(data stored in SCRATCH zone)

EMBL: AM269956

ID   AM269956; SV 1; linear; genomic DNA; STD; FUN; 5738 BP.
XX
AC   AM269956;
XX
DT   28-JAN-2007 (Rel. 90, Created)
DT   14-MAR-2015 (Rel. 124, Last updated, Version 5)
XX
DE   Aspergillus niger contig An01c0090, genomic contig
XX
KW   .
XX
OS   Aspergillus niger
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
XX
RN   [1]
RP   1-5738
RA   Pel H.J.;
RT   ;
RL   Submitted (01-MAY-2006) to the INSDC.
RL   Pel H.J., DSM, 624-0295, P.O. Box 1, 2600 MA Delft, THE NETHERLANDS.
XX
RN   [2]
RX   DOI; 10.1038/nbt1282.
RX   PUBMED; 17259976.
RA   Pel H.J., de Winde J.H., Archer D.B., Dyer P.S., Hofmann G., Schaap P.J.,
RA   Turner G., de Vries R.P., Albang R., Albermann K., Andersen M.R.,
RA   Bendtsen J.D., Benen J.A., van den Berg M., Breestraat S., Caddick M.X.,
RA   Contreras R., Cornell M., Coutinho P.M., Danchin E.G., Debets A.J.,
RA   Dekker P., van Dijck P.W., van Dijk A., Dijkhuizen L., Driessen A.J.,
RA   d'Enfert C., Geysens S., Goosen C., Groot G.S., de Groot P.W.,
RA   Guillemette T., Henrissat B., Herweijer M., van den Hombergh J.P.,
RA   van den Hondel C.A., van der Heijden R.T., van der Kaaij R.M., Klis F.M.,
RA   Kools H.J., Kubicek C.P., van Kuyk P.A., Lauber J., Lu X.,
RA   van der Maarel M.J., Meulenberg R., Menke H., Mortimer M.A., Nielsen J.,
RA   Oliver S.G., Olsthoorn M., Pal K., van Peij N.N., Ram A.F., Rinas U.,
RA   Roubos J.A., Sagt C.M., Schmoll M., Sun J., Ussery D., Varga J.,
RA   Vervecken W., van de Vondervoort P.J., Wedler H., Wosten H.A., Zeng A.P.,
RA   van Ooyen A.J., Visser J., Stam H.;
RT   "Genome sequencing and analysis of the versatile cell factory Aspergillus
RT   niger CBS 513.88";
RL   Nat. Biotechnol. 25(2):221-231(2007).
XX
DR   MD5; b13ead255d1bee30650bad61b49b1792.
DR   ENA-CON; AM270980.
DR   BioSample; SAMEA3283178.
DR   EnsemblGenomes-Tr; CADANGAT00000324.
DR   EnsemblGenomes-Tr; CADANGAT00000325.
DR   EnsemblGenomes-Tr; CADANGAT00000326.
DR   StrainInfo; 791018; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5738
FT                   /organism="Aspergillus niger"
FT                   /strain="CBS 513.88"
FT                   /mol_type="genomic DNA"
FT                   /clone="An01c0090"
FT                   /db_xref="taxon:5061"
FT   exon            <121..384
FT                   /locus_tag="An01g03290"
FT                   /number=1
FT   CDS_pept        <121..384
FT                   /pseudo
FT                   /locus_tag="An01g03290"
FT                   /note="Remark: no start codon due to end of contig."
FT                   /note="Title: weak similarity to hypothetical lipoprotein
FT                   nlpD - Synechocystis sp. [truncated ORF]"
FT                   /db_xref="PSEUDO:CAK32618.1"
FT   mRNA            <121..>384
FT                   /locus_tag="An01g03290"
FT   CDS_pept        complement(join(1608..1724,1800..2194,2318..2896))
FT                   /exception="reasons given in citation"
FT                   /locus_tag="An01g03300"
FT                   /EC_number="3.-.-.-"
FT                   /note="Function: E. coli iucB functions as N
FT                   epsilon-hydroxylysine:acetyl coenzyme A N
FT                   epsilon-transacetylase involved in biosynthesis of
FT                   aerobactin."
FT                   /note="Function: E. coli iucB is involved in iron uptake
FT                   through biosynthesis of the low molecular weight iron
FT                   specific chelator (siderophore) aerobactin, a hydroxamate
FT                   compound."
FT                   /note="Regulation: expression of E. coli iucB is iron
FT                   dependent."
FT                   /note="Title: strong similarity to siderophore synthesizing
FT                   acetylase iucB - Escherichia coli [putative frameshift]"
FT                   /note="putative frameshift"
FT                   /note="See PMID 2935523"
FT                   /note="See PMID 2973985"
FT                   /note="See PMID 4313071"
FT                   /db_xref="GOA:A2Q873"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR019432"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q873"
FT                   /inference="similar to AA sequence:PIR:S44019"
FT                   /inference="profile:COGS:COG1670"
FT                   /protein_id="CAK32619.1"
FT                   /translation="MMLWVTLWWYFHEPQPDRRLQTDASANTPPSGQPKGDWRINIKRE
FT                   GFFKGRTLLQKLERMGLIASEDSSVGAEPYDPQCWANMFISRRSFWQIDPRLFVFTMSP
FT                   QTIPPSVSGSPFVQRVASPSRESFNLAHAAGQEVAHYVPNEGPFASTSHLPTYFPPPPT
FT                   QYTFTNGIRHPIRPKPPHQGDVFYVRYIPSPLTAGPSDLDLLHKWMNDPRVNASWGEAG
FT                   PIEHQEKFLRTNLNSRHSFPVIGCWDGKPFGYFELYWVKEDRLGPLIGGADNYDRGIHL
FT                   LIGEQEYRGPHRVQIWLSALVHYCFLADSRTQTVMLEPRVDNFKLITYLQEAGFYKEGE
FT                   VTFPHKQSALMKIKRDTWECPAI"
FT   mRNA            complement(join(<1608..1724,1800..2194,2318..>2896))
FT                   /locus_tag="An01g03300"
FT   exon            complement(1608..1724)
FT                   /locus_tag="An01g03300"
FT                   /number=1
FT   intron          complement(1725..1799)
FT                   /locus_tag="An01g03300"
FT                   /number=1
FT   exon            complement(1800..2194)
FT                   /locus_tag="An01g03300"
FT                   /number=2
FT   intron          complement(2195..2317)
FT                   /locus_tag="An01g03300"
FT                   /number=2
FT   exon            complement(2318..2896)
FT                   /locus_tag="An01g03300"
FT                   /number=3
FT   CDS_pept        complement(join(3933..4792,5096..5354))
FT                   /exception="reasons given in citation"
FT                   /locus_tag="An01g03310"
FT                   /note="Function: human Crym is a NADP-regulated thyroid
FT                   hormone receptor."
FT                   /note="Localization: human Crym was purified from cytosol."
FT                   /note="Similarity: human Crym shows similarity to bacterial
FT                   lysine cyclodeaminase and ornithine cyclodeaminase."
FT                   /note="Title: similarity to thyroid hormone-binding protein
FT                   mu-crystallin Crym - Homo sapiens"
FT                   /note="cytoplasm"
FT                   /note="putative frameshift"
FT                   /db_xref="GOA:A2Q874"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q874"
FT                   /inference="profile:COGS:COG2423"
FT                   /protein_id="CAK32620.1"
FT                   /translation="MPLTILSQTQLRSLLLSLSRDQIIELQQNLSNALRDYSTGSQEKG
FT                   CAAAYQPTRTAITRQNGCTTLFMPASTGNTLGMKMISLQDNMTLIDETSLPFGLINAHE
FT                   LTPFRTALTATMTLNKRKRVRTVVVFGAGKQAYWHIRLALILRGEGIKRVYIINRSFDR
FT                   AAQLLRDIYSPENASWRGDVKFSAVSTDFVEYDRILHDALLKADAIFCCTPSTEPLFPA
FT                   QILTSRDGRRKGRLISAIGSYRPHMTELPPELLRDEVTVHSSHRHFHKHVRRSGVVVVD
FT                   SLDAALKEAGEIVQAGIRPHQVVELGELLIVRDASRGEGDNSEDGKSLRDWVERGNVIF
FT                   KSVGMGLMDLVTGGDLVRLAREKGVGTTLEEF"
FT   mRNA            complement(join(<3933..4792,5096..>5354))
FT                   /locus_tag="An01g03310"
FT   exon            complement(3933..4792)
FT                   /locus_tag="An01g03310"
FT                   /number=1
FT   intron          complement(4793..5095)
FT                   /locus_tag="An01g03310"
FT                   /number=1
FT   exon            complement(5096..5354)
FT                   /locus_tag="An01g03310"
FT                   /number=2
XX
SQ   Sequence 5738 BP; 1359 A; 1341 C; 1731 G; 1307 T; 0 other;
     aatcaacacc caacctcctc ctcccctccc aaccccgcgt cttgaaccac cccgcgccaa        60
     agaaagatct ccccgcgggc ccgttccccc acccctaacc ctaaccactc ctacgggcag       120
     caacacagcc caccagcacg gacgcagtcc atcatcgtca ctgcccttcc gggacgctta       180
     cccgctacag agcgcgccgg ccacgaagct cacggttctg gagaggcctt tgaagcacat       240
     gaatgggcca aggacgggcg tgcccacgcc gtacagtccg tacatgccgt tcacgcccgt       300
     gacgccattg acgccgagct cgatgattac gaagaggcag agacggcgcg cggagaagga       360
     gagtgggttg aaggtgttaa atgaggatga tatggttagg gatgatgggg atatgtgggg       420
     gtattagctt ttctctaact cgtcgaattt caaattcctg tctgacactc tgctttattt       480
     cactaggtag tgtgcttgga tgggttgatg tgaggcgaga gtgtatggtg atgatatttc       540
     cggggattat actgcttctg gggttatgtg atatgtggtt atgcttggtt ttatgaatat       600
     acgagtattt attcgaatta ttttgaatgg tcatgtcttt aacgtcattt caatactagc       660
     acggagtaga gtagaataat ttgattcatt ttaatcatgt aactactcca tcaaagtttc       720
     tatgttgctc ccgtgacaga agccattgga ggccgaaaag agatgtcgag ggttcggaga       780
     aaagtagcag aagtccatgg ggggccgtct gatgactttg gatagaatac tactacctac       840
     gcagtcgatc tatgatctca aggtgtggct gccaaatcaa cggcaggctt gggatcggac       900
     acacatcgca tcctgttgac aatacagtac ttatgaacaa ctaactgatt tttcatccga       960
     ctctcagtca acttgactaa ttgacagtaa cctagcaagt gtcgattcat ttaggcttaa      1020
     gtttttcgac acctgcgaca gcatattgtt tacgctgcgg aggttgcggg ccatagatcg      1080
     aaatgaactt tttcaggaca gtattataag ttacttggta ggttcagtaa gtgagtaaat      1140
     tggatttgtt ctggtttatt tattatgatt tactactcta gaaaaaaaaa ataatcttcc      1200
     aattttttat aggcttctac agtacagaaa gacaaggtca tttgacttct ggagtccacc      1260
     acagtagtag taagatgagt agaggtcgac gatccgcacc gcaaccacaa ccataaccct      1320
     aattaaatgc agataccaaa caccgttgga aagaaaagaa gagattctaa aaagaggtag      1380
     taaaatagtc ctatatacag ttccctgcgc cgcaccccac ctcgttttcg ctatagtaat      1440
     ctcactcttt aatgcttttc ctctctctct ctctctcttc gtatgcaaca caattcctgc      1500
     catctgcatt agtccgccaa tgcaactaat ccttaatgct tctgaaatat cttacctcta      1560
     tcggcatcac caccatcaac cagcacgcct tctagagaac aggaaagcta aatagcagga      1620
     cactcccacg tatcccgctt aatcttcatc aaagccgatt gcttatgcgg gaaagtaacc      1680
     tcgccttctt tatagaagcc tgcttcttga aggtacgtaa tcaacctatt catctatcat      1740
     tagtatctgt acctgtatgc tttattgatt gcgagatggt agtgatagtg ggggcatact      1800
     taaaattatc caccctcggc tccaacatga ccgtctgagt tctcgaatcc gccaagaagc      1860
     aataatgcac cagtgcactc aaccagatct gcacgcggtg tgggccacgg tactcctgct      1920
     cgccgattaa caggtgaatg ccgcgatcgt agttgtcggc tccgccgatt aacggtccca      1980
     gtcggtcttc cttcacccag tacagctcga agtagccgaa tggcttgccg tcccagcagc      2040
     cgatgacggg gaaactgtgt ctgctgttaa ggttcgtgcg caggaatttc tcctggtgct      2100
     cgatgggccc ggcttcaccc caggaggcgt tgacgcgggg gtcgttcatc catttgtgca      2160
     gtaggtcgag gtctgacggc cctgcggtta ggggctggtc gagactgcta gtggagtggc      2220
     tagcggagtg gctgggggtg gggttgttgg atcctggggc gcgtttttgg tgagatgggg      2280
     ggatataggg gatgcggaag gagaggtatt gttgcacgct ggggatgtaa cggacgtaga      2340
     agacgtcgcc ttggtgcggc ggtttggggc ggatggggtg tcggatgccg ttggtgaagg      2400
     tgtattgggt ggggggaggg gggaagtatg tgggcagatg gctggtggag gcaaaggggc      2460
     cctcgttggg gacatagtgt gcgacctctt ggccggctgc gtgagcgaga ttgaagctct      2520
     cgcgcgaggg cgaggccacg cgctggacaa agggagagcc ggacactgat ggggggatgg      2580
     tctgcgggct catggtgaag acgaacagcc gggggtcgat ctgccagaag ctgcgacggc      2640
     tgatgaacat gttggcccag cattgcgggt catagggctc tgcgccgacg gacgagtcct      2700
     cggaggcgat gaggcccatg cgctcgagct tctggagcag cgtgcgaccc ttgaagaagc      2760
     cttcgcgctt gatatttatg cgccagtcac ctttgggctg gccagaaggc ggggtattgg      2820
     cggaggcgtc cgtctgcaga cgacggtcgg gctggggttc gtggaagtac caccacagcg      2880
     tgacccagag catcatggcg atctggcgag tgggggagct gaccggcttg tagtcactgc      2940
     tgggtgggtc gacaatgtag gagatgtaga gggagtcatc gcgcaaggtg ggggtagtga      3000
     agcgcgtaag gcgggcacgc tgctcatcat cgccagtccc gcgagttcga ccacgctctt      3060
     catcgttggt gtccgtggtt tcggggtctg gacggtttgt ggcgagcacg atgctccaac      3120
     caggaggcac gatggactgg ttggagttga catcgttgga tttgaaggtg aagccccgaa      3180
     gacgggggag acactgaagc tcagcccgtt gggtagatgg cacacgtgat ggcgcatagt      3240
     tgctgatttg acttgacttt aagcagggga agggggaaaa gaagaagaag aaggaaggga      3300
     aagcaagagg agggagggaa gtaagagtaa atagtcaata gtaaatcgta gtatctagac      3360
     agagtggggg ggggcgcgca aagaatgagc ttgtgtggga tgatgcgcag ttgcccctca      3420
     ctgggttttt gacgatcgcg cggcgcctgc aggaaactcg cttttggctt tcaccggcgc      3480
     tgcagaaaga gatcagccca gttcgggtgc tgtccgactg ggtggccaca tgttcctggg      3540
     gtgccgatgg atccccgcgg cagcacgaga gatgcagaag ttgcagtgag ctgaggcagc      3600
     agaagcaaaa gcagaacaag aaatgaagtc taaagaaaag aaaagagaga cgatggttga      3660
     tgtcatgttc cgggcggtca gcaaaaagat tgtaattggg gcagttgatt ggctgggagt      3720
     gcatgcctta ccctatttac tttgatttac tttcgaaatt acttgatagt ctcacatttg      3780
     ttcaagaaaa gggagacaga tagaaagata aaagtagcat gaattgaata tggatatcat      3840
     agtccagcaa ttacctcctt cccagtgccc gcatcgtgat agttctccag taattactac      3900
     atgaaaagaa agaaagaaaa gaaagaaagc aatcagaatt cctccagcgt cgtgcccact      3960
     cccttctccc gcgccaaccg caccagatcg ccgcccgtca ccagatccat caagcccatc      4020
     cccacgctct tgaagatcac attcccgcgc tccacccaat cccgaagact cttgccatct      4080
     tcgctgttgt cgccctcccc gcgcgacgca tcccgcacaa tcagcagctc gcccaattcc      4140
     accacctgat gcggccggat gcccgcctgc acaatctcgc cggcttcctt cagcgccgca      4200
     tccaaactgt ccaccaccac tacgccactc cgtcgcacat gcttgtggaa atgccgatgc      4260
     gagctgtgca ccgtcacctc gtcgcgcagc aactcaggtg gcagctcggt catgtgtggc      4320
     cgatatgatc caatcgcgct gatcagacgg ccctttcggc gtccgtcgcg cgatgtgagg      4380
     atctgtgcag ggaagagcgg ttccgtcgag ggcgtgcagc agaagatcgc atctgccttg      4440
     agcagcgcat cgtgcaggat gcggtcgtac tcgacaaagt ccgtgctgac ggcggagaat      4500
     ttcacatcgc cgcgccagct ggcgttctcg gggctgtaga tatcccgcag cagctgggcc      4560
     gcgcggtcaa aggatcggtt gataatatac acccgtttga tgccctctcc gcgcaggatc      4620
     agcgccagcc gaatgtgcca gtatgcctgc ttgcccgccc cgaacaccac cacggttcgt      4680
     acgcgcttgc gtttgttgag ggtcatggtg gcggtcaagg cggtgcgaaa gggggtaagt      4740
     tcatgagcgt tgatcaatcc aaagggtagg ctcgtctcgt caatcaatgt cactgatcct      4800
     tgcggggagg tatcacggga gccggcggcg ggccaggcac ccatggtgtt ggacattccg      4860
     gtatcgatgg gttgctggtt cacgcagccg ggggtgagcg atttgctgct ggaggaggga      4920
     gaggaggagg tgtggtcgtc gtcttcttgg gaggacatgg attgctcgct gccttcggag      4980
     gagatggagg acatggactt gcgctggttg actcggctgg aggaggtggt ggtggtggtc      5040
     cgggaggctg cggaggacaa gtctaaggct gggtcgacgg agcagccggc ctgactgtta      5100
     tcttgtaagg agatcatctt catgcccagg gtgttgcccg tgctagcggg catgaacaag      5160
     gtggtgcagc cattctgacg ggtgatggcc gtgcgcgtgg gttggtaggc agccgcacag      5220
     cccttttctt ggctaccagt ggagtagtcc cgcagagcat tggagaggtt ctgctggagc      5280
     tcaatgatct ggtcgcgaga gagcgacagg aggagggagc ggagttgtgt ttgagagagg      5340
     atggtgagtg gcatgataag cagtgtgata agagatatga gagaaaaaga gggaggggag      5400
     gagaggagag tagtaggaga gaggatggag aagagggagg tggagaagaa ctggcagggc      5460
     agagcagggg acagtccggg aacagcggag acgatggggg agagttaata tatttattag      5520
     tatctggagt acctgcgata aagacacgga cagagagaga aagaaagtcg cgaagacgca      5580
     agcgggcggg ttcacttctc tgggcgggcg gaccggatga cgacaattct ctcagcctcg      5640
     gcggggcgtt ggattaatac cactgtttat ctccataaca agagataata ataatcttat      5700
     aataataata atgagaattc tactgagagt atagcaag                              5738
//

If you have problems or comments...

PBIL Back to PBIL home page