgcccgagag cgagatgtga    326520
     gtgcctgagc ggcctctcgc cagatttcgg gcgtttccac accaggaaac ttggtctcga    326580
     cgaaggatct gaagattcgc caatcttgag cagcgacaac gtggtgtagg cgccagcagg    326640
     tccttgacag attcacaagc gcgctggcag atggcaaata gcttgtaata agctgtataa    326700
     tctctggagg aagctctgca agcatattgc gggccaggat aagactgtct tctgtgctaa    326760
     agtagataaa tcacaagaat gacgtaaaaa tctctgccgt cacgtgtgtc agtcaaagtg    326820
     agttgtcaag attcacgaag gtatagagga agattcacac atttactgat ctaagcaaca    326880
     acaagggaat gctctaggaa aggccaggtg gaggtggttg catgaaggaa tcgccatggc    326940
     gattctagac attgtgcgcc ccgtcccatc tatcgccgcg gtaatctgca gaagtgcgtg    327000
     aggccatcaa cgtgatccgt gtatcaacat tctttgctgt agatatgttt gctaagtgtt    327060
     agaataggct agtgactagt acgcaccctc aaaatgaatt gtgaatgcta tgctgtgaga    327120
     gatggcacag cctgtagatg tggatggtgg aggaaagtgg ctggagaggc cttatgtcat    327180
     ccggtatctt atcgctcctc ggctcttctt ggttcttatc ggcaatccaa actttctgag    327240
     tggtggaggc cattcatgag gagttggaga agctggtgat agacgatgtt accccatcaa    327300
     tgctgtgact caggctcttc ggctatatat ctgggcctat cccgggcttt gatatgtctc    327360
     ctcacatcta gcccgatgtt tatttcccct ctgcgtggag taggcctctg ccctagttcc    327420
     ccggctcatt cctagcactc ttctttattc atcaaccact gggcttgcgg agtcaagcga    327480
     aacttactca ctgctcatat gacacctcga gagtcccagg ttctttgagc tgagtgacga    327540
     taatacaact atactccact cgcgcattga ctttaaaatt tacatctcca agcaccggac    327600
     aacatggcaa tctcagccgt tactcttgcg gccaccagct tctgtatcct gctgctggcg    327660
     tacaaactga tcatataccc cgtcttcctg tccccgttgt ctaagatacc caatgcacat    327720
     tggtcagccc caatctcgcc agcatggatt atctggaaac ggtatagggc acagaacaat    327780
     aggaccattc aatccgcaca tgtaaggcta gggcctattg tccggcttgc accatccgaa    327840
     gtctccgtca actgcgtaga tgggggcatc aagtctatct atacgggtgg atatgagaag    327900
     cacgagtggt acccccgtgt attcggctct ttcgggtaag catgaccccc acagtgagtg    327960
     catgcgagga ctatactgac agctctactc tgcaccatgg tagaaccgtt agcatgttca    328020
     ccatgacaaa caacaaagcc cactctaccc gcaaaaggat gctgtccaac atatacagca    328080
     agtcattctt gcaatcatca ccccatatcc acctcatctc cgagacaatc ctgctcgacc    328140
     gtctcctgcc catcatccaa gatgctgcct cctcaggctc acccattgaa atgcatgatc    328200
     tcgatcaggg cattacaatg gactttgtct ctgcctacct ctacggccta gccaacggga    328260
     ccaacttcct ccaagacgaa gctttccgcc gcaagatcct ccgcctctac caaagcagaa    328320
     agccattcga attctaccac caagaagtcc ccaacctcgt atcatggaca aaacggctcg    328380
     gcctccgcct aattcccaaa tggtgcgacg aggccaacga ggtcctcgac gcctggggcc    328440
     tatccttctg cgacaaagca gacgaatgtc tcagctcgac ccagctcaac acagaaccaa    328500
     tggtctacaa acaacttaag caaagcatat cgaagcagct cccgcccaaa gaagcagcat    328560
     cctacaacaa actcatcgag caacaacgcc tcgacattgc ctgcgaacta tacgaccacc    328620
     tcacagccgg ccacgaaacc agcgccgtag ccctgaccta cctcttttgg gaactctcca    328680
     agcacccgga cctccagtcc gccctccgcg aagagctcca taccctagaa cctaagatcc    328740
     tgtacccccg tccatcatcc tcccgagacc tccccacccc caagtccatc gactccttgc    328800
     ccctcctcga cgctatcgta acagaaacct tacgcctgca tgccccgatc cccgggatcc    328860
     agccccgagt caccccgtcc cctggatgca cgctagttgg gtatagcgat atccccggga    328920
     acacgcgggt cagtgcgcag gcgtactcgc ttcatcgcaa tccagaggtc tttcctgagc    328980
     ctgagacgtg gcagccgaag cggtggctga aggattgtaa tccgtcggag gtgctggagg    329040
     aaaggagacg ctggttttgg gcgtttggga gtggggggag gatgtgtgtg gggagtaatc    329100
     tggctttgca gggtatgtat aactctcata aagttggttg ttgttatggt gagatgaagc    329160
     tgaccagtga ttttagagat gaaattggta gtcgcggcca tttacaccaa ttatacgacg    329220
     gctattattg atgatgagga tattgaggcc attgatgcat ataccgtcaa gccgaggggg    329280
     gagaagctgg tcttgaagtt tgagtctgtt gcgtagttct tctatgcgtt ctttcgggta    329340
     gctattgtgg tatataatgt gtgacttcct gtgcttcttt actattctat tgcaaatcca    329400
     gcagtactca actctacaga gcaatacaag accagataag tcgaaaataa ttgatagcat    329460
     acaacatcca cataatatta tacaaaaaga acccacccac ctaccctcaa cacagaatca    329520
     aaactgatgc ggtaggtagt agctattaca aacccaaaac tccatataaa aaatattttc    329580
     tctctcccct tttcccccgg ggaagccctc acttcctcca taccaccaca ccacccaatc    329640
     atcacatccg gcagtgtata agtaggtaga tcatatgccc gtatgcaacc gctcgaaaag    329700
     gtattgaatc acacgcaaac aatgtagtgt atattggctt ggcacttaac ccaacacacc    329760
     atccttcttc ttgggaccga cgaccttggg gaacattctc atgaggtggt agttgatggg    329820
     gttgcgtctc tgggtcttgg gtttctatat ggtggaggag atatgattag cacggatcca    329880
     agacaagcgc aatccaggtt tgagagatat ctccctctcc tgaaagtttc aaaaacaagg    329940
     gaatggaaac gtacaggagc atccatgcaa gatctcaatt gttgttcgag aatcgcgcat    330000
     ccctcgtggg tgtagccctg ggatgcccag caacctgatc gattcattcg tattagccat    330060
     attattcgag ccacaccgaa actccttaga gtagttgtag tactcactca gcatagacga    330120
     catcaccgca acgcaggtat tcggctcatt ggtgttcgga cgccggacgc gcaggtgagg    330180
     gatggactgc agacggaccg ggttgagacg ggtagagact cctttcgggg gcatgattgc    330240
     gaatggtgac tttgtagttt ctcgaaaaca atggtacagg gaggggggag ataacgacaa    330300
     cgcagccgag tgacgatgcg gacaaccaaa agttgactga aggcttcgga ggtgccaaga    330360
     ctttttcggc gatttgcccg ccgcggaagt gtctggctga tgtaatcacc gcggcgagtt    330420
     caggctggta actaagctga tttgctccta cttcttcagt ttctactata tttgaagatt    330480
     ggtttgcacg ctgatcggag acagagatga gcagaaggca tgtgagcgct ttttacacta    330540
     atacggtcgc gccagtatgt gcgccgagac ggcagagtat acccttatcg agatgcttct    330600
     ccgttgggag cgtgcggcga actgcggcga gttcgaagcc gggcgagcag catgagaata    330660
     ccaagacaca agatgagacg aaggaggagg aacagggggc tatggcgcgg cgactttcgg    330720
     atatgacaga gcaagccatg ctggaaggag gccggtccgc gcagagaaac atgcaacagg    330780
     cggggttctc ggacgagttg aagcagcagc tagaggagag ggtggcggcg gcggctttta    330840
     agaacgagta tgcgaccgcg cactcaattg ttgatatgcc ggtatgctca ctacatggac    330900
     attacatgtt cgataacacg accaggtact aacaagtccc agtcaagcgc aggtcaagga    330960
     acacgagaca tcgcaggcgc tccggcatgg accggaacag aaaacaccca cgacatcacg    331020
     ctacgcatgt tagacgactc caagaagcgc atacgcacac catacaagat cccccaacca    331080
     aatccggtcg acatgcgaat aagcccgaag cccaaagagt ccgccggatt gcgtctagcg    331140
     aaagcccgag agcgcagggc aacatactcc ttgagccaga gcgagggtat atcagaggac    331200
     gaacgtgaag ctatgcgtcg agagatgcgg gaacggttct cccccggggc acgaccgatg    331260
     ccggccacgc tgcaggggtt gtcagcgctt gcgaacgagc ggatcgagga tgcgatggcg    331320
     cgcggtcagt ttaacaggat aaggaggggt aagggtgtga atacggagac ggatcaccga    331380
     gccaatagtc cgttcatcga taccaccgag tacttcatga acaaaatgat ccagaagcag    331440
     gagatcgtgc cgccatggat cgagaaacaa caggacctag ctagggaggt tgatcggttc    331500
     cgatcacgtc tgagggcaga gtggcggcga catgcggccc ggctgattgc cagcgaggga    331560
     gggtctctgg atatacagat gagacgggct ggtgcgtatg ccgcggcgga ggctcgactg    331620
     gctgaaaggg ccaagataga gcaagcgttc cgcgagagcg atagtgcgag tagttctgga    331680
     gggctggact cttcagacgg agctccgcag agctcggata gtacagtttc agggccgcaa    331740
     gaggataaag atcctttacc ctatgttacg cccctgcgtg atccgcaata tatgaacaca    331800
     gagcgctcgt ttcttgagct gacgatcaag aacctcaatg ctcttactcg gacttacaat    331860
     cttcaggctc ctccggtggc acagaagccg tatctcaatc ttgagcgtga gctggctgca    331920
     tgttatgcgg aagtggctcc aagcttggcg gaggaaatta agcggcgtgc aactgaacga    331980
     gctcgtccaa agaattcggg gcctcaagct gcgaacatcc tggagtctct gagcacatcg    332040
     agtaaggtgc gtgtatatga ggaggatcag gccaagggct atgggttcaa agaattctgg    332100
     cgtgaccttt tctcgaagaa ggaataaacg ttcagagaac ttgtatataa tgaagatgat    332160
     gtgctgtgta tgatactcta cctgaataat agatatgagt gacacccgtg agcaaaagac    332220
     aaagacgaat atccatctta cacggcaatg cgcgcgacgt tctccatttc atctaacaat    332280
     atcccgctat ctaaacccaa ctacctcaac caatacctag cgtcgaagtc gtcgtctcga    332340
     cacatactgc caaactattc cttatttgtt tgatcacggc atcagcgtca acaaccctat    332400
     ctatctcacg tcttcaacgg cggcgcctaa ccattctgta cctgtacccc aagcgccaca    332460
     ccgcgtacaa tccgcgaatc cagacgactg ccaacagcac attactcgct gtccccagaa    332520
     ttctcaggaa aaacgcgatt cgagcattcg accacaaacc catcaagtga tgtctaagat    332580
     aaagtcccag tacccaggaa gcaaagccgt atatgagcgc gactgatgag atcaggagag    332640
     catctctata ccgatcctcc ctcgtcgagt gtgatatctc tcctggtgtg cgaagtgccc    332700
     gatgcaaagg taccttcatc ccatgccaag cgctagcgta gcagaacatg atgaatatca    332760
     ttatcactac ggcgcccagc tcatcgtata tgcctctccg ctccgaattg accagcgctc    332820
     gtttggtgac agtgatgttg gcctcgaaag ctcgcttgag tattgatgta catcgcttca    332880
     acggtgtcat aaagtcggtc caggcggtct tggattggcc ttggggccat gctgcttgtg    332940
     ccatgtctgg attggtgatt gaggaggaat aatcaggttt atgctgtgcg gttagatctc    333000
     ggtagttgcg ttgctgggtg aatggtaagg aactctctga tcagtgtgct aggacagtat    333060
     gtccgtgaat attatgaata ctggaattca aaggattgtg taactatgtc tcaacggatg    333120
     cacgtcaaac gatgacatga tggagaagag gatgttgtcg ctgtcgcaga cgtataagca    333180
     tcggatgtac attactggcc atcatgggag gtactagtca gcgatttgcg ccttccttat    333240
     acgagctgag catgaagatt gggtaaagta ggggaaagct tctgaagcta acctgctcat    333300
     agctgtgcaa ttcctcgctg cattatttcc aatattttct agatagtaaa gtattatata    333360
     ggctatatga atgtctattg ccactgtagc ttcagtaaat tgatctctcc tggtcctgat    333420
     ggaaataagc agctagagcc agagtgtggt gagttctttc atcatgtgct caacggttga    333480
     agctcagggc tttagatagt taccgtgtaa atttcgcact attatccaag ccatttttcg    333540
     agaacagata gtgtccgcga gccttgagga tggtggtgag agaggggagg gggagaaaga    333600
     gatgtgagag acaggaggtg agtcaatcag cctccccact tctttcttca agttcacagt    333660
     ccacggctgc tcaatcactc tgttgcttcc taggcctgat acatgatggt gctcagtccg    333720
     atacatcctt ttgttgggtc taattttgaa catggaatgg cagttgtata ccaaccaaac    333780
     agcttgtcgt atccaacaga caagtccccc ctcattcagc aagacgacac tgtcaatgct    333840
     ggtatgaata gtcaaagaca gattgtgcat tgcagtcagc gacaataaag ttcatactta    333900
     accagatggc tcttgtgcta aacaacagtt cgtggatctt cgtcttcgga gcccagttcc    333960
     tagatcactc ggtagagtga ttccatcgct ttcatttctg gtctatgagc cctcgtgagt    334020
     gtctctatta acttcttatt agatgcatac ttagaatgca ccccttaaag ctcatctaca    334080
     cgctcttgac cccaaattat atacatttgg ttctgcctga ctgaaacgtg ctatcaaaat    334140
     gtcgcaccac gagtagccca ttcagcttca atacaagcac acaaaagtac caatcaatta    334200
     ccaatcacga cgatcttaag ataaggttta gaaagcgaaa caacttcgga aattacctca    334260
     gtggagaaca tctcgtcagc aatatgaagc tgccgttgca attcgcacgt ccacggctga    334320
     tcagatcgac aaccaaccat cgagtggtta ttgttcgcat ttgacaggga gtttaggttt    334380
     tctagagcct actgttactg cagcctgtct ggcgaggtag tcagcggaaa tgacccggac    334440
     ttgatcgtgc tgtgactcga caacagtgat acctgcatac agcgggatgt gcttggaaca    334500
     gaccctgtag tttgccccgg gcacagacaa accctatcca tgccgctaca gtctgtcaca    334560
     aagcgctaaa ttagcgggaa ttgattcgag cataactgcc agtagtcaac cgcccgatgt    334620
     gacggggtgt gccgtgcatg caggcccggc gcgtaaattg accaacggcc gttgcgggac    334680
     ggccgtcgca gcagatcacc tcttcacacc atcacatcga cttcccccag gcctctcaat    334740
     ataccgcttc tcccctcttt tcttccatca tgtttctctc attgcgcaag gatttacagc    334800
     cttcagacca gatccgatat gtctgcaggt gctacttaat cgtcaccttg tctgcaatca    334860
     caaagcttca tcccgacccc atataatgcc ctatctgcta ttctttgcgc tccttccccg    334920
     cctcattact gctggctcag tatccaagga gcagttagac cccgttcgtc ggaatagtta    334980
     tcccatcact ccagccgtgg acgagtcgct cctggccatc cagatcggag gcattgtcgg    335040
     tgcatacgtg atcttcgttg ccctacttct ttcgctgctt ctcttcgtgg gccgccgtct    335100
     gcgacgagct gtcctctcct ccaactactc cctccacgtc gagatgatga agcccatgaa    335160
     gccccctccc agcatggacc ccagtcccgt caccccgatc tccatcaacc tgcccagccc    335220
     gggccctcga agcttcagcc ggtcctggag cagcctcggc aagggccctc gctcccacgc    335280
     ctcagggacc accaccagcg tcgccacgat cgacgaatcc gtcgtagcaa ctgaccgcca    335340
     gcgagcccaa gaggatctgg aaatgcttta cgccgccgtg atggagcacg acgcccagaa    335400
     ggaagctgcc gccgcagccc ggggtgccaa caaggactcc tccgatggag acgaagcagc    335460
     agagaaagag attccctctc cagacagcat ccccacgaat ccgttcgcag atcgctcttc    335520
     acacgcctcc tccaacaact ccccactgag ccctcgatct agcggccgac tatcccgcat    335580
     ctcctccctg tcgctcttca acctcaagtc gcagaaccag cagcaatcat caaacag       335637
//

If you have problems or comments...

PBIL Back to PBIL home page