(data stored in SCRATCH zone)

EMBL: AM269959

ID   AM269959; SV 1; linear; genomic DNA; STD; FUN; 96160 BP.
XX
AC   AM269959;
XX
DT   28-JAN-2007 (Rel. 90, Created)
DT   14-MAR-2015 (Rel. 124, Last updated, Version 5)
XX
DE   Aspergillus niger contig An01c0120, genomic contig
XX
KW   .
XX
OS   Aspergillus niger
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
XX
RN   [1]
RP   1-96160
RA   Pel H.J.;
RT   ;
RL   Submitted (01-MAY-2006) to the INSDC.
RL   Pel H.J., DSM, 624-0295, P.O. Box 1, 2600 MA Delft, THE NETHERLANDS.
XX
RN   [2]
RX   DOI; 10.1038/nbt1282.
RX   PUBMED; 17259976.
RA   Pel H.J., de Winde J.H., Archer D.B., Dyer P.S., Hofmann G., Schaap P.J.,
RA   Turner G., de Vries R.P., Albang R., Albermann K., Andersen M.R.,
RA   Bendtsen J.D., Benen J.A., van den Berg M., Breestraat S., Caddick M.X.,
RA   Contreras R., Cornell M., Coutinho P.M., Danchin E.G., Debets A.J.,
RA   Dekker P., van Dijck P.W., van Dijk A., Dijkhuizen L., Driessen A.J.,
RA   d'Enfert C., Geysens S., Goosen C., Groot G.S., de Groot P.W.,
RA   Guillemette T., Henrissat B., Herweijer M., van den Hombergh J.P.,
RA   van den Hondel C.A., van der Heijden R.T., van der Kaaij R.M., Klis F.M.,
RA   Kools H.J., Kubicek C.P., van Kuyk P.A., Lauber J., Lu X.,
RA   van der Maarel M.J., Meulenberg R., Menke H., Mortimer M.A., Nielsen J.,
RA   Oliver S.G., Olsthoorn M., Pal K., van Peij N.N., Ram A.F., Rinas U.,
RA   Roubos J.A., Sagt C.M., Schmoll M., Sun J., Ussery D., Varga J.,
RA   Vervecken W., van de Vondervoort P.J., Wedler H., Wosten H.A., Zeng A.P.,
RA   van Ooyen A.J., Visser J., Stam H.;
RT   "Genome sequencing and analysis of the versatile cell factory Aspergillus
RT   niger CBS 513.88";
RL   Nat. Biotechnol. 25(2):221-231(2007).
XX
DR   MD5; 7f76bb59443216d92b1de3f01525abe7.
DR   ENA-CON; AM270980.
DR   BioSample; SAMEA3283178.
DR   EnsemblGenomes-Tr; CADANGAT00000350.
DR   EnsemblGenomes-Tr; CADANGAT00000351.
DR   EnsemblGenomes-Tr; CADANGAT00000352.
DR   EnsemblGenomes-Tr; CADANGAT00000353.
DR   EnsemblGenomes-Tr; CADANGAT00000354.
DR   EnsemblGenomes-Tr; CADANGAT00000355.
DR   EnsemblGenomes-Tr; CADANGAT00000356.
DR   EnsemblGenomes-Tr; CADANGAT00000357.
DR   EnsemblGenomes-Tr; CADANGAT00000358.
DR   EnsemblGenomes-Tr; CADANGAT00000359.
DR   EnsemblGenomes-Tr; CADANGAT00000360.
DR   EnsemblGenomes-Tr; CADANGAT00000361.
DR   EnsemblGenomes-Tr; CADANGAT00000362.
DR   EnsemblGenomes-Tr; CADANGAT00000363.
DR   EnsemblGenomes-Tr; CADANGAT00000364.
DR   EnsemblGenomes-Tr; CADANGAT00000365.
DR   EnsemblGenomes-Tr; CADANGAT00000366.
DR   EnsemblGenomes-Tr; CADANGAT00000367.
DR   EnsemblGenomes-Tr; CADANGAT00000368.
DR   EnsemblGenomes-Tr; CADANGAT00000369.
DR   EnsemblGenomes-Tr; CADANGAT00000370.
DR   EnsemblGenomes-Tr; CADANGAT00000371.
DR   EnsemblGenomes-Tr; CADANGAT00000372.
DR   EnsemblGenomes-Tr; CADANGAT00000373.
DR   EnsemblGenomes-Tr; CADANGAT00000374.
DR   EnsemblGenomes-Tr; CADANGAT00000375.
DR   EnsemblGenomes-Tr; CADANGAT00000376.
DR   EnsemblGenomes-Tr; CADANGAT00000377.
DR   EnsemblGenomes-Tr; CADANGAT00000378.
DR   EnsemblGenomes-Tr; CADANGAT00000379.
DR   EnsemblGenomes-Tr; CADANGAT00000380.
DR   EnsemblGenomes-Tr; CADANGAT00000381.
DR   EnsemblGenomes-Tr; CADANGAT00000382.
DR   EnsemblGenomes-Tr; CADANGAT00000383.
DR   EnsemblGenomes-Tr; CADANGAT00000384.
DR   EnsemblGenomes-Tr; CADANGAT00000385.
DR   EnsemblGenomes-Tr; CADANGAT00000386.
DR   EnsemblGenomes-Tr; CADANGAT00000387.
DR   EnsemblGenomes-Tr; CADANGAT00000388.
DR   EnsemblGenomes-Tr; CADANGAT00000389.
DR   EnsemblGenomes-Tr; CADANGAT00000390.
DR   EnsemblGenomes-Tr; CADANGAT00000391.
DR   EnsemblGenomes-Tr; CADANGAT00000392.
DR   EnsemblGenomes-Tr; CADANGAT00000393.
DR   EnsemblGenomes-Tr; CADANGAT00000394.
DR   EnsemblGenomes-Tr; CADANGAT00000395.
DR   EnsemblGenomes-Tr; CADANGAT00000396.
DR   EnsemblGenomes-Tr; CADANGAT00000397.
DR   EnsemblGenomes-Tr; CADANGAT00000398.
DR   EnsemblGenomes-Tr; CADANGAT00014426.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00015; U4.
DR   RFAM; RF01513; Afu_335.
DR   StrainInfo; 791018; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..96160
FT                   /organism="Aspergillus niger"
FT                   /strain="CBS 513.88"
FT                   /mol_type="genomic DNA"
FT                   /clone="An01c0120"
FT                   /db_xref="taxon:5061"
FT   CDS_pept        complement(join(230..798,856..930,987..1266,1374..1418))
FT                   /locus_tag="An01g03570"
FT                   /EC_number="1.6.2.2"
FT                   /note="Catalytic activity: cytochrome-b5 reductases convert
FT                   NADH + 2 ferricytochrome b5 to NAD(+) + 2 ferrocytochrome
FT                   b5."
FT                   /note="Function: S. cerevisiae MCR1 plays an important role
FT                   in the response to oxidative damage."
FT                   /note="Localization: S. cerevisiae MCR1 is inserted into
FT                   the outer mitochondrial membrane, where 1/3 becomes firmely
FT                   anchored at the outer surface while the rest is released
FT                   into the intermembrane space after proteolytic cleavage in
FT                   the inner membrane."
FT                   /note="Remark: the Exon-Intron structure of the predicted
FT                   A. niger protein is in accordance with the A. niger EST
FT                   an_2939."
FT                   /note="Title: strong similarity to cytochrome-b5 reductase
FT                   Mcr1 - Saccharomyces cerevisiae"
FT                   /note="localisation:mitochondrion"
FT                   /note="See PMID 8001120"
FT                   /note="See PMID 11420140"
FT                   /db_xref="GOA:A2Q898"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2Q898"
FT                   /inference="profile:COGS:COG0543"
FT                   /inference="profile:COGS:COG1018"
FT                   /inference="profile:PFAM:PF00175"
FT                   /inference="profile:PFAM:PF00970"
FT                   /inference="similar to AA sequence:PIR:S37800"
FT                   /protein_id="CAK36895.1"
FT                   /translation="MFARQAFRCAQPLKQGFRKYSTEAPKGKSSLAPIYAAVGITGVGV
FT                   GLYRYNSATAEAPAAVDRPKVFKGGDQGWFDLKLSEIEVLNHNTKRLRFEFEDKEALSG
FT                   LQVASALLTKFKPADAKAVIRPYTPTSDEETPGYIDLVVKVYPNGPMSEHLHSMNVGQR
FT                   LDFKGPIVKYPWETNKHNHICLIAGGTGITPMYQLAREIFKNPEDQTKVTLVFGNVKEE
FT                   DILLKKEFEELENTYPRRFRAFYVLDNPPKEWTGGKGYISKELLKTVLPEPKEENIKIF
FT                   VCGPPGMYKAISGTKNSPTDQGELSGILKELGYSKEQVFKF"
FT   mRNA            complement(join(<230..798,856..930,987..1266,1374..>1418))
FT                   /locus_tag="An01g03570"
FT   exon            complement(230..798)
FT                   /locus_tag="An01g03570"
FT                   /number=1
FT   intron          complement(799..855)
FT                   /locus_tag="An01g03570"
FT                   /number=1
FT   exon            complement(856..930)
FT                   /locus_tag="An01g03570"
FT                   /number=2
FT   intron          complement(931..986)
FT                   /locus_tag="An01g03570"
FT                   /number=2
FT   exon            complement(987..1266)
FT                   /locus_tag="An01g03570"
FT                   /number=3
FT   intron          complement(1267..1373)
FT                   /locus_tag="An01g03570"
FT                   /number=3
FT   exon            complement(1374..1418)
FT                   /locus_tag="An01g03570"
FT                   /number=4
FT   CDS_pept        complement(join(2690..2842,2905..3081,3154..3338,
FT                   3715..3718,3783..3828,4019..4050))
FT                   /locus_tag="An01g03580"
FT                   /note="Remark: alternative names for S. cerevisiae RPL20
FT                   are RPL18A2 and YMR242C."
FT                   /note="Remark: the exon/intron structure of the predicted
FT                   A. niger protein is in accordance with the A. niger ESTs
FT                   an_3214, 0548, 1747, 3000, 3600, 3406, 2063 and 0732."
FT                   /note="Title: strong similarity to cytoplasmic ribosomal
FT                   protein of the large subunit L18a Rpl20 - Saccharomyces
FT                   cerevisiae"
FT                   /note="cytoplasm"
FT                   /note="See PMID 9396790"
FT                   /note="See PMID 9421530"
FT                   /note="See PMID 10404161"
FT                   /db_xref="GOA:A2Q899"
FT                   /db_xref="InterPro:IPR021138"
FT                   /db_xref="InterPro:IPR023573"
FT                   /db_xref="InterPro:IPR028877"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q899"
FT                   /inference="profile:COGS:COG2157"
FT                   /inference="profile:PFAM:PF01775"
FT                   /inference="similar to AA sequence:PIR:S56056"
FT                   /protein_id="CAK36896.1"
FT                   /translation="MKPAADAIGGSRHTSRRLTTTASTIKMGRLTEYQVIGRHLPTEAN
FT                   PTPKLYRMRIFAPNTVVAKSRFWYFLTQLRKVKKANGEIVSINVISEKRPTKVKNFGIW
FT                   LRYDSRSGTHNMYKEFREMSRTEAVEALYQDMAARHRARFGSIHILKVVEIENADSIRR
FT                   PYIKQLLSKNLKFPLPHRAAHGKKLFAYSRPTTFA"
FT   mRNA            complement(join(<2690..2842,2905..3081,3154..3338,
FT                   3715..3718,3783..3828,4019..>4050))
FT                   /locus_tag="An01g03580"
FT   exon            complement(2690..2842)
FT                   /locus_tag="An01g03580"
FT                   /number=1
FT   intron          complement(2843..2904)
FT                   /locus_tag="An01g03580"
FT                   /number=1
FT   exon            complement(2905..3081)
FT                   /locus_tag="An01g03580"
FT                   /number=2
FT   intron          complement(3082..3153)
FT                   /locus_tag="An01g03580"
FT                   /number=2
FT   exon            complement(3154..3338)
FT                   /locus_tag="An01g03580"
FT                   /number=3
FT   intron          complement(3339..3714)
FT                   /locus_tag="An01g03580"
FT                   /number=3
FT   exon            complement(3715..3718)
FT                   /locus_tag="An01g03580"
FT                   /number=4
FT   intron          complement(3719..3782)
FT                   /locus_tag="An01g03580"
FT                   /number=4
FT   exon            complement(3783..3828)
FT                   /locus_tag="An01g03580"
FT                   /number=5
FT   intron          complement(3829..4018)
FT                   /locus_tag="An01g03580"
FT                   /number=5
FT   exon            complement(4019..4050)
FT                   /locus_tag="An01g03580"
FT                   /number=6
FT   CDS_pept        join(4189..4754,4805..5030,5086..5616,5672..5758)
FT                   /locus_tag="An01g03590"
FT                   /EC_number="3.4.-.-"
FT                   /note="Title: strong similarity to peptidase HPEP-6 from
FT                   patent WO200042201-A2 - Homo sapiens"
FT                   /db_xref="GOA:A2Q8A0"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8A0"
FT                   /inference="profile:COGS:COG5600"
FT                   /protein_id="CAK36897.1"
FT                   /translation="MSNIFDDFKEGQKIGSGARLAASLSPVATAEYPDRLKSFYYFSNA
FT                   AHVSADLRYSLFQANGLRLPKQEQNSWVDIFTAYWKAVGEIVRFDDSPRHASWVKVFDA
FT                   WKDTANQLIRGYSTGSLQAWTVPCLYSVGRYLRAFAMKADAELSAQDSVTFDDRFQDDA
FT                   TDAKNPKLEEATRVLNRMFTLCLSDRAPIEESRKWGIYDTTNLLFKTYFKLNTVGLSKN
FT                   LLRALNASSADLPGLDAFPKSHIVTFEYYVGVIHFLDENYAEAEEHLSYAWRMCNKHAT
FT                   KNRESVLHMPPHATLLTTSRLILTYLVPCHLVTTHTLPSKKLLAPFPRLEKLFRPLCDC
FT                   IKRGDLGGFDAAMTAGEEEFVKRRIYLPLERGRDIALRNLFRKVFIAGGFDEPKEGQPP
FT                   IRRTRVPVAEFAAALRIGTHADDRSRIDIDEVECLLSNLIYKGLMKGYIARERGMVVLS
FT                   KGGTAFPGTGV"
FT   mRNA            join(<4189..4754,4805..5030,5086..5616,5672..>5758)
FT                   /locus_tag="An01g03590"
FT   exon            4189..4754
FT                   /locus_tag="An01g03590"
FT                   /number=1
FT   intron          4755..4804
FT                   /locus_tag="An01g03590"
FT                   /number=1
FT   exon            4805..5030
FT                   /locus_tag="An01g03590"
FT                   /number=2
FT   intron          5031..5085
FT                   /locus_tag="An01g03590"
FT                   /number=2
FT   exon            5086..5616
FT                   /locus_tag="An01g03590"
FT                   /number=3
FT   intron          5617..5671
FT                   /locus_tag="An01g03590"
FT                   /number=3
FT   exon            5672..5758
FT                   /locus_tag="An01g03590"
FT                   /number=4
FT   CDS_pept        complement(join(6210..6212,6465..6738,6814..7183,
FT                   7329..7604,7701..7779))
FT                   /locus_tag="An01g03600"
FT                   /note="Title: weak similarity to casein kinase 1 cki1p
FT                   -Schizosaccharomyces pombe"
FT                   /db_xref="GOA:A2Q8A1"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8A1"
FT                   /protein_id="CAK36898.1"
FT                   /translation="MACACGSATPFPETKKALQIGEVKHTWSNSFSPVTSPSPSKFPPL
FT                   QCYPNSNNHSNSRASIALAPEYSPQNAYIPTTQTASPPDTEPEKPNPGLANNLSSHHDV
FT                   SIAADTPLTHPQMEAHKDILCVSPYFAALCNPPNNDVSSSSPSSSPSSSPSPTESMRQI
FT                   DLPDEQPEIFSCVLEYLYRGDYYPRLRHDKTTNTWDLETTPSSSTNTRTTTNNKDTTDP
FT                   NAIIFHPAVGAEILRDTAVYCAAEKYSLEHLKRLALKKQGLHSNIPCHIILSSARYAYM
FT                   HTPDTESKLRAHYLALIIRSRGTFKRSGTMQMEMERGGKLFFDLFVAMCNHM"
FT   mRNA            complement(join(<6210..6212,6465..6738,6814..7183,
FT                   7329..7604,7701..>7779))
FT                   /locus_tag="An01g03600"
FT   exon            complement(6210..6212)
FT                   /locus_tag="An01g03600"
FT                   /number=1
FT   intron          complement(6213..6464)
FT                   /locus_tag="An01g03600"
FT                   /number=1
FT   exon            complement(6465..6738)
FT                   /locus_tag="An01g03600"
FT                   /number=2
FT   intron          complement(6739..6813)
FT                   /locus_tag="An01g03600"
FT                   /number=2
FT   exon            complement(6814..7183)
FT                   /locus_tag="An01g03600"
FT                   /number=3
FT   intron          complement(7184..7328)
FT                   /locus_tag="An01g03600"
FT                   /number=3
FT   exon            complement(7329..7604)
FT                   /locus_tag="An01g03600"
FT                   /number=4
FT   intron          complement(7605..7700)
FT                   /locus_tag="An01g03600"
FT                   /number=4
FT   exon            complement(7701..7779)
FT                   /locus_tag="An01g03600"
FT                   /number=5
FT   CDS_pept        complement(join(8035..8153,8315..8445,8654..8745,
FT                   8932..8976,9035..9802,9861..9988,10059..10179))
FT                   /locus_tag="An01g03610"
FT                   /note="Remark: the Exon-Intron structure of the predicted
FT                   A. niger protein is in accordance with the A. niger ESTs
FT                   an_2008."
FT                   /note="Title: strong similarity to hypothetical zf-C3HC4
FT                   zinc finger protein - Schizosaccharomyces pombe"
FT                   /db_xref="GOA:A2Q8A2"
FT                   /db_xref="InterPro:IPR013144"
FT                   /db_xref="InterPro:IPR024964"
FT                   /db_xref="InterPro:IPR027711"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8A2"
FT                   /inference="profile:COGS:COG5109"
FT                   /inference="similar to AA sequence:PIR:T40074"
FT                   /protein_id="CAK36899.1"
FT                   /translation="MELVQKEHDRLSKKIKAGQGIKNVQSTIDLLQSARDAIAADPSQA
FT                   SITLAKLQNPVKSSFDSINDSLKETHSGLNKYSKSLDKLFKDRPLPSTEHDVLSSQEHL
FT                   INRAIAMHLLREGQFSVASEFLNEMAQKKAMKKQQEGDIEAIDNAASLLDLDEVPPGEV
FT                   RQQFHTMYHILHELKENNNLLPAIQWSRENKEALEARGSNLEFELCRLQFVWLFYGGQH
FT                   QQGPSPGGRQAALEYGRREFHTFLPRYLREVQQLMGAMAFCPNLRDSPYNHIFNNPSAW
FT                   SDVAHSFTREFCSLLGLSADSPLYVAATAGAIALPTLLKLQTIMKAKRTEWTTENELPV
FT                   EIPLPPSYLFHSIFGQFSGYSGSQVQAHLHTAMGVGYTICKQALCDWPSPGDAIGSLHA
FT                   KLSVLKVSLCNSRKQRLLMQPVYTRTRHGATLTWMHRVSAPIAGVDGTKHAGLIRSGAF
FT                   KSPPPNFPP"
FT   mRNA            complement(join(<8035..8153,8315..8445,8654..8745,
FT                   8932..8976,9035..9802,9861..9988,10059..>10179))
FT                   /locus_tag="An01g03610"
FT   exon            complement(8035..8153)
FT                   /locus_tag="An01g03610"
FT                   /number=1
FT   intron          complement(8154..8314)
FT                   /locus_tag="An01g03610"
FT                   /number=1
FT   exon            complement(8315..8445)
FT                   /locus_tag="An01g03610"
FT                   /number=2
FT   intron          complement(8446..8653)
FT                   /locus_tag="An01g03610"
FT                   /number=2
FT   exon            complement(8654..8745)
FT                   /locus_tag="An01g03610"
FT                   /number=3
FT   intron          complement(8746..8931)
FT                   /locus_tag="An01g03610"
FT                   /number=3
FT   exon            complement(8932..8976)
FT                   /locus_tag="An01g03610"
FT                   /number=4
FT   intron          complement(8977..9034)
FT                   /locus_tag="An01g03610"
FT                   /number=4
FT   exon            complement(9035..9802)
FT                   /locus_tag="An01g03610"
FT                   /number=5
FT   intron          complement(9803..9860)
FT                   /locus_tag="An01g03610"
FT                   /number=5
FT   exon            complement(9861..9988)
FT                   /locus_tag="An01g03610"
FT                   /number=6
FT   intron          complement(9989..10058)
FT                   /locus_tag="An01g03610"
FT                   /number=6
FT   exon            complement(10059..10179)
FT                   /locus_tag="An01g03610"
FT                   /number=7
FT   CDS_pept        complement(join(11857..12071,12227..12344,12397..12447,
FT                   12538..12549))
FT                   /locus_tag="An01g03620"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8A3"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8A3"
FT                   /protein_id="CAK36900.1"
FT                   /translation="MPGAQVSIPYRQNTGKRDTTWNTTLHLDQSILHETQLPRCIQPQL
FT                   NRSSALPQGPYGRSRGGQALFSPGLLKGGNSSEKKTNLEYYPDELTNGQQQDCLRTLNR
FT                   LQNLKAWHLFFQKFLPDPKTKESGQTR"
FT   mRNA            complement(join(<11857..12071,12227..12344,12397..12447,
FT                   12538..>12549))
FT                   /locus_tag="An01g03620"
FT   exon            complement(11857..12071)
FT                   /locus_tag="An01g03620"
FT                   /number=1
FT   intron          complement(12072..12226)
FT                   /locus_tag="An01g03620"
FT                   /number=1
FT   exon            complement(12227..12344)
FT                   /locus_tag="An01g03620"
FT                   /number=2
FT   intron          complement(12345..12396)
FT                   /locus_tag="An01g03620"
FT                   /number=2
FT   exon            complement(12397..12447)
FT                   /locus_tag="An01g03620"
FT                   /number=3
FT   intron          complement(12448..12537)
FT                   /locus_tag="An01g03620"
FT                   /number=3
FT   exon            complement(12538..12549)
FT                   /locus_tag="An01g03620"
FT                   /number=4
FT   CDS_pept        join(12916..14194,14311..15482)
FT                   /locus_tag="An01g03630"
FT                   /note="Complex: S. cerevisiae STB1, STB2 and SIN3 are
FT                   components of a large multiprotein complex."
FT                   /note="Complex: in a two-hybrid screen S. cerevisiae STB2
FT                   binds the transcriptional repressor SIN3 which has no DNA
FT                   binding activity."
FT                   /note="Similarity: similarity is between the N-terminal
FT                   halfs of the predicted A. niger protein and S. cerevisiae
FT                   STB2."
FT                   /note="Title: strong similarity to Sin3p binding protein
FT                   Stb2 - Saccharomyces cerevisiae"
FT                   /note="nucleus"
FT                   /note="See PMID 9234741"
FT                   /note="See PMID 9393435"
FT                   /db_xref="GOA:A2Q8A4"
FT                   /db_xref="InterPro:IPR038919"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8A4"
FT                   /inference="similar to AA sequence:PIR:S54553"
FT                   /protein_id="CAK36901.1"
FT                   /translation="MPPPATQTGGQAPPPSITPRELAKHSINTKDVQSTQLVGSEGQSP
FT                   RHGRQRLVFTDPVALRYLEEDNEADLLGRRLTLEGYEAFIVEQWACTRMHPTFIITTYT
FT                   GDPSHKVVVGVLSVPTDESRWSPRMKMYFDAVRQCQARKKETPLGTLMVTDLNEFPLAL
FT                   TLIPVPDGDVLKHKEDFIVNENLKRLGCSGRSGLKLQPPSPATEGKFHHLYRTSEKVPL
FT                   YTAVIELVKQCQIALMMFGNLAPEYVDGLLCDVTEAAINDWWTETGMDLYNIEPSDSML
FT                   GPISVAALLGTLMGARNRLHAFGAPVGKDAFDIDNLTKGIGSFQKSQKLKRTRILDRQT
FT                   LDRLHRVTAKAANAEGWTDAVKSTMAELSGHGGEMVMGMVRGREKGGIADIETLDIDNF
FT                   AHLVTGERAKWLWRGKPRKGGIDDNAQRRPPESASSLDEKDQNLGRLVRKGVSEKVSDA
FT                   RAGFGRFKDAVGLRSHPQKHSRDDIDLGGASTHLSPIDSDTEVSQSKKSDGGAPVGSVD
FT                   VQDHEGQAPKDDSQVESPPRTILPQSPKSRAPAITVETVPSQADSESSRKVSVPRTDDE
FT                   AQDLERWRTLSTDITVDPREQTSEVGIMLLRRPQSCTELNVASDSSRLDNYWPRHLSFS
FT                   TVEEVVLGWKDLGGEAFKEKPDTLLDEAIMQEDILASDARIFSSRIQELSEHTVPWVEQ
FT                   QVSSVDDLSRCLHESREKVNAAYLERLSIFEQMRARSSDLLTEEHSQLTDYMRRVELMG
FT                   AKLDYELHVLDSRVEDVETNLDEFERHVNAIENRVKLLIRGEHEKQDNSWFSWVRRLTG
FT                   CSTQ"
FT   mRNA            join(<12916..14194,14311..>15482)
FT                   /locus_tag="An01g03630"
FT   exon            12916..14194
FT                   /locus_tag="An01g03630"
FT                   /number=1
FT   intron          14195..14310
FT                   /locus_tag="An01g03630"
FT                   /number=1
FT   exon            14311..15482
FT                   /locus_tag="An01g03630"
FT                   /number=2
FT   CDS_pept        complement(join(15865..16048,16170..16267))
FT                   /locus_tag="An01g03640"
FT                   /note="Complex: in S. cerevisiae the TIM10 complex can be
FT                   formed exclusively from Tim9 and Tim10."
FT                   /note="Complex: in S. cerevisiae the TIM10 complex is a
FT                   member of the Tim18p-Tim22p-Tim54p membrane complex."
FT                   /note="Function: the S. cerevisiae TIM10 complex functions
FT                   as a putative chaperone to guide hydrophobic precursors
FT                   across the intermembrane space."
FT                   /note="Function: the S. cerevisiae TIM10 complex is a
FT                   member of the Tim18p-Tim22p-Tim54p membrane complex that
FT                   mediates precursor insertion into the membrane."
FT                   /note="Function: the S. cerevisiae TIM10 complex is
FT                   required for import of the ADP/ATP carrier (AAC) into
FT                   mitochondria."
FT                   /note="Localization: in S. cerevisiae the soluble TIM10
FT                   complex localises in the mitochondrial intermembrane space
FT                   while as part of a larger complex it localises to the
FT                   membrane."
FT                   /note="Remark: an alternative name for S. cerevisiae TIM10
FT                   is MRS11."
FT                   /note="Title: strong similarity to mitochondrial import
FT                   factor Tim10 - Saccharomyces cerevisiae"
FT                   /note="localisation:mitochondrion"
FT                   /note="See PMID 11483513"
FT                   /note="See PMID 11509656"
FT                   /db_xref="GOA:A2Q8A5"
FT                   /db_xref="InterPro:IPR004217"
FT                   /db_xref="InterPro:IPR027100"
FT                   /db_xref="InterPro:IPR035427"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8A5"
FT                   /inference="profile:PFAM:PF02953"
FT                   /inference="similar to AA sequence:PIR:S72314"
FT                   /protein_id="CAK36902.1"
FT                   /translation="MSFLFGGAPKLSSEQKIAAAETEVEMVTDMFSRLTESCIKKCIPN
FT                   DYREGDLNKGESVCIDRCVGKFFEVNMKVSEKMQGEANQKGGMGGFGM"
FT   mRNA            complement(join(<15865..16048,16170..>16267))
FT                   /locus_tag="An01g03640"
FT   exon            complement(15865..16048)
FT                   /locus_tag="An01g03640"
FT                   /number=1
FT   intron          complement(16049..16169)
FT                   /locus_tag="An01g03640"
FT                   /number=1
FT   exon            complement(16170..16267)
FT                   /locus_tag="An01g03640"
FT                   /number=2
FT   CDS_pept        join(16619..16677,16906..17195,17255..17419,17477..17902,
FT                   17954..18771)
FT                   /locus_tag="An01g03650"
FT                   /EC_number="6.1.1.6"
FT                   /note="Catalytic activity: lysine-tRNA ligase convert ATP +
FT                   L-lysine + tRNA(Lys) to AMP + diphosphate +
FT                   L-lysyl-tRNA(Lys)."
FT                   /note="Title: strong similarity to cytosolic lysine--tRNA
FT                   ligase Krs1 - Saccharomyces cerevisiae"
FT                   /note="cytoplasm"
FT                   /note="See PMID 2903861"
FT                   /db_xref="GOA:A2Q8A6"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8A6"
FT                   /inference="profile:COGS:COG1190"
FT                   /inference="profile:PFAM:PF00152"
FT                   /inference="profile:PFAM:PF01336"
FT                   /inference="similar to AA sequence:UniProtKB:SCKRS1.1"
FT                   /protein_id="CAK36903.1"
FT                   /translation="MQPIRPFRASSLRVGGLLSRAGLPISRTSQAFQTSGRLARVIQHT
FT                   LAPLVQTRHNSVDAYPEKAFKRRVQLIEEAVAESYPRLASNKNTVSCAEFRGRYSHLAD
FT                   NEIVEDDTVVINGRVRTLRLVGGNLIFFDLVHDGHKIQVMCNRRRLKDIPPATFKQFYR
FT                   MLRRGDAFSVTGNPHRTERGELTVLATELPQLLSPCLHDIPVDAQGQENSPYPRHVQFL
FT                   ADPETVNVIRARSAVVQYLRQFFVDRAFMEVNTPIIEAVAGGAIARPFHTTATEFPDRQ
FT                   LSLRIAPELWLKRLVVGGFDRVFEIGPSFRNEGLDKTHNPEFTTCEFYHAYANLEDLMT
FT                   TTEQLLSGLAEHLTAFHQSSPFKRPNQEDTPLPFSHLNFSAPFRRLDFITSIEQSIGQK
FT                   LPDLASPDALEQVKAIFRDRNHALPDKVTLPRLLDELCSIYVEPQCIDPTFIVNPPECL
FT                   SPLSKSFIHPTTNQRVAARGELFIEGREVVNTYEEENSPFEQRRKFEDQVRYSKQADEA
FT                   EEIDESYLKALEWGLPPTGGWGCGIDRLCMLFTGMTRIGDILPFGNLRKVTTRADAAAE
FT                   SQATEGKEN"
FT   mRNA            join(<16619..16677,16906..17195,17255..17419,17477..17902,
FT                   17954..>18771)
FT                   /locus_tag="An01g03650"
FT   exon            16619..16677
FT                   /locus_tag="An01g03650"
FT                   /number=1
FT   intron          16678..16905
FT                   /locus_tag="An01g03650"
FT                   /number=1
FT   exon            16906..17195
FT                   /locus_tag="An01g03650"
FT                   /number=2
FT   intron          17196..17254
FT                   /locus_tag="An01g03650"
FT                   /number=2
FT   exon            17255..17419
FT                   /locus_tag="An01g03650"
FT                   /number=3
FT   intron          17420..17476
FT                   /locus_tag="An01g03650"
FT                   /number=3
FT   exon            17477..17902
FT                   /locus_tag="An01g03650"
FT                   /number=4
FT   intron          17903..17953
FT                   /locus_tag="An01g03650"
FT                   /number=4
FT   exon            17954..18771
FT                   /locus_tag="An01g03650"
FT                   /number=5
FT   CDS_pept        join(19276..19339,19453..20212,20316..20340)
FT                   /locus_tag="An01g03660"
FT                   /note="Similarity: the ORF shows strong similarity to EST
FT                   5419 - Aspergillus oryzae."
FT                   /note="Title: similarity to hypothetical protein T9E8.140
FT                   -Arabidopsis thaliana"
FT                   /db_xref="GOA:A2Q8A7"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8A7"
FT                   /inference="similar to AA sequence:PIR:T06297"
FT                   /protein_id="CAK36904.1"
FT                   /translation="MALDDIPVAQAVTVSLQELIDGTISPQTLTAAFGPFSLGIILVKD
FT                   LPPTFSHLRAQVLSNASYLASLPPSALDSLTCPSAKYLIGWSLGKETLRDGHYDTHKGS
FT                   YYLNCAFYKDPSLQGAPSIDTEFPEYTSPNIWPSETDLPTFRSSFEQLCTLIIDTAALV
FT                   ARACDRFAVESVDGYKDGYLEKVVRGSFTTKARLLHYFPTEDSSSSTESTGGEEGAEDN
FT                   DDDWCATHLDHGCLTGLTSAMFVDEEAHDPSSLEDKSAPLPELTTSPDPKAGFSALCRI
FT                   S"
FT   mRNA            join(<19276..19339,19453..20212,20316..>20340)
FT                   /locus_tag="An01g03660"
FT   exon            19276..19339
FT                   /locus_tag="An01g03660"
FT                   /number=1
FT   intron          19340..19452
FT                   /locus_tag="An01g03660"
FT                   /number=1
FT   exon            19453..20212
FT                   /locus_tag="An01g03660"
FT                   /number=2
FT   intron          20213..20315
FT                   /locus_tag="An01g03660"
FT                   /number=2
FT   exon            20316..20340
FT                   /locus_tag="An01g03660"
FT                   /number=3
FT   CDS_pept        complement(join(20568..22486,22553..22828,23122..23314))
FT                   /locus_tag="An01g03670"
FT                   /note="Similarity: the similarities are mainly due to
FT                   repetetive sequences."
FT                   /note="Title: strong similarity to hypothetical protein
FT                   EAA66525.1 - Aspergillus nidulans"
FT                   /db_xref="GOA:A2Q8A8"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="InterPro:IPR018839"
FT                   /db_xref="InterPro:IPR031915"
FT                   /db_xref="InterPro:IPR038986"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8A8"
FT                   /inference="profile:COGS:COG0532"
FT                   /inference="profile:COGS:COG4547"
FT                   /inference="similar to AA sequence:UniProtKB:SCZ86109.1"
FT                   /protein_id="CAK36905.1"
FT                   /translation="MSVIMQDSSASDQQKMVVIPINRAFSDGTQDNWPKDERFLRPDDS
FT                   YYREKLASMWLQKTGAYERGVEYILDSLPDGYALFDRPRMANPDIVGFSRSTPKRIHIP
FT                   NSLQYDRFLYGHPTDVYFNSTKQFFPHFYYLMTGGQEPCACVLCEKMSKRLQEKRGPGR
FT                   PRGRPSGTGTLIRTPGRPPGRPPGRPPGSSASKTPGRPPGRPPGRPGRPPGRPPGRPPG
FT                   RPPGKLSGSATCPCTDNEGTPDVFKMAVLQLELKGLQETDITEPGSMDWRAERSPLDEY
FT                   IQKLDLQPSFLPRAGEIVLWTPDFEGELAWNPENNQIQIYFPSEKRWLGTPEWRAGIVS
FT                   QVPEEDTIFQDIVQTSPKEQSINYSGFRVETFPDPHSPDKSYSLHYKYVYLKSIKPFNA
FT                   YEHFLQNIPRENLHPSIEYAMTIMSSFSLLDKYHFKGVWPDASIYSRGIFIGAELLTVG
FT                   DAVRLKPQNYNLNSPHSTPNPAVTDIMVIDEIRLDLKNCDSALRSKHLAEKYIVRIRGK
FT                   VYTPSDRRIYLSSNTLHPIKPLTPDEVVSAFNYVGMSGYGDWYRMHPGASVDISQDMIL
FT                   GRLYEPDALQLMFGSLALGYDLQGVLRGRVYSRQADERIPEGQKWFWGDFRTQTLAIDS
FT                   LNGEDVGHYSDARDVKMWRANLRVLDGVARPADFREAKIPGDVGRPSTKSRSNFAKVGK
FT                   LSKLVSTGLGSADLSNPVSEAEEGTSRLSVGDDDEEEEEEEEEEEEEEEEEEEEEEESE
FT                   EEEEDFTLRMDQLRGGTEETEEGNYMPDKERERERKRVRHDD"
FT   mRNA            complement(join(<20568..22486,22553..22828,23122..>23314))
FT                   /locus_tag="An01g03670"
FT   exon            complement(20568..22486)
FT                   /locus_tag="An01g03670"
FT                   /number=1
FT   intron          complement(22487..22552)
FT                   /locus_tag="An01g03670"
FT                   /number=1
FT   exon            complement(22553..22828)
FT                   /locus_tag="An01g03670"
FT                   /number=2
FT   intron          complement(22829..23121)
FT                   /locus_tag="An01g03670"
FT                   /number=2
FT   exon            complement(23122..23314)
FT                   /locus_tag="An01g03670"
FT                   /number=3
FT   exon            complement(23779..26235)
FT                   /locus_tag="An01g03680"
FT                   /number=1
FT   CDS_pept        complement(23779..26235)
FT                   /locus_tag="An01g03680"
FT                   /note="Complex: mouse ALDR must form a homo- or heterodimer
FT                   to be functional."
FT                   /note="Similarity: mouse ALDR is a ABC half transporter
FT                   containing one transmembrane domain and a single
FT                   ATP-binding fold while functional ABC-tansporter comprise
FT                   two transmembrane and two ATP-binding domains."
FT                   /note="Title: strong similarity to peroxisomal ABC
FT                   transporter ALDR - Mus musculus"
FT                   /note="peroxisome"
FT                   /note="See PMID 8577752"
FT                   /note="See PMID 10504404"
FT                   /db_xref="GOA:A2Q8A9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8A9"
FT                   /inference="profile:COGS:COG1132"
FT                   /inference="profile:COGS:COG2274"
FT                   /inference="profile:PFAM:PF00005"
FT                   /protein_id="CAK36906.1"
FT                   /translation="MAAHSTLRRREDPLVALYNKYASLVRSRIKRSSKTTQIIATIALI
FT                   LSILGSGYGGYKWFRERAKERARGRQLLRRNSGIRGKDGTRTIYVPYKGSMTSKVVIHP
FT                   TKQTTFDAHRRLFLNPPAAARVGDGESVNQIPPPTTKPGINLAFLHQFLSLGSIMVPRW
FT                   GSKETGLLMGHGVFLLLRTYLSLLIARLDGEIVRDLVAGKGRAFAWGILKWCGIGTLAS
FT                   YTNAMIKFLQSKVSIAFRTRLTRYIHDLYLTGDNNYYKLMNLDGGVGQGPDQFITQDLT
FT                   LFCSAAAALYSSMGKPMVDLFVFNYQLYRSLGPLALTGILTGYFSTAAVLRKLSPPFGK
FT                   LKAVEGKKEGDFRGLHSRLLANAEEISFYGGADIERVFLMRSFKDLQRWMEGIYSLKIR
FT                   YNMLEDVILKYAWSAFGYLITSLPIFLPAWGGMGGALELVDVPKETGRERDRMKEFITN
FT                   KRLMLSLADAGGRMMYSIKDISELAGYTSRVYSLISTLHRVHASAYYPPRNSHAELYSL
FT                   ADVQGTIHNGFDGVRLEQVPIVAPSIYPRGGDDLIESLSFVVHSGDHLLISGPNGVGKT
FT                   AIARVVSGLWPVYRGLVSRPRGFGLDGIMFLPQRPYLSVGTLRDQVIYPHTAVDMHEAG
FT                   ITDAALQKILDDAHLGYLPGREGGWDTRKEWKDVLSGGEKQRMALARIYYHEPRYAFLD
FT                   EGTSAVSSDVEGLLYQRAKERGITVITISTRASLKKYHTYNLSISIGEEGEQWEFERIG
FT                   TAKEKLGVEKELQEIRKRLDKVEEWKQRREEIENELRKVWVEEGELAPPPYGSESEAVE
FT                   VQDDQQ"
FT   mRNA            complement(<23779..>26235)
FT                   /locus_tag="An01g03680"
FT   CDS_pept        complement(join(28976..29068,29164..29277,29365..29577,
FT                   29623..29689,30137..30169,30283..30381,30704..30737,
FT                   30834..31236))
FT                   /locus_tag="An01g03690"
FT                   /note="Title: weak similarity to toxin subunit 1 TOX S1
FT                   -Bordetella pertussis"
FT                   /note="See PMID 2873570"
FT                   /db_xref="GOA:A2Q8B0"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8B0"
FT                   /inference="similar to AA sequence:UniProtKB:BPA006151.1"
FT                   /protein_id="CAK36907.1"
FT                   /translation="MTTRVTAEKGREGGCAGKEDEERERGCSHASWLFARTEWMGWRQV
FT                   TKVVVPVSCLALGPGPPPGIRLVRSTKKNSFAMSRSNQSALQCPEYTGRQTSIKAYATG
FT                   TIWRSSLGMIAGMEGFERVKCRLFESRGSRGKGHRSDSPVDGRDERQGSTEVKGNQPRC
FT                   GGVLMWSSKPVDDSGEELAEEYAEPEGAAELGPDTLRTATTGWSSIGTEMPRTLKFARP
FT                   DYPPLEPVNHYEVCRTNLSLPAPMVMVNHAPQRIQINYYCTDMWMIRIPAGSPILHLIQ
FT                   TDPSTRGHPEHVPTREQAYAVLCSSRTQLEISPKLGEVMKGPCSSFIPRALLGRIGGSQ
FT                   ESRWSQPPLTR"
FT   mRNA            complement(join(<28976..29068,29164..29277,29365..29577,
FT                   29623..29689,30137..30169,30283..30381,30704..30737,
FT                   30834..>31236))
FT                   /locus_tag="An01g03690"
FT   exon            complement(28976..29068)
FT                   /locus_tag="An01g03690"
FT                   /number=1
FT   intron          complement(29069..29163)
FT                   /locus_tag="An01g03690"
FT                   /number=1
FT   exon            complement(29164..29277)
FT                   /locus_tag="An01g03690"
FT                   /number=2
FT   intron          complement(29278..29364)
FT                   /locus_tag="An01g03690"
FT                   /number=2
FT   exon            complement(29365..29577)
FT                   /locus_tag="An01g03690"
FT                   /number=3
FT   intron          complement(29578..29622)
FT                   /locus_tag="An01g03690"
FT                   /number=3
FT   exon            complement(29623..29689)
FT                   /locus_tag="An01g03690"
FT                   /number=4
FT   intron          complement(29690..30136)
FT                   /locus_tag="An01g03690"
FT                   /number=4
FT   exon            complement(30137..30169)
FT                   /locus_tag="An01g03690"
FT                   /number=5
FT   intron          complement(30170..30282)
FT                   /locus_tag="An01g03690"
FT                   /number=5
FT   exon            complement(30283..30381)
FT                   /locus_tag="An01g03690"
FT                   /number=6
FT   intron          complement(30382..30703)
FT                   /locus_tag="An01g03690"
FT                   /number=6
FT   exon            complement(30704..30737)
FT                   /locus_tag="An01g03690"
FT                   /number=7
FT   intron          complement(30738..30833)
FT                   /locus_tag="An01g03690"
FT                   /number=7
FT   exon            complement(30834..31236)
FT                   /locus_tag="An01g03690"
FT                   /number=8
FT   CDS_pept        join(31356..31455,31553..32748,32800..32949,33005..33103,
FT                   33161..33373)
FT                   /locus_tag="An01g03700"
FT                   /note="Function: PSR1 of S. cerevisiae is a membrane-linked
FT                   protein phosphatase involved in response to sodium
FT                   stress,together with the homologue PSR2."
FT                   /note="Phenotype: growth of the PSR1/PSR2 mutant is
FT                   severely inhibited under conditions of sodium stress, due
FT                   to the inability to properly induce transcription of
FT                   ENA1/PMR2, the major sodium extrusion pump of yeast cells."
FT                   /note="Remark: PSR1 of S. cerevisiae is also called
FT                   YLL010c."
FT                   /note="Similarity: the N-terminal region of the predicted
FT                   ORF shows no significant similarity."
FT                   /note="Title: strong similarity to phosphatase Psr1
FT                   -Saccharomyces cerevisiae"
FT                   /note="plasma membrane"
FT                   /note="See PMID 10777497"
FT                   /db_xref="GOA:A2Q8B1"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR011948"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8B1"
FT                   /inference="profile:COGS:COG5190"
FT                   /inference="profile:PFAM:PF03031"
FT                   /protein_id="CAK36908.1"
FT                   /translation="MLGGSLERDSSPSNSKPTTGEAPMPIATSPPDSNPEPSPQDQPAT
FT                   TDASPLSNNVEPTNAAQESVAPAQGSVDESAATSADAPKKHHLLLPISSRASLKADRQS
FT                   TLDKSQDTAHDDSENTLRGSKRSIFKGRRDRSRGSSMRSRRQNQEGASMEEDKSASPDL
FT                   RDPAKPERRSKVSYRLFAFLSCCSSPSDDSEDPAIPVKRTSRQPSVPHTQATPEKADAN
FT                   AGDSSTAESKDPSYYRDEKPNMTVTSNQSMSQVDEERTVTTSEQGAQLDGATVPSGPAE
FT                   TEKVPALPQDSADSQGLGVGQSTQPSTTTAEASAVASEAEEPSQKTEEQIISTSTEKAQ
FT                   DTPTAPIELDELPKPPASENSYDDEKYTSHDEEATVLPAELPPPTGPSGHHVDTMLEET
FT                   QQQFLLPPPLPHLRDRKCLVLDLDETLVHSSFKVLERADFTIPVEIEGQYHNIYVIKRP
FT                   GVDQFMKRVGELYEVVVFTASVSKYGDPLLDQLDIHNVVHHRLFRDSCYNHQGNYVKDL
FT                   SQVGRDLRDTIIIDNSPTSYIFHPQHAIPISSWFSDAHDNELLDLIPVLEDLAGAQVKD
FT                   VSLVLDIAL"
FT   mRNA            join(<31356..31455,31553..32748,32800..32949,33005..33103,
FT                   33161..>33373)
FT                   /locus_tag="An01g03700"
FT   exon            31356..31455
FT                   /locus_tag="An01g03700"
FT                   /number=1
FT   intron          31456..31552
FT                   /locus_tag="An01g03700"
FT                   /number=1
FT   exon            31553..32748
FT                   /locus_tag="An01g03700"
FT                   /number=2
FT   intron          32749..32799
FT                   /locus_tag="An01g03700"
FT                   /number=2
FT   exon            32800..32949
FT                   /locus_tag="An01g03700"
FT                   /number=3
FT   intron          32950..33004
FT                   /locus_tag="An01g03700"
FT                   /number=3
FT   exon            33005..33103
FT                   /locus_tag="An01g03700"
FT                   /number=4
FT   intron          33104..33160
FT                   /locus_tag="An01g03700"
FT                   /number=4
FT   exon            33161..33373
FT                   /locus_tag="An01g03700"
FT                   /number=5
FT   CDS_pept        complement(join(33629..33795,33826..33883))
FT                   /locus_tag="An01g03710"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8B2"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8B2"
FT                   /protein_id="CAK36909.1"
FT                   /translation="METMKGTKSRKRQMKEKRESKFWLMTKTDACGMQQERKLQTLGNK
FT                   TGGGNLVSARWERKNMAGARKKNGASDMG"
FT   mRNA            complement(join(<33629..33795,33826..>33883))
FT                   /locus_tag="An01g03710"
FT   exon            complement(33629..33795)
FT                   /locus_tag="An01g03710"
FT                   /number=1
FT   intron          complement(33796..33825)
FT                   /locus_tag="An01g03710"
FT                   /number=1
FT   exon            complement(33826..33883)
FT                   /locus_tag="An01g03710"
FT                   /number=2
FT   CDS_pept        join(34708..34843,34938..34969,35046..35117,35187..35483,
FT                   35540..35614,35683..36085,36146..36165)
FT                   /locus_tag="An01g03720"
FT                   /note="Function: SDS22 of S. cerevisiae is essential for
FT                   the mitotic metaphase/anaphase transition, positively
FT                   modulating protein phosphatase-1."
FT                   /note="Remark: SDS22 of S. cerevisiae is also called EGP1
FT                   or YKL193c."
FT                   /note="Title: strong similarity to protein phosphatase
FT                   type1 regulatory subunit Sds22 - Saccharomyces cerevisiae"
FT                   /note="nucleus"
FT                   /note="See PMID 9584086"
FT                   /note="See PMID 10775415"
FT                   /note="See PMID 7791784"
FT                   /note="See PMID 7791785"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR025875"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8B3"
FT                   /inference="profile:COGS:COG4886"
FT                   /inference="similar to AA sequence:PIR:S38030"
FT                   /protein_id="CAK36910.1"
FT                   /translation="MKDKNGWDGKLRVEPKATITNPEALEDPDYSDSDAPPVEEIEADE
FT                   DLLEDEDPDAEEIDLVHCRITSIPALRLERFPKVKRLCFRQNQISRIEFPTEVAKSLTE
FT                   LDLYDNLISHVKGLDEFENLTSLDLSFNKIKHVKNISHLVKLTDLYFVQNKISKIEGVE
FT                   TFTSLRNLELGANRIREIENLDNLKALEELWLGKNKITELKNLDGLSNLRILSIQSNRL
FT                   TKISGLANLKNLEELYVSHNAITDLSGLEENTSLRVLDFSNNQVSKLEHLSHLKNLEEL
FT                   WASNNQLSSFDEVERELRDKENLQTVYFEGNPLQTRAPALYRNKVRLAIPHIMQVDATY
FT                   IRVV"
FT   mRNA            join(<34708..34843,34938..34969,35046..35117,35187..35483,
FT                   35540..35614,35683..36085,36146..>36165)
FT                   /locus_tag="An01g03720"
FT   exon            34708..34843
FT                   /locus_tag="An01g03720"
FT                   /number=1
FT   intron          34844..34937
FT                   /locus_tag="An01g03720"
FT                   /number=1
FT   exon            34938..34969
FT                   /locus_tag="An01g03720"
FT                   /number=2
FT   intron          34970..35045
FT                   /locus_tag="An01g03720"
FT                   /number=2
FT   exon            35046..35117
FT                   /locus_tag="An01g03720"
FT                   /number=3
FT   intron          35118..35186
FT                   /locus_tag="An01g03720"
FT                   /number=3
FT   exon            35187..35483
FT                   /locus_tag="An01g03720"
FT                   /number=4
FT   intron          35484..35539
FT                   /locus_tag="An01g03720"
FT                   /number=4
FT   exon            35540..35614
FT                   /locus_tag="An01g03720"
FT                   /number=5
FT   intron          35615..35682
FT                   /locus_tag="An01g03720"
FT                   /number=5
FT   exon            35683..36085
FT                   /locus_tag="An01g03720"
FT                   /number=6
FT   intron          36086..36145
FT                   /locus_tag="An01g03720"
FT                   /number=6
FT   exon            36146..36165
FT                   /locus_tag="An01g03720"
FT                   /number=7
FT   CDS_pept        complement(join(36383..36940,37015..37146))
FT                   /locus_tag="An01g03730"
FT                   /note="Remark: the gene model was extracted to fill an
FT                   intergenic region; the N-terminal part of the predicted ORF
FT                   overlaps to the 3'UTR of the A. niger xyrA gene."
FT                   /note="Title: questionable ORF"
FT                   /db_xref="GOA:A2Q8B4"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8B4"
FT                   /protein_id="CAK36911.1"
FT                   /translation="MTLKPLTSSIHIKTHPAPRSLSESKLILSALQKFGEVVTFRNLKY
FT                   DPTNTSPKSAHNTIAIFESASAASSAIAASPISIPIQNQTQTQTQTQTQTQSQDESPSN
FT                   ANHTASPATQSQETTQQPHTLTCTIQPSRHNHVSAMTRNPYHTFFYVDKESHMYKDLVK
FT                   SGIPLDYLADGPMRRKAHVPERVKRMLDRDVWRFGGKSLMGLYRFGMESENGKESGNGD
FT                   GEDEGTK"
FT   mRNA            complement(join(<36383..36940,37015..>37146))
FT                   /locus_tag="An01g03730"
FT   exon            complement(36383..36940)
FT                   /locus_tag="An01g03730"
FT                   /number=1
FT   intron          complement(36941..37014)
FT                   /locus_tag="An01g03730"
FT                   /number=1
FT   exon            complement(37015..37146)
FT                   /locus_tag="An01g03730"
FT                   /number=2
FT   CDS_pept        complement(join(37401..37427,37489..38276,38338..38482))
FT                   /gene="xyrA"
FT                   /locus_tag="An01g03740"
FT                   /product="D-xylose reductase xyrA-Aspergillus niger"
FT                   /EC_number="1.1.1.-"
FT                   /note="Function: D-xylose reductase catalyses the
FT                   NADPH-dependent reduction of D-xylose to xylitol, which is
FT                   the first step in D-xylose catabolism in fungi."
FT                   /note="Gene-ID: xyrA"
FT                   /note="Induction: xyrA is under the transcriptional control
FT                   of XlnR, a major transcription factor involved in the
FT                   degradation of the polysaccharides xylan and cellulose."
FT                   /note="See PMID 10760176"
FT                   /db_xref="GOA:A2Q8B5"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2Q8B5"
FT                   /inference="profile:COGS:COG0656"
FT                   /inference="profile:PFAM:PF00248"
FT                   /inference="similar to AA sequence:UniProtKB:AF219625.1"
FT                   /protein_id="CAK36912.1"
FT                   /translation="MASPTVKLNSGYDMPLVGFGLWKVNNDTCADQIYHAIKEGYRLFD
FT                   GACDYGNEVEAGQGIARAIKDGLVKREELFIVSKLWNSFHDGDRVEPICRKQLADWGID
FT                   YFDLYIVHFPISLKYVDPAVRYPPGWKSEKDELEFGNATIQETWTAMESLVDKKLARSI
FT                   GISNFSAQLVMDLLRYARIRPATLQIEHHPYLTQTRLVEYAQKEGLTVTAYSSFGPLSF
FT                   LELSVQNAVDSPPLFEHQLVKSIAEKHGRTPAQVLLRWATQRGIAVIPKSNNPQRLKQN
FT                   LDVTGWNLEEEEIKAISGLDRGLRFNDPLGYGLYAPIF"
FT   mRNA            complement(join(<37401..37427,37489..38276,38338..>38482))
FT                   /gene="xyrA"
FT                   /locus_tag="An01g03740"
FT   exon            complement(37401..37427)
FT                   /gene="xyrA"
FT                   /locus_tag="An01g03740"
FT                   /number=1
FT   intron          complement(37428..37488)
FT                   /gene="xyrA"
FT                   /locus_tag="An01g03740"
FT                   /number=1
FT   exon            complement(37489..38276)
FT                   /gene="xyrA"
FT                   /locus_tag="An01g03740"
FT                   /number=2
FT   intron          complement(38277..38337)
FT                   /gene="xyrA"
FT                   /locus_tag="An01g03740"
FT                   /number=2
FT   exon            complement(38338..38482)
FT                   /gene="xyrA"
FT                   /locus_tag="An01g03740"
FT                   /number=3
FT   CDS_pept        complement(join(39026..40773,40830..41006,41060..41498))
FT                   /locus_tag="An01g03750"
FT                   /note="Function: A. nidulans brlA, abaA, and wetA form a
FT                   dependent pathway that regulates asexual reproductive
FT                   development."
FT                   /note="Function: in A. nidulans, expression of abaA in
FT                   vegetative cells does not result in conidial
FT                   differentiation but does lead to activation of brlA and
FT                   wetA, cessation of vegetative growth, and accentuated
FT                   cellular vacuolization."
FT                   /note="Title: strong similarity to protein abaA
FT                   -Aspergillus nidulans"
FT                   /note="See PMID 2655931"
FT                   /db_xref="GOA:A2Q8B6"
FT                   /db_xref="InterPro:IPR000818"
FT                   /db_xref="InterPro:IPR038096"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8B6"
FT                   /inference="profile:PFAM:PF01285"
FT                   /inference="similar to AA sequence:PIR:A32434"
FT                   /protein_id="CAK36913.1"
FT                   /translation="MAHWQTGCIVPQHQSALESIGAHTDRALQNTSGNVQTYSDNLADS
FT                   STVGRDDQLQQLAFKYPQPPVPTHPVPTVPTTLQPPQNLRLQSKKLRRLHLSGPSLIGP
FT                   RSRPRSYLRSSKYLEYRSRPRRDTGKDGEPVWSDELEDAFQQALEANPPMGRRKWSERG
FT                   KSYGRNELIAEFIYKKTGKRRTRKQVSSHLQVLDSFLKGDPDWERLVREEANVRSNNQH
FT                   PPAGPRWGPAMDPPLSSHYGTHLHPTYHDPMRQAYGGDLPPTPFSMNASWPESNFSTIQ
FT                   GLGFGMWVNEPDKNDRIEDASHIYSRLQDDQRHPVAPISLNEIRNWQTSFPYLNSLMAN
FT                   SNGSLDCDIILIEANLKLMDDFPAARSKLGIHLELDFAQASAAGVPILSEMENWSSKIY
FT                   MYENGQEIYQGRQEVARPVHTATHTKVKPHFESKWWANRFTKLTQDQKMAEDAGHHGHE
FT                   QAREFLRHLTVVQEIRAMAPYSSRRMSNPYSGHAVSEKKRVAIILWKFRQTLPRDVVGT
FT                   TTWRRVVSSDRIPHASPKAATGIDLPPPMSLADSILLNRPGPSVYHQPQSHELLHNHGV
FT                   SQNPWPLYSTGQESVAQMFNAPFDFMSPLKQEDRLNDKIAVTLGLDAFPSLQSHDINQQ
FT                   TSLNGPNSGTSILSMSEVPLSHSTHGPYSLEHDSHYVHSQPLGVNVHDNNALLNGMLVT
FT                   SAQSIDDINNSQASWMPPTTAMSGDIPGSHYPHMGYPSSEHHVAVPREPNPSHSYDFMP
FT                   EELDKWPGSLPTDMNGGAHEHAHSYTASNTVQAV"
FT   mRNA            complement(join(<39026..40773,40830..41006,41060..>41498))
FT                   /locus_tag="An01g03750"
FT   exon            complement(39026..40773)
FT                   /locus_tag="An01g03750"
FT                   /number=1
FT   intron          complement(40774..40829)
FT                   /locus_tag="An01g03750"
FT                   /number=1
FT   exon            complement(40830..41006)
FT                   /locus_tag="An01g03750"
FT                   /number=2
FT   intron          complement(41007..41059)
FT                   /locus_tag="An01g03750"
FT                   /number=2
FT   exon            complement(41060..41498)
FT                   /locus_tag="An01g03750"
FT                   /number=3
FT   CDS_pept        complement(join(42482..43699,43750..44022,44235..44993,
FT                   45089..45316))
FT                   /locus_tag="An01g03760"
FT                   /note="Similarity: the presence of RNA binding domains
FT                   suggests a role in RNA processing."
FT                   /note="Title: strong similarity to hypothetical protein
FT                   pi029 - Schizosaccharomyces pombe"
FT                   /db_xref="GOA:A2Q8B7"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034482"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8B7"
FT                   /inference="profile:COGS:COG0724"
FT                   /inference="profile:PFAM:PF00076"
FT                   /inference="similar to AA sequence:UniProtKB:SPAB4535.15"
FT                   /protein_id="CAK36914.1"
FT                   /translation="MESTRVFVSGLPPTLSDDQLRKHFATRFQVTDAHVLPKRRIGFVG
FT                   FKSHEVAQQAVSYFNKTYVKMSKISVDIAKPIDAEPTRKAGKHDKSSASNAADTSLKRK
FT                   RDGENAPQDARLQEYLSVMQHSSKTKTWANDDVPKPPENDSPAEQPAEVEEQPQELTYA
FT                   QRKKAKLGEEYDHSKEMHTADREAHGSPEPMVVDHSGEGNAEAPAEQDDTVAEAEAPAV
FT                   SDADWLRSKTSRLLGLLDEEEQADFDAAAQQKESAAPEEAEDPGADSRDAQIVAPAATE
FT                   DKTVQEPQVDTNIENIRLSARLFVRNLAYDTSESDLEPLFAPFGRIEEIHVAFDTRVNT
FT                   SKGFAYIQYLDADAAVEAYKNLDGKHFQGRLMHILPAAAKKTYKIDDAELAKLPLKKQK
FT                   QIKKKMDASSSTFSWNSLYMNTDAVMSSVAERLGVSKADLLDPTSSDAAVKQAHAETHV
FT                   IQETKAYFSANGVNIEAFKQRERGNTAILVKNFSYGVKTDELRKMFEPFGQITRLLMPP
FT                   SGTIAIVEFSRPDEAQKAFKGLAYRKLGDSILFLEKAPKDLFDAAVVPQKATIETKAVS
FT                   QGFSTADTFAADEVDDLTPTTTLFVKNLNFATTNQSFVDLFRPLDGFVSAKIKTKPDPK
FT                   HPGQTLSMGFGFVEFRSKAQAQSALAAMNGYKLDQHELVVRVSHRGMDAAEERRREDTA
FT                   KKVAARRTKIIIKNLPFQATKKDVRSLFGAYGQLRSVRVPQKFDRSARGFGFADFVSAR
FT                   EAENAMDALKNTHLLGRKLVLEFANEEAIDAEEEIKQIEKKVGEQMDRVKLQKLAGPGR
FT                   KKFTVGAQDGEED"
FT   mRNA            complement(join(<42482..43699,43750..44022,44235..44993,
FT                   45089..>45316))
FT                   /locus_tag="An01g03760"
FT   exon            complement(42482..43699)
FT                   /locus_tag="An01g03760"
FT                   /number=1
FT   intron          complement(43700..43749)
FT                   /locus_tag="An01g03760"
FT                   /number=1
FT   exon            complement(43750..44022)
FT                   /locus_tag="An01g03760"
FT                   /number=2
FT   intron          complement(44023..44234)
FT                   /locus_tag="An01g03760"
FT                   /number=2
FT   exon            complement(44235..44993)
FT                   /locus_tag="An01g03760"
FT                   /number=3
FT   intron          complement(44994..45088)
FT                   /locus_tag="An01g03760"
FT                   /number=3
FT   exon            complement(45089..45316)
FT                   /locus_tag="An01g03760"
FT                   /number=4
FT   CDS_pept        join(45606..45636,45688..45710,45761..45794,45848..45882,
FT                   45928..45954,46007..46076,46126..46190)
FT                   /locus_tag="An01g03770"
FT                   /note="Complex: dynein consists of at least two heavy
FT                   chains and a number of intermediate and light chains."
FT                   /note="Function: dynein is involved in intracellular
FT                   transport and motility, and plays a role in changing or
FT                   maintaining the spatial distribution of cytoskeletal
FT                   structures."
FT                   /note="Similarity: the predicted ORF is almost identical to
FT                   the 8 kDa cytoplasmic dynein light chain NUDG of
FT                   Aspergillus nidulans, whose characterization has not been
FT                   published."
FT                   /note="Title: strong similarity to dynein light chain 1
FT                   cdlc1 - Drosophila melanogaster"
FT                   /note="See PMID 8628263"
FT                   /note="See PMID 11212346"
FT                   /db_xref="GOA:A2Q8B8"
FT                   /db_xref="InterPro:IPR001372"
FT                   /db_xref="InterPro:IPR019763"
FT                   /db_xref="InterPro:IPR037177"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8B8"
FT                   /inference="profile:PFAM:PF01221"
FT                   /inference="similar to AA sequence:SWISSPROT:DYL1.DROME"
FT                   /protein_id="CAK36915.1"
FT                   /translation="MASEKKDKLEAQIKSVDMTEDMQQEAVEVAIEAMDKYHIEKDIAQ
FT                   YIKREFDSRKGATWHCVVGRNFGSFVTHETKHFIYFYLGHCAILLFKTQ"
FT   mRNA            join(<45606..45636,45688..45710,45761..45794,45848..45882,
FT                   45928..45954,46007..46076,46126..>46190)
FT                   /locus_tag="An01g03770"
FT   exon            45606..45636
FT                   /locus_tag="An01g03770"
FT                   /number=1
FT   intron          45637..45687
FT                   /locus_tag="An01g03770"
FT                   /number=1
FT   exon            45688..45710
FT                   /locus_tag="An01g03770"
FT                   /number=2
FT   intron          45711..45760
FT                   /locus_tag="An01g03770"
FT                   /number=2
FT   exon            45761..45794
FT                   /locus_tag="An01g03770"
FT                   /number=3
FT   intron          45795..45847
FT                   /locus_tag="An01g03770"
FT                   /number=3
FT   exon            45848..45882
FT                   /locus_tag="An01g03770"
FT                   /number=4
FT   intron          45883..45927
FT                   /locus_tag="An01g03770"
FT                   /number=4
FT   exon            45928..45954
FT                   /locus_tag="An01g03770"
FT                   /number=5
FT   intron          45955..46006
FT                   /locus_tag="An01g03770"
FT                   /number=5
FT   exon            46007..46076
FT                   /locus_tag="An01g03770"
FT                   /number=6
FT   intron          46077..46125
FT                   /locus_tag="An01g03770"
FT                   /number=6
FT   exon            46126..46190
FT                   /locus_tag="An01g03770"
FT                   /number=7
FT   CDS_pept        join(46533..46830,47131..47164,47240..47264,47322..47354,
FT                   47420..47460,47529..47721)
FT                   /locus_tag="An01g03780"
FT                   /note="Similarity: the patented EST covers the last two
FT                   exons and part of the putative 3'-UTR."
FT                   /note="Title: strong similarity to EST SEQ ID NO:4125 from
FT                   patent WO200056762-A2 - Aspergillus niger"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8B9"
FT                   /protein_id="CAK36916.1"
FT                   /translation="MGPQQLTTPPSAERQVPNRAKPQRHTSAPISLLYGCLPLPITWAA
FT                   ANVVLLHVALHDPTRSRFLSFITSLVRIYQPTRCLSWEHSKAVNMAICITFGTHGQHWN
FT                   GHCLTRWPWFTVCFIPVIPLATHKYKEVTCYTCRFTQDLRDRPDITPDTRPPPGVVPGQ
FT                   LPQAYYGGGAPFYPPQQASGPPPQASGGVVAPQQQAEQQNHVYK"
FT   mRNA            join(<46533..46830,47131..47164,47240..47264,47322..47354,
FT                   47420..47460,47529..>47721)
FT                   /locus_tag="An01g03780"
FT   exon            46533..46830
FT                   /locus_tag="An01g03780"
FT                   /number=1
FT   intron          46831..47130
FT                   /locus_tag="An01g03780"
FT                   /number=1
FT   exon            47131..47164
FT                   /locus_tag="An01g03780"
FT                   /number=2
FT   intron          47165..47239
FT                   /locus_tag="An01g03780"
FT                   /number=2
FT   exon            47240..47264
FT                   /locus_tag="An01g03780"
FT                   /number=3
FT   intron          47265..47321
FT                   /locus_tag="An01g03780"
FT                   /number=3
FT   exon            47322..47354
FT                   /locus_tag="An01g03780"
FT                   /number=4
FT   intron          47355..47419
FT                   /locus_tag="An01g03780"
FT                   /number=4
FT   exon            47420..47460
FT                   /locus_tag="An01g03780"
FT                   /number=5
FT   intron          47461..47528
FT                   /locus_tag="An01g03780"
FT                   /number=5
FT   exon            47529..47721
FT                   /locus_tag="An01g03780"
FT                   /number=6
FT   CDS_pept        complement(join(48061..48637,48693..49346,49400..49916,
FT                   49970..50142,50226..50347))
FT                   /locus_tag="An01g03790"
FT                   /note="Function: DUR3 is a component required for active
FT                   transport of urea in S. cerevisiae."
FT                   /note="Similarity: DUR3 of S. cerevisiae is a member of the
FT                   major facilitator superfamily (MFS) of transport proteins."
FT                   /note="Title: strong similarity to urea transport protein
FT                   Dur3 - Saccharomyces cerevisiae"
FT                   /note="plasma membrane"
FT                   /note="See PMID 7867803"
FT                   /note="See PMID 8335627"
FT                   /note="See PMID 8720066"
FT                   /db_xref="GOA:A2Q8C0"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR031155"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8C0"
FT                   /inference="profile:COGS:COG0591"
FT                   /inference="similar to AA sequence:UniProtKB:SCDURIII.1"
FT                   /protein_id="CAK36917.1"
FT                   /translation="MSSDTVTFTAPLSQGFGYGIIIGLGFAFALLMIFITWALKRYQNE
FT                   VQTSEMFSTAGRSVKSGLVAAAVVSSWTWAATLLQSTTVAYEYGISGPFFYASGATVQI
FT                   ILFATLAIELKRRAPNAHTFLEALRARYGTVVHVVFIVFCLMTNILVTAMLLTGGSAVL
FT                   TSLTGVNTVAACFLLPIGVVLYTLFGGIKATFITDYLHTVVIIVVIFIFAFSAYATSDK
FT                   LGSPGAVYDALVAASKLHPVDGNAEGSYLTMRSKEGGIFWIINLVGNFGTVFLDNGYYN
FT                   KAIAASPVHAFPGYVIGGLCWFAIPWLCASTLGMTALSLEGTQRLSPDDVTAGLVLPFA
FT                   AVKLLGYSGAVCTTIMIFMAVTSAFSAQLIAVSSIFTYDIYQAYIDPSAKGKRLVWVSH
FT                   MTCVFWAIAMAGFSTGLYYAGIGMGYLYLLMGVIISSAVFPGAMSLIWKHQNWIAAAAS
FT                   PPLGLAVSFIAWLVTTKKQYGILTVTTTGANYPMLAGNVAALLSPVIFSPILTLIFGSQ
FT                   NYDYGTMRAIRRVDDADVAAAAHIDIELIPGEINTQSAAQEEEETRKLNRAALYSRTLT
FT                   IFMVLCFLILWPIPMYGSSYVFSKKFFTGWVVVGLIWLFCTTFGVVIFPLYEGRESIVR
FT                   TVRMMALDIMGKRGRRKGMIVGEMTSGDVSGVQTPVPEKKEVLEK"
FT   mRNA            complement(join(<48061..48637,48693..49346,49400..49916,
FT                   49970..50142,50226..>50347))
FT                   /locus_tag="An01g03790"
FT   exon            complement(48061..48637)
FT                   /locus_tag="An01g03790"
FT                   /number=1
FT   intron          complement(48638..48692)
FT                   /locus_tag="An01g03790"
FT                   /number=1
FT   exon            complement(48693..49346)
FT                   /locus_tag="An01g03790"
FT                   /number=2
FT   intron          complement(49347..49399)
FT                   /locus_tag="An01g03790"
FT                   /number=2
FT   exon            complement(49400..49916)
FT                   /locus_tag="An01g03790"
FT                   /number=3
FT   intron          complement(49917..49969)
FT                   /locus_tag="An01g03790"
FT                   /number=3
FT   exon            complement(49970..50142)
FT                   /locus_tag="An01g03790"
FT                   /number=4
FT   intron          complement(50143..50225)
FT                   /locus_tag="An01g03790"
FT                   /number=4
FT   exon            complement(50226..50347)
FT                   /locus_tag="An01g03790"
FT                   /number=5
FT   CDS_pept        join(50521..50607,50772..51065,51147..51203)
FT                   /locus_tag="An01g03800"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8C1"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8C1"
FT                   /protein_id="CAK36918.1"
FT                   /translation="MTTDPISLDPRSQAWGSEWLIRTTPGGRFPNPRWVINVSSPDSLL
FT                   ARRKCFLSAEVSATTPIGPSRERTMIRNRRLSDKEVSQVMDWFVGAACRSAKSSMALWG
FT                   ADLMIALYQLLHYLLDPATNALGEPTDLALHLRYARSQYCA"
FT   mRNA            join(<50521..50607,50772..51065,51147..>51203)
FT                   /locus_tag="An01g03800"
FT   exon            50521..50607
FT                   /locus_tag="An01g03800"
FT                   /number=1
FT   intron          50608..50771
FT                   /locus_tag="An01g03800"
FT                   /number=1
FT   exon            50772..51065
FT                   /locus_tag="An01g03800"
FT                   /number=2
FT   intron          51066..51146
FT                   /locus_tag="An01g03800"
FT                   /number=2
FT   exon            51147..51203
FT                   /locus_tag="An01g03800"
FT                   /number=3
FT   exon            51723..52637
FT                   /locus_tag="An01g03810"
FT                   /number=1
FT   CDS_pept        51723..52637
FT                   /locus_tag="An01g03810"
FT                   /note="Similarity: the HIT (histidine triad) region binds
FT                   one zinc ion in proteins lacking zinc fingers; the domain
FT                   is poorly conserved in the predicted ORF."
FT                   /note="Similarity: the N-terminal part of the predicted
FT                   protein produces some BLASTP hits due to the high content
FT                   of low-complexity regions."
FT                   /note="Title: similarity to hypothetical HIT-like protein
FT                   -Rhodococcus sp."
FT                   /db_xref="GOA:A2Q8C2"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8C2"
FT                   /inference="profile:COGS:COG0537"
FT                   /inference="similar to AA sequence:UniProtKB:AF265258.2"
FT                   /protein_id="CAK36919.1"
FT                   /translation="MTTKIYHTNNLTISLSHHPTTPGHTIATLTNTTTPKTTLFALPKS
FT                   TFISTLVTLRTIIPSLKSTYHTPRIALITSGNTTLSLLPLHGLTSTWTPITSPETTFND
FT                   PQSSSHPQSYITSKSGPRMPSAHLTHIADIITTHTPSTPNYTFHGPSSDTNLFANIIRG
FT                   TEHPQWRIWEDESRVAFLTPYPNTPGFTVLVPRTHLGSDIFALGEEDFEGLMGAAWTVG
FT                   RVLMEALGVGRCGMVFEGLEVDYAHVKLVPVYGDGEDDGGEREVFREVYPGYVSSLPGP
FT                   EVGDVGELVRRAGEIRQLIAAQE"
FT   mRNA            <51723..>52637
FT                   /locus_tag="An01g03810"
FT   CDS_pept        complement(join(53107..53141,53203..53548,53688..53690))
FT                   /locus_tag="An01g03820"
FT                   /note="Complex: SBH2 of cerevisiae interacts with SSH1 and
FT                   SSS1; the complex is involved in protein translocation into
FT                   the endoplasmic reticulum."
FT                   /note="Remark: SBH2 of S. cerevisiae is also known as SEB2
FT                   or YER019C."
FT                   /note="Similarity: strong similarity to A. oryzae EST
FT                   PATENTDNA:AAF12808, which confirms the structure of exons 2
FT                   and 3."
FT                   /note="Title: strong similarity to ER protein-translocation
FT                   complex subunit Sbh2 - Saccharomyces cerevisiae"
FT                   /note="endoplasmatic reticulum"
FT                   /note="See PMID 8612571"
FT                   /note="See PMID 8740416"
FT                   /note="See PMID 10921929"
FT                   /db_xref="GOA:A2Q8C3"
FT                   /db_xref="InterPro:IPR016482"
FT                   /db_xref="InterPro:IPR030671"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8C3"
FT                   /inference="profile:PFAM:PF03911"
FT                   /inference="similar to AA sequence:PIR:S68163"
FT                   /protein_id="CAK36920.1"
FT                   /translation="MASPRAASPMTSGAESGPDSKSAGAGTGASAVSSVNRPSSPTPPG
FT                   GPRAAMRRRAAADHKESLRNARPSSTRAAGAGGSSGTMLKLYTDESPGLRVDPVVVLVL
FT                   SLGFIFSVVGLHVIAKITRKFSS"
FT   mRNA            complement(join(<53107..53141,53203..53548,53688..>53690))
FT                   /locus_tag="An01g03820"
FT   exon            complement(53107..53141)
FT                   /locus_tag="An01g03820"
FT                   /number=1
FT   intron          complement(53142..53202)
FT                   /locus_tag="An01g03820"
FT                   /number=1
FT   exon            complement(53203..53548)
FT                   /locus_tag="An01g03820"
FT                   /number=2
FT   intron          complement(53549..53687)
FT                   /locus_tag="An01g03820"
FT                   /number=2
FT   exon            complement(53688..53690)
FT                   /locus_tag="An01g03820"
FT                   /number=3
FT   tRNA            53992..54063
FT                   /gene="tRNA-Glu (TTC)"
FT                   /locus_tag="An01e03830"
FT                   /product="transfer RNA-Glu (TTC)"
FT                   /inference="profile:tRNAscan:1.4"
FT   CDS_pept        complement(join(54112..54265,54367..54484,54597..54793,
FT                   55002..55042))
FT                   /locus_tag="An01g03840"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8C4"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8C4"
FT                   /protein_id="CAK36921.1"
FT                   /translation="MYASTSTNAVLKPRSHSGLSEVMTLKGCLLYALQLHSSSASGEPV
FT                   LIGRHVRRTLPTAVASMWLPASGSGMASMGRISAGTRIGLVVLPLLAVDYPCLKHHFVG
FT                   ADLPDCGVESRSNPSEGLRDSWASGASEPRFVVDQSTLWLIEIRNNDNYTTLAIRKNQV
FT                   QKGTSH"
FT   mRNA            complement(join(<54112..54265,54367..54484,54597..54793,
FT                   55002..>55042))
FT                   /locus_tag="An01g03840"
FT   exon            complement(54112..54265)
FT                   /locus_tag="An01g03840"
FT                   /number=1
FT   mat_peptide     complement(join(54115..54265,54367..54484,54597..54708))
FT                   /locus_tag="An01g03840"
FT                   /product="hypothetical protein"
FT   intron          complement(54266..54366)
FT                   /locus_tag="An01g03840"
FT                   /number=1
FT   exon            complement(54367..54484)
FT                   /locus_tag="An01g03840"
FT                   /number=2
FT   intron          complement(54485..54596)
FT                   /locus_tag="An01g03840"
FT                   /number=2
FT   exon            complement(54597..54793)
FT                   /locus_tag="An01g03840"
FT                   /number=3
FT   sig_peptide     complement(join(54709..54793,55002..55042))
FT                   /locus_tag="An01g03840"
FT                   /inference="protein motif:SignalP:2.0"
FT   intron          complement(54794..55001)
FT                   /locus_tag="An01g03840"
FT                   /number=3
FT   exon            complement(55002..55042)
FT                   /locus_tag="An01g03840"
FT                   /number=4
FT   CDS_pept        join(55349..55388,55590..55635,55679..55853,55955..56005)
FT                   /locus_tag="An01g03850"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8C5"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8C5"
FT                   /protein_id="CAK36922.1"
FT                   /translation="MQRLPCTQSDTAHLEWLPKTSSSYGVDLSYGEVYGSDSKASHGGH
FT                   ISLQNVVDMDDSHVDRFSNILPSYSYGSPAVSDPCLPILDFLFFDRSDNLEYQGNPIG"
FT   mRNA            join(<55349..55388,55590..55635,55679..55853,55955..>56005)
FT                   /locus_tag="An01g03850"
FT   exon            55349..55388
FT                   /locus_tag="An01g03850"
FT                   /number=1
FT   intron          55389..55589
FT                   /locus_tag="An01g03850"
FT                   /number=1
FT   exon            55590..55635
FT                   /locus_tag="An01g03850"
FT                   /number=2
FT   intron          55636..55678
FT                   /locus_tag="An01g03850"
FT                   /number=2
FT   exon            55679..55853
FT                   /locus_tag="An01g03850"
FT                   /number=3
FT   intron          55854..55954
FT                   /locus_tag="An01g03850"
FT                   /number=3
FT   exon            55955..56005
FT                   /locus_tag="An01g03850"
FT                   /number=4
FT   CDS_pept        complement(join(56843..56964,57063..57190,57323..57409,
FT                   57454..57531,57614..57660))
FT                   /locus_tag="An01g03860"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8C6"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8C6"
FT                   /protein_id="CAK36923.1"
FT                   /translation="MSGGGVQEVGVLEDDGGICARRMARCRVKEEDGKSRGDAVGLLSP
FT                   MIDGSGLEEVCWRKAEHLRTQNRSPEKYECERWKRKAGRRTIEDDGWNGSERARDRGKT
FT                   EAAVKLSPRCVCGIQGSAGSPDTAMEGKKREKAAMITKIRGGLDDALED"
FT   mRNA            complement(join(<56843..56964,57063..57190,57323..57409,
FT                   57454..57531,57614..>57660))
FT                   /locus_tag="An01g03860"
FT   exon            complement(56843..56964)
FT                   /locus_tag="An01g03860"
FT                   /number=1
FT   intron          complement(56965..57062)
FT                   /locus_tag="An01g03860"
FT                   /number=1
FT   exon            complement(57063..57190)
FT                   /locus_tag="An01g03860"
FT                   /number=2
FT   intron          complement(57191..57322)
FT                   /locus_tag="An01g03860"
FT                   /number=2
FT   exon            complement(57323..57409)
FT                   /locus_tag="An01g03860"
FT                   /number=3
FT   intron          complement(57410..57453)
FT                   /locus_tag="An01g03860"
FT                   /number=3
FT   exon            complement(57454..57531)
FT                   /locus_tag="An01g03860"
FT                   /number=4
FT   intron          complement(57532..57613)
FT                   /locus_tag="An01g03860"
FT                   /number=4
FT   exon            complement(57614..57660)
FT                   /locus_tag="An01g03860"
FT                   /number=5
FT   CDS_pept        join(57973..58055,58125..58563,58616..58810,58865..59155)
FT                   /locus_tag="An01g03870"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   SPAC23H3.04 - Schizosaccharomyces pombe"
FT                   /db_xref="GOA:A2Q8C7"
FT                   /db_xref="InterPro:IPR040410"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8C7"
FT                   /inference="similar to AA sequence:PIR:T38297"
FT                   /protein_id="CAK36924.1"
FT                   /translation="MYRPNSLWTWSFCIVTLIQTIITLALESYVFANFQIQLFPKGEVS
FT                   TASKTVTTFLALYCFGFIYELILVYDALRLKNTIQVIGLCVCNLGLLIYGAVQVQQIKD
FT                   SIEMLVAESAITIDVWGETEPFLIIIPCVVAMGSILMMIIAWKLYDEFAWSIYKHISAD
FT                   LRMKRRYLTYQIYIALLKFDFFFFLGFTVQFLVIVTNKTDVEFALTTAAIPVTILILVC
FT                   AAIFVKRESSIGMIVVILLYFAAMAYFLFKLVRMYQPQTYQEYLPARRSLTFFAVITLL
FT                   LIVLTITNACVCMHNFHKGLKQHVHKKKSRDKDEKTTELSSNISGQVPNRMMID"
FT   mRNA            join(<57973..58055,58125..58563,58616..58810,58865..>59155)
FT                   /locus_tag="An01g03870"
FT   exon            57973..58055
FT                   /locus_tag="An01g03870"
FT                   /number=1
FT   intron          58056..58124
FT                   /locus_tag="An01g03870"
FT                   /number=1
FT   exon            58125..58563
FT                   /locus_tag="An01g03870"
FT                   /number=2
FT   intron          58564..58615
FT                   /locus_tag="An01g03870"
FT                   /number=2
FT   exon            58616..58810
FT                   /locus_tag="An01g03870"
FT                   /number=3
FT   intron          58811..58864
FT                   /locus_tag="An01g03870"
FT                   /number=3
FT   exon            58865..59155
FT                   /locus_tag="An01g03870"
FT                   /number=4
FT   exon            59407..59556
FT                   /locus_tag="An01g03880"
FT                   /number=1
FT   CDS_pept        59407..59556
FT                   /locus_tag="An01g03880"
FT                   /note="Title: strong similarity to EST an_1234 -Aspergillus
FT                   niger"
FT                   /db_xref="GOA:A2Q8C8"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8C8"
FT                   /protein_id="CAK36925.1"
FT                   /translation="MIPPTALLGFFLRTFDCLSLLISSEFCLKWLFTLPASRSCSMTRR
FT                   VASH"
FT   mRNA            <59407..>59556
FT                   /locus_tag="An01g03880"
FT   sig_peptide     59407..59463
FT                   /locus_tag="An01g03880"
FT                   /inference="protein motif:SignalP:2.0"
FT   mat_peptide     59464..59553
FT                   /locus_tag="An01g03880"
FT   tRNA            complement(59938..60009)
FT                   /gene="tRNA-Glu (TTC)"
FT                   /locus_tag="An01e03890"
FT                   /product="transfer RNA-Glu (TTC)"
FT                   /inference="profile:tRNAscan:1.4"
FT   CDS_pept        complement(join(60772..62025,62273..65083))
FT                   /locus_tag="An01g03900"
FT                   /note="Function: AtrA of A. nidulans is an ABC
FT                   transporter,and can complement the drug hypersensitivity
FT                   associated with PDR5 deficiency in S. cerevisiae."
FT                   /note="Function: multidrug transporters are membrane
FT                   proteins which, by an unknown mechanism, recognize diverse
FT                   toxic compounds and efflux them from cells."
FT                   /note="Title: strong similarity to ATP-binding cassette
FT                   multidrug transport protein atrA - Aspergillus nidulans"
FT                   /note="plasma membrane"
FT                   /note="See PMID 9180695"
FT                   /db_xref="GOA:A2Q8C9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010929"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029481"
FT                   /db_xref="InterPro:IPR034001"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8C9"
FT                   /inference="profile:COGS:COG1123"
FT                   /inference="profile:COGS:COG4608"
FT                   /inference="profile:PFAM:PF00005"
FT                   /inference="similar to AA sequence:PIR:T30566"
FT                   /protein_id="CAK36926.1"
FT                   /translation="MEEKVASAHDPYPSDKEQTPSLDEEEQELHNLTRIASSRTGRRIS
FT                   HAATINEKDDPRLDPTNPAFDQRLWAKLVLRALDQSGIVQQTQGVVFSNLCVSGSGSSL
FT                   QIQNTISTQLAAPFRAAARALSGRASPPPRQILHGFDGFLKSGELLLVLGRPGSGCTTF
FT                   LKTLCGHLGGLTLEPQSTIHYQGIEYEDMIKHHRGEVAYNKEVDQHFPHLTVGETLSFA
FT                   AHARTPQKRIEGLTRSEYVETLTQVVLAVFGLSNTYYTKVGDNFVRGVSGGERKRVSIA
FT                   EMFVSRCRIGAWDNSTRGLDASSALKFVRALRIAADMGRSCHAIAAYQASQSMYDLVDK
FT                   VVVLYEGREIYFGHRDRAVPYFEEMGWELPDRQVSGDFLTSITNPGERKARPDMVDKVP
FT                   RTAKEFEEYWKRSPEYKELCGQIEEYQRAHPPDSDEAKAFKAHHEEQQARHTRPRSPYL
FT                   LSVPMQVRLCLRRAFQRLRNDLPTVIVTVATQPILGLVIGSIFFNSPPTTATFFQKGAV
FT                   LYFAVLFNALIALNEIIQLYSQRPIAVKQAGYAFVHPFAEALASWIMDLPIKFTRGTLF
FT                   CVILYLMSNLRREPSQFFICYMFLLTSVLTMSGIFRSLAAATRTSAQAMSMAGVCILCI
FT                   VVYTGFVLPQAYMHPWLSWIRWVNPIYYVYEALLANEFHGRNFECASVIPSYATGSSFI
FT                   CSTVGAVAGERFVSGDAYVEQNYQYYYSHVWRNYGILVAYLVFFTGLYLFLSEYNSGET
FT                   SKAETLVFRSGHVPQYLLSSDGIEDGEAPPDKPEVGDQVDAISLPQQTDVLSWKGLNYD
FT                   IPVKDGTRRLLDNVNGWVKPGTLTALMGVSGAGKTTLLDVLAQRVSIGVVTGDVLVNGR
FT                   ALQANFPRETGYVQQQDLHMETTTVREALRFSAMLRQPASVSEKEKYEYVEEVIKVLRM
FT                   QDFAEAVTKGGKTVYFGDIGDQSRILLDYFERSGIRRCGDMENPAEYILEVVAGEGSEG
FT                   IDWVQRWNDSPERKEVLAELERLQDPQQQPEPRAQDGDSNNSEFAMPFTSQLYHVMKRA
FT                   FQQYYRQPEYVFAKYSLGIACGLFIGFSFFKANNTQQGFQCALFSVFLLATVFTTLVNQ
FT                   ITPRFVAQRALYEVRERPSRVYSWKVFILSNVLVEIPYHIVLGVFVWLSFYWAVMGTGQ
FT                   DAERHVLGLLYIVQFYLYVASMAHFVIAAVPQAPVAGILAVLMFAFAFIFNGMLQPPGD
FT                   LPGFWIFMYRVSPFTYYTAGVGSSILHGRPVECSATELSVFDPPSNYTCGQYMQKYVEA
FT                   AGGQVYNPNATSACEYCSMTVADEYLALRWVYWKDRWRDYGIFWCYFVFNIAGAVMLYY
FT                   FFRVKKWGKGK"
FT   mRNA            complement(join(<60772..62025,62273..>65083))
FT                   /locus_tag="An01g03900"
FT   exon            complement(60772..62025)
FT                   /locus_tag="An01g03900"
FT                   /number=1
FT   intron          complement(62026..62272)
FT                   /locus_tag="An01g03900"
FT                   /number=1
FT   exon            complement(62273..65083)
FT                   /locus_tag="An01g03900"
FT                   /number=2
FT   CDS_pept        complement(join(65978..66127,66215..66427))
FT                   /locus_tag="An01g03910"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8D0"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8D0"
FT                   /protein_id="CAK36927.1"
FT                   /translation="MARKHCEYTITYGYGRSNNLQQGEFEIKHKELLNEVFIHSTALWN
FT                   VSFTARYLLITRVFICGTAIPNPRRPPKWIPYRGLIVDHRRVGGPISRDRVGGLGVASR
FT                   QYFPSLLSLGPGTTPA"
FT   mRNA            complement(join(<65978..66127,66215..>66427))
FT                   /locus_tag="An01g03910"
FT   exon            complement(65978..66127)
FT                   /locus_tag="An01g03910"
FT                   /number=1
FT   intron          complement(66128..66214)
FT                   /locus_tag="An01g03910"
FT                   /number=1
FT   exon            complement(66215..66427)
FT                   /locus_tag="An01g03910"
FT                   /number=2
FT   CDS_pept        join(66531..66654,66878..66943,67140..67208,67286..67392)
FT                   /locus_tag="An01g03920"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8D1"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8D1"
FT                   /protein_id="CAK36928.1"
FT                   /translation="MPGISFLLSSGVHWRWLEARNGLPCSVYYDVQMEKGLQPSKAYAL
FT                   GPQHRTLELDGVIQNHARGWVGPEGLISRSRSCFAASGWLKGQEVRTVLSDRLAMSTDA
FT                   AKATVTSEVIQKVTHKK"
FT   mRNA            join(<66531..66654,66878..66943,67140..67208,67286..>67392)
FT                   /locus_tag="An01g03920"
FT   exon            66531..66654
FT                   /locus_tag="An01g03920"
FT                   /number=1
FT   sig_peptide     66531..66587
FT                   /locus_tag="An01g03920"
FT                   /inference="protein motif:SignalP:2.0"
FT   mat_peptide     join(66588..66654,66878..66943,67140..67208,67286..67389)
FT                   /locus_tag="An01g03920"
FT                   /product="hypothetical protein"
FT   intron          66655..66877
FT                   /locus_tag="An01g03920"
FT                   /number=1
FT   exon            66878..66943
FT                   /locus_tag="An01g03920"
FT                   /number=2
FT   intron          66944..67139
FT                   /locus_tag="An01g03920"
FT                   /number=2
FT   exon            67140..67208
FT                   /locus_tag="An01g03920"
FT                   /number=3
FT   intron          67209..67285
FT                   /locus_tag="An01g03920"
FT                   /number=3
FT   exon            67286..67392
FT                   /locus_tag="An01g03920"
FT                   /number=4
FT   CDS_pept        complement(join(68623..68640,68697..68983,69037..69466,
FT                   69535..69575,69629..69835,70252..70267))
FT                   /locus_tag="An01g03930"
FT                   /note="Function: pcn1 of S. pombe is involved in nucleic
FT                   acid metabolism and cell-cycle control."
FT                   /note="Function: pcn1 of S. pombe seems to encircle DNA and
FT                   tether the polymerase to the DNA template for processive
FT                   DNA synthesis."
FT                   /note="Title: strong similarity to proliferating cell
FT                   nuclear antigen pcn1p - Schizosaccharomyces pombe"
FT                   /note="nucleus"
FT                   /note="See PMID 10449724"
FT                   /note="See PMID 1361173"
FT                   /db_xref="GOA:A2Q8D2"
FT                   /db_xref="InterPro:IPR000730"
FT                   /db_xref="InterPro:IPR022648"
FT                   /db_xref="InterPro:IPR022649"
FT                   /db_xref="InterPro:IPR022659"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8D2"
FT                   /inference="profile:COGS:COG0592"
FT                   /inference="profile:PFAM:PF00705"
FT                   /inference="profile:PFAM:PF02747"
FT                   /inference="similar to AA sequence:PIR:WMZPET"
FT                   /protein_id="CAK36929.1"
FT                   /translation="MCLVVSPSINSPQPERHAVILPTHSIPSVSSLRFPIFTILLSPAN
FT                   HHLLISASPLSSTSPSNQLLTVLTYHHIKMLEARLEQASLLKRVVDAIKDLVQDCNFDC
FT                   NDSGISLQAMDNSHVALVSMMLKAEGFSPYRCDRNIALGINLLSLTKVLRAAQNEDILT
FT                   LKAEDSPDAVNLMFESAETDRLSEYDIKLMDIDQEHLAIPETEYAATVEMPAAEFQRIC
FT                   RDLNALSESVVIEATKEGVKFSCQGDIGSGSVTVRQHTNVENPAQNVSISLTEPVALTF
FT                   SLKYLVNFCKATNLSNKVTLCLSQEVPLLVEYGLGSGHLRFYLAPKIGDEE"
FT   mRNA            complement(join(<68623..68640,68697..68983,69037..69466,
FT                   69535..69575,69629..69835,70252..>70267))
FT                   /locus_tag="An01g03930"
FT   exon            complement(68623..68640)
FT                   /locus_tag="An01g03930"
FT                   /number=1
FT   intron          complement(68641..68696)
FT                   /locus_tag="An01g03930"
FT                   /number=1
FT   exon            complement(68697..68983)
FT                   /locus_tag="An01g03930"
FT                   /number=2
FT   intron          complement(68984..69036)
FT                   /locus_tag="An01g03930"
FT                   /number=2
FT   exon            complement(69037..69466)
FT                   /locus_tag="An01g03930"
FT                   /number=3
FT   intron          complement(69467..69534)
FT                   /locus_tag="An01g03930"
FT                   /number=3
FT   exon            complement(69535..69575)
FT                   /locus_tag="An01g03930"
FT                   /number=4
FT   intron          complement(69576..69628)
FT                   /locus_tag="An01g03930"
FT                   /number=4
FT   exon            complement(69629..69835)
FT                   /locus_tag="An01g03930"
FT                   /number=5
FT   intron          complement(69836..70251)
FT                   /locus_tag="An01g03930"
FT                   /number=5
FT   exon            complement(70252..70267)
FT                   /locus_tag="An01g03930"
FT                   /number=6
FT   CDS_pept        join(70723..70739,70813..70852,70896..71019,71078..71241,
FT                   71284..71413,71478..71980)
FT                   /locus_tag="An01g03940"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   EAA64320.1 - Aspergillus nidulans"
FT                   /db_xref="GOA:A2Q8D3"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8D3"
FT                   /inference="profile:COGS:COG1088"
FT                   /protein_id="CAK36930.1"
FT                   /translation="MTTVFITGASGYIGGDLLSSEAATAARKIKAQYPTVEIIQGSLDD
FT                   SETLVAESARADIIIPDFTGMKDTADAADHLGAAKAIAQGALEGHTEEHPVYWLHTSGA
FT                   GIFSFLDTETKDIKEIVNFPDHAFHRDVDKAVFEAGSVRPEVLKTAIISPVTVYGQGRG
FT                   PCSQRSRQIYELAKLTIQRQKVPIIGRGLSFGTDIHIYDLTNLYVILFERALSKQDDGL
FT                   WGPEAYYLCENGEHCWGELARSIGRICVAEGFIPSAEEEAFGFEEAQKWAGYEAASWGL
FT                   NSRCRASRARLLLGWQPSAPSLESELRDIVKGEYRRLQEAERDA"
FT   mRNA            join(<70723..70739,70813..70852,70896..71019,71078..71241,
FT                   71284..71413,71478..>71980)
FT                   /locus_tag="An01g03940"
FT   exon            70723..70739
FT                   /locus_tag="An01g03940"
FT                   /number=1
FT   intron          70740..70812
FT                   /locus_tag="An01g03940"
FT                   /number=1
FT   exon            70813..70852
FT                   /locus_tag="An01g03940"
FT                   /number=2
FT   intron          70853..70895
FT                   /locus_tag="An01g03940"
FT                   /number=2
FT   exon            70896..71019
FT                   /locus_tag="An01g03940"
FT                   /number=3
FT   intron          71020..71077
FT                   /locus_tag="An01g03940"
FT                   /number=3
FT   exon            71078..71241
FT                   /locus_tag="An01g03940"
FT                   /number=4
FT   intron          71242..71283
FT                   /locus_tag="An01g03940"
FT                   /number=4
FT   exon            71284..71413
FT                   /locus_tag="An01g03940"
FT                   /number=5
FT   intron          71414..71477
FT                   /locus_tag="An01g03940"
FT                   /number=5
FT   exon            71478..71980
FT                   /locus_tag="An01g03940"
FT                   /number=6
FT   CDS_pept        complement(join(72629..73293,73345..73796,73852..74333,
FT                   74395..74594,74656..74704))
FT                   /locus_tag="An01g03950"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   CAE76289.1 - Neurospora crassa"
FT                   /db_xref="GOA:A2Q8D4"
FT                   /db_xref="InterPro:IPR026859"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8D4"
FT                   /protein_id="CAK36931.1"
FT                   /translation="MESLVYENSPLADYLQGEGEHDPSWPVKEADHSDDFSDSTAADFA
FT                   PRGVSKFQERIRNKLPKPLERKVSRQRAALGRLYDVCTSALNSRVGRSDNERFLEQFGY
FT                   VIVASQLLNEHSAPSYTSAADVMSTALPADLPSISTTFGIQGAVVTASTSFSVAWLLHW
FT                   SRSRTSSGLNPRKVGVLLVLVPVIGVLFYAFAKRQWLKYLRHQAVDAAVTFISNAQGFD
FT                   SAASASVVFIQEVELVSRGYRISTPLPPVSRLEDQTQTRRCLRLRRTVSESFYLMLGQY
FT                   IRAQHTLRPLTDATNLAKYYDIYDISEEELMEAEAAFDERATEDQYSLRALRTLFGRLY
FT                   IVRKSILCCLLALGADGGGSDIARWTTAVEQMRDLAHVTGENIHKMTNILNEDDRDVIP
FT                   PSPLPTASPNKDNLRAQYRNINSLSQGIRALHAKMHILKEASSSNLERPDAGEFEASLM
FT                   PQYESIGADIRSLLQEWESGKSALMSSLGKPANPEFSRPSSFLKTPLSPTPSLGGSTAV
FT                   EGSPADALRALTGENTDPSIVHTLDDEEEIFEAVALPARNKRMSLTREERIARVKEDRA
FT                   RQAAARERTDANTNMLKELEMVIKQRPRTTIAAKRVTSI"
FT   mRNA            complement(join(<72629..73293,73345..73796,73852..74333,
FT                   74395..74594,74656..>74704))
FT                   /locus_tag="An01g03950"
FT   exon            complement(72629..73293)
FT                   /locus_tag="An01g03950"
FT                   /number=1
FT   intron          complement(73294..73344)
FT                   /locus_tag="An01g03950"
FT                   /number=1
FT   exon            complement(73345..73796)
FT                   /locus_tag="An01g03950"
FT                   /number=2
FT   intron          complement(73797..73851)
FT                   /locus_tag="An01g03950"
FT                   /number=2
FT   exon            complement(73852..74333)
FT                   /locus_tag="An01g03950"
FT                   /number=3
FT   intron          complement(74334..74394)
FT                   /locus_tag="An01g03950"
FT                   /number=3
FT   exon            complement(74395..74594)
FT                   /locus_tag="An01g03950"
FT                   /number=4
FT   intron          complement(74595..74655)
FT                   /locus_tag="An01g03950"
FT                   /number=4
FT   exon            complement(74656..74704)
FT                   /locus_tag="An01g03950"
FT                   /number=5
FT   CDS_pept        complement(join(75111..75267,75357..75555,75600..75663))
FT                   /locus_tag="An01g03960"
FT                   /note="Title: weak similarity to hypothetical kinesin-like
FT                   protein klp-7 - Caenorhabditis elegans"
FT                   /db_xref="GOA:A2Q8D5"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8D5"
FT                   /inference="similar to AA sequence:TREMBLNEW:CEK11D9.2"
FT                   /protein_id="CAK36932.1"
FT                   /translation="MVTSEIPRGLQHMLDAETSVCRESQSTDLDHPLANLCDHRLNPLG
FT                   SLGCTPSRALTGWKTRLAVPWRNNPPDRIEANDSHKGKSPPKRKRQLRFEQKREAQAIQ
FT                   FPRHTHGLIFNVAAAQAPSFGLPLCSLTSVSICQG"
FT   mRNA            complement(join(<75111..75267,75357..75555,75600..>75663))
FT                   /locus_tag="An01g03960"
FT   exon            complement(75111..75267)
FT                   /locus_tag="An01g03960"
FT                   /number=1
FT   intron          complement(75268..75356)
FT                   /locus_tag="An01g03960"
FT                   /number=1
FT   exon            complement(75357..75555)
FT                   /locus_tag="An01g03960"
FT                   /number=2
FT   intron          complement(75556..75599)
FT                   /locus_tag="An01g03960"
FT                   /number=2
FT   exon            complement(75600..75663)
FT                   /locus_tag="An01g03960"
FT                   /number=3
FT   CDS_pept        join(76703..78732,78778..79633)
FT                   /locus_tag="An01g03970"
FT                   /note="Similarity: the C-terminal part shows strong
FT                   similarity to D. melanogaster asp, mammalian plectins and
FT                   dystonin, all proteins involved in cytoskeletal
FT                   organization, in different cellular compartments and
FT                   functional contexts."
FT                   /note="Similarity: the N-terminal part shows a weaker
FT                   similarity to X. laevis nucleolar phosphoprotein
FT                   xNopp180,involved in nuclear localization signal binding,
FT                   which shuttles between the nucleolus and the cytoplasm."
FT                   /note="Similarity: the predicted protein shows different
FT                   similarities in the N-terminal and C-terminal halves."
FT                   /note="Title: similarity to microtubule-associated protein
FT                   asp - Drosophila melanogaster"
FT                   /note="See PMID 9151690"
FT                   /note="See PMID 7593294"
FT                   /db_xref="GOA:A2Q8D6"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR036872"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8D6"
FT                   /inference="similar to AA sequence:UniProtKB:AE003749.7"
FT                   /protein_id="CAK36933.1"
FT                   /translation="MSGFLYEATTPCPSRTSASIFSRGSDRCSSDSMWEDSLGNWDDTA
FT                   NVEFTTEIKQSVLTGAKPRRRTKTSTSFAIHEDLGGKPTQPTYKPKRDSSIAAPTTSRK
FT                   TSLLAQPAQRFRPKVSFGPSPDTQLRQEGLAHKSTTKRTDTEKNNALLMRINGADGQGK
FT                   VKESLKMDVRRNTVYIPPDDGTVASVFMGLFSPLKSDDFEKCMNEDTQVNSLESQIARK
FT                   RQAKRSLASSAQRAPLRPSSKVMQESCIHHDIAGKNGGKENVPPGTVIAEGKKGNQPLK
FT                   IKGDLGSRLNAPPMAARRAGATNAPAKPTSKPLSTKTNNPLHRSNVLSNSQNSTKSQQN
FT                   KPEHNRTMKPSLTSEYNRLGSMRSPNSSTPRKPSKTSTILKPTTSRSNVKPIAKECPII
FT                   LDSITNPALYEENWLSHQEVAITQLVNELLRCTYEESEIDNHTMLRHELLALYQGESFA
FT                   YLHKRLQASLLYGAMSIPKDVLMRSSRLHNDLGLKRKFLDIWIKTYDPRALRAALEAVT
FT                   GRKIPTPKLVHESDTSDNDKAMKRRLEGFLDAFLLQNQDINHQEKTCVGEDGGAAGRTY
FT                   RRTVLRSIMMVILLDKARMCQGTAVPRRLFLSSSPVKSSVAVLQALGRFLLPSCGDMIK
FT                   ALSHLDCELSYEQHPLEEYDYRVDNLAVDLRDGVRLTRVVEIFPLSSHLKFPCRSRAVK
FT                   LFNIKIALDALASEPGTRKLAKDIRAEDIVDGHREKTIALLWKLVSTWGLAGLVDWTEV
FT                   RKEIERLRQKAALHAGHGDAEDNIWHDMCINRNDESDEPTLLLKQWASTLAHLKGVPLD
FT                   NLSTSFSDGKIYESIIDEYEGYIVDRPESYSRTASLDSRLRALGCSAQFGEFTKDLTPF
FT                   TATNIDQPNSWPPLRRLVSSIAILQSEHSRSFVRGFCPLRNAREPRQYFSRHGDGSLRV
FT                   ETMSAEPSQGTLPDNAPQLYKLSTGSYGRRK"
FT   mRNA            join(<76703..78732,78778..>79633)
FT                   /locus_tag="An01g03970"
FT   exon            76703..78732
FT                   /locus_tag="An01g03970"
FT                   /number=1
FT   intron          78733..78777
FT                   /locus_tag="An01g03970"
FT                   /number=1
FT   exon            78778..79633
FT                   /locus_tag="An01g03970"
FT                   /number=2
FT   CDS_pept        complement(join(80089..80160,80221..80229,80284..80321,
FT                   80555..80588,80692..80712,80769..80774))
FT                   /locus_tag="An01g03980"
FT                   /note="Title: questionable ORF"
FT                   /db_xref="GOA:A2Q8D7"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8D7"
FT                   /protein_id="CAK36934.1"
FT                   /translation="MYLVVTVFQSKFIFIIIESTKSKGRGGVGHSSWQVLPIDYPHYLS
FT                   PMYIITLDNFISYL"
FT   mRNA            complement(join(<80089..80160,80221..80229,80284..80321,
FT                   80555..80588,80692..80712,80769..>80774))
FT                   /locus_tag="An01g03980"
FT   exon            complement(80089..80160)
FT                   /locus_tag="An01g03980"
FT                   /number=1
FT   intron          complement(80161..80220)
FT                   /locus_tag="An01g03980"
FT                   /number=1
FT   exon            complement(80221..80229)
FT                   /locus_tag="An01g03980"
FT                   /number=2
FT   intron          complement(80230..80283)
FT                   /locus_tag="An01g03980"
FT                   /number=2
FT   exon            complement(80284..80321)
FT                   /locus_tag="An01g03980"
FT                   /number=3
FT   intron          complement(80322..80554)
FT                   /locus_tag="An01g03980"
FT                   /number=3
FT   exon            complement(80555..80588)
FT                   /locus_tag="An01g03980"
FT                   /number=4
FT   intron          complement(80589..80691)
FT                   /locus_tag="An01g03980"
FT                   /number=4
FT   exon            complement(80692..80712)
FT                   /locus_tag="An01g03980"
FT                   /number=5
FT   intron          complement(80713..80768)
FT                   /locus_tag="An01g03980"
FT                   /number=5
FT   exon            complement(80769..80774)
FT                   /locus_tag="An01g03980"
FT                   /number=6
FT   CDS_pept        complement(join(81370..81436,81493..81606,81663..81819,
FT                   81901..81934,82007..82055,82148..82263))
FT                   /locus_tag="An01g03990"
FT                   /product="hypothetical protein"
FT                   /note="Similarity: very weak similarity to a putative
FT                   protein kinase of Myxococcus xanthus, that has a totally
FT                   different length."
FT                   /db_xref="GOA:A2Q8D8"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8D8"
FT                   /protein_id="CAK36935.1"
FT                   /translation="MPSTIPNTWANDCDCGIEDGGGISKVETGRSEKEYPPGRGKERAT
FT                   RLRCSLNRLDDVHRRDDTKSEATPASKEHLAIPSEPAIDRSFLRRTPEGASPDGGVAVS
FT                   ANNNPAIKVRSRQHRAFAARLLYAVREGSQSPLAIDLVIGQGGGETKDRKEETAAADDY
FT                   LLTSLRIRSLIQNSI"
FT   mRNA            complement(join(<81370..81436,81493..81606,81663..81819,
FT                   81901..81934,82007..82055,82148..>82263))
FT                   /locus_tag="An01g03990"
FT   exon            complement(81370..81436)
FT                   /locus_tag="An01g03990"
FT                   /number=1
FT   intron          complement(81437..81492)
FT                   /locus_tag="An01g03990"
FT                   /number=1
FT   exon            complement(81493..81606)
FT                   /locus_tag="An01g03990"
FT                   /number=2
FT   intron          complement(81607..81662)
FT                   /locus_tag="An01g03990"
FT                   /number=2
FT   exon            complement(81663..81819)
FT                   /locus_tag="An01g03990"
FT                   /number=3
FT   intron          complement(81820..81900)
FT                   /locus_tag="An01g03990"
FT                   /number=3
FT   exon            complement(81901..81934)
FT                   /locus_tag="An01g03990"
FT                   /number=4
FT   intron          complement(81935..82006)
FT                   /locus_tag="An01g03990"
FT                   /number=4
FT   exon            complement(82007..82055)
FT                   /locus_tag="An01g03990"
FT                   /number=5
FT   intron          complement(82056..82147)
FT                   /locus_tag="An01g03990"
FT                   /number=5
FT   exon            complement(82148..82263)
FT                   /locus_tag="An01g03990"
FT                   /number=6
FT   CDS_pept        join(82336..82666,82717..82775)
FT                   /locus_tag="An01g04000"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8D9"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8D9"
FT                   /protein_id="CAK36936.1"
FT                   /translation="MCRGRTVGRPLLLRTPGKTGDRPLPLSWGSSSQTLAHSSATGVVR
FT                   NLAVIILAAILRRTGGKVTGRCQELPWNVQRGGMSIEQGAVETGTTRFFYSASQLKGSL
FT                   IFMVAWVGIVTLPRGCDVCDVEGFG"
FT   mRNA            join(<82336..82666,82717..>82775)
FT                   /locus_tag="An01g04000"
FT   exon            82336..82666
FT                   /locus_tag="An01g04000"
FT                   /number=1
FT   intron          82667..82716
FT                   /locus_tag="An01g04000"
FT                   /number=1
FT   exon            82717..82775
FT                   /locus_tag="An01g04000"
FT                   /number=2
FT   CDS_pept        complement(join(83043..83089,83256..83379))
FT                   /locus_tag="An01g04010"
FT                   /note="Title: weak similarity to protein fragment SEQ ID
FT                   NO:5110 from patent EP1033405-A2 - Zea mays"
FT                   /db_xref="GOA:A2Q8E0"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8E0"
FT                   /protein_id="CAK36937.1"
FT                   /translation="MIDGWGSWTRSIGESSLTPLAVELNPPPDIRHSIHGFYADKRIGY
FT                   TKDKMVANAAI"
FT   mRNA            complement(join(<83043..83089,83256..>83379))
FT                   /locus_tag="An01g04010"
FT   exon            complement(83043..83089)
FT                   /locus_tag="An01g04010"
FT                   /number=1
FT   intron          complement(83090..83255)
FT                   /locus_tag="An01g04010"
FT                   /number=1
FT   exon            complement(83256..83379)
FT                   /locus_tag="An01g04010"
FT                   /number=2
FT   CDS_pept        complement(join(84487..84713,85126..85385,85488..85585,
FT                   85754..85852,85955..86014,86379..86441,86657..86810,
FT                   86855..86910,87152..87268,87511..87678,87944..88074,
FT                   88167..88412,88592..88675,88930..89070,89153..89213))
FT                   /locus_tag="An01g04020"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8E1"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8E1"
FT                   /protein_id="CAK36938.1"
FT                   /translation="MHSRYRSIVALIDPEGGNEGCPRKGEERQVCGQEMDLRLLQRLAA
FT                   QRAPEEEDASKEFRRCNVLAVLAKRRAGKKAQPQRVNDDSQGKRGGRAAPGGRETLSPT
FT                   NPAKPRPTLSFSSPNPCMLRFLRLRDAGQYQYLGILYAPVNTQPSCYLLVGNYRQAKTP
FT                   SWREEAPSHKGLEKRVTGFVTSRFHPWGKPAPKYKKQKTMRHFGGWLPRRANLDLTNPS
FT                   KERLSDKEGGYSMRRNEPPRGQDSAGARAGIIAARAATVVCGKVALPTVGAGNARVPRR
FT                   SYLFRLIRSVAAPGIHTTHHHPTYSIHSTPNQTNMLGLNLVVPDPESDGLGPVTLSQSE
FT                   AVVTSTVGASRVMPMMRARTTNLPACYRHHWELRTNCKRSLDDSIPRLAMGQAGGFHVF
FT                   NLPRSPLKPSSCLPPGNSTVIIPGMVTQAFPTRKAQHVQRVAVMESVRGKKEAGKPIGI
FT                   GLIVSGRMETRKREKKQYGDDDQIHARWQSNWDKRVAISKAETIERANSTPSTTNGLTI
FT                   KKPAHPRSLRMGGAARLLNASRSLQVLGQASCDSGITPTQCHGCSGRCSFPQSQQPICA
FT                   SREFLSEGSSSMTANTDSPHLDREQDTRYMLLMYTYVPNTSGICATRPRSQDRNRLSAN
FT                   KLRPSTERKNRIRNINYIQ"
FT   mRNA            complement(join(<84487..84713,85126..85385,85488..85585,
FT                   85754..85852,85955..86014,86379..86441,86657..86810,
FT                   86855..86910,87152..87268,87511..87678,87944..88074,
FT                   88167..88412,88592..88675,88930..89070,89153..>89213))
FT                   /locus_tag="An01g04020"
FT   exon            complement(84487..84713)
FT                   /locus_tag="An01g04020"
FT                   /number=1
FT   intron          complement(84714..85125)
FT                   /locus_tag="An01g04020"
FT                   /number=1
FT   exon            complement(85126..85385)
FT                   /locus_tag="An01g04020"
FT                   /number=2
FT   intron          complement(85386..85487)
FT                   /locus_tag="An01g04020"
FT                   /number=2
FT   exon            complement(85488..85585)
FT                   /locus_tag="An01g04020"
FT                   /number=3
FT   intron          complement(85586..85753)
FT                   /locus_tag="An01g04020"
FT                   /number=3
FT   exon            complement(85754..85852)
FT                   /locus_tag="An01g04020"
FT                   /number=4
FT   intron          complement(85853..85954)
FT                   /locus_tag="An01g04020"
FT                   /number=4
FT   exon            complement(85955..86014)
FT                   /locus_tag="An01g04020"
FT                   /number=5
FT   intron          complement(86015..86378)
FT                   /locus_tag="An01g04020"
FT                   /number=5
FT   exon            complement(86379..86441)
FT                   /locus_tag="An01g04020"
FT                   /number=6
FT   intron          complement(86442..86656)
FT                   /locus_tag="An01g04020"
FT                   /number=6
FT   exon            complement(86657..86810)
FT                   /locus_tag="An01g04020"
FT                   /number=7
FT   intron          complement(86811..86854)
FT                   /locus_tag="An01g04020"
FT                   /number=7
FT   exon            complement(86855..86910)
FT                   /locus_tag="An01g04020"
FT                   /number=8
FT   intron          complement(86911..87151)
FT                   /locus_tag="An01g04020"
FT                   /number=8
FT   exon            complement(87152..87268)
FT                   /locus_tag="An01g04020"
FT                   /number=9
FT   intron          complement(87269..87510)
FT                   /locus_tag="An01g04020"
FT                   /number=9
FT   exon            complement(87511..87678)
FT                   /locus_tag="An01g04020"
FT                   /number=10
FT   intron          complement(87679..87943)
FT                   /locus_tag="An01g04020"
FT                   /number=10
FT   exon            complement(87944..88074)
FT                   /locus_tag="An01g04020"
FT                   /number=11
FT   intron          complement(88075..88166)
FT                   /locus_tag="An01g04020"
FT                   /number=11
FT   exon            complement(88167..88412)
FT                   /locus_tag="An01g04020"
FT                   /number=12
FT   intron          complement(88413..88591)
FT                   /locus_tag="An01g04020"
FT                   /number=12
FT   exon            complement(88592..88675)
FT                   /locus_tag="An01g04020"
FT                   /number=13
FT   intron          complement(88676..88929)
FT                   /locus_tag="An01g04020"
FT                   /number=13
FT   exon            complement(88930..89070)
FT                   /locus_tag="An01g04020"
FT                   /number=14
FT   intron          complement(89071..89152)
FT                   /locus_tag="An01g04020"
FT                   /number=14
FT   exon            complement(89153..89213)
FT                   /locus_tag="An01g04020"
FT                   /number=15
FT   exon            89500..91611
FT                   /locus_tag="An01g04030"
FT                   /number=1
FT   CDS_pept        89500..91611
FT                   /locus_tag="An01g04030"
FT                   /note="Similarity: the inner part of the predicted ORF
FT                   shows some similarity to the C-terminal half of the
FT                   hypothetical protein SPCC1259. 08 of S. pombe."
FT                   /note="Title: weak similarity to hypothetical protein
FT                   SPCC1259.08 - Schizosaccharomyces pombe"
FT                   /db_xref="InterPro:IPR018853"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8E2"
FT                   /inference="similar to AA sequence:PIR:T40897"
FT                   /protein_id="CAK36939.1"
FT                   /translation="MLLSPHQSSKSAPQEADMVEDIDEPPDHRFLNTSMNNMDDGVVYV
FT                   KSTAAMTDRKESLLTRALKSSPPPSPADRHSPSQEHSFYRSYTYTNISGISTAELTSDG
FT                   GLTSPSLSNTPSPPLPSHLSNNTSSMGDKRKAEAVEVGESAVEANLGRKRCISFACGRK
FT                   AEEQKPQNPSPQRPVTKIHDASVTPTEPKRRTVLTFVCPARDPETRRERSPLRGGCRPR
FT                   PRGSPAPMARKASPEKAAPSPVSKASQEQKIDRRGVPTKGLGKFEESEATRFHEFASSV
FT                   EEDDEWVTKSGEYSEKITLNDCMKKENAIRKLGEEAEEEALEEDDEDDVEDSDDDSTVH
FT                   DFSSDDGNESDNEAGFAESDESDDGSEYDFWAPTSTTAATSPQNADIARHPFSRRDSNT
FT                   SFDSANDVQQQQRWSPVLSAKTTSRSPMKIPKLRPGTPNLPDSTDFVCGTFDEDRPLEA
FT                   AYKSCIEQRRLSKQIVIPQDIDPSFPTSDPEDEEDEEDDIEESVMDEGPRGRTGRDSAQ
FT                   KPSPRTSPRRMVSPPPRRQGRSSPKRLRSPPPPMKLRSSKDDLASADEAPAVPSRGLNI
FT                   SELVQRPAMSRTKSLPRTPNPFFTSLDKSHRWSGIVPVYESPERESSRTREVHTRGPID
FT                   IVEGLEKKRQKRKEKFWRQHCRKAAKEQMVRRPIPGKGAERMKELGLEVAERCRAYGVG
FT                   ENAQLVLSV"
FT   mRNA            <89500..>91611
FT                   /locus_tag="An01g04030"
FT   CDS_pept        join(92421..92439,92598..92701,92865..92904,93007..93072,
FT                   93148..93447,93512..93552)
FT                   /gene="sarA"
FT                   /locus_tag="An01g04040"
FT                   /product="secretion-associated GTP-binding protein
FT                   sarA-Aspergillus niger"
FT                   /note="Function: sarA of A. nidulans is involved in the
FT                   secretion of proteins, probably as a component of COPII
FT                   coat of vesicles, that facilitate the transport from the ER
FT                   to the Golgi by vesicle budding."
FT                   /note="Gene-ID: sarA"
FT                   /note="Phenotype: three mutant alleles of the A. niger sarA
FT                   gene (D29G, E109K, D29G/E109K), generated by site-directed
FT                   mutagenesis, revealed a thermosensitive dominant-negative
FT                   phenotype in the presence of the wild-type sarA allele."
FT                   /note="Similarity: the sequence of the predicted ORF is
FT                   different to the published translation of the A. niger sarA
FT                   gene at positions C102R, D141E and V142L."
FT                   /note="See PMID 8889833"
FT                   /note="See PMID 9756629"
FT                   /db_xref="GOA:P0C951"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006687"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0C951"
FT                   /inference="profile:COGS:COG0532"
FT                   /inference="profile:COGS:COG1100"
FT                   /inference="profile:PFAM:PF00025"
FT                   /inference="similar to AA sequence:SWISSPROT:SARA.ASPNG"
FT                   /protein_id="CAK36940.1"
FT                   /translation="MWLINWFYDLLASLGLLNKHAKLLFLGLDNAGKTTLLHMLKNDRV
FT                   AILQPTAHPTSEELAIGNNRFTTFDLGGHQQARRLWKDYFPEVSGIVFLVDAKDHERFP
FT                   ESKAELDALLAMEELAKVPFLILGNKIDHPDAVSEDELRHQLGLYQTTGKGKVPLEGIR
FT                   PIEVFMCSVVMRQGYGEGIRWLSQYV"
FT   mRNA            join(<92421..92439,92598..92701,92865..92904,93007..93072,
FT                   93148..93447,93512..>93552)
FT                   /gene="sarA"
FT                   /locus_tag="An01g04040"
FT   exon            92421..92439
FT                   /gene="sarA"
FT                   /locus_tag="An01g04040"
FT                   /number=1
FT   intron          92440..92597
FT                   /gene="sarA"
FT                   /locus_tag="An01g04040"
FT                   /number=1
FT   exon            92598..92701
FT                   /gene="sarA"
FT                   /locus_tag="An01g04040"
FT                   /number=2
FT   intron          92702..92864
FT                   /gene="sarA"
FT                   /locus_tag="An01g04040"
FT                   /number=2
FT   exon            92865..92904
FT                   /gene="sarA"
FT                   /locus_tag="An01g04040"
FT                   /number=3
FT   intron          92905..93006
FT                   /gene="sarA"
FT                   /locus_tag="An01g04040"
FT                   /number=3
FT   exon            93007..93072
FT                   /gene="sarA"
FT                   /locus_tag="An01g04040"
FT                   /number=4
FT   intron          93073..93147
FT                   /gene="sarA"
FT                   /locus_tag="An01g04040"
FT                   /number=4
FT   exon            93148..93447
FT                   /gene="sarA"
FT                   /locus_tag="An01g04040"
FT                   /number=5
FT   intron          93448..93511
FT                   /gene="sarA"
FT                   /locus_tag="An01g04040"
FT                   /number=5
FT   exon            93512..93552
FT                   /gene="sarA"
FT                   /locus_tag="An01g04040"
FT                   /number=6
FT   CDS_pept        complement(join(95591..95686,95765..>96064))
FT                   /locus_tag="An01g04050"
FT                   /EC_number="3.1.3.16"
FT                   /note="Function: bimG of A. nidulans is required for the
FT                   completion of anaphase by reversing the action of the nimA
FT                   kinase."
FT                   /note="Phenotype: a mutation in bimG of A. nidulans causes
FT                   an abnormally high content of nuclear phosphoproteins."
FT                   /note="Phenotype: the temperature-sensitive, recessive cell
FT                   cycle mutation A. nidulans bimG11 causes an elevated
FT                   mitotic index at restrictive temperature and an inability
FT                   to complete the anaphase separation of daughter nuclei."
FT                   /note="Remark: the N-terminal part of the ORF is found on
FT                   ORF An01g04060."
FT                   /note="Remark: the ORF is N-terminally truncated due to
FT                   contig border."
FT                   /note="Title: strong similarity to phosphoprotein
FT                   phosphatase bimG - Aspergillus nidulans [truncated ORF]"
FT                   /db_xref="GOA:A2Q8E4"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8E4"
FT                   /inference="profile:COGS:COG0639"
FT                   /inference="similar to AA sequence:PIR:A32549"
FT                   /protein_id="CAK36941.1"
FT                   /translation="IPDCGLLCDLLWSDPDKDITGWSENDRGVSFTFGPDVVSRFLQKH
FT                   DMDLICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKP
FT                   AEKKQKYVYGGMSSGRPITPPRKQKKK"
FT   mRNA            complement(join(<95591..95686,95765..>96064))
FT                   /locus_tag="An01g04050"
FT   exon            complement(95591..95686)
FT                   /locus_tag="An01g04050"
FT                   /number=1
FT   intron          complement(95687..95764)
FT                   /locus_tag="An01g04050"
FT                   /number=1
FT   exon            complement(95765..>96064)
FT                   /locus_tag="An01g04050"
FT                   /number=2
XX
SQ   Sequence 96160 BP; 23743 A; 24235 C; 24268 G; 23913 T; 1 other;
     ccctcaggct tatcgaggta atgaggggct gcttacgccc gcacctctct agtactaccc        60
     aatatgttag acatggcatc agtgtctctc agtttactgt acaatgtatt gatcgcaagt       120
     aggtatacaa ttccactaat gagctctaca cgctcgaaat ggtctaagat gacatgacat       180
     ggtctttctt tcctatcaga tatttcatca ctcttcatgt acaccccgtc taaaacttga       240
     agacctgctc cttagagtag cccagctcct tcaggatacc ggacagctcg ccctggtcgg       300
     tagggctgtt cttggtgcca ctgatggcct tgtacatgcc gggaggtccg cagacgaaga       360
     tcttgatgtt ctcctccttg ggctcgggca ggacggtctt caggagctcc ttgctgatgt       420
     agcccttgcc gccggtccac tccttgggag ggttgtccag gacgtagaag gcacggaagc       480
     ggcgggggta ggtgttctcg agctcctcga attccttctt caggaggatg tcctcctcct       540
     tgacgttacc gaacaccagg gtgaccttgg tctggtcctc ggggttcttg aagatctcac       600
     gcgcaagctg gtacatgggg gtgataccgg taccaccagc gatcaggcaa atgtggttgt       660
     gcttgttggt ctcccagggg tacttgacga taggaccctt gaagtccagg cgctggccga       720
     cgttcatgct gtgcaggtgc tcggacatgg gtccgttggg gtagaccttg acgacaaggt       780
     cgatgtaacc gggggtttct gtgccaagtc agcgaatgtc caaaatgtgc tcgagagtga       840
     gttgcgagga cataccctca tcgctggtag gggtgtaagg gcgaatgaca gccttggcgt       900
     cggcgggctt gaacttggtc aagagggcag ctgcaggttc gtgagtaaga aatccgggtg       960
     gttctttcag agcaagggcg acatacaggc aacctggagg ccggagagag cctccttgtc      1020
     ctcgaactcg aagcgcagac gcttggtgtt gtggttcagg acctcaatct cggacagctt      1080
     caggtcaaac catccttggt caccaccctt gaagaccttg gggcggtcaa cagcagcggg      1140
     ggcctcagcg gtggccgagt tgtagcggta gagaccgaca ccgacaccgg tgataccaac      1200
     ggcggcgtag atgggagcca gggaagactt gcccttgggc gcttccgtgg agtacttgcg      1260
     gaagccctgg ggtaagccgg cattagcaca aaattcggtc gtcggtagag atcgggaagg      1320
     gcgaaaagtg tcggaaaata acagcgctca ggtggaagag ggatagagca tacctgtttg      1380
     aggggctgag cgcagcggaa agcttgacga gcgaacattt tgaatgaatg acagacacca      1440
     atgcgtgctc aatgggtggt gagacggaga ggaaaggtca agggagccag agcggaggga      1500
     agaggacctt cggcaaaggt aattagtcta aagctcctcc tccctctcgg actccgagac      1560
     gccgtttccg cacatgacgc aatggggccg ctcgcgtacc tggcggttta ctaattacca      1620
     attagttaac atttgttgaa catctcatct ttttatcgtg tattgcagat aagtggatga      1680
     taggaaatgc tatatactgg ggttatacat tgaacattat aaaccgcaca cccgccataa      1740
     cattctcctg ggacaacccc cgaggcagcc cgatatcccg gtcttatggc gtcccttaca      1800
     gaacgtatac tacctgcaat atggccgagc gccagcggat aaattcatac ctggaatgaa      1860
     tccagttttt ctaaatactt gaccgaatcc ctgccttgct ggcatgaaga gacggtagtt      1920
     tggaatggaa attagtcgat ttcctgcgta tatactccaa atgccaagca ggatctgttg      1980
     cccacaaacc cgtcatgcta caggctaaag cccaataatt gcttaaaaag gcacctgatc      2040
     aagtggatag actaggcaca ggtagtgcca cccctattcg gagcaagacg aagtaactga      2100
     ggcaaaaagc catgatgtca ggcgtgttat gtgttttccc actgccatcc tcaacatccg      2160
     acggatatac atgactaaag ccgagccagc caaatacgcc actgcgacta ggctctctcg      2220
     acgtcccaca aatggcctat aatttgggaa caagaagtaa cgttccgaca tgctaggcta      2280
     tttgtaggta tcaagaaaat aatctggcaa atgatctggg gaagctggaa taggcgatag      2340
     agcatacata gatcgaaaaa tcctgatttg ggtgtttcga atttagtcca gcagtataga      2400
     atcaaatccg tgtggatcag caagtcccca tgctacgcaa agcgttctac gatctctaca      2460
     gtacgctatg ccccatccaa gaataaacag aaacaatacc ccggtatttt ttgatataac      2520
     ttgaaagggt cgctgcagag gacttaaaga gacataaaaa ccatccgtcc cattacctgg      2580
     gttgaggaaa cacgccctgt ccgcgtgctc cgtgtccttc gtgcatgcta tggccataac      2640
     atagtcattc atccacacac tccgatcacc caaacccaaa acgtcacatt tacgcgaaag      2700
     tagtgggacg agagtaagcg aacagcttct tgccgtgggc agcacggtgg ggcaggggga      2760
     acttgaggtt cttggagagg agctgcttga tgtaggggcg gcggatgctg tcggcgttct      2820
     cgatctcaac aaccttaagg atctgtagga acgtagttag atcgcaatat tcctcagcaa      2880
     aagaggatag gaatctcaac atacgtggat ggagccgaag cgggcacggt ggcgggcagc      2940
     catgtcctgg tagagagcct caacagcctc ggtgcggctc atctcacgga actccttgta      3000
     catgttgtgg gtgccggagc gggagtcgta gcggagccag ataccgaagt tcttgacctt      3060
     ggtagggcgc ttctcgctga tctattggat ggggaaaaaa gacaggcgtc agccaacact      3120
     gccgagttgt cgcttgataa cggccacaca taccacattg atgctgacga tctcaccgtt      3180
     ggccttcttg accttgcgga gctgggtcag gaagtaccag aaccgggact tagcgacaac      3240
     agtgttgggc gcgaagatgc gcatgcggta cagcttgggc gtggggttag cctcggtggg      3300
     caggtgacgc ccaatgacct ggtactcggt gagacgccct aaggatccca gtcagccatg      3360
     ttctcccatc cgatgagaac tgcctcgtgc aatggcttca gtcgttgcgt atattccgtg      3420
     cgaaacgttg ttgactgttg tgcaagtcgt cggtcctttg cgatgatttc atttctgcgc      3480
     cacgatatct tcgaaaattt cgtcctcccc cattagtcgt ccagagttga aaaatccttc      3540
     caccattctt gttcccaacc gattccagtc caatttcaat cgagtcttat attatccgat      3600
     gtcgctgaga taaaatgatg ccgtaaaaag tcgttcaacg atcgcagggg gaatatcgca      3660
     atagccgatc caccattgag agacaataaa ggtattttgg aaaaattcac tcacccatct      3720
     ggtaaattca gtcagtaaca atttcaatat gtcgatgagc agatcaaaag ggtagggctt      3780
     actttgattg ttgacgctgt agtggttagt cgacgagagg tgtgccggct gctggactcg      3840
     tcgcggaaag gaggattttt ggaacagttg attgtgagct aggtttagcc ctgcttaggg      3900
     ctaagcgacc gtgtggcttg gttacccacc tttcctattt gggaacacta gccacactaa      3960
     tggtggcagc agtgattaga taagacggct tccctgagcg ccgcggcggc ttccccacct      4020
     tcctccgatc gcgtccgcgg ctggcttcat ggacctggaa ctcctgtcag tgacgccgat      4080
     tgttggtctc tgtcgctcgg acgtacgatc gccgtgaatg catgtctgct gctaaacccc      4140
     tccccttctt ccccgcctcc tacttctaca cgcttttaat caccagccat gtccaatatc      4200
     tttgatgatt tcaaggaagg ccagaagatc ggctctggtg cccgcctggc ggcatctctc      4260
     tcccccgtcg cgactgcgga gtaccccgac cgattgaagt cgttctatta cttttctaac      4320
     gccgcacatg tctccgccga cctccgatac tcgctcttcc aggcgaatgg cttgaggctt      4380
     cccaagcaag agcagaactc ctgggtcgat atctttaccg cttattggaa agctgtgggg      4440
     gagattgttc gatttgacga ctccccaaga catgccagtt gggtgaaggt gttcgatgct      4500
     tggaaggata cggcaaatca attaatcagg ggatactcga caggcagttt gcaagcctgg      4560
     acagtgccat gcttgtattc tgtcgggaga tatttgcggg cattcgcgat gaaggcagat      4620
     gctgagcttt ctgcccaaga ctccgtcact ttcgacgatc gcttccaaga tgatgcgacg      4680
     gatgccaaga atccaaagtt ggaggaagct acacgagtgc tcaacagaat gttcactttg      4740
     tgtctaagtg accggtaagc tatgtccgga agcgtcgtgg atataccatg ctaatgttgt      4800
     ctagggcacc gatcgaggaa tcgcggaaat ggggcattta cgacactacg aacctgttgt      4860
     tcaagacata ctttaagctt aacaccgttg gcctctccaa gaacttgctg cgggccctca      4920
     atgcctcgtc tgccgacctt cctggcttgg acgccttccc caagtcccat attgtcacct      4980
     ttgagtacta tgtcggtgtt atacactttc tggatgagaa ttatgccgaa gtatgtgctt      5040
     caatcatcaa tgttagttgc cggtgctaat agctggtttc aataggctga agagcatttg      5100
     tcgtacgcat ggaggatgtg caacaaacat gccacaaaga atagagagtc agtactccac      5160
     atgccgcccc atgctacatt gctgactact tcaagattga ttctcaccta cctcgtcccc      5220
     tgccacctcg tcaccacaca taccctgccc agcaaaaagc tgcttgcacc gtttcctcgt      5280
     ctcgagaagc tcttccgtcc tttgtgcgac tgcatcaaaa ggggagacct gggcgggttc      5340
     gatgccgcaa tgacagccgg ggaagaggaa tttgttaaga gacgcatata cttgcccctg      5400
     gaaaggggac gcgatatcgc tttacggaac ctcttccgca aggtctttat tgccggtgga      5460
     tttgacgagc ccaaggaagg acagcctcct atccgccgca cacgggttcc cgttgccgag      5520
     tttgcagcgg cattaaggat cggtactcat gctgacgacc ggtcccgcat agacattgat      5580
     gaggttgaat gtctgttgtc gaaccttatc tacaaggtgc gtgttgaggt gcccgaactc      5640
     tatcaaagca tttgactgac caaaattgta ggggttgatg aaaggataca ttgcccgtga      5700
     gcgcggcatg gtcgtattga gcaaaggtgg aactgcattc cctggaacgg gggtttaatc      5760
     ctgctatcat ctgtcatcgc atctttgatg acagcctccg ttttctttac acctatcgaa      5820
     cagtatcggg ccaccagtat gccatgcaca agggcataac ccaagagccg tcaagatcac      5880
     ggctatggca gggaaatctg cgtcgcttgc cagcctgtat gatatgcgct accacaggtc      5940
     attgagcagc tcccatgcgg catgtatatc ctagatggcg gtctacagga tctatgcctc      6000
     caacggcgct ggtacattaa cggacggtat accccgcagt tatgcaagtc gtccagttag      6060
     ggctggtgac atgcctcaaa tgcctgcttc aagctgaaac agctgtaatt tataccatga      6120
     tagaccagtt tataaatacc acataaaata tgaatacctc atgactgata cagtttcgca      6180
     ttcctctatt agtccctata atagacacat tactatacaa catcgcatca agcaatacat      6240
     agcatacaat aaccatccat ctcaaacaat aagactatcc caaatccctc caaccctcaa      6300
     aacaaaacat aataacaagc ccaaaccagc cgggcttcag atatcactaa cacgcccctt      6360
     cacccctcgc cgcctcctca agatcatcct atagtcaatc atctgaatta gccaccccgc      6420
     acacatcctc cactttgaca aaggggaaag tttttaaaac tcaccatatg attacacatc      6480
     gccacaaaca aatcaaaaaa caacttccct ccacgttcca tctccatctg catcgtccca      6540
     ctccgcttaa acgtcccccg actccgaata atcagcgcca gataatgcgc ccgcagttta      6600
     ctctccgtat cgggagtgtg catgtatgcg taccgcgcac tgcttaggat aatgtggcag      6660
     gggatgttgg agtggaggcc ttgtttcttc aaggcgaggc gcttgagatg ctcgagggag      6720
     tatttctcgg ctgcgcagct atgtagtaca tttattgtgt cagaatagga tgggattttg      6780
     gatgataatt tggggaagaa agggttgaca tactatactg ctgtgtcgcg gaggatctct      6840
     gctcctaccg ctgggtggaa gatgatggcg ttggggtcgg tggtgtcttt gttattagtg      6900
     gtcgttctgg tattagtaga cgatgagggg gtggtttcca agtcccatgt gttggtggtt      6960
     ttgtcgtggc gaagacgggg gtagtagtcg ccgcggtaga ggtattcgag gacgcaggag      7020
     aagatttcgg gttgttcgtc gggaaggtcg atttgtctca tggattcggt agggcttggt      7080
     gaggaggaag gggaagaaga gggggaagag gaggagacat cattgttggg aggattgcag      7140
     agggctgcga agtagggtga gacgcagagg atgtctttgt gtgctgcgaa gaggcgtttg      7200
     gttgggccaa tggtgagggt tattacgcct tgcgagaggg aggaattgct attttttgtt      7260
     gaattgggtc ttctggttag tgggtgcctt tcttttactg agggtttgat agggaaagga      7320
     tgtagaacct tccatctggg ggtgtgtcag gggtgtgtct gctgcgatgg agacgtcgtg      7380
     atgcgacgac agattgttcg cgagaccggg gtttggcttt tccggctcgg tatctggagg      7440
     agatgctgtc tgggtggtgg gaatgtaggc gttttgtgga gagtactctg gggctagggc      7500
     gatggaggcc ctgctgttgc tgtggttgtt gctgttggga tagcattgta agggagggaa      7560
     tttcgaagga gatggagatg taactgggga gaaagaattt gaccctgtag atggaaatca      7620
     ggggttcctt gcgattataa aactactagt actgtaggat actcggtggt agaaagagat      7680
     ggtaagaact ggacagatac atgtatgttt gacctctcct atttggagtg ccttctttgt      7740
     ctctggaaag ggggttgctg aaccacaagc acaggccatc ctttctcctc gcagaggaag      7800
     gggaacgagg gaggttcccc tgccctttta tttccagatc ctggtcgatt ttgacgcatt      7860
     atatatcaac tcgaccagga tgcatgttca tctttgtgca ggaggggcca tggagagggg      7920
     aagagcagcg aacgcgtaac ggcaggtact gctagtaatg gacgcgtaaa gtggtttttt      7980
     gtgcatcgcc aaatcatcgc gcagtcacgg gagagccatt ggccaatgat ggcttcaagg      8040
     agggaaattg ggaggtggag acttaaaggc gccagagcga atcagcccgg catgcttcgt      8100
     tccgtccaca cccgcgatcg gcgcagagac tcgatgcatc caagtgaggg tagctatgga      8160
     ttgtatggcc aggggaaaca aggttcttcc tggtcattac tcatggacta aacgcagaat      8220
     ccatggctca tcacgtccag ttggtgtgga tgggcggatt tcaccatccg tgactcatgg      8280
     gtccgtctcc gggatcattc tgtctgtgtc ataccgccgt gcctggttcg ggtgtagaca      8340
     ggttgcatca acagccgctg ctttctggaa ttacacaaag acaccttcaa gacacttagc      8400
     ttcgcatgca gtgatccgat tgcatctcct ggagacggcc agtcactgtg agatgattag      8460
     tctggtcctt tctacgctgg atggtgttca acgtctccaa agttgatagc tccgattcct      8520
     accccgccaa cacactggac ggtacaacgc tggtagtatt atatcctttc aaacatagta      8580
     aagaaacgtt gccgctatgt acaaccatgt acagcccagt tcccgtgcct gcccagcccg      8640
     agtacgccca taccataacg cctgcttgca aattgtgtaa ccgacgccca ttgcggtgtg      8700
     gagatgtgcc tgcacttgtg atccgctata tccgctgaac tgaccctgtc ggttcaacta      8760
     gaggaatacc tttcgcgcct cccgaggatg actctcactc gggcagtaag ggcacttgaa      8820
     ccggctaccc ttgcacaacc gtttgagtga ctcctccgcg ataacatgcc cacagggcat      8880
     catcatgggg ggattctcat ccgtggtttg ctcctttgac acgggacata caaaaataga      8940
     atggaagaga tatgacggcg gtagcggaat ctcaacctat aaggcgtacc agtcagtcca      9000
     cgaaccgtca tgcatgccaa tcaaggtaac ttaccgggag ctcattctcc gtggtccact      9060
     cggtgcgttt ggctttcatg atagtctgca acttcaacag tgtcggcaac gctatcgcac      9120
     cagccgtagc agcaacatat aggggcgaat cggccgacaa gccgaggagc gagcaaaact      9180
     ctcgcgtgaa tgagtgtgcc acatcggacc atgccgacgg gttattgaag atatgattgt      9240
     acggggagtc tcgcagattg gggcaaaatg ccatggcacc catgagctgt tggacctcgc      9300
     gcagatacct gggcaagaac gtgtggaatt cacgcctgcc atattccaaa gctgcctgcc      9360
     gtccacccgg actgggtcct tgctgatgct gtccgccgta gaaaagccag acgaattgca      9420
     gcctgcacaa ttcgaactca aggttactac ctctcgcttc caaggcctcc ttattctccc      9480
     tggaccactg tattgccggc agcaggttgt tgttttcctt cagctcatga aggatgtggt      9540
     acatggtgtg gaactgttgc cgcacctcac ccggcggaac ttcatcgaga tctaagagcg      9600
     aggccgcatt gtctatagcc tctatatctc cttcttgctg ctttttcatc gctttctttt      9660
     gtgccatttc gttcaggaac tccgacgcaa cggaaaactg tccttctcgg agaaggtgca      9720
     tggcgatggc cctgttgata aggtgttctt gggacgaaag gacatcatgc tcggtgctcg      9780
     gcaaaggtcg atctttgaac aactgcgaca gtgaagtagt taacatatgc cattcaccgt      9840
     aagagcctga cgcgtgctac cttatctaac gatttggagt atttgttgag accactgtgt      9900
     gtttctttta gactatcgtt gatggaatca aaagacgatt tgacgggatt ctggagctta      9960
     gccagtgtaa tggatgcttg actgggatct gggattgtcc tcgtgatcag tatagttcca     10020
     ggatcaagcc cgcgcaacgt ccgacgaggc acacgcacct gcagcaattg catctcgtgc     10080
     cgactgaagt aaatctatgg tagactgcac gttcttaatt ccttgaccgg ccttgatctt     10140
     cttggaaagc cggtcgtgct ccttctgcac cagctccatg acggggcaga cgggaaagcg     10200
     gtgtccgaca gttaccgcac cttcacttaa gcaatcgttg cagccatatg taggtgagcc     10260
     tggtgattgt gctgctcacc gcaagatctg ttatgaaggt caagatcaac aacgaactcg     10320
     tgagggagat actcgaatgg aatagagtcg gcttcttctt caggtcatcg gagcatgggc     10380
     aggtgaggag gagaacggag cggcaaccag cccaattacg acatgaacca tcacgtgcaa     10440
     ctatccgggt gccccgcccg cggcccgttt gcagtcaact ttccccaata acatgatcta     10500
     gatcactcca atgcaatcta taaatgattg ctatctaccc aataaaggtc ttttgtgaat     10560
     cccagtttcc ctctaagata ctaggcgttt gtctgtcact gagtctcaac actgataaga     10620
     ataatagact cgtaatgagt gcggcatcgg attgccagtc acactggaat tgcttttccc     10680
     ctcactaatg cagtgagatg ccgccttaca ttgccagctc acaagtagct aactcattac     10740
     ttaacgagtt aacaagagaa cctgagccac tgagcaagta gagatccgtg ccttacccga     10800
     caagtcctat gaatgcctct gctccacttg tcagatagca tgctggaatc acactgggtg     10860
     cgtcccaccc actcactctt gcaggccctc tttgtcctgc gacatccggg tattcgaagc     10920
     acacgctcgc taactatact ggtccgcttc gtttctagag ccttagcggg ttcctgtcga     10980
     ctggattgcc acaacccatg gaggtgggca catttccttg tcttcgaatc aaagttacta     11040
     ccaacggtgc attgagagtg aggcattcag aagagaccac aacaaaggtg cctttctata     11100
     cgccttatct gtccaagtca aaataatgtc tctcctctga ggcccttggt tttgggcaat     11160
     cttccgaatt tgtggcgaga atgagtgatt ggcctaggca agacccatat tctgtcgcgg     11220
     tgaagcagct ctgcctgcac caggggatcc ctattcacaa ctgtttggat tctggacgcc     11280
     gacaatgaca tagcactggc tgtattgcag attgctcttc cgtaaaaagg tgctgcctgt     11340
     caagatgccg acttaaagcg cagtgagtaa ttttcggtag tcattaacag ctcgttatgt     11400
     ttgggaacaa gactgggtcc ggtagtagta gttccaaggt gacagtagtg ggtttccaaa     11460
     atggcagaac atggcttatc gacggactgc accctgactc gctgagaaac ccacatacac     11520
     cactttaact aactcagcgg atatttccag cttggcagtc tggagcatca tgattattcc     11580
     tctgtgtgtg tgaaaaggtg tcggtacctc cctagtagtc gcgaagcaag acagtgactg     11640
     taggatcata caggcagcag attccgacca atcatagcca gcatagaccc tcgcttacgc     11700
     tagctcgtcc ggtggggccc cgccgcagca ctatataagc tcagcgcacc cgccctcctt     11760
     ttagacattt tctttctttt cttctccatc ctggtgcacg ggttttacac gtgtcagtga     11820
     ggagacatcc gagaccgtgt ttttgctagt tgaaaactac ctagtttgac cgctctcctt     11880
     ggtcttcgga tcggggagga atttttgaaa aaaaagatgc catgccttca aattttggag     11940
     gcggttaaga gtgcgtagac agtcctgctg ttgcccattt gttagttcat ctgggtagta     12000
     ctcgagattg gtcttctttt cactgctgtt gcctcccttg aggaggcctg gagagaagag     12060
     agcttgacca cctgtaaatg gatgtattta tctactgcat gtcactatta taatagaccc     12120
     aagatatctg gtacatgtga atccagttcg ctgcgcatgg ttgactcggg ccgttctact     12180
     gggggtactc cggactggca gacgcgtcca gtgtccgccc actcaccacg gcttctcccg     12240
     tagggccctt gtggcagtgc tgaggaacga ttgagttgtg gctgaatgca cctaggcagc     12300
     tgcgtttcat gcaaaattga ttggtctaga tgtagtgtag tgttctagaa tggtaacagc     12360
     gtcctcacgc ttacccccaa ggatcgtaag acttacccaa gtagtatcac gctttcctgt     12420
     gttctgtcta tatggaattg agacctgcta gtttcggata tacactgtcc atcccgtggg     12480
     gtctgtttga ccagagtggc ccccaaaagt cagggcgatg atggcttagc cgctcaccgc     12540
     tccaggcatg gtgggaaacc cttgtgacgt cgccaactga acctgctgca gatgccgcga     12600
     acaacaacca cctttcggcc agacttgtac ttctactttc tccttcaatg atttgacatg     12660
     acatggacag cccttagccc ggcttgttaa ggctcatagc ttcttcaacc tcggatatgt     12720
     tacagttctt ccttacctct gtacaatacg acaagacccc cggagggtca acgcttctgt     12780
     ctctttcgcc tttatttgag cacggcctcc tggtttcctc ttcttcggat ttcttgaact     12840
     cccacgcact ttcatagtat ttaaatcacc cttttgacag cccttatgtg ttaaggaaat     12900
     tgttccgtct tcatcatgcc acctcccgcg acgcagacag gcggccaagc tccgcctcct     12960
     tcgataaccc cccgcgaatt ggcaaaacac tctattaaca cgaaagatgt acagtctaca     13020
     cagctcgttg gttctgaggg acagtcgcca cggcatggtc gccagagact cgtattcacc     13080
     gatccggttg ccctccgata tctcgaagag gataatgaag cagatttgct aggtcgacgc     13140
     ttgactttag aaggatatga ggcattcatt gttgaacaat gggcctgcac gcgcatgcac     13200
     cccaccttca taataaccac ctatacgggg gatccttcgc acaaggtcgt ggtgggggtg     13260
     ctgagcgtcc ccacagacga gtctaggtgg tcgccccgta tgaagatgta cttcgacgca     13320
     gtcaggcaat gccaggcgcg gaaaaaggaa acgccattgg ggacacttat ggttaccgac     13380
     ctgaacgagt tcccattggc actgactctc attccggtac ccgacggtga tgttctgaaa     13440
     cacaaggagg attttattgt gaatgaaaac ctgaaacggt tgggctgttc aggccgctct     13500
     ggtttaaagc tacaaccgcc ctcacccgct accgagggga agttccatca cctttaccga     13560
     acgagcgaaa aggtgcctct atacactgcc gtcatagagc ttgtgaagca atgccagatc     13620
     gctctgatga tgtttggcaa tcttgctcca gagtacgttg acggactgct ctgtgatgtc     13680
     acagaagcgg ccataaatga ttggtggacc gagacgggta tggacttata caacattgaa     13740
     ccgagtgatt ccatgttggg tcctatctca gtagccgcgc tattgggtac actcatgggg     13800
     gcgcgaaatc ggctgcatgc tttcggcgct ccggtgggta aggatgcgtt tgatattgat     13860
     aacctgacga aaggcatcgg aagctttcaa aaatcacaga aactgaaacg tacccgaata     13920
     ttagatcgac agaccttaga tcgcctgcac cgggtgacag cgaaagctgc gaatgcagaa     13980
     ggctggaccg atgccgtgaa atcaaccatg gcagaactaa gcggacacgg gggagagatg     14040
     gtcatgggaa tggtccgggg ccgtgaaaaa ggcgggatag ctgatatcga gaccctcgat     14100
     atcgataact ttgcacacct ggtcaccggt gaacgagcaa aatggctgtg gaggggaaag     14160
     ccgcgaaagg gcggcattga cgacaatgca cagagtgcag atgtcgtatt tactacagac     14220
     gacccagtgg ccatttttgg acgagtcgaa aacgatcctc gcacgaagat ctagtagcag     14280
     accgcgcact gcaaagctca gatcgtccag ggaggccgcc agaatcagca tcgtccttag     14340
     atgagaaaga ccaaaatctg ggccggttag tccgaaaagg ggtgagcgag aaagtgtcag     14400
     acgcgcgggc aggatttggc cggttcaagg atgcagtagg cctccggtcc catccccaga     14460
     agcactctag ggatgacata gaccttggcg gtgcctctac tcatttgtca cccatcgata     14520
     gcgacacaga ggtgtctcag tcgaagaaat cagatggtgg tgctccagtc ggatccgtgg     14580
     atgtgcagga ccatgaaggt caggccccga aggatgactc gcaggttgaa tctcccccaa     14640
     ggacgatatt gccgcaatca cccaaatcaa gagcgccagc cataaccgta gaaacggttc     14700
     catcccaggc tgattcggaa tcgtcgcgta aggtgtcagt accccgaaca gatgacgaag     14760
     cgcaggacct tgagcgctgg aggacactct ccaccgacat taccgtcgat cctcgggagc     14820
     agacatctga agttggtatt atgctgctgc gtcgaccgca gagctgcact gaactgaacg     14880
     tggcgagtga ctccagtcgt cttgataact actggcctcg ccatctgtcc ttcagcactg     14940
     tcgaagaggt ggtgctggga tggaaggatt tgggaggtga ggctttcaaa gagaagcccg     15000
     atactcttct ggatgaggcc atcatgcaag aagacattct ggcctcagat gcacgaatct     15060
     tcagctcacg tatccaggag cttagtgagc acactgtgcc ttgggtcgag cagcaagtgt     15120
     cctctgtaga tgatcttagc cggtgtttac acgagagccg cgaaaaggtc aacgctgcct     15180
     acctggaacg gctgtcaatc tttgagcaga tgagagctag gtcgagcgac ctgttgacgg     15240
     aagagcacag ccaactcacc gattacatga ggagggtcga actgatgggc gcgaagctgg     15300
     actacgagct ccatgttctg gattcacgtg tcgaggatgt cgaaaccaac ctcgacgagt     15360
     tcgaacggca tgtaaatgcc atcgaaaaca gagtcaagct gctgatacgg ggcgagcacg     15420
     aaaagcagga caattcctgg ttctcctggg ttaggagact taccggatgc tcgacacagt     15480
     gactgtgatg tctcttttcc cagaaagaag ccttgtagac atatatcatt tctaatgtac     15540
     ataatttccg agatagactt gcgcagttcg cgttgaccgt gcaatgccaa agacccagtc     15600
     ttcgctaaca gcaaaccccc tttccagaag caaacaacct tgtatatcca tgtccgagca     15660
     gaagtcatcc atcccaatca gcaaaatccc aggccttccg ctcccgtcag tcaatcagtc     15720
     atgccataag agagaccaaa ggaaaacaag ccatccagaa gagcaaccat gacagatctg     15780
     aaacccgaat agattataca cgttttatag aaaaacagaa aaaagatcca attagatgaa     15840
     caatcgtttc gttgacctcg cactttacat gccgaaacca cccatgccgc ccttctggtt     15900
     cgcctcaccc tgcatcttct cgctgacctt catgttgact tcgaagaact tgccaacaca     15960
     gcggtcaatg cagacggact cgcccttgtt caggtcacct tcgcggtagt cgttgggaat     16020
     gcacttcttg atgcaggact cggtgagact ggtggtcatg agtgggttag ttaagtataa     16080
     aaagtgtccg gggaataggc aaatgtttgg caggaaagga atatgagcgt tataaatgga     16140
     tagacaggat gataataatt gaatcttacc ggctgaacat gtcggtgacc atctcaactt     16200
     ccgtctcagc cgcagcaatc ttctgttccg aggaaagctt gggggcgccg ccgaagagga     16260
     aagacatgat gacgatgtgt agtgggagtg gtgtttttta gctgggttca acagattagt     16320
     agctagtttc aatataatgc tggcaatata aggagcaaat cagtcactca caagtgagaa     16380
     cagagtttat caatgtgtct tacaaggagt atgagttgaa tgcgctgaac gagctgccgg     16440
     agcagacctg aagttgccgg gattcgaagc tggcactgcc gctgccgctc ctcaccgcct     16500
     taggaatttt cgccggattt gccaacgcgt tatttcccgc acaacttggc tctgttcttt     16560
     ttctctttcc ttccttttct caaaatgtga gcacgtagta gttctctttt cactctcaat     16620
     gcaaccaatt cgcccgttca gggcgtcgtc gttgcgggtt ggaggtcttt tgtctaggta     16680
     agcagtttta tgttttgctg tgtttttcac aatacctctt tttatcctgc acttgcatga     16740
     tgagacatac ccttccaaat tacagaaccg ctgcattgaa gcttgggggt ttatcttcca     16800
     agttatgagt aacaaggaag ctttatgtct tctgatttta tcttgtctct gctatcattt     16860
     tgtatggtat ttgtctgtta gacatcttgc taacggcatg ttcagggcag gacttccgat     16920
     ttcccgtaca tcgcaggcct ttcagacttc tggcaggctt gctcgagtaa tacagcacac     16980
     tcttgcacct ctggtacaaa caaggcataa cagcgtcgat gcgtatcctg agaaggcgtt     17040
     caagaggcgt gtgcaattga tcgaagaggc tgttgctgag tcgtatcccc ggctcgcgtc     17100
     aaacaagaac acggtgagct gtgcggaatt tcgtggccgc tacagccatc tagcagataa     17160
     tgaaatagta gaggatgata cagttgttat taatggtagg tcctagttct agcctagctg     17220
     gccctaccat gtcgtctcgt acttaaatca gtaggtaggg tacgtacctt aagacttgtt     17280
     ggaggcaatt tgatattctt cgacttagtt catgatggcc ataaaattca agttatgtgc     17340
     aatcgtcgtc gactgaagga tatccctccg gcgaccttca agcagttcta ccggatgctt     17400
     cggcgtggcg atgccttctg tatgtttcac cagccgctcc ttagtattct gctctagact     17460
     gaacgatatc ctatagccgt aacgggtaat cctcaccgga ctgaacgagg tgaactcact     17520
     gttctggcga ccgaattacc gcagcttctg tcgccctgtc tgcatgatat tcccgttgat     17580
     gcccaagggc aggagaattc gccgtaccct cgacatgttc aattccttgc ggacccggag     17640
     acagtaaatg tcatcagagc tagatcggca gttgtccaat atcttcgcca attctttgtc     17700
     gaccgcgctt ttatggaggt taatacgccg attatcgaag ctgttgctgg cggtgcaatt     17760
     gctcgtccat ttcatactac agccaccgag tttccagatc gccaattgtc gttacggatt     17820
     gcgccggaac tctggctaaa gaggttggtg gtaggagggt ttgaccgggt ttttgagatt     17880
     ggaccttcgt tccgcaatga aggtattagt cttcagtcga agtgtttgaa cgaaaactga     17940
     cgatttgtga caggccttga caaaacccac aaccccgagt tcaccacttg cgagttctac     18000
     cacgcctacg ccaacctgga ggatctcatg accacaaccg agcagctgct ttcgggcctg     18060
     gctgagcacc ttacagcatt ccatcaatcg tcacccttca agaggcctaa tcaggaagac     18120
     acacctctgc cgttctccca tctcaatttc tctgcaccct tccgccgact cgacttcatc     18180
     acctccattg agcagagcat cgggcagaaa ctgccagacc tcgcatctcc cgatgctctc     18240
     gagcaggtga aggcaatctt ccgtgaccgc aatcatgcac ttccagataa agtgaccctc     18300
     ccccggctgc tggacgagct ctgcagcatc tacgtcgaac ctcagtgcat cgacccaacc     18360
     ttcatcgtta acccgccgga gtgcttatca ccgttgtcta agtccttcat ccaccccacc     18420
     accaaccagc gcgtcgccgc gcgcggagag cttttcatcg agggccgcga agtcgtgaac     18480
     acatacgaag aggagaattc gccgttcgaa cagcgtcgca agtttgaaga ccaggttcgg     18540
     tacagcaagc aggctgacga ggcggaagag atcgacgaga gctacttgaa ggcgctggaa     18600
     tggggtctcc ctccgactgg cggctgggga tgcggtatcg accgtctctg catgctattc     18660
     acgggcatga cgagaatcgg ggacattctg ccttttggca acttgcgcaa agtgaccacg     18720
     cgtgctgatg cagcggccga gagtcaggct accgaaggga aagaaaacta gacggcgttt     18780
     agtgaatggg aagacacgat gacgcgtctt gcggcggcac tctcattggc ccgttgcagg     18840
     cgagtggatt ttcgcgattc ttgcaagatc tcgtcttgag tgtcttctga acgttcagtc     18900
     ctgcagactt cgctgggctg ctcgactgct gggctggaaa cccaaacggg gatcagaccg     18960
     actccaactg cagctatgag caagctgcct gtacattaca tgaattctat gttatagtaa     19020
     ccacacaacc cacctcttca ttgtacatat ccacagtcca gatatcacaa ctctcaactg     19080
     aatccaacat ccacctcttc atattccatc cattcggccg atgccatccg ataagaagcg     19140
     ccgataagca cgattgaccg gcgcgggccg agggcctcca tcatcccacc tgcaatcttt     19200
     tcccctcatt atctcctctt caccaccaac actcttacaa caacaaaacc accaacatta     19260
     ataccaacac caacaatggc tctcgacgac atacccgtag cgcaagctgt caccgtcagc     19320
     ctgcaagagc taatcgatgg tacttccacc taatcccact cgacactcaa agctacaaaa     19380
     taataaatct gaaccactcc aaaacacatc ttatctcgcc caactaacaa ctcattttca     19440
     acaaaacaac aggcacaata tccccccaaa ccctaacggc agccttcggc cccttctccc     19500
     tgggcataat ccttgtcaaa gatctccccc caaccttctc ccacctgcgc gcccaagtcc     19560
     tctccaacgc ctcctacctc gcctctctgc cccccagcgc cctcgactcc ctaacttgcc     19620
     cctccgcaaa atacctcatc ggctggtccc tgggcaaaga aaccctccgc gacggccact     19680
     acgacacgca caagggctcc tactacctca actgcgcctt ctacaaagac ccttccctgc     19740
     agggcgcccc ctccatcgac acagagttcc ccgagtacac ttccccgaat atctggccta     19800
     gcgagacgga tctcccgacc tttcggagca gctttgagca gctgtgtaca ttgatcattg     19860
     atacggcggc gttggtggcc agagcgtgtg atcgcttcgc ggtggagagt gtggatgggt     19920
     ataaggatgg gtatttggag aaagtggtga gggggagttt tacgacgaag gcgaggttgt     19980
     tgcattattt tcctactgaa gattcctcct cctctacaga atctactggg ggggaagaag     20040
     gggctgagga taatgatgat gactggtgcg ccacacacct cgaccacgga tgtctgacgg     20100
     gtctcacgtc cgcgatgttc gtcgatgagg aggcgcatga tccctcctcc ttggaagata     20160
     aatccgctcc gttgccggag ctcactacct cgccggatcc taaggccggg ttgtatatcc     20220
     gctccaggac gggccaggtc gtcaaggtga atataccgaa ggattgtctt gcgtttcaga     20280
     cgggcgaggc gctgcagctt attacgaagg ggcagttccg cgctgtgccg catttcgtga     20340
     agggagcgag gggagtcggt aaggtggcga ggaatacgtt ggctgtgttt acgcagccga     20400
     atttggagga ggaggtgcag gagggggtta cgtttgggga ttttgccagg ggggtggtgg     20460
     agaagacgtc gaaataggac tgagtgtgtc tagtttagtt tattgcattg gattagcttg     20520
     ctagcgagct tttggtatct tcttgaatat agtacagtcc agctcaatca atcatcatgt     20580
     cttacccgct tccgctccct ctctctctcc ttgtcaggca tatagttccc ctcctctgtt     20640
     tcctctgtcc cacctcgcag ctggtccatc cgtagcgtga agtcttcctc ttcctcttcc     20700
     gattcttctt cctcctcctc ctcctcctcc tcctcctcct cctcctcctc ctcctcctcc     20760
     tcctcctcct catcatcatc accaaccgac aaccgactcg tcccctcctc cgcctcacta     20820
     acaggattac tcaaatctgc actccccaac cccgtactaa caagcttact gagcttccct     20880
     accttcgcaa aattcgacct tgacttcgtc gacggccgtc ccacatcccc aggtatcttc     20940
     gcctccctga aatccgccgg tctcgccacc ccatccagca cgcggagatt agcccgccac     21000
     atcttcacgt ccctggcgtc gctataatgc cctacatcct cgccattcag tgagtcaatc     21060
     gcaagcgtct gcgtgcggaa atcgccccag aaccatttct gcccctccgg gatacgctcg     21120
     tcggcttggc gggagtacac ccgtccgcga agcacccctt gcaggtcata tccgagtgcc     21180
     agggatccga acatgagttg cagtgcgtct ggttcgtaga gccggccgag aatcatgtcc     21240
     tgggatatgt cgacagaggc gccggggtgc atgcggtacc agtcgccgta gccgctcatg     21300
     ccgacgtagt tgaaggcgga gacgacttcg tctggggtga ggggtttgat ggggtggagg     21360
     gtgttgctgg agaggtagat gcggcggtcg ctgggggtgt agaccttgcc gcggatgcgg     21420
     acgatgtatt tctccgcgag atgtttggat ctaagggccg agtcgcagtt tttgaggtcg     21480
     aggcggatct catcgattac cattatgtcg gtgacggctg ggttgggggt ggaatggggg     21540
     ctgttgaggt tgtagttctg gggttttagg cggacggcgt cgccgacggt gaggagctcg     21600
     gcgccgatga atatcccccg gctgtagatg gatgcgtcgg gccagacacc tttgaagtgg     21660
     tatttgtcta agaggctgaa ggaggacatg atggtcatgg cgtattcgat ggaggggtgg     21720
     aggttctcgc gagggatgtt ttggaggaag tgctcgtagg cgttgaacgg cttgatggat     21780
     ttaaggtaga cgtatttgta gtgcagggag tagctcttgt cgggactgtg agggtcaggg     21840
     aaggtttcga cgcggaatcc cgagtagttg atgctctgtt ctttggggga tgtttgaaca     21900
     atgtcttgga agatggtgtc ttcttcgggg acctgactga cgatacctgc tcgccattca     21960
     ggagtgccca gccatcgttt ctcgctggga aagtaaattt ggatctgatt gttctcaggg     22020
     ttccaggcta gttcgccttc gaaatctggc gtccagagca cgatttctcc agcacggggc     22080
     agaaaggacg gttgcaagtc caatttctgg atgtattcgt caagtggtga acgctcggct     22140
     cgccagtcca tgcttccggg ttctgtgatg tccgtctcct gtagcccttt tagctcaagc     22200
     tgtagcacag ccatcttgaa gacgtctggc gttccctcgt tatctgtaca agggcatgtc     22260
     gccgatcctg aaagctttcc tggaggcctg ccaggaggtc taccaggggg cctaccaggg     22320
     ggtcttccgg gtcttcctgg tggtcgtccg ggtggccttc cgggggtttt gcttgcgctt     22380
     gatccgggag gtcggccagg tggcctcccc ggcggcctac caggggttcg aataagcgtt     22440
     ccagttccag aaggtctccc ccgaggcctt ccaggacctc gcttttctga gccaccttct     22500
     gtgtattgct gtcagcattg cactggaagc ctggatagcc atggaaaaat accttgtagc     22560
     ctctttgaca ttttctcgca gagaacgcag gcgcatggtt cttggccacc cgtcatcagg     22620
     taatagaaat gcggaaagaa ctgcttcgtg gagttgaaat acacatctgt tggatggcca     22680
     tagaggaaac ggtcgtactg caaagagtta gggatgtgaa tgcgcttggg agtagagcgc     22740
     gaaaaaccta caatatcggg gtttgccata cgcggcctgt caaatagagc ataaccatcg     22800
     ggcagactgt ccaggatgta ttctactcct aaaagcaggg ttagtgaggt gaaaatgcaa     22860
     ttatgatttc aatatgctaa caaatgcagc gacatggctc ttttcctttc atttcaaagc     22920
     atatcaacta acgttggcct ccacatgatg gtacaattag gtataagttg cgccaaacat     22980
     ctcattatgg atcccgagta catagtccga aaggagtatt ggagaggtaa atcacgaaca     23040
     acctcaacag cagccgtgcg aagatgtaga gtgctcgatc gaagtaaaat aaggccaaag     23100
     taaatcatgc gatcaacgta ccacgctcat aagctcccgt cttttgcagc cacatcgagg     23160
     ccagcttctc tcgatagtaa ctatcgtctg gtctcaggaa cctctcatct ttgggccagt     23220
     tgtcctgggt gccgtcgctg aatgcgcgat tgattggaat tacgaccatt ttttgctggt     23280
     ctgatgcaga tgagtcttgc ataatgactg acattatagc agaaggggcg tgtttcccct     23340
     gcaggagtag ttaaacttag ataagattga aaataagagc tgggtataag ctgtgattag     23400
     tctgcacgca gaaggcatat tatgggttgg aaggaacacg tgacaggaac actgagtaag     23460
     aagaagtggt aaaaccaaag ggtagaaatt caggaggaaa ggagacaata agaaagctat     23520
     gcagcattga tgatagttga aatgaatgca tgggacgaga acaggatccg ctctgccgcc     23580
     gtgggtgacg gtcatgtgac tctacagatg ggtaaatcac caccacagct tcacaataac     23640
     atgtcaatct atttccatca tccaaaagtc taggcacaga ttcacccgga cactaattca     23700
     acatgcattg ataaacaaac agtggtcagt ggtcagtggt cacggcctca accaacctga     23760
     tctgaagtgt aggagagcct actgctggtc atcctgtacc tcaactgctt ccgactctga     23820
     tccatagggt ggtggagcaa gctctccttc ttcaacccag actttgcgta gctcgttttc     23880
     aatctcctcc cgacgctgtt tccactcttc caccttgtca agccgctttc gtatctcctg     23940
     cagctccttc tctactccca gcttctcttt ggcggtgccg attctctcga actcccattg     24000
     ctcaccctct tcgccaatac taatgctaag gttatatgtg tgatacttct tcagcgacgc     24060
     gcgtgtggag atcgtgatca cggttattcc ccgctccttt gcccgttgat acagcaggcc     24120
     ctcgacgtca gaagagaccg ctgaggttcc ttcatcgagg aaagcatagc gaggctcgtg     24180
     gtagtaaatt cgtgccaaag ccatgcgttg cttctctcct ccgctcaaaa cgtccttcca     24240
     ctccttgcga gtgtcccatc cgccctctcg cccagggagg tagcccagat gagcgtcgtc     24300
     cagaattttc tgcagtgcag catcggttat gcctgcctcg tgcatgtcga ctgcagtgtg     24360
     agggtagatt acttgatcgc ggagagtccc cacgctgaga tagggccgct ggggaaggaa     24420
     catgatgccg tcaagcccaa accctcttgg gcgactgacc aaaccgcggt acactggcca     24480
     caatcctgat acaacccggg caatagcagt cttgccgacg ccattcggtc cagatatcag     24540
     aagatggtcg ccggagtgca cgacgaatga cagcgactcg atcagatcat cgccaccccg     24600
     ggggtatata gaaggtgcga cgatgggaac ttgttcaaga cgtacaccat caaatccgtt     24660
     atgaatcgtc ccttgtacat ccgcgaggga atatagctct gcatgggaat tgcgtggagg     24720
     gtagtaggca cttgcatgca ctcggtggag cgtggatatc aagctgtaga cccgagacgt     24780
     gtacccagcc agctccgaga tgtccttgat actatacatc atccggccac ccgcatccgc     24840
     caaagacagc atcagacgtt tgttcgtaat aaactccttc atgcgatcgc gttctcgacc     24900
     agtctccttt ggcacgtcca ccagctccag ggcaccaccc atgccgcccc aggctggaag     24960
     gaatattggc agggacgtga tcaggtagcc aaacgcagac caagcgtatt tcaggatgac     25020
     gtcttctaac atgttgtagc ggatcttgag actgtaaata ccctccatcc agcgctggag     25080
     atctttgaag cttctcatta ggaaaaccct ttcgatgtct gcaccgccat agaaagaaat     25140
     ttcctcggca ttggcgagta accttgaatg tagaccccgg aagtcaccct ctttcttccc     25200
     ctcgacagcc tttagctttc cgaacggtgg cgagagtttc ctcagaactg ctgcggtact     25260
     gaagtaaccc gtgagaatac ccgtaagcgc cagaggcccg agagaacggt acaattgata     25320
     attaaacacg aataggtcca ccataggctt ccccatggac gaatataaag cggctgctgc     25380
     agaacagaag agggtaaggt cttgggtaat gaactggtct ggtccttggc caacaccgcc     25440
     atccagattc atcaacttgt agtagttgtt gtcgccagta agataaagat cgtggatata     25500
     tctcgttagt cgggtccgga acgcaataga cacctttgat tggagaaact tgatcatggc     25560
     attggtgtag gaagccaggg tgccaatgcc gcaccatttg agaatgcccc aagcgaaagc     25620
     gcgccctttg ccagcgacaa gatccctcac aatctcgccg tccagtcgtg cgatcagtag     25680
     agataggtac gtccgcaaga gcaagaaaac cccatggccc atcaataatc ctgtctcttt     25740
     gctaccccat ctcgggacca taatactccc aagactgagg aattgatgaa gaaatgccaa     25800
     attgatccct ggctttgtgg ttggcggcgg tatttgattc actgattctc cgtcgccgac     25860
     acgagcggca gcaggtgggt tcaagaacaa tcgccgatgc gcatcgaaag tcgtttgttt     25920
     ggtcggatga atcacaacct tggaggtcat ggagccctta tagggcacat agatggtacg     25980
     agtgccatct ttgcctcgaa tcccggaatt ccgacgcagc agctgtcttc ctcgtgcacg     26040
     ttctttagcc ctttccctga accatttgta gcctccataa ccagaaccca agatagatag     26100
     gatcagtgcg atcgtggcga tgatttgggt tgtctttgat gaacgcttga ttcgggagcg     26160
     aacgagactg gcatacttgt tgtacagcgc cacgagggga tcttctcgac gtcgaagggt     26220
     tgaatgagcg gccattattt ctcgtgtatg gccagaaaat cacttcaagt acagactgtg     26280
     ggcaccttat aggacagtgc cctcacggca gctggcattc ttaggccaga ctgtcgaagg     26340
     ccatcaggag atggtggaag cgtccgcagg gatgacgcgt tctatatcgt tccgtggtgc     26400
     aatttcgagg tcggaaatgc tgtgagcagt aaatatgggt aagaataatt gtggttgtga     26460
     gactgttgtt agcggacaac tcactcagga gctcacatta tggatgaagc tgacgatgtt     26520
     gtggagagtt gatgcatgtg aagacctcgg gccaacattg cggaggggcg gaggcgcatc     26580
     tcacgtgcgg agtccccaga ccttcattac atcaggattt agcatcacag agacctgctc     26640
     ggttatttta agaaacttcc cataagccta atatccgaaa aggtggtacg tataactttt     26700
     tagattgctt ctaggtgttc aagtattcaa tgaacccgtt gacatcatcc ggttgatgtt     26760
     gtggcactga atcatttgat ttcacagatc atgtaccaca tgtagtaaat gaggcaccca     26820
     aattgaatca attaatcgac agtaaaccgg ctgtgataat gctctgcggt attgaaattg     26880
     gcaggtccac tctctatcag tcttactatg gaggccctta agcgcccaac ttcctaaatg     26940
     ggaccaagtg cgctgcaacc aagaccagcc ggatagagaa gtcgggtacg attcatgcga     27000
     tccacaaccg aatagaattg ggggcatttt acgccgtgtg gaaggagggg tctgatcatt     27060
     gggatgaaag aagaaggtaa ttctcgggaa attacatgat ggtagctata ctccatgcga     27120
     cgaaagtacc tagacgagag tacggtagta acgaggtcac tggttcatct gatagaagta     27180
     gttgttatct gcatcgatag attgatctgg tgcaggtcaa ttaagcttca atagcgggat     27240
     gttgttggta aaatacaaga tttaccaata tcgcacgagg cacctaaatt tgaggtcagt     27300
     gcaggtccgg gagactttaa tcggagaacc atatggcagg ccggcacttt ggcaaccaag     27360
     aaagctcgga gagatcaagc gaatctggat cgttgtcaga tttgaacacg gcatttcttg     27420
     attccgatat cttggtctag ctcttccatt tgtcctcgat cttatggctt ggatgccagg     27480
     aactgaaggc ataaacgaat atcttgaaga acaaaaatag catccgaagg ctgcagtctc     27540
     gcacttgatg cgggggttgg atacaacagt ggggatggca tggagatcag gtcttacggg     27600
     gtaattacca gctccctctc ttgctgctga gtgatggtat acaagtcctt gccagcggta     27660
     caatccaggc tgtctccgca tacctgtctg aaaccaaaac ttgacaatca cttggatctc     27720
     aagacaagca aagtggtttg gagaatgcgc catcccttgt gtgtcaatga tcaaccataa     27780
     aggatattgg aatgtagcac ttaggtagaa ataggatagg aagattgtat tgttggggtt     27840
     gttgcttaac tcctacctag caaaccccgc ataatatgga tgactgcagt ggcatcttct     27900
     ttggcaggaa tggctatcac cctttgaagc ggaccgttat ttacgaacgt agggtaacac     27960
     aaacgaagga aaggggatgc tgatacctac agcgtataga acattgagac taggtatgtg     28020
     tgcaggtatg caagcatggg taggtggcta gataggatga tcgactctcc tctcgacaac     28080
     tgcacgggcc tatttttgtt agagagcatc tgattcgcag gcagtcccaa gtggatgcat     28140
     ggaatgacgc cccgggcgca ttatccgcca gccatggtga tgagcctttc cggactagag     28200
     catgttaatg gtcttggaag atgacccaag acctctaaaa gctagctgct gaacagggcc     28260
     ttggacccag cgaaggagga ataagattga cggcgacatg ggagacctga gcagtcgctg     28320
     aagccgatca cggtcggtga tagatagcca atggtatgac ttattccaaa cagaataacg     28380
     gatgatgcat gtcttgattg accttataga atgctagagg gcttgaagat gttagatgtg     28440
     agcggattcg tggtactgtg ttagggcatg ggggtttttt taggctgagg gctggcagga     28500
     cgaaaagcga atgaagatac tgatttcctc ggagtggagg tgcccgtcca ggatctcagt     28560
     cccagaagac tgtaatttcg actcgatcct gtattaggag gtactgatca cccacaatag     28620
     ctgtaagtta ttcttgggcc ttgcctactt ggtattggtg ctgcccgctt ggctgagcag     28680
     gagaccgtcg tcacctggaa ctgtttccgg ggtcttgaag aggatggagg gagggccagg     28740
     gtgtaggtct cccatgattg ttaaggtcat gagggatgag aagctgcagg ttcagtgaag     28800
     gtggtgtgga ccataaattg acccgactcg tgcagaccat actattacgg aagagagatg     28860
     ttacggccaa agaaaccacg gccccctccc aaagacacca tcaaatgcta gcagatatgc     28920
     acgacggcta caggtcctct aaagggacta ttgagctgcc agatataccc cagcctcacc     28980
     ttgtcagtgg tggttgagac caccttgact cttggctacc tccgattcgt cctagaagcg     29040
     cccgcggaat aaaagacgag caaggtccct gcaccaagcc ttctgggggg taacaatgat     29100
     aacacttact ttcgggcttt gctatgtgat caatgagagt aattattgaa aataaaatca     29160
     gactttcata acttctccca attttggtga tatttctaac tgggtgcgac tgctacatag     29220
     gacggcatag gcctgttcac gagtcggaac gtgttccgga tgacctcgag tcgaaggcta     29280
     ctacatacag aggactactt actacctggg accgggctgt gggtaggcgt gtaactaact     29340
     agcttctgcc tatgcatgaa ttacatcagt ctgaatcaaa tgaagtatgg gggatcctgc     29400
     tggtatcctt atcatccaca tgtctgtgca atagtagtta atctgaattc tctgaggagc     29460
     gtggttcacc atcaccatgg gtgccggcaa agataagttg gtacgacaga cctcatagtg     29520
     attaaccggt tccaatgggg ggtaatcagg gcgtgcaaac ttcaaggtac ggggcatctc     29580
     ccgtcaaatc aggcccgaac ctgctgcgaa tggagactga acctccgtcc caatgctgga     29640
     ccagccagtc gtagcagttc tgagagtgtc tggccccaat tctgcagccc tgcatctttt     29700
     ggtccagacc agacttggcc tgtgttctcc cgctttttct ttttccattt ttcttccctt     29760
     ttttcattcg tcttttctcc tggggcccgt actaatttct catgcggttt ccgaggtctg     29820
     ctgctttcct cttacccctt gcccccccgt ttccctaagg cacatccgag catccatcaa     29880
     tgctcgtccc tatttaacgg tacctcctgt atctctctgc acaactggtt agttaattta     29940
     aggtcagcgc atagcaacac gaatggagta attttaaatt atttttcatt ttctgtctct     30000
     tattattatc attcctgtat tataattgtg ataataataa taatgatgat aattttggtt     30060
     ttattactat catcattgct gtatttgccc gcccacttcc acctccctcc cctcccctcc     30120
     ccttctcctc tctcacccct cgggctctgc gtattcttct gctaattccc tcttactcta     30180
     tctttcctct tttcgctctt attccctttc ccccctttcc ccttcgtctt tctctctctt     30240
     aaaccggtta gccgccagtc aaggagctaa gaaataagcc actctccact atcatcaacc     30300
     ggcttgcttg accacatcaa aacaccaccg cacctgggct gattcccctt gacttccgtg     30360
     ctcccctgtc gctcatcccg actgtagaaa aaccgtcatc agaccgtcca actagtggaa     30420
     acaggtctct tacctagtcc gctggctaca cttttttttt ttttttgaca cttcctttgc     30480
     ccatcgacta agcgaaaggg acgaacccac agcacaagaa atccgatcac caaccgccga     30540
     tcagattact ttctcggggg gcaccttttt agagttcctt ttcaccttaa cttccctccc     30600
     gctggccagc aacccgtcag ccccagtgca acaagcgatc ataccctaga tcgtttacgt     30660
     tacagctatt attcctctcc aactaactaa ctaactaact aacccatcta ccgggctgtc     30720
     tgaccggtga cctttgcctg aaccttgcct aaaccttttt atcacattct actactccgt     30780
     accattctta aatccaaaag gtcatcacga gtcaagaggc gccctggccc aaccacgtga     30840
     tcccctactt tcaaacagcc tgcacttcac acgctcgaac ccttccattc ctgcgatcat     30900
     ccccagactt gacctccaga tcgtgccggt cgcatatgct tttatgctcg tctgccgccc     30960
     tgtatattct ggacattgga gggcggattg attggatctg ctcatagcga acgagttctt     31020
     tttagtgctg cgcactagcc ttattccagg cggtggtccg ggtcccagag ctaagcaact     31080
     cactggtact accaccttag taacctgcct ccatcccatc cattcagtac gtgcgaagag     31140
     ccaggaggcg tgactgcacc ctctctctct ctcctcatct tccttgccgg cgcaaccccc     31200
     ctccctcccc ttctcggcgg taaccctggt ggtcattgtc ctccgactcc tctctatctc     31260
     gctctcgctc tctcttttct actctcgcca ctcttcttcc ccttggcctt tttggttttc     31320
     ctgtcggctc agtgaacctc gctctgctac cctcaatgct cggagggagc ttggagcgag     31380
     attcttcacc atcaaactca aaaccgacca ccggagaagc gcccatgcct atcgcgacga     31440
     gccccccgga ctccagtaag tttccaacac cgttgtttcc tggattcgca gtaaaattct     31500
     ccgatgcgct tcggtcggtt ccgagtattg ttactgatat cttcttggtt agatcctgaa     31560
     ccgtcgcctc aggaccagcc cgccaccacc gatgcgtcgc ctctgtcgaa caatgtagag     31620
     cccaccaatg cggctcaaga gtccgtcgca ccggcccagg gctcggtaga cgagtctgca     31680
     gccacctctg ccgacgcacc gaagaaacat catctactgt tgcccatttc gtcgcgtgca     31740
     tccttaaaag cggatcgaca gtctacgctg gacaagagtc aagacaccgc ccacgatgac     31800
     tccgagaata ctcttcgcgg ttcgaaaaga agcatcttca aaggtcgtag ggacaggagc     31860
     agaggcagca gtatgaggtc gcgtcggcag aaccaggagg gggccagtat ggaggaagac     31920
     aagtcggcaa gccctgactt gcgtgatccg gccaagccag agaggagaag caaggtctcg     31980
     tataggttgt tcgctttctt gagctgttgt tcctcgccca gcgatgattc ggaggaccct     32040
     gccatccccg tgaagaggac atccagacag ccatcggtcc cccacaccca ggccactccg     32100
     gagaaggccg acgccaatgc tggtgattcg agcaccgcgg aatccaaaga cccaagctac     32160
     taccgggatg agaaacccaa catgaccgtg acgtcgaacc agtccatgtc tcaagtggac     32220
     gaagagcgca ctgtgactac ttccgagcag ggcgctcagc tcgatggcgc aacggtacct     32280
     tcgggcccgg cagagacaga aaaagtaccg gccttgccac aggacagtgc tgattcacag     32340
     gggcttggtg taggccagag tactcaacct tccaccacga ccgccgaagc gagcgctgtt     32400
     gccagcgaag cggaggaacc cagtcagaaa acagaggagc agataatttc tacctccaca     32460
     gagaaggctc aggatactcc gactgctcct atagaactgg atgaattgcc taagcccccg     32520
     gcgtctgaaa acagctatga cgacgagaag tacacttcac acgatgagga ggcgacagta     32580
     cttccagccg aattgcctcc cccgacgggc ccatccggac accacgtcga cacaatgcta     32640
     gaggagacgc aacagcaatt cctcttgcca ccacctcttc cccatcttcg ggacaggaaa     32700
     tgcttggttc ttgatttgga cgagacgttg gttcacagta gtttcaaggt ccgccctccc     32760
     cagattattt acccagtgcc agactgacac tatgttcagg ttctcgaacg tgcggacttc     32820
     accattcccg tggaaattga agggcaatat cacaacatct acgttataaa aagacctgga     32880
     gtcgaccaat tcatgaaaag ggtgggtgag ttgtacgaag tggttgtctt taccgcttct     32940
     gtctcgaagg tgagttattc caagacgagg gttgtcggct acgcattcgc tcacgcttca     33000
     ttagtacggt gatcccctgc tggatcagct agacattcac aacgttgtcc accaccgact     33060
     gttcagggat agttgctata accatcaagg caactatgtc aaggtttgtc tcggccagct     33120
     ccattccctt gcgtgactag gatgctgatc cttgtgttag gatctttctc aagtaggccg     33180
     cgacctacgc gacacgatta tcatcgataa ttctccgact tcctatatct tccaccctca     33240
     acatgcgata cccatcagca gctggttctc tgacgcccac gataacgagc tacttgatct     33300
     gattcccgtc ctcgaagacc ttgccggggc acaagtgaaa gacgttagtc tggttctcga     33360
     cattgcattg tgatgcctgt aactctagtt cttctggcat ttgcattaca gcatgcttat     33420
     cttcacattg cgggtccagt cggtttccaa aaagaaagag tcgtctgatc tttgttcaac     33480
     tatacgcatg gaacgtctgc tgggtcgagc aaccagacca tccgggcagc tcactccagt     33540
     cccgtttgga atcggaacac tcgcggcagt tccaccatga agatgtgttc ccctttcctg     33600
     ttcttcccct ttttgacctt ttttcctttt accccatgtc acttgcaccg tttttcttcc     33660
     gagcaccggc catgttcttg cgctcccagc gagcagatac cagattaccc ccgccagtct     33720
     tgtttcctag tgtttgaagt ttcctttctt gttgcatacc gcaggcgtca gtcttggtca     33780
     tcagccaaaa ttttgctgat ctcatgtata cgctccccga tttacattcc ctcttttctt     33840
     tcatctgtct ctttctactt ttggttcctt tcatcgtctc cattttgttt cttcttgctt     33900
     aacatgtagc ccatacgagg ctcgacccac cgtcctggtt attttcctag tctccttgtg     33960
     cccgaagatg tggaccccaa aacccagcgt tgtttttgtc attggtgcgc catggtctgt     34020
     tttttggtaa ctcccttgcg cgtggcattt tgattcatgt ctcaagcgcc tgtcgctgct     34080
     tctggtacac gcatagtctg aatggtcccg gactcttttg ggatcggcga ctttgcaatg     34140
     tatatgtact gattgggcgt gcgtgctgta cataaaagcg tccgcctaca ccattcagct     34200
     tgtcccgtgt ttaagtagtt ttgaattgac catttcacga gacggcagag ctccaagtaa     34260
     tatttagtct agatcagaag tagtgagaaa acgagaggca gtaacgcatg taggcagggt     34320
     gattggcgat atatcatgca tctacagcgt gaagtggatc acctcccacg gcgaaggcgg     34380
     gctgggatca cgccgcggca ataatgaccg atcggtcatc ttcaaatctt ccatcgatcc     34440
     cgcttttgtc cgcactacat cgtgtcagct catgtgagta ttccccgatt agccccgtca     34500
     taaagtcttt catacatata tacatacata tttcccctgc aaggctgcgt ccgttccctt     34560
     gagcctccat ccaaagctcc gacgatctcc taatatttct tggcagcgtc ataccattct     34620
     ccccgcctcc gataccatca ccaccatcaa ccactttttt ctcgcaggac ctccctacac     34680
     acacgcgccc acaccccatc gctcaccatg aaggacaaga acggctggga tggaaagcta     34740
     cgggtcgaac ccaaagcgac gatcacgaac ccggaagcgc tagaagaccc cgattactcg     34800
     gactcggatg cgccgcctgt ggaggagatc gaggccgatg agggtatgtc catcattgcc     34860
     catatatacc gggatgctgt gaactggtat aacggtaacg cgagagaaaa tatactgata     34920
     gtgggtttcg tatttagatc tattggagga tgaggacccg gacgcagagg tatacgctga     34980
     tacttnatcc gacgcgacgc gttggttgat ggacacaacc agctagctaa cacatctcac     35040
     atcaggaaat cgaccttgtt cactgtcgca taacttcgat tccggcgttg cgattggagc     35100
     ggtttcccaa ggtgaaggta tggcaggagt gcccggcatg tgtgtggccg cgcgacccag     35160
     tgctaataga acggtgaatg gtatagagac tatgcttccg acagaaccaa atctcgcgaa     35220
     tcgaattccc cacggaagtt gccaaatcgt tgacggaact cgatctctac gataacctta     35280
     tatcgcatgt gaaggggctt gatgagttcg agaacctgac cagcttggat ctcagcttca     35340
     ataaaattaa acatgtcaag aatatttcgc atttggtcaa gttgaccgat ctgtactttg     35400
     tgcagaataa gatctcgaag atagaggggg tggagacgtt tacgtcgttg cgtaatttgg     35460
     agttgggggc gaataggatc cgggtgggtc ttgaatgtgc ttcaagtgat gattggggta     35520
     ttgttctgac tggttgcagg aaattgagaa tctggataat ttgaaggcat tggaagagtt     35580
     gtggttgggg aagaataaga ttacggaatt gaaggtccgt ggattgcatt gtgattctta     35640
     ggtgtgatat gcgttggctg actgaccggg gtgatgatat agaatctcga tggcctctcc     35700
     aacctgcgca ttctctccat ccagtcgaac cgtctcacga aaatcagtgg gctcgcgaac     35760
     ctgaagaacc tggaggaact ctacgtgtct cataatgcga tcaccgacct cagcggtctc     35820
     gaggagaaca cttcgctgcg cgtgctagac ttttccaaca accaagtgtc caagctggaa     35880
     catttgtctc atttgaagaa tctggaggag ctgtgggcgt ccaacaatca actgtcgagc     35940
     ttcgatgaag tggaacgcga actccgggac aaggagaatc tccagacggt gtactttgag     36000
     ggcaacccgc tgcagacgag agcgccagca ttgtatcgga ataaggtgcg gttggcgata     36060
     ccgcatatca tgcaggttga cgcgagtaag tcctatcgtc tatatctact aatgcttacg     36120
     gagatactaa caaaacccaa tgtagcgtat atccgcgtcg tgtaagggaa caacctatgt     36180
     tcatcttctc cataccatca tcaacatcat ccataactac ttatctaccc acctacctac     36240
     ctactctatt agaattacaa taaacgaagt gacgtaccgt agcccgctat acatacatgt     36300
     acaacccacc gacccaacca aaaccaatgc agtattatac agagaacgaa aacaaatcat     36360
     acaatcatca aaccacttca cttcacttcg tcccctcatc ctccccatcc ccattcccac     36420
     tctcctttcc attctcactc tccatcccaa accgatacaa ccccatcaaa ctcttccccc     36480
     caaacctcca cacatcccga tccagcattc tcttcacccg ttccggcaca tgcgccttcc     36540
     tcctcatcgg cccatccgcc aaataatcca acggtatccc gctcttcacc agatccttat     36600
     acatatggct ttccttgtcc acgtagaaga acgtatggta agggttgcgc gtcatcgccg     36660
     agacgtggtt atgccgcgat ggttggatcg tgcatgtcag ggtgtgtggt tgttgcgtcg     36720
     tttcttggga ttgcgttgct ggtgatgctg tgtggtttgc attggaggga gattcgtctt     36780
     gactctgggt ttgtgtttgt gtttgtgttt gtgtttgtgt ttggttctgg atgggaatgg     36840
     aaatcggcga tgccgcaatg gccgaagacg ccgcggatgc ggactcgaag atggcgatgg     36900
     tgttgtgcgc ggatttgggg gatgtgtttg tggggtcgta ctaaattcac catatttctt     36960
     tagcattggg tttatgtatt taggaaaaag gggggtaagg ggggagaggg ctacctttag     37020
     atttcgaaat gtcacgactt cgccgaattt ctggagtgcg gagagaatga gtttgctttc     37080
     ggagagggag cgcggggcgg ggtgggtttt gatgtggatg ctgctagtta agggtttgag     37140
     ggtcattttg tctttattgt gcggttctta ggattggagt tgaggggggt gtggtgggat     37200
     gttcatgagt aatgaatgga tgaattgaaa gggagagaga gggtaatgga tgaatggatg     37260
     gagaaatgtg gttatcgcga cgcggtcttg gcgggtttat ctattttatc ttatctatta     37320
     tctacatgtc acatgcatca agtataacat ctaagttgtt atgtattcat atatatcata     37380
     tacactcata gctgaatggt ctagaaaata ggagcgtaga gtccgtactg taataatcaa     37440
     gttagcaaat atccccacgt atcaaataaa aagcggaagg aaactcactc ccaaaggatc     37500
     attgaaccgc aacccgcgat ccaacccaga aatagccttg atctcctcct cctccaaatt     37560
     ccacccagta acatccaaat tctgcttcaa ccgctgaggg ttgttactct tggggataac     37620
     agcaatcccc ctctgcgtcg cccacctcaa caacacctgc gccggcgtcc ttccgtgctt     37680
     ctcggcaatg ctcttaacaa gctgatgctc gaacagcggc ggcgaatcca ccgcattctg     37740
     cacactcaac tcgaggaaac tcaacggacc aaaagaacta tacgccgtaa ccgtcaaccc     37800
     ctccttctgg gcatactcga ccaatcttgt ctgcgtgagg tacgggtgat gctcgatctg     37860
     cagcgtggca ggacgaatgc gcgcataccg cagcagatcc atgaccagct gcgcagagaa     37920
     gttactgata ccaatgctgc gggcaagctt cttgtccacg agcgactcca tcgctgtcca     37980
     ggtctcctgg atcgtggcgt tgccgaactc cagttcgtcc ttctcggact tccagcccgg     38040
     cgggtagcgg accgcagggt cgacgtattt cagagagatg gggaagtgca caatgtacag     38100
     gtcgaagtag tcgatgcccc agtcagcgag ctgcttgcgg caaatgggct cgacgcggtc     38160
     gccatcgtgg aagctgttcc agagcttgga gacgatgaag agctcttcgc gcttgacgag     38220
     accgtcttta atggcgcggg cgatgccttg gccggcttcg acttcgttgc catagtctgg     38280
     tttgcgtgtt tagattggga attggtagtg atttataagg ggaggggagg gtagtaccgc     38340
     aggcgccgtc aaacagacgg tatccttcct tgatggcgtg gtagatctgg tcggcgcagg     38400
     tgtcgttgtt caccttccag agaccgaagc ccacgagggg catgtcgtag ccgctgttta     38460
     gctttactgt gggagaggcc atggtgatta aggagtaaca aggtcgtgtt gagacaaggt     38520
     atagagacgc ggtcgaagca ggatcagggg gggatgaagg gagagaaggg gaaggtttgg     38580
     aggggtaata agtaactacc cctcggtcat ggcattatga acttaatcca ttgcgcgtat     38640
     ccactggagg cgccatacac ggcacggaga gcggcattgg aggctaaatg aagttgtggc     38700
     ggctgttttg aactggggaa gtaacttatc caaaggctgg ccggaagcca tccaaagtcg     38760
     ggcccggcta aattaaccca tttgccggct aaatgcacgc cactcaagac cctaatcttg     38820
     cttttctacc attactacgt ttacaacttg gaagataata ttactgggat atttgtaata     38880
     agaatagaat aatcattgtg aataaaaggt atcctgccat tattatacac tgcatatgaa     38940
     tcgaagatta acccgcccat cacattatta gaaatacttt ttttcgcccg taattatcat     39000
     taagtattct cgcttggcct gttcattaaa cggcctgtac tgtattactc gcggtgtaag     39060
     agtgcgcgtg ctcatgcgct cctccgttca tatcggtcgg caggctgccc ggccacttat     39120
     caagctcctc aggcataaag tcatagctgt ggctgggatt tggctcacgg ggcaccgcaa     39180
     catggtgttc ggatgacggg tagcccatgt gcgggtagtg gctgccgggg atgtccccag     39240
     acattgcagt ggttggtggc atccaagatg cctggctgtt gttgatatca tcgatagact     39300
     gtgcgctcgt caccagcatg ccattcagca aggcattgtt atcgtgcaca ttgaccccaa     39360
     gtggctggct gtggacatag tggctatcat gctcaaggct gtaaggacca tgcgtggaat     39420
     gcgacaaagg aacttcagac atgctaagga tgcttgtgcc actgttgggg ccattgagac     39480
     tagtctgctg gttgatatca tgtgattgta ggcttgggaa ggcatccaga cccaaggtca     39540
     cggcgatctt atcgttgagg cggtcctctt gcttaagggg actcatgaaa tcaaaaggcg     39600
     cgttgaacat ttgagcaacg ctctcctggc ctgtcgaata cagaggccaa gggttttgag     39660
     aaactccgtg gttatgaagc agctcgtggg attggggttg gtggtagaca ctagggcccg     39720
     gccggttcaa gagtatcgag tcagccagcg acatgggagg agggagatcg atgcccgtcg     39780
     ctgccttggg gctcgcgtga gggattcgat ccgacgaaac cactctacgc catgtcgtgg     39840
     tgccgactac gtcgcgaggc agcgtctgtc ggaacttcca gaggataatt gccaccctct     39900
     ttttctcact cacggcatgt ccagagtaag ggttggacat tctccgcgag ctgtagggtg     39960
     ccatagcccg gatctcctgg actacagtca ggtggcggag gaactcccta gcttgctcgt     40020
     ggccatggtg tccagcatcc tcggccatct tttgatcttg cgtgagcttg gtgaagcgat     40080
     tcgcccacca tttggattca aagtggggct tgaccttggt gtgcgtcgcg gtgtgcacag     40140
     gcctcgcgac ttcctggcgc ccttgataga tctcttggcc attttcatac atgtagatct     40200
     tggaggacca attctccatc tcactgagga tcggaacgcc agccgcactg gcctgggcaa     40260
     aatctaattc caagtgaatg ccgagtttag agcgagcagc cgggaagtcg tccatcaact     40320
     tcaggttggc ttcgattaag ataatgtcgc agtccaacga cccattagaa ttcgccatca     40380
     gcgaattgag gtaaggaaaa gatgtttgcc agttcctgat ttcattcaag gagattggtg     40440
     cgaccggatg gcgctggtcg tcttgaaggc gactgtagat atggctcgcg tcctcgatac     40500
     gatcattctt gtctggctcg tttacccaca taccgaaccc gaggccttga atagtactga     40560
     aattgctctc gggccagctg gcgttcatgg aaaatggggt aggcggcaga tctcctccat     40620
     aggcctgtct catagggtca tgataggtgg ggtggaggtg agtgccataa tgacttgaca     40680
     agggaggatc catggcaggc ccccatcttg gaccagcggg cggatgttgg ttgttcgagc     40740
     ggacgttcgc ctcttctcgt acgagtcgct cccctagaca cttttattag accagtccga     40800
     cttgagtatt acttgaatat gccacttaca atcggggtct cctttgagga acgagtcgag     40860
     gacttggagg tggctggaga cttgctttct agttcttcgt ttaccagttt tcttgtagat     40920
     gaactcagca atgagctcat ttcgaccata tgactttcct cgctcggacc atttccgtct     40980
     gcccattggc ggattcgcct cgagagctat cacaacatta gctttcatgt accgttcatc     41040
     tgaagcattg acttctcacc ttgttgaaac gcgtcttcaa gctcgtccga ccataccggt     41100
     tccccatctt tgccagtgtc tcgacgtgga cgggacctgt actccagata cttgctggac     41160
     ctgagatagc ttctgggcct gctacgagga ccgattaggc tgggcccaga taaatgcagg     41220
     cgccggagct tcttgctctg gagccggagg ttctgagggg gctgaagggt ggtgggaaca     41280
     gtgggcactg gatgtgttgg aactgggggt tgaggatact tgaaggcaag ttgctgcagc     41340
     tggtcgtcac gaccaacagt gctgctgtcg gctaggttgt cagagtatgt ctggacgttc     41400
     ccagaggtgt tctgcagggc cctgtccgta tgggcaccga tgctctcaag agctgactgg     41460
     tgttgaggca caatacaccc cgtttgccag tgcgccatcg agcggaccac cggagaggat     41520
     tgactctggg aaagaatgac aaagaatgcc aaagaggagg gtgatggagg acagcaaaat     41580
     gctttctacc gccgtaccaa agaaccagta gtcacaaacc agcgatcaag aacgtagatg     41640
     cttggagaga atgtaagaat tgggaaagag aatgtgggag cgaagagcat ggtgtttata     41700
     ggaaaccact actctccctg gagagggagg cctagtggca tagctgaatc acgctgctcg     41760
     ttgatacacc acccctccaa gggctatgtc aactgttcaa ggcggggaaa ggaatctcct     41820
     cccaagcttc acgcgtccag gtcgagctat gaacgaagga agatcctgtg tccgagcaaa     41880
     tcaggaggaa aggaactgca cgatgggaac gagcggaaga cccatgcaag ggatgctccc     41940
     tgagcacgaa ccagtgagct gctcctcgga ggttttagtg cacgagacga gcagtgactg     42000
     ctaatttgag atacatttag gagcagctag acgtccaggt ccgtggcaat ggccatcctc     42060
     tggaatgagc agtggccaac gaaatcgtcc agtgccacgg cagtggaatg taagaggtgg     42120
     ttacgtagat catgttggaa tgtatggcct ggacaatccc aggaccagac taatcttcac     42180
     ttggataacc agggctcgag caactaggtg tataaggagt taagggaagg aagccttgaa     42240
     tcggcgagga taaaggaacc cgcgatggga tgacaggaat agactcggat gaaagaagtc     42300
     cactgcacga gcggacgggt aactctgcag gacgcgcgcg tgtgtacgtg ttgacagccg     42360
     caggaacgtg ttaaacctgc gtccgcacca tgctcagcgt ccgggaacgc aagggatatt     42420
     aatatcaaaa tcgaaccatt gctattgtct gtccctacca acagggagaa agagtaggga     42480
     cttagtcctc ttcgccgtcc tgggccccta cagtgaactt cttgcgccca ggcccggcaa     42540
     gcttttgtag cttgaccctg tccatctgtt cccctacttt cttttcgatc tgcttgattt     42600
     cttcctcggc atcgattgcc tcctcgtttg caaactccag gaccagcttt ctgcccagaa     42660
     gatgggtatt cttcaacgcg tccatggcgt tttccgcttc gcgagcgctt acaaaatccg     42720
     caaaaccgaa accacgagcc gatctatcaa acttctgagg aacccgcaca gagcgaagtt     42780
     gcccgtaggc tccaaagagt gaccgaacat ccttcttggt ggcctggaac ggcaagttct     42840
     taatgatgat cttcgtcctt ctggctgcaa ccttcttcgc ggtatcttca cgtctccgct     42900
     cttcagctgc atccattcca cggtgagaca ccctaactac cagttcatgc tgatcaagtt     42960
     tgtagccatt catggcggca agcgcagatt gagcctgggc ttttgacctg aactccacga     43020
     aaccaaaacc catgctgagc gtctgtccag gatgcttagg gtcaggcttc gtcttgatct     43080
     tagcagacac aaagccgtcc agtggccgga agaggtccac aaaactctgg ttcgtagtag     43140
     caaagttgag gttctttacg aagagggttg tagtgggcgt aaggtcatca acctcatctg     43200
     ccgcgaaagt gtcagcagtg gagaagcctt gagagacagc cttagtctct atcgttgcct     43260
     tctgtggcac gactgcagca tcaaacagat ccttgggtgc cttctccagg aagaggatgg     43320
     agtctccgag tttccggtag gcaagtccct tgaaagcctt ctgggcctca tcgggtctcg     43380
     aaaactccac gatagctatc gttccactag ggggcatgag taacctcgtt atttgcccga     43440
     atggttcgaa cattttcctg agctcatcag tcttgacgcc gtacgagaag ttctttacaa     43500
     ggatagcagt gtttccacgc tcccgctgct tgaaggcttc gatattaacc ccattagctg     43560
     agaagtaagc tttcgtttct tgaattacgt gggtttcagc gtgggcctgc ttcacagcag     43620
     catcagatga agtaggatcc aaaagatctg ctttggaaac accaagtcgc tcagctactg     43680
     aagacataac ggcatccgtc tgcaatatat tagcgtatag tactggcggc tatcatacga     43740
     gctactcacg ttcatgtaga gagagttcca gctaaacgta gaagacgaag catccatctt     43800
     ctttttgatc tgcttttgct ttttcagggg tagtttcgcc agctccgcat catcaatctt     43860
     gtaagtcttc tttgcagctg ctggcagaat atgcatcaag cgaccttgga agtgctttcc     43920
     gtcaagattc ttgtaggcct ctacggccgc atctgcgtcg aggtactgaa tataggcaaa     43980
     gcccttgctg gtattaaccc tagtatcgaa agccacatgg atctaggcac attagcataa     44040
     ttcaaataac taatgagtga atcaagcaac aatattgagg tgtatagctc atcagataac     44100
     aagaggcatc tactaaaata ctctttcctg gtaacatcat gtgctttgca tctgatgtcc     44160
     ctatcaggac gatcatcatt gagctgggga gggggtcgtg gatggcagaa aataaaactc     44220
     atggattcac taacctcttc aattcgtccg aagggagcaa atagcggttc aagatctgac     44280
     tccgaggtgt cataagcaag gtttcgcacg aacagacgtg cagatagacg gatattctca     44340
     atattcgtgt cgacctgcgg ctcctgaacc gtcttatcct cagtcgctgc gggagcgaca     44400
     atctgggcat ccctagagtc agcacctgga tcctctgctt cttctggagc tgcagattcc     44460
     ttctgctgcg cagcagcgtc gaaatccgcc tgctcttcct catcaagcag accaagaagg     44520
     cgacttgtct tggagcggag ccagtccgca tccgaaacag ctggcgcctc agcctcggcg     44580
     acagtatcat cttgctctgc cggtgcctcg gcgttgcctt ctccactgtg gtctaccacc     44640
     atgggttcag gtgatccatg agcttcgcgg tcagctgtgt gcatctcctt agagtgatca     44700
     tattcctcgc caagcttcgc cttcttcctc tgtgcatagg taagctcctg aggttgctcc     44760
     tctacttcag cgggctgttc tgcaggtgag tcattctccg gcggcttggg cacatcatca     44820
     tttgcccatg tcttggtctt agacgaatgt tgcattacag agagatactc ttgcaagcga     44880
     gcgtcttgcg gggcgttctc gccatcccgt ttacgcttga gggaagtatc tgcagcattg     44940
     ctagcagaac tcttatcatg ttttccagct ttgcgagtgg gttcggcatc gatctacaag     45000
     attactggtc agtcacaaga ccaccttgac tgtcagcggg gaaaacaaaa gaaacaaagc     45060
     aagtgggaat agggagtaga gcacataccg gcttagcaat gtctactgag attttggaca     45120
     tcttcacgta agtcttattg aagtaagaca cagcctgctg ggccacctca tggctcttaa     45180
     agcccacgaa gccaatcctg cgtttaggca atacatgagc gtccgtgact tggaagcgag     45240
     tagcgaagtg cttcctcaat tgatcatcag acaaggttgg cggaaggcca gagacaaata     45300
     ctctggtgct ctccatgatt gtgacaatgt gtgccactaa aattgtatgg aaagaaaaag     45360
     ttcgaaaaaa ttttggtgga atgttttttt ttgcttcctt atagtgccga gggcggtgag     45420
     gatggcggcc tggcccgtgc gtgatccggg cggcgtccat tgcgtgcagc cagcaatgtt     45480
     gattcccaat acttccattg ggcttcgtgg gacgtctgcg tacactaaat taatagcgct     45540
     tgatcgttgt tttgaatcct tgctcattca acctattact acattcctca tcgacgtcca     45600
     gcaaaatggc tagcgaaaag aaagataagc ttgagggtaa gtccccggac gcggcattgt     45660
     caaatgatgg ctaacatgac cgttcagcgc agatcaagtc cgtcgatatg gtaagaggaa     45720
     ttgctggagg taaccaagaa ttgtgcttac aacatggcag acggaggata tgcagcagga     45780
     ggctgttgaa gttggtatgg tcagccctac gggtcacctc gaaaaggagg gctaatacaa     45840
     cggctagcaa ttgaggcaat ggacaagtac cacattgaga aggtaggttc ggtgtcatct     45900
     gttggttgac tatgctaacg acagcaggat atcgcccaat acatcaagcg agaggtcagc     45960
     attgcgcact gtatccggac cacccctcat tgctcacaat ctacagttcg attcgcgcaa     46020
     gggtgcgaca tggcactgtg tagtcggaag gaactttggc agcttcgtca cgcatggtga     46080
     gtgtcatggc cagggcatca ggggtacggg ctaactttcg agcagagacg aaacacttca     46140
     tctacttcta cctcgggcac tgcgccatcc tccttttcaa gacccaatga acatacgacc     46200
     gcagacaccg gtctgattcg ccaaagcgat gtctataacc ctttcggata attcaagcag     46260
     aagtatcgtg cagtgaaagg tcccatgcaa gagctggaag gaaatgcagc catatggtcc     46320
     aaaacggaat gctgtggggt tgcctagagg gcacaacgag gcggtgattc ttccgcgcat     46380
     ttacctgcta cttgattcaa attctttgtt aatcatttca aaatatccta gtgaatacaa     46440
     gttgatccaa tcgcagaact actgcagcgc tgtaccgtag acacgtagct tttccagcac     46500
     gcaggctaca ctgctaactc actatatata taatgggacc gcagcaactt acgacaccgc     46560
     cgagtgcgga acgccaagtg ccaaaccgcg ccaagccaca gcgccacacg tcagccccaa     46620
     tcagtttatt atatggctgc ctcccccttc ccattacttg ggctgctgcc aatgttgtcc     46680
     ttctacacgt cgcattacat gatccaacac gatcccgatt cctgtcattt attacctcct     46740
     tagttagaat ataccaaccc acccgttgtc tatcctggga gcactccaaa gccgtaaaca     46800
     tggccatctg catcaccttc ggaacacatg gtatgtgact tatctactcc cttccctcct     46860
     agttactcca cacgaccacc gaccggggcg acgaccatct tgagcatcga ttccacaaga     46920
     acccacgacc aacaaagagt atgccaaaac taacaccaaa ggaatccaga gttcacttcc     46980
     atgctagaag gatacgagaa tgtccgcgcg ttctgctata actgtgagcc cctggaccct     47040
     gacaatcatg actgctaatt ttagctctgg ttcctgatcc aaccaataat taaatcgatt     47100
     attgactgac ccgtcttcct tttgatctag gccaacattg gaatggtcat tgtttgacga     47160
     gatggtaagc ttcaacttga ctaatttctt agatgggaat atgtttggag gtgtatgcta     47220
     atgtatgatg atcaactagg ccgtggttca ccgtctgctt cattgtaacc ttgtcccccg     47280
     tccacatgac ctcggaccaa actgaccgta catacttata gcctgtcatc cctctcgcaa     47340
     cacataagta caaggtatgt taatagactg ttctctcctc tctatgcacc ttggatggcg     47400
     taaactaata tccttatagg aagtaacctg ctatacatgc cgcttcacgc aggatctacg     47460
     gtaactccat tcctccctcc aacctaccca aggagcaggg aaggatagaa actaacactt     47520
     gtttccagcg accgtcctga tatcacacca gatacaagac cccctccagg tgttgtaccg     47580
     ggtcaactac cgcaggcgta ctatggcggc ggtgcgcctt tctatccccc gcagcaggca     47640
     tcgggcccgc ctccacaggc gtccgggggt gtggtagcgc cgcagcagca ggcagagcag     47700
     cagaaccatg tgtataagtg atgtatcatt tcgatgcttt ttcgctgatg atgtattatg     47760
     atgggttgat ggtctgtctc tgtatttatc gaataccttt tgcttgtttg ctgttcttga     47820
     cgtctggtgg ttagcttact cgctatcgtg catgtattgt atcgaatcgg agttaattgc     47880
     tctaatgagg tgcatactat atgtgtagat ccatattatc atactatcta atttaaaact     47940
     gtacagtaac gaatggggta tatatccaag ccaaaataac aaaaccaatc gtaaccatcc     48000
     caagcccaat atttccagac atcaaacaca tctcatcatc cagttaccat aaaaaaggtc     48060
     ctacttctcc aaaacctcct tcttctcagg cacaggcgtc tgcactcccg aaacatcccc     48120
     actcgtcatc tccccaacaa tcatgccctt tctccttccc ctcttcccca taatatccaa     48180
     cgccatcatc ctcaccgtcc tcacaatact ctcccgaccc tcatacaacg ggaaaatgac     48240
     caccccgaaa gtcgtgcaga aaagccaaat cagaccgaca acgacccaac ccgtaaagaa     48300
     cttcttgctg aagacatacg agctgccata catagggatg ggccagagaa tgaggaagca     48360
     gaggaccatg aagatggtca aggtgcggga gtagagagcg gcgcggttga gtttgcgtgt     48420
     ttcttcttcc tcctgggcgg cggactgggt gttgatttcg ccggggatga gttcgatgtc     48480
     gatgtgagcg gctgctgcta cgtcggcgtc gtcgacgcgg cgaatggcgc gcatggtgcc     48540
     gtagtcgtag ttttgagagc cgaagatgag ggtgaggatc ggggagaaga tcacggggct     48600
     caggagggcg gcgacgttac cggcgagcat tgggtagctt ttaactatgt tagttgattg     48660
     tttgaggaga gaaggtgtgg ggatggactc actttgcgcc ggttgtggtg acggttaata     48720
     tgccgtattg tttcttggtt gtcacgagcc aggcgataaa ggagactgca aggccgaggg     48780
     gtggcgaggc ggctgctgcg atccagttct ggtgcttcca gatgagggac atggcgccgg     48840
     ggaagactgc agaggagatg atcacgccca tcagcaggta gaggtagccc attccgatac     48900
     cagcgtagta gagaccggtg gagaagccgg ccatggcgat ggcccagaac acacaggtca     48960
     tgtgcgaaac ccagacgaga cgcttgccct tggcggatgg gtcgatgtag gcctggtaga     49020
     tatcgtaggt gaagatggat gagacagcaa tcagctgggc agagaaagcg gaggtgactg     49080
     ccatgaagat catgattgtt gtgcatactg cgccgctata gccgagaagc ttgacggcgg     49140
     caaagggcag gacaagaccg gctgtgacgt cgtcggggct caagcgctga gtgccctcca     49200
     gagagagagc agtcatgccc agagtgctgg cgcacaacca agggattgcg aaccagcaaa     49260
     gaccaccaat gacatatccg gggaaagcgt gcacggggct tgcggcaata gctttgttgt     49320
     agtatccgtt gtcgaggaag acagtactga tggggttcgt tagcaagcaa tttatacggg     49380
     agtgtggtgg ttggcatacc caaagttgcc gaccaggttg ataatccaga agatgccacc     49440
     ctccttcgac ctcatggtca gatagcttcc ctctgcattg ccgtcaactg ggtggagctt     49500
     cgatgctgct actagtgcat catagacagc tccaggggag ccaagcttgt cgctagtcgc     49560
     gtaggcagag aatgcaaaga tgaagatgac gacaataatc acgacggtat gcaaatagtc     49620
     cgtgatgaat gttgccttta taccaccaaa cagggtgtag agcacgacac caattggcag     49680
     gaggaaacag gcagcaactg tattaacccc cgtgagagac gtcaggacgg cagaaccacc     49740
     ggtaagcagc atggcagtaa cgagaatgtt ggtcatcagg cagaaaacga tgaaaacaac     49800
     atgaacaacg gttccgtatc gagcacggag agcttcgagg aaggtatgcg catttggagc     49860
     cctccgcttg agctcgatgg ccagtgtagc gaacaagatg atctggaccg tagcacctgt     49920
     atcaccgaat cagaatgata ttgaccgtat tgttgctggc tgtaagtacc tgatgcatag     49980
     aagaaaggac ccgagatgcc gtactcgtaa gccacagtag tcgactgaag aagagttgca     50040
     gcccatgtcc aactactgac aactgccgcg gcaaccaagc ccgacttgac tgatcttcca     50100
     gccgttgaga acatttccga tgtctgcact tcattttggt atctacacaa aaaccgtaag     50160
     cctcgctaga ctccaaagct tgaaggggcc aaaggccatg gttgaaatgg tattagacta     50220
     catacctctt cagagcccag gtgataaaga tcataagcag ggcaaaggca aagcccagac     50280
     caatgatgat gccatatcca aacccttgcg agagaggcgc tgtgaatgtg acagtgtctg     50340
     aagacatgtt ggcagcgtat gaacacgcga agcgatgcct tgctatggct gtaggatgac     50400
     tgaatgagac aagatcttga gcatggcggc agaggcaaga acatataagg cacgggaccc     50460
     ttgaaaaatc tccgacctcg cagacacgct ggtgatcggc gggaaggcca tattgaatca     50520
     atgactaccg atccaatatc attggatccg aggagtcagg cctggggaag cgaatggctg     50580
     ataagaacaa ctcctggtgg tcgtttcgta atgtgctttc atcagatggg agtgtaacat     50640
     taatggcagc ggactagctc caggaagttt agtaccgagc aatctagtca gtgccatcgt     50700
     tccacagttc cattcgcata cacatggatt atcccatggc ccctccactt tctttgcacg     50760
     aaaatgaaca gccgaacccc aggtgggtta tcaacgtatc aagcccggac agcttattgg     50820
     cgaggcggaa atgcttctta tcagcggagg tcagcgcaac gacgcctatt ggcccgagtc     50880
     gggagcggac gatgataaga aaccgtagac tatcagataa ggaggtcagc caagtcatgg     50940
     attggtttgt tggtgcagcc tgtcgctctg ccaagagctc catggcttta tggggagcag     51000
     acttgatgat agcgctctat cagttactac attacttact cgatcctgcc actaatgctt     51060
     tgggggtcta ccccactgct cttggttttg aaaccgggga atttccatcg tgcttccatc     51120
     cctgtaattg gtgggtgtct gagtaggaac caactgatct tgctttgcat ctgaggtatg     51180
     ccagatctca gtactgtgcg tagggcagac cttgcttgtg tgaatatgtc atccacgtgt     51240
     acttcacctt aggccattct tagtatgtgg attgatctac ttactaatat atatctactg     51300
     ccattgtatc gtcctttact gggggcatgt gtgcataata tatacatcac ctgtgctaga     51360
     gttgaacagt ccttctaatg tcatagtagt tctctggcag ttgggtgccc atgtacatgt     51420
     gacattatca ctcagtataa tctatgggtc tcggtgtcag gactctctac actggcactg     51480
     tatatattca aacaatatac taggcctcct accaacccac caagtctggc actactgcaa     51540
     tgatctaatc atctcaccac cgtataaatt gagctagtat tcgtagctag ccatgactca     51600
     cgccatttca agcaactata catcagcact agcaccaagg taccttcacc atcacataaa     51660
     cattcacagc ctaccccaac caggaccaaa tcatctacca ccaccaccac caccacaaca     51720
     acatgaccac caaaatctac cacaccaaca acctcaccat ctccctctcc caccacccaa     51780
     caacacccgg ccacaccatc gcaaccctaa ccaataccac cacccccaag accacactct     51840
     tcgccctccc caagtccacc ttcatctcca ccctcgtcac cctccgcacc atcatcccct     51900
     ccctcaaatc aacctaccac accccccgca tcgccttaat aacctccggc aacaccaccc     51960
     tttccctcct ccccctccac ggcctcacct caacctggac cccgataacc agtcccgaaa     52020
     caaccttcaa cgaccctcaa tcctcctccc acccccaaag ctacataaca tccaaatccg     52080
     gcccccgcat gccctccgcc cacctaaccc acatagccga cattatcacc acccacaccc     52140
     catccacccc caactacacc ttccacggcc cttcctcaga caccaacctc ttcgcgaaca     52200
     taattcgggg caccgagcac cctcaatggc gtatctggga ggatgagtcc cgtgtagcct     52260
     ttctaacgcc ttatccgaac acgcccgggt tcacggtgct agtgccgcga acacatttgg     52320
     ggagtgatat atttgccctt ggggaggaag actttgaagg attgatgggc gcggcgtgga     52380
     cggttggacg ggtgttgatg gaggcgctgg gagtggggag atgtgggatg gtgtttgagg     52440
     ggttggaggt ggattatgca catgtcaagc tggttcctgt ctatggggac ggggaggatg     52500
     atggtgggga gagggaggtt tttcgtgagg tgtatcctgg gtatgtgagt tctttgcctg     52560
     ggccggaggt gggggatgtg ggggagttgg tgaggagggc tggggagatt cgtcaattga     52620
     ttgctgcgca ggagtaggga ggagatgggg gtgtggttgt gggtttgttt gatttaatta     52680
     attgatataa ggatcggggt gggttttcat cgagtctcgt tttcattgac aagcactata     52740
     ttacacaaaa cgcatttctt cacggaacta gggctctcca ttaattgttg atgggcacaa     52800
     gtgcacggca taatttagcg ataattgttc catcctattc tgcagataga tttggaccaa     52860
     ttgtagaagc acaagatcgg catgtgcctt ccccactacc agcacacaca agaaagaggc     52920
     aagggacacc aggggtatat gtatcgaagg gcaaaaggtt ggatgatgga ttcgctggcc     52980
     tcgcttgatc cctgcgctgc tgatctcgcg cgcgaccccg aatcattcga cacgagccag     53040
     acatatcacg tataatagga ccaggagaca gcaacggggc gagagtacaa gtcgcatttc     53100
     agcggcttat gaggagaact tgcgggtgat cttggcaatg actggatatg cgcgttagag     53160
     gccacttcac cacccagaag acaacccgga aagcacactt accgtggaga ccaacgacgg     53220
     agaaaatgaa gcccagactg agaaccagga caacaacggg gtcaaccctc agaccggggc     53280
     tctcgtcagt gtagagcttg agcatcgtgc cggaggagcc accagcaccg gcggcgcgag     53340
     tcgagctggg tctggcattg cggagggact ccttgtggtc agcggccgcg cggcgacgca     53400
     tagcagcccg gggaccacca ggaggagtag gagaggaagg gcggttgacg gaggagacag     53460
     cagaggcgcc ggtgccagcg ccagcagact tggagtcggg accggactca gcaccggagg     53520
     tcatggggga agcagcacgg ggagaggcct gaagagaata cagacgttag atgaggttgc     53580
     ccttagtcta attgactgaa gttgtcacaa ttcgtcgatg gtctggttga gttcgcttgg     53640
     gagacaacgg tagccaccaa gaggatcggc aggacaaggg tgctcaccat tttggagaat     53700
     aaggagattc aagaagataa gaatcaaaga aagtgaagct gaattaaaca ataatgacaa     53760
     caagaagcaa ggaagcaatt ggccgatgaa gagggaagga gtcggctgaa gagtagaaga     53820
     ggaggagata ctggtaggag gtccgggagg tgaggtcgcg agatgccaga aagaggccac     53880
     gctcacgatt tccaactggc ggaaggtacc gtcatttacg gtaatgccaa gacctctact     53940
     ttgagaagtg tagcttattt aacataaagt tgctgtaact ttcacaacaa atccgatgtg     54000
     gtgtaacggc taacatcgcc gtctttcaca cggcagctcg gggttcgatt ccccgcatcg     54060
     gagttctctt tttgattttt gtcttcattc tttcctttcc gttttaacct cttaatgtga     54120
     tgtccctttt tgcacttggt ttttacgtat ggctagtgtg gtgtaattgt cgttattcct     54180
     gatctcaata agccacagtg tactttgatc gactacaaag cgaggctctg aagctccact     54240
     ggcccatgag tctcttaacc cttcgctctc cactacaaat tctagacctt gaagctacat     54300
     aggttgtgac gatctcgggt ctaaactttg tagactgcca gatgttgtgc gcccggtgaa     54360
     cagaaccttg gattagatct cgactccact ccacaatcag gcaggtcagc tccgacgaag     54420
     tgatgcttta ggcacggata gtctacggct aaaaggggca aaaccacgag ccctatgcgt     54480
     gtccctgaaa acactgtgga gcagttcagt ctcgcgcggc tgatttatcc attcttgcgg     54540
     agcagactcg tttgtctacc cgccactcac gtggaaaatt caatcttaag ttgaaccagc     54600
     agagatccgg cccatggatg ccattccaga accgctggca ggcagccaca tagacgcgac     54660
     agccgttgga agagttctcc tgacatgacg accaattaga acgggctctc cactcgctga     54720
     gctagagtgt agttgtaaag cgtagagaag acagcccttt agtgtcatga cttcagacaa     54780
     gcctgagtga gacctgtgtc gccatagcaa taccgcaatc tgtgacgacg gaaaatcttg     54840
     ggtgtttttt acattgccgt tgtttcaccg ggggcacact aagcacgttg aatggcacat     54900
     ggagcaagca gcaaggggag ggaggggaaa gcgcactaaa atagccacac gacactgtct     54960
     tagaagaatt catgggctca cagacctgtg gctttcagca ccttggtttg agaaccgcat     55020
     tggtgcttgt gcttgcatac atggtgagac cggagtcacc gaaatcaaag aggtttccca     55080
     agtagatgaa gactttctgc tccgtatctg ctcttggaga tacacgttat caggtctagc     55140
     taattcgtcg gtacggcgtc gactccgaca ataaggttag atgggtacgt aacccggcgt     55200
     gagaagaggc ttaaatgtcg ttatgcgtct gcctaaggca aattttgtcg acctagacct     55260
     cttccaggtg cttcatgatt cactgcagaa gcgaggcaac gacaaaatca ctcttcttct     55320
     ttactgactg aacgaggaac tgctgaccat gcagaggttg ccatgcaccc aaagtgacac     55380
     cgcacattgt actaggtttc aggaagctga gccacggatc tggtctgatc tgagccggcc     55440
     accacaaatt tggccccaat tctggccccg ttccatctcc ggggcaaagg gaagccgtct     55500
     ggcgcgcgct agtctagatg gggaggtagt tcggtgcaac gtttatctag tctgcacaca     55560
     gttgactgct gtagataact agtaaacagt ggaatggttg cctaagacat cctcatccta     55620
     cggcgtagat ctttcgtaag cgggatctct caggccggta tagtgaacaa caacccagat     55680
     atggtgaagt ttatggatct gattcaaagg catcgcatgg tgggcatatt tccctacaaa     55740
     atgtcgtgga tatggatgat tcacatgtag atcgcttttc aaacattctt ccatcttata     55800
     gttacggatc tcctgccgtc agcgatccat gcttgcctat tttagacttt cttgtgagct     55860
     gttggtttgc agctcttccg ccacttagaa acgttgacat tcccccatac ccacttgcca     55920
     tggtgtatag aacggctgca ctttgctgat acagtttttc gaccgatcgg ataatctaga     55980
     gtatcaaggt aatccaattg gataacaaag ctcccgaaat aacgcgatcg atgaatgccc     56040
     caacaccttg gaataactgt tctgtcggta cttcggtagc cagcccgata actattctac     56100
     taagaactgt gtgactcgga tgcgcccctt tggggcgaaa tgcgagtaag tgcacacacg     56160
     gaaatttgga gctacaatag tcaagtaata atagggcttg agagaggtaa cgcgcggcat     56220
     tttactagag agttaataaa atcgtaatcg ggaacccaag tttcaagagg cagccggtcc     56280
     atgggtccga cccactgcga cgcgacgaat tcaggagaca atcgagtcta gttcctttct     56340
     ttctcgagtt tagcccaggc acgggatcca gttctgagac ccggaataac gaataacaac     56400
     aattcacaac aacacaccga aggattgatt ttatcaccac aacaaacaca catccctccg     56460
     taagcagaag cctttgtctg tcctcaggaa gaaagaaaga aaaaggagca agggaaaata     56520
     gtcaagaaca gccaaacaag ctggagcata tctcatcttc atgttcagta ctgactgagt     56580
     aaccaagact attttcctca tgaatggtcc aggtccctcc cgtaattacc gtgggtagat     56640
     taaaagcttc ttggctctga gaggataatc ccgtgtataa gccgaacgcc atgataaacc     56700
     atcataaaat tagaagaaaa ttgggcccag gacgggagtc tggcacattt gggtgaaccc     56760
     caacgcaact tgctttgccg ttaaccgtcg cttatatgct tgactccgac taaactgggt     56820
     tgtcatgtaa ggtgtggatt agttagtctt ccagagcatc gtccaaccct cctcggattt     56880
     ttgtgatcat cgctgctttt tcccgctttt tcccttccat tgctgtgtct ggactcccag     56940
     ctgaaccctg gatgccacat acgcctcccc cgaccgaaaa gcagccccct cctccttctc     57000
     ctccttctct ccaaaagtgc gtgagtaatc cgtttggaat tgtctgttgg ttcactattc     57060
     acatctcggg cttagcttga cagcagcctc cgttttccct ctgtctctcg ctctctcact     57120
     gccattccac ccatcatctt cgatcgttct tctcccagcc ttccttttcc acctctcaca     57180
     ttcatacttc ctccttcctc ccgacactcg ttttcatttt cccctttcac ctctattgca     57240
     tttttctcct tattcctttt ctctcttttc tccctccccc ggtctctctc tctctctctt     57300
     gctatccctc tctccgactg actctgggct tcggttttga gtccgcaggt gctcagcctt     57360
     acgccaacag acctcctcca atcccgaacc atcgatcatc ggactgagcc tccccgccca     57420
     aaggtaacac gacaattcgc accacggctt aacaatccta cggcatcccc ccgagacttc     57480
     ccatcctcct ccttcaccct gcagcgagcc attctccggg cgcagattcc cctccactcg     57540
     ctccgttagc ccgtctcgag tgtggcttgg tgtggcttat acgcttgtcg tcgagtggtc     57600
     gtcctctcag aacccgtcat cttcgagaac tccgacctcc tgaactcccc ctcctgacat     57660
     cctcaaaaac aaggccacgg ccgcaaccca ctcagatcgg ggttgtcacc tccgcgcatc     57720
     acgaatctgt gtccttgatc ctctgcctgt gctatatttt cgcggccgtc gggtggtcga     57780
     accgtcatat tgtatcccga tcctgagcct ccgacggaca ccagctccgt aacggagcac     57840
     ttcgtcaaga tttattccca caattctcgg gcctccctgc ttgggggcac tttcgatcca     57900
     tcttttagac gcggtttccg tgcccgagaa gggtatacga atgttcctcc ggatccccca     57960
     aagcgacaca ggatgtaccg accaaactcg ttatggactt ggtccttctg cattgtcaca     58020
     ctcatccaga ccatcattac ccttgccctc gagtcgtaag tgtgactttt actactgttg     58080
     aatcgcaaat ttccgagtac ttatgctgat caccacacga atagttatgt cttcgcaaac     58140
     ttccagatcc aactcttccc aaagggcgag gtctcgactg cgtcaaagac agtaacaacc     58200
     ttcttggcgc tctactgttt cgggtttata tatgagttga tcctcgttta cgatgctcta     58260
     cgtctcaaga ataccattca agtcattggt ctgtgcgtgt gcaatctcgg tcttctgatt     58320
     tacggggcgg tgcaagtcca gcaaatcaag gactccatcg aaatgctcgt ggccgaaagc     58380
     gccatcacca tagacgtgtg gggggagaca gagccctttc tgattatcat tccgtgtgtc     58440
     gttgccatgg gctcaatttt gatgatgatc atcgcttgga agctctacga tgaattcgca     58500
     tggtcgatct acaagcatat cagcgccgat ctgcgaatga agcgccggta tcttacatat     58560
     caggtacttc tgcatgtccg tcgaaatggg gacccgaatc taacaggatt tctagatcta     58620
     tatcgctctg ctgaagttcg atttcttctt tttcctcggt ttcaccgttc agttccttgt     58680
     cattgtcacg aacaagacgg atgttgaatt cgctctcacg acggctgcca ttcccgttac     58740
     gattcttatt cttgtttgcg ctgcgatctt cgtgaaacga gagagctcga tcggaatgat     58800
     cgttgtcatt gtacgttgtc ctagcagcag atgggtctga attatcttct aactggtatc     58860
     gcagcttcta tactttgcag ccatggcata cttcctattc aagctggtcc gcatgtacca     58920
     gcctcaaaca taccaagagt acctgcccgc ccggcggtct ctgacattct tcgctgttat     58980
     cacgcttctc ttgatcgttt tgacgatcac taacgcctgc gtttgtatgc acaatttcca     59040
     caaaggcctg aagcagcacg tccataagaa gaagtcccgc gacaaggacg agaagacaac     59100
     tgagttgtct tccaatatct cgggccaggt gccgaatcgc atgatgatcg actgagcgac     59160
     ttcagcccca cgttatgaac caaacacaat aaaacgtaaa aaagaaaaaa aaaaaaggga     59220
     agaccaaaaa taacagcaaa tttgcaaatt gggggacttt tccttttccg attttctaac     59280
     cactgcacat ttattcatgg agcgatatat cttttcttta aaggttagcg agttgtgcaa     59340
     cagtccgcca gtaggtggag ctactgcttg gatactgaga ttgggcgtgt ttccgggatt     59400
     taccatatga tacctcctac tgcgttgctc ggttttttct tacgaacctt cgactgtctt     59460
     tccttgttga tttcctcgga gttttgtctg aagtggctgt tcaccctccc cgcatcacgc     59520
     tcttgctcaa tgacgcgccg tgtcgcgtct cattgatgaa atttccttgt ccatttattt     59580
     ctttttgacc atttccccct tatatctaca tatctacaac ccccgattat gtgaatatca     59640
     cgactttgca ttatgtactg tatttattaa tttgccttgc tgcatggaga taatcaatca     59700
     aaagacacta cttatcgagc catcctgtta cattcaacct agttgtctat gatcaacaac     59760
     aacctagata ttttcaaatg aaataagcag aacaataaca catcacagtg tattcgagca     59820
     agacagtagg tatttataca tacacataaa aaggaggcaa ggaaagcaaa caaaaacagg     59880
     tttcgttcta tctgaacaat agaaaagaaa gaccaaaaaa agagatgaaa aagaaatctc     59940
     cgatgcgggg aatcgaaccc cgagctgccg tgtgaaagac ggcgatgtta gccgttacac     60000
     cacatcggat tgttgttgaa taacggacta aacttataat ctatgtagaa ccatgtaaac     60060
     ctcacctccc accatccgct aatcaagtta ctactcttag tactactgtc tttcccagct     60120
     taatcacaac aagaacattt tattaggagt cgaaggagct tacaggtaaa gggggaaaaa     60180
     aggattaaat tgaaacgaat aggataatta gtaatacccc cttgtcatat gatgattgaa     60240
     gcgctgacgt tggggatgga catggagtat atatccgatg tacgtatatg gctgcctaaa     60300
     ttatttgaat acatacgtgg tgaggaggtt accaaataat gttactacgg ggggatttga     60360
     gtagctgcta gatgattctg tcgggaagag catccgaagc tggaatgatg agaacaatag     60420
     aggggggaaa ggggaaggag taagggattg attgttttgg ctaggtgcat aggatgcgag     60480
     gtatacacgg aaactacttc ctcgtcaatt attcctgtcc cgatacggac aatacattat     60540
     tactaccatg gatgcagcaa aaagaagaat ttgctcatct gattgatcca actaccaagc     60600
     tggtatggct atcgacaatt tcaatggagc agcagaaata tatgtataag agaacgagta     60660
     ttaacaggaa gaagtagtag tcagaaccga aaccagctat atgcataaag cagcgagtga     60720
     atatcttgac tagtaggtca atttaggcag aaagaatgtc agtcagtcat tttatttccc     60780
     tttcccccac ttcttcactc tgaagaaata gtacaacatg acagcgccgg caatgttgaa     60840
     tacgaaatag caccagaaaa taccgtagtc gcgccaacga tctttccaat agacccatcg     60900
     aagagcaagg tactcatcgg ccactgtcat ggagcagtat tcgcaggcag aggtggcgtt     60960
     cggattgtac acctggcctc cagcggcctc aacatacttc tgcatgtact gtccacaggt     61020
     atagttggat ggagggtcaa aaacactgag ctccgtagcg ctgcactcca ctgggcggcc     61080
     atggaggatt gagctgccga caccagccgt gtagtacgta aaaggagaga cacggtacat     61140
     gaatatccag aacccgggta ggtctccagg tggttgcagc ataccgttga agatgaacgc     61200
     aaacgcgaac atgagaacgg ccaatatacc tgccaccggc gcttggggga ctgcggctat     61260
     cacgaagtga gccatactgg ccacatacag atagaattgg acgatgtaga gaaggccaag     61320
     gacatgccgc tcggcatctt gacccgtgcc catcacagcc cagtaaaacg ataaccaaac     61380
     aaaaactccc agaacaatgt ggtaggggat ttcaacgaga acatttgaaa gaatgaatac     61440
     tttccacgaa taaaccctgg atggccgctc ccggacttca tatagcgccc gctgtgcaac     61500
     gaatcggggc gtgatctgat tgacgagcgt ggtgaaaacc gtggcaagga ggaagacact     61560
     gaagagagca cattggaaac cttgttgggt gttgttcgct ttgaagaagg agaagccaat     61620
     aaacaatcca cacgctatac ccaatgagta ctttgcaaac acatattccg gttggcggta     61680
     gtactgctgg aacgcacgct tcatgacgtg gtagagttgg ctggtgaaag gcatagcgaa     61740
     ttccgagttg ttgctatcac catcctgggc tcgtggctcg ggctgttgtt gtggatcctg     61800
     aagacgttcg agttctgcga ggacctcctt gcgctcaggg ctatcgttcc atctctgaac     61860
     ccagtcaatg ccttccgatc cctcccctgc cacaacctca agaatgtact ccgcaggatt     61920
     ttccatgtcc ccacagcgcc taataccgct gcgctcaaaa tagtccaaaa gtatgcggga     61980
     ttggtcccca atatcaccaa aatagacagt tttgccccct ttagtctagg aacaacaagc     62040
     gatcgaaggt ctggaacaac agagcactcg gttgatgaat ggtggcaagg actgcctgac     62100
     cgtgatcggc aagccgcctt agcagcgagc agattgtcca ggaactctga gagtccaggc     62160
     cgctggttgg ctcgtcgagg aatatcaata atgtcggttt tgcagcaagt tcaaccccaa     62220
     tactcagcaa ctttctctgc tccacgttca agccctctcc caaagagccc acaactgcct     62280
     ccgcaaagtc ttgcatgcgt agaactttaa tgacctcttc gacatattcg tacttctctt     62340
     tttccgatac tgaagcgggc tgacggagca tagcactgaa gcggagggcc tcgcgcaccg     62400
     tagtcgtctc catatgaagg tcttgctgtt gcacataccc agtttctcgt ggaaaattag     62460
     cctgcaaagc tcttccgtta accagaacgt cgccggtaac aacaccaata gataccctct     62520
     gggcgaggac atccaaaagc gttgttttac cagccccaga aacccccatc agcgcggtta     62580
     aagtgcctgg cttaacccat ccattcacat tatcgagaag tcgccgggta ccatctttga     62640
     cgggaatatc gtagttgagg cccttccaag aaaggacgtc agtttgctga ggaagactaa     62700
     tagcatccac ttggtccccc acttcgggct tgtctggggg cgcttctcca tcttcgatcc     62760
     catcggagga tagcagatat tgcggaacat gaccagatcg aaaaaccaag gtttctgctt     62820
     tggatgtctc acccgagttg tattccgaaa gaaacaaata gagaccggtg aagaatacca     62880
     ggtaggcgac gagaattccg taattccgcc agacatggct gtagtagtac tggtaattct     62940
     gctccacata agcgtccccg gagacgaacc gctctcctgc aacggcaccc acggtcgaac     63000
     agataaagga tgagccagta gcatagcttg ggatcaccga tgcgcattca aagttcctgc     63060
     catggaactc attcgctaac agggcctcgt acacatagta gatggggttg acccagcgga     63120
     tccacgaaag ccacgggtgc atatatgctt gcggtaacac aaagccagta tataccacaa     63180
     tgcataagat acaaacacca gccattgaca ttgcctgcgc gcttgtcctt gttgctgcag     63240
     ctaagctacg gaaaatcccg gacatcgtca agacggaagt caacagaaac atgtagcaaa     63300
     tgaagaactg cgatggttct cgtcgaaggt tggacatcag gtaaaggatc acacaaaata     63360
     gagtaccccg tgtgaatttg ataggcagat ccatgatcca actggccaag gcctcagcga     63420
     agggatggac gaacgcataa cccgcttgct tcacagcgat tggccgctgg ctatatagct     63480
     gaatgatctc attgagtgcg atcaaggcat tgaaaagtac agcaaagtat agcacagccc     63540
     ctttctggaa gaatgtggcg gttgtgggcg gagaattgaa gaaaatcgag ccgatcacca     63600
     atcccagaat gggttgtgtc gctaccgtaa cgatcacggt tggcaggtcg tttcgtagtc     63660
     gctgaaaagc ccggcgcagg cagagacgga cttgcatcgg gacagagaga agatatgggc     63720
     tgcgcggccg agtatggcgg gcctgctgct cttcatgatg ggccttgaat gctttggcct     63780
     cgtctgaatc tggtgggtga gcacgttgat actcctctat ctgaccgcag agctccttat     63840
     actcggggct acgcttccaa tattcctcga attccttcgc cgtgcgtggt accttgtcca     63900
     ccatgtcagg acgggccttt cgttcgcctg ggttggtaat tgaagtcagg aagtcgccgc     63960
     tgacctgtcg atctggcaat tcccagccca tttcctcgaa gtaaggtact gcacgatcgc     64020
     ggtgaccgaa gtagatctcg cgaccttcgt agaggacgac gactttgtca acgagatcat     64080
     acatcgactg agaagcttga tatgcagcga tagcatgaca tgatcgaccc atgtcggcag     64140
     caatacgtaa tgccctgaca aatttcagag cggatgacgc atcgagacct cgtgtgctgt     64200
     tatcccaagc tccgatacga caccttgaga cgaacatttc ggcgatactg accctcttcc     64260
     gctcaccacc gctaacacct cgcacaaagt tgtctcctac cttggtgtaa taggtgtttg     64320
     agaggccaaa cacagccagg acaacctgag tgagagtttc aacatattcg gagcgtgtca     64380
     agccttcaat tcgtttctga ggggtccgtg catgcgctgc gaaagaaagc gtttcgccaa     64440
     cggtaaggtg tggaaagtgt tgatcgactt ccttgttgta ggctacctct ccacggtggt     64500
     gcttgatcat atcctcatat tcgatgcctt ggtaatggat ggtgctctga ggttcgagcg     64560
     tcagaccacc caggtggcca caaagggtct tcaggaatgt tgtacatcca cttccagggc     64620
     gaccgaggac aagcagaagc tctccactct tgaggaagcc atcgaagcca tggagaatct     64680
     gccttggcgg aggggaggct cgccccgaaa gtgcacgcgc ggcagcgcgg aagggagctg     64740
     ccaactgtgt ggaaatagta ttctggattt gcaatgacga gcctgatcca gacacgcaaa     64800
     ggttagaaaa cacgacaccc tgcgtctgct gtacaatgcc ggactggtcc agggctctta     64860
     agacgagctt tgcccagaga cgttgatcga acgccggatt agtggggtcc aaacgggggt     64920
     catccttctc attgatcgta gcagcgtggg aaatcctgcg accggttcgg ctagaggcga     64980
     ttcttgtcag attgtgaagc tcttgttcct cttcgtccaa cgatggggtc tgctccttat     65040
     ccgaaggata cggatcgtgt gcgctggcaa ccttttcctc catggtgcca gtcgatgaga     65100
     gttcctggat agacccgttt cgagagcctt caggtcacca aacgagagag gtaaaccggc     65160
     atctagagag aagcggaatt ctgccagaga taagggttgg gaagaaggcc ctgcatgtac     65220
     gggatacacc taatcaataa agcccacagg gcaaactata gaagggccaa tttcgagtgt     65280
     caatgttagg aagcgatcgc cctgctgcgt atccagccat ttttcagtaa taaatggatc     65340
     tcactccctt catccgcatt agtgcactct tatgcctcgt ttctagaatt atttcagcca     65400
     tgtctatgca atcaagcacg gccgggcggc ctgctcctct gggatgcagg atctaggcgg     65460
     ccctaactac ggcctgcagc agctagcgta acaataagcc ccaactagag cgtggattga     65520
     tcggcgctat tattacacat agtcgatcgc ttcaggccac accgtgtgga ccaccttcag     65580
     ccttgtcatt ggcggttctg actgactgaa ttgagaaatg ccatttattc tagcatctca     65640
     acgtgtgtcg gtgctggact gtgtgtaggc cgtgggaggc tgtcgatgga gacttgtggc     65700
     acgtagccgc atttgtgtgg agctggacac tgaatctcac tgtttggact taggaatggc     65760
     ctagtcggaa gatggaggtg atgatcccga cgatggatgc atgaaccggc tgtaggttta     65820
     ctccgctagg ccaaccagtc attgaaggag gatggtaaag gaaacgctgc tactcgcttg     65880
     tttttcctgc tcgggtgaaa ttacgtgact gatgggagag gtcagcaaaa gcaattcagc     65940
     gaaaaaacac gtcaacttgc gacttcctgt aaaagcccta tgccggagtt gtcccagggc     66000
     ctaatgagag caaggaaggg aaatattggc gggacgcgac gcccaaccca ccgactcggt     66060
     cacggctgat cggccctccg acgcgccggt gatcaactat caatccacga tatggtatcc     66120
     atttgggctt aaactcagca cgaaagatac tccgtggctc tgggttcgcc gtaaaatctc     66180
     aagggcaacc atgctagcgc tttagtgtgg ataccggccg tcgtggattc gggattgccg     66240
     tcccacatat gaaaacccga gtaataagta gataccttgc ggtgaagctt acattccaga     66300
     gggctgtact gtgtatgaag acttcgttta gtaactcctt atgtttgatc tcaaactctc     66360
     cttgctgcaa gttgttgctt cttccgtatc cataagtaat tgtatactca cagtgcttcc     66420
     gggccattgt gacatgtcta ctccgtaccc tccgtagcaa ttccaagtag gatgatatct     66480
     cttcttccga aacgaggatg aattagtatt tgttccccgt gcagccaatc atgccaggta     66540
     tcagtttctt attatctagt ggcgttcatt ggaggtggct ggaggcgagg aacggactcc     66600
     cctgctctgt atattacgac gttcagatgg agaaaggatt acaaccatcg aaaggttgtt     66660
     atggcttata aagataacaa ggtgtatgag ctcgaaattt ttcttaactg agttgtcttg     66720
     agggtagagc ccaaagcgtg tcttggtaaa cagcagagtt gaacgtggcg aactcgaaca     66780
     caaacatctg ggccttcgca catgtagagt tgtgttttct ggttcttgta actgaacctt     66840
     aatgtttccc agacatcaca tcgcagatct taggcagcat atgcactagg cccgcaacac     66900
     aggactcttg agcttgatgg ggtgattcag aaccatgcaa gaggttagtt tcgcaagctt     66960
     tactgaacgc ggctatgatc gtgagctgac atgcataagt atgatgtatg atggagcgtg     67020
     gtccatgaca gacttttcgg agcacagtag agccatggct tggtattaga gtgtctcagt     67080
     gaggagtaga agataagaag tgtctgcgaa acgttgaact ggactagatg tttgtgcagg     67140
     ctgggtaggc cctgaagggc ttataagtag atcgagaagc tgcttcgcgg catcagggtg     67200
     gctcaaaggt gagcactaaa gttcagagta ggattagagc ccaacatgac acataacgtg     67260
     aatcaatgct gtgcgagttg tagaggacaa gaagtccgga cagttctttc cgacaggcta     67320
     gccatgtcga cagatgcagc caaggcaacc gtgacctcgg aagttatcca gaaggtaacg     67380
     cacaaaaaat aagcaatgcc aaaggcacat ctaaacttcg aagatctcag actgcgaatt     67440
     cacaagatag tcagtcacaa tacttggtag agacaccctc tcaggccaaa caaacaaaac     67500
     aaacaaacac caatccccgt actcccccaa cccccaatcc agtaagcggt caagcccacc     67560
     accaacacat cgcaccataa aaaaacccac gacagctaag cttgactcac ctttcttttt     67620
     ctcctcttaa gcgccatccc caccaatgct gcgtttcttt gctacacacg acaggaatac     67680
     cttcctgtcc tcggctctga tttcctccgg gaaaccaccc gaaacccact gcaaatgaga     67740
     aattcggagg aatcttcacc ctgtgcaccc gccacttgga aatgagtaat atcatttgca     67800
     atggccggta ctgccctcaa gggcctggtg tgacatcctt gcacacacct gcaattggca     67860
     tcagaaacat cgggggggag gaaggatgta agaacctctt acattccttt tcttcttttt     67920
     ccccatggga gagtcgttgc gaagattgtg tgtgcactcg gctttgatcg ggtgtgcgac     67980
     actttagtgc aatacgcagc atgccgtttc ctgtctctcg ctcacccctt atagggtggg     68040
     ttagggggat aggattggta tcattcgatt ccgattattc tggtgggggt ggcgcttcac     68100
     ttcttttttt ctgaggttag ttggatccct gttctatatt tgaggatctg tgtgtgtttg     68160
     cggtttggga actggaaagg actttgtttt cccccggcta attgttgggt ttggggacct     68220
     gtatgggtcc ctttctttag gtacggagta cttgatgggt ttggtggtag gggatatatt     68280
     gtatggtcaa ggaggaaaag ctgtgttatg gacatgtaat caagctgcta ttgcagaata     68340
     cttatatgca gtttgaccaa tgcagcttca ttgcacaaaa tccactgctt cgtacatcat     68400
     atataacatg tagagagact gcaaaagtta tcgtaaccaa ttggactttg aacacgttgg     68460
     tcgcttagca tctagctgga tattatagaa acaaaaatga acacaggccc ccgagaacat     68520
     tcaggatatt ttccgaacat cagaagttga aatgaaaaaa aagagaaatc gttgcctcca     68580
     tattgctccc cactcgtcat tatgatttcg catattgttc acttactcct catcgccaat     68640
     ctaaatatca taagtcagta caactctcaa acaagccaga tgaggagtca tcgtacctta     68700
     ggagccaggt agaatctcag atgaccgcta ccgaggccat actcaacgag gagcggcacc     68760
     tcctgcgaca ggcacagggt gaccttgttc gacaggttgg tagccttgca gaagttgacg     68820
     aggtacttga gggagaaagt gagggcaacg ggttcggtga gggagatgga gacgttctgt     68880
     gcggggttct cgacgttggt gtgctgacgg acggtgacgg agccactgcc aatgtcaccc     68940
     tggcaggaga acttgacacc ctccttcgta gcctcaatga caactaggag ttgaattagt     69000
     cgcggatcac acccgttgcc aataagaaga acataccgga ctcagagagg gcattcagat     69060
     ccctgcagat acgctggaac tctgctgccg gcatctctac cgtagcagcg tactctgtct     69120
     ccgggatggc caggtgctcc tggtcaatat ccatcaactt aatatcatat tcgctaagtc     69180
     tatccgtctc ggcactctcg aacatcaggt tgacggcatc gggagagtcc tcagccttga     69240
     gagtgaggat atcttcattc tgggcggcgc gcaggacctt ggtcagggag agcaggttga     69300
     taccgagggc aatgttacgg tcgcaacggt aaggggagaa tccctcggcc ttgagcatca     69360
     tggagacgag agcaacatgg gagttgtcca tggcctgaag tgagataccg gagtcattgc     69420
     agtcgaagtt gcagtcttgg accaggtcct tgatggcgtc gacgacctga agaaagaaac     69480
     caaatgtcag caatcaagca ttgacatgca acaatatgat gtagagttac tcacgcgctt     69540
     cagaagactg gcttgttcta ggcgagcttc aagcactgag taagctgtta gcatagaatt     69600
     ctgaaccagt tgaagctgtg acgctcactt ttgatgtgat ggtatgtgag tacggtgaga     69660
     agctgattag aaggagaagt ggaagaaaga ggagaggctg agataagtag atggtggtta     69720
     gcgggtgaaa ggagtatcgt gaagattgga aatcgtaaag aactgacaga aggaattgag     69780
     tgcgtaggaa ggataacggc gtgtctttca ggttggggtg aatttattga gggacctgaa     69840
     agtgcagcga attcgcgttc gagggtttca ttagtgggga ggcacgcgtc ccagtcgcgt     69900
     cattccttag gctgatatca ccctttgggg ttagtctggg tggtgcctga ggctgggcta     69960
     taccgcaccc gtcacaaaga agtgtcacta ccactatgac aaatactaca actgaaacgt     70020
     ctctataggc agttatttct gtgtacctag aaggcctaca gggtgctgaa ttatgctttt     70080
     atgctaggga ttcagtctca gaagagtctt gcattgccta gctaagcatg ttgaactatt     70140
     attgtgtgtg gtcgaatact ccaaaccgtt gcctgcaatt cacgagtaat aattgaccag     70200
     agaacgaagc ttaacagttt tctgggtccc aatgacaatg gcatcaatta ctgaccacta     70260
     agcacattat tgacttataa agtcgcaaat taatccacct ctgagtctat aatggtacca     70320
     actcagcaat gcattacatc acaactggga taatgctact tcttgctagc cttgcagtac     70380
     tatggctcga tagctgcagg caagtagttg agatatgaat atcccattgg tctggaggga     70440
     gggacatgtg gagaatgcgg aatttggatc cctgaagaca gggaagatgg actttacttt     70500
     gtaagtcctc ttccgcggta atggctggat tacaaatgca atcagtctgg agatgatgac     70560
     aaacattcga acaactcaga ggagagatag tgcatgcact acaggccact gagctattaa     70620
     gttgtataaa tattaggatc agctgtgaac ttgttcgaac gattattccc ccctctttac     70680
     agtgacagta aactaaaact ccaacgcaaa atcgatctaa atatgaccac agtattcatg     70740
     ttagtcgctc atcataaaac caaagcactt tgatagaata tgcatagcct agatagctca     70800
     cacaagccac agaacaggag ccagcggcta catcggcggc gaccttctat cagtacttgt     70860
     atccaagtac cccgacctgc actaccgctt gttagtccga agccgcgaca gcggccagaa     70920
     aaatcaaggc acaatatcct actgtcgaga ttatacaagg cagtctcgat gattcagaga     70980
     cgctggtcgc agaaagtgct agggccgata tcatcatccg ttagtggaca cattcagttt     71040
     ttattatata ctatccacca gaaggaatac gtaccagctg actttaccgg tatgaaagac     71100
     actgccgatg ctgctgacca ccttggcgca gccaaggcaa tagcccaggg tgctctagaa     71160
     ggacacactg aagaacatcc cgtctattgg ttgcatacca gtggtgccgg gatcttctcg     71220
     ttcttagaca ccgagaccaa ggtatatggg gagaaaggcg agaaaatcta tgatgatgtg     71280
     caggacatta aggagattgt gaacttccct gaccacgcgt tccaccgaga tgtggataaa     71340
     gcggtgtttg aggctggatc ggtgcgtcca gaagtcctga agactgctat catatccccg     71400
     gtaactgttt acggtaagct tcagtagaaa ccaaaatgta agggcatgaa atcaactaat     71460
     ttactgctat aatttaggtc aaggccgagg accttgctcc caacgcagca gacagatata     71520
     tgagctagcc aaactgacca tccaacgaca gaaagttccc ataatcggcc ggggcctctc     71580
     attcgggacc gatatccaca tttatgattt gaccaaccta tatgtgattc ttttcgaaag     71640
     ggccctttcg aagcaagatg atgggctttg gggtccggag gcatactacc tctgtgagaa     71700
     tggggagcat tgctggggtg agctggcccg ttcaattgga cgaatttgtg tggcggaagg     71760
     attcatccca tcggccgaag aggaggcttt cggcttcgag gaggcacaaa aatgggcagg     71820
     ctatgaagct gctagttggg ggctaaattc acggtgtcgg gccagtcgtg cccgtctatt     71880
     gctggggtgg cagccgtctg cgccatcgtt ggaatccgag cttcgggata tcgtgaaggg     71940
     ggaataccga cgcctacagg aggcggaaag agatgcctga agctctgatg aaatgttaat     72000
     tgcggctgta cttcatgatg attgcaaata cttcgccgac gtacagtggt cgagtcatag     72060
     taacacagga ttgaagttcc ttccatcgta ctacgcaaat cacacaatct atatgatcga     72120
     atacacctgg atcgatggag taaaacagta tatttcagac gtcattgagt acggtatcga     72180
     tacaaataat tacgctagaa tgtaggatat gtacacaagg ctgatgatac agaacaaacg     72240
     agatcgagcg aaagctgcca gcattgcttc ggcaagcata gtgagtatac aggaagacga     72300
     agagacgagt caaggaaaaa aaaaataata acatgatata cagtatcaac gattgtaagg     72360
     cccacgggag tccaccaggg gaaaaaggta ataataagta accaggctga gagaaaatgc     72420
     aaaactgcct taacgccgct gacaccggac cgctctatac atttctgggt atcaatctgc     72480
     aaaggttgct aggaagagtc ggcttccagc tcaaggtaga gtaaagctta ggtggttata     72540
     tgcggggagg aggaagggaa gggaatcggg tatcgaggtg gcggtagagg agatagggtt     72600
     ggaaggatgc tgtcgaatga tggcgaaatc aaatgcttgt gacacgtttc gcagctattg     72660
     tggtacgagg ccgttgctta attaccattt ctagctcctt gagcatgttt gtgttggcat     72720
     cagtgcgctc ccgagcggct gcttgtcgtg ctctatcttc cttgactcgt gcgattcgtt     72780
     cttcccgggt taatgacatc ctcttgttcc gagccggaag agccactgct tcaaatattt     72840
     cctcctcatc gtctagtgta tggacgatgc tcggatctgt gttttcccca gtcaacgctc     72900
     taagggcgtc tgcagggctg ccctcgactg cagtagaacc tccaaggctg ggtgtgggtg     72960
     acaggggtgt tttcagaaag ctcgagggtc gcgaaaattc cggatttgcg ggttttccca     73020
     agctactcat caatgcggat ttgcctgact cccactcctg gaggaggctt ctgatatccg     73080
     ctccaatcga ttcatactgg ggcatgaggc tcgcctcgaa ttcgccagca tccggtcgct     73140
     cgagattaga actagatgcc tccttgagga tgtgcatctt tgcgtgaagc gcacgaattc     73200
     cctgggagag tgaattgata tttcggtatt gtgcacggag attgtccttg ttgggtgagg     73260
     ctgttggtag cggagaaggc ggaatgacat cacctgacac aatgttcagc ttaagcatgg     73320
     attgtgtcga ggattggtac ttacgatcgt cctcgttgag gatgttggtc atcttgtgaa     73380
     tgttctcgcc agtcacatgg gccaggtccc gcatctgctc gactgccgtg gtccatctag     73440
     caatatcgga cccgccgcca tccgcgccga gcgcgaggag acagcagagg atactctttc     73500
     tcacgatgta gagtcttccg aaaagtgtgc gaagggcacg tagagagtac tggtcttcgg     73560
     tggctcgctc atcgaacgct gcctcggcct ccataagctc ctcctctgat atgtcgtaga     73620
     tatcataata cttggcgagg ttggtggcat cggtaagtgg gcgtagggta tgctgtgccc     73680
     gaatgtactg gcccagcatg agatagaacg attccgatac ggttcggcgc agtctcagac     73740
     atcgccgtgt ttgcgtctga tcttcaagtc tgcttactgg gggcaacggc gtgcttctac     73800
     tcgatagatt agtgattttt ggctcccaag ctgacagtca gagcaactta catgcggtag     73860
     cctcttgaga ccagctcaac ttcctgtatg aatacaaccg acgcggaagc ggcagagtca     73920
     aacccttggg cgttgctaat gaaagtcaca gctgcgtcga cagcttgatg gcgcaaatat     73980
     ttcagccact gtcgcttggc gaatgcatag aacagaaccc caattacggg cacgagaacc     74040
     agcaaaactc cgaccttccg aggattaaga ccagacgatg ttcgagaccg gctccaatgt     74100
     aacaaccaag cgacggagaa agaagtcgaa gccgtgacaa cagcaccttg tatgccaaac     74160
     gttgtggaga tagacgggag atctgctgga agagccgtgg acatcacatc tgcagctgat     74220
     gtgtaagacg gcgcactgtg ttcgttcagc agctgagacg caacgataac atagccgaac     74280
     tgttccagga atctttcgtt gtcgcttcgt ccaacgcggg aattcagagc agactgtggc     74340
     agacagttcc atcagtattg accgcagcca aggcatcagg tggggagttc ataccgtgca     74400
     gacatcatag agtcgaccca gtgctgcccg ctgtcgcgag actttccgtt cgagaggctt     74460
     gggcagttta ttccgaatac gctcctggaa cttcgaaaca cctcgtgggg caaaatccgc     74520
     agccgtagag tcggagaaat catcgctatg gtctgcctcc ttgacaggcc aacttgggtc     74580
     gtgttcacct tcccctgacg tatgaacaga taagcttttg tgatttcccc caacacgtga     74640
     atcgggataa ctcaccctgg aggtagtccg ccaaaggcga gttctcatag acgagtgatt     74700
     ccatgaccag tgaacattcc gtaatggtgg cgatgagaga ggaggttgga gagacgcgga     74760
     tgttgtaaga caaggcaggg gagacaaagg accaggcggg agattcgaac aatagagttg     74820
     agacaggtgt gagattcaag cgcgttcagg tgcgaattat cgcaaaccca tctccgcgac     74880
     agtccaatgg ggcgcgtggg aaagtcgact caaggagagg gcgatggagt ggaggagcaa     74940
     gttagtatcg aatgggaacg ggggggaaga agggcgacga gctaaatgca ggttgaacta     75000
     gttagaaatc cgaggcgcgg cgggttgtaa gggagggcga gtggatacgc aagaggaggt     75060
     aataggtata gtaagcgggt ttaaggacgg cgcaggatat acatagcaat ctacccctgg     75120
     cagatggaga cactggttaa ggaacaaaga ggaagcccga acgacggtgc ctgtgcagcg     75180
     gccacgttga agatcagacc atgtgtgtgt ctggggaact ggattgcctg cgcttccctt     75240
     ttctgctcga atcggagctg gcgtttgctc cggcggccgc ccggccttgt ccgttctttt     75300
     cttctactcc gtacctgcaa accaaaattc actaactaag aataggcgcc ccccaccgtt     75360
     tcggtgggct ttttcccttg tgcgaatcat tcgcctcgat tcgatctggc ggattattcc     75420
     tccagggcac tgccaatctc gttttccacc cagtgagcgc tcgcgatggg gtgcacccca     75480
     ggcttcccaa cggattcaaa cggtgatcac acaagttagc gagggggtga tccaagtctg     75540
     tgctttgact ttcccctcat caaccaaaac ttgggtggaa ctgacgtctt gtgaactacg     75600
     gcagaccgag gtttcagcat caagcatatg ctggagcccg cgtgggattt cggatgtcac     75660
     cattattacc ctcggggtac acatttaaac ggcttgtttc atgttgctcg gatttgaggc     75720
     agcctcggag aatggctctt tatggctaat accaagaact caaatactag cagatgattt     75780
     attgacgctg cattgaggtt gtctcaagtg gctcattact ttttccttcc acaaaaacca     75840
     tcaccacagc ctggcgcgga atctctggac ggcaataaca aggtgagaca gaggcggcaa     75900
     tattaccttt caacttccat gtctccttgc catatccaca tgcacagtgc ctattgagga     75960
     tccttgtcgg accctacagc atacaggacg atttcgctct gtggcgcaag tagttacatg     76020
     cagctttacg tctccttaca caatcaatcc aactctctcc accatagaag atagtaatcg     76080
     atactctgta tatgggcacg ttaaacgaat acgagaggat gctgttcgtg cagcaacaga     76140
     ttatttagtt actcctcagt ggacaccgtt ggggctttgt atgtgatcga catctaaccc     76200
     aaaagggact aaaatagtat tctagaaatg cagccagtgg cggcatggga cctgtgaaga     76260
     atgtgggaga ctaagtcaag tagcatccac agcgagtcac ctcgtgaaaa ggtgttcaat     76320
     gaccttcgcc aggcagaagt tactttgatc gagagcgact cgatttgcca tctaaaattt     76380
     ctgcctaagg tgtcaaaccc cttcccgttg cacgggcaac gaagcgtcaa catcgcgtct     76440
     ccatacctga gacccatcct cgaccaaact ttctatgact tagcctcgat ctcgcccccg     76500
     aagcttgaca ggtcatccca tctcataact tgaaggcctt ctatcctttc tgccaattaa     76560
     accatagctc ccatccgaca attgaaccgc cgacacgcca tacaggagtc gggggagtta     76620
     tctacgagat atccacatgg aatagaggca ctgcctaaac atccagttta cttcaaaggg     76680
     gttctccttg cattttctca atatgtccgg ctttctgtac gaagctacga ccccgtgccc     76740
     ttcaaggacg agcgcttcaa tcttcagccg cggtagcgac agatgctcgt ccgacagcat     76800
     gtgggaagat agcctgggca actgggacga tactgctaat gtcgagttca cgaccgaaat     76860
     caaacagtca gttctcacag gggcaaagcc cagacgaaga actaagacaa gtacatcttt     76920
     tgctattcac gaagaccttg gagggaaacc tacacagccc acatacaaac cgaagcggga     76980
     ttcaagtata gcagcaccaa ccacgagccg caagacatcc ttacttgcgc agccagctca     77040
     gagatttcgt cccaaagtca gcttcggtcc gagtccagac acgcagttgc gacaagaagg     77100
     gttggctcac aagtcaacaa ctaagagaac ggacacagag aagaacaacg cgcttttaat     77160
     gcggataaat ggagcagatg gtcaggggaa agtaaaggaa agcctcaaaa tggatgtgcg     77220
     ccgtaatacg gtttatattc ccccggatga tggtacagtg gccagcgttt tcatgggtct     77280
     ctttagcccg ctcaaatcgg acgactttga gaagtgtatg aatgaagata ctcaagtcaa     77340
     cagcttggag tcacaaattg ccaggaagcg acaagctaag cggtctctcg cctcgtctgc     77400
     ccaacgggcc ccattacgac ccagctctaa agtaatgcag gagtcctgca ttcatcacga     77460
     tattgccggg aagaatggcg gaaaggaaaa tgtacctcca ggaacagtca tagctgaagg     77520
     caagaaagga aatcagccct taaaaatcaa gggggatttg ggaagccgcc ttaatgctcc     77580
     tccgatggcg gctagaagag ctggtgctac aaacgcccct gcgaagccta catccaagcc     77640
     tctatctacc aagacaaaca acccacttca taggagcaat gtactgagca acagccagaa     77700
     cagcactaaa tcacaacaga acaaacccga gcacaatcgt accatgaagc caagtttgac     77760
     atcagaatac aaccgactcg gttctatgcg aagcccaaac tcatctacac cccgaaagcc     77820
     atcgaaaaca agcacaatac tcaagccaac tacttcgcgc agtaatgtga agcctatcgc     77880
     aaaggaatgt ccaattattc ttgacagcat cacaaacccg gcactgtacg aagagaattg     77940
     gctctcgcac caggaggtgg caataacaca gttggtgaat gaattgctcc gatgtactta     78000
     tgaggagtcg gagattgaca accataccat gcttcgacat gagctcctcg ccttgtacca     78060
     gggagaatct tttgcatacc tccacaaacg tctccaagca tcattgttat acggcgcaat     78120
     gagtataccg aaagacgtac tcatgcgcag tagccgtctt cacaatgatc tgggcttaaa     78180
     acgaaagttt ttggatattt ggatcaagac ctacgatcca cgagcattgc gagccgcatt     78240
     ggaagcagtc actggaagga agatacctac ccccaagttg gttcatgaaa gcgatacctc     78300
     ggataacgac aaggcgatga aacgcaggtt ggaaggattt ctagacgcat tcttgttaca     78360
     aaaccaggat attaaccatc aagaaaagac ctgtgttgga gaggatggcg gtgcagctgg     78420
     ccggacctac cgtcggactg ttcttcgaag cataatgatg gtcatccttc tggacaaggc     78480
     aagaatgtgt caagggaccg ccgttccccg acgccttttc ctctcttcgt cacccgtcaa     78540
     gtcctccgtt gcagttctcc aggcactggg tcggtttctg ctgccatcat gcggagatat     78600
     gatcaaagca ttgagccatc tggactgtga actgagttat gagcagcatc cattggagga     78660
     atatgactac cgggtcgaca accttgctgt agatctccgg gacggtgtga ggttgacaag     78720
     ggttgtggaa atgttactct atccttcaac ctcatccggt gaactgtcga acggaagttt     78780
     cccgctttcg agtcatctga agttcccatg cagaagtcgc gcagtaaagc ttttcaacat     78840
     caaaattgcc ctggatgcgc tagcttctga accaggaaca aggaagctcg cgaaagacat     78900
     acgcgcggaa gacatcgtcg acggacatcg cgagaagact attgcgttgt tgtggaagct     78960
     ggtcagcaca tggggtcttg ctggattggt ggactggaca gaagtcagga aggagattga     79020
     aagactcagg cagaaagccg ctcttcacgc tggtcacggg gatgctgagg acaatatttg     79080
     gcacgacatg tgcataaaca ggaacgacga gagcgacgaa ccaaccttgc tgcttaagca     79140
     atgggcatct actctagcac atctgaaggg cgtaccactc gacaatctaa gcactagctt     79200
     tagcgatggc aagatatacg aaagtatcat tgacgaatac gagggatata tcgtggatcg     79260
     ccccgagagt tatagcagaa cagcatctct agattcgcgc cttcgagcac tgggatgcag     79320
     tgcacaattc ggtgagttta ccaaagacct tactcccttc acagcgacta acattgacca     79380
     gccaaactcg tggccccctc ttcggagact cgtatcgtcg atagcgattt tacaatcgga     79440
     gcactcgcgt tcctttgttc gcggcttctg cccgctacga aacgcgcgcg agccgcgaca     79500
     gtacttcagt cggcatggcg acggatcctt acgcgtcgag acgatgagcg ccgagccgtc     79560
     gcaagggaca ttgccagaca atgcgccgca gttgtacaaa ctcagcaccg gatcctatgg     79620
     gcgaaggaag tgattgtgcg atggtggagg cagactcggg ctcaacagcg tcgccgagca     79680
     gttgctacgc aggctcacaa ggacaaacga tatctatgaa cgcaagtcac catattatga     79740
     tagggattat tgcattgttc aggcgtttat ctacagacca gaaggtctcc aagtttagca     79800
     ctattgtcta attcatgtat tccaacacta atacatcata ccaatcacac agcaccagcc     79860
     cccaaataat gacaccaaac cactacgtaa tataccctgc cctcttcctt gcattatatc     79920
     tcatcagcca gatcatcacc caactagtac ttagaaccta aacaacatcc atgatagata     79980
     cttattacaa atgggggcat ccatcaacca acaccgacca cccaaccaca cacccccctc     80040
     accaacaagc cttatctccc atgacaacta aaaagaagca aacaaaaact aaagatacga     80100
     gatgaaatta tccaatgtga ttatgtacat tggggataga tagtgggggt aatcaatagg     80160
     ctgatagtac ttatcatatc actactatac tagtatttaa ctgctgcagg taaaacttac     80220
     tagtacttgc ttttgccata tagtatatac ccaaccaagt cactaccact actacccact     80280
     tacccaacta ctatgcccta ccccccctct ccccttgctt tctattggtt atagttatga     80340
     tggtttggta ataggttatg tctggtaaat gtgctagatg ggttatagtt aatatgaagc     80400
     agcctacata cagtacagga ttatgtatgc gttatgcatt atgcatcatg gtgaagaaga     80460
     aagaaaatag taagaaaaag aagtaagaga agagcacaag taaacagcga tcatgacgac     80520
     agcagacctg cgacgatatc atcatactac ttactagtag attctatgat gataaaaata     80580
     aacttgctct actagtagta aggtactata tatataaatg atagtatatg catctgccta     80640
     gtatttaggt gctactatca tctgggaaca tccaagcaaa tcaagtcaca cctggaagac     80700
     agttactact aactaagtat tgataggcag taaagtaaaa gttgaaatct gaatgaattg     80760
     ttacttacat acatggttat ttagctactt actattactt tagtaatatt aatcatgatg     80820
     aaagtaaaat ctgttaagat gatatgctta tgcttatgtt catgctacat ttactgttac     80880
     agtggagggt gtgcctacta cgactcctag ttggtagtgg tagagtaagc tatggcttac     80940
     gtgggagatc agccatttat cgtaagtaat aatactgtgt actattaaat ggtgatggag     81000
     ggagagaaag tttgtcgagg tgaactcgta tgatgtcaca ggtttttgca gctgacgagg     81060
     aaaacgacta ctactacaaa gtagttcgtt agttactagt taggagaatt tctttattaa     81120
     tgtaactgta gttggctgaa gtaatgattt gttcacaagt gatgctattc attaatttac     81180
     caatattaat gtgcctgttg tcagtgattt tcatcgattt gagtggttgg atagttagtg     81240
     ggaatgacgt cggttgagca tctgccatct gccagttgag cggccgatcg catttccacc     81300
     cccctcgact acaaagtatg accgaggtag tactgggaat tctccatgat gatataatgc     81360
     ttccgatgat cagatgctgt tctgaatcaa cgaacgaatc cggaggcttg tgagtaggta     81420
     atcatcagca gcagccctgc ggggaaaaag aacaacagac gttcgagaag attactggaa     81480
     gcggcaacac acgtctcctc ttttctatct tttgtctctc cacctccctg tccgatgacc     81540
     agatcgatcg ccagcgggct ttgacttccc tcccttacgg cgtacagtag tctcgctgca     81600
     aaggccctgc agtgcattgg taccgacctg ctggttggag tccggtagac tattatatgt     81660
     acctgtgctg gcgtgaacga actttaatcg cggggttgtt attggcagaa acggccactc     81720
     cgccatcagg agatgccccc tctggcgtcc tcctgagaaa agagcggtcg atcgccggct     81780
     cggagggaat cgcgagatgc tctttgctgg ccggagttgc tattcttccg gatcagcgga     81840
     ggagaaaaga gaaggggtgg gttccttaag ttagtcggta atgcaatgag gcttagacac     81900
     cctctgactt ggtatcgtct ctcctgtgga catcctgtgg tgtgcggaca gacgtgtccg     81960
     aggaccagga cagcttgtct tcttccaaag ccccttaatt gggtacgtct aaacgattca     82020
     agctgcaacg taacctagtc gctctctctt tccccctgaa caaacttcga cgtggtcatg     82080
     cttggtattc gttcgccaag gatcaatcct gcaatatagg agtagatgat cgacgatgat     82140
     ctcccacctt ccggggggat actccttttc agaacggcca gtctctactt ttgagatccc     82200
     tcccccatcc tctatcccgc agtcgcagtc attcgcccaa gtatttggaa tggtgcttgg     82260
     catccttggc cggtcaccaa ctcaacgcgg gatcttcttg gaccagttgc actggagagg     82320
     caaggaggag gaggaatgtg tcgagggcgg acagtaggtc ggccgctgtt gctccggact     82380
     ccgggaaaga ccggggaccg accgctccca ctgtcatggg gaagttctag ccagacgctc     82440
     gctcattcca gcgcaacagg cgtcgttcgc aacttggctg tgatcatctt ggcggcaatt     82500
     ctccgtcgta ctgggggaaa ggtcacagga cgttgccaag aactgccgtg gaatgtccag     82560
     aggggaggga tgagcattga gcaaggggca gtcgaaacgg ggaccactcg gtttttctac     82620
     tccgcctctc agctgaaggg atccctcatc ttcatggttg catggggtga aatgtatatg     82680
     ccttggccat cttggcggcc ctcttggccg tctcagtcgg aatcgtgacc ctcccaagag     82740
     gctgtgatgt ctgtgatgtt gaaggtttcg ggtgatccgc tgtgtctccc ccaagccagt     82800
     gtggtatgtc gatcatgcgc tcactgatga ggacattgcc atccctttga agacccgggc     82860
     tcgatgctgc cactgacaca ttctagacgt ttgcctacca cggtaagttt tcgacgtgca     82920
     ggccggcccg tcatggagtg cttgggacct ggatctttat tcatctttgc aacggctttg     82980
     ttctttgttg cctcccttct tcttcgttct agccgaagca agggcgtaac ccccatgtgc     83040
     gactaaattg ctgcattagc gaccatctta tctttcgtgt acccgatacc tggtatacgg     83100
     gaggtatggt aattgtggtt acctggatcg aagcgaggag taggctgatt aacgtcgacg     83160
     acgttctgaa tccttccatg actgaccatg ccatgcgctc agtcatgggc tcggagaggg     83220
     aggtgcactt gcatatgtca tggcggcagc ctcacgttta tccgcataaa agccatggat     83280
     ggagtgtctg atgtccgggg gtgggtttag ttcgacagcc aggggagtca acgatgattc     83340
     gccaattgac cgagtccaag acccccatcc atcaatcatg atggttgtac ggggtacagg     83400
     tgggcaatgc cgggtcggcg gaatgaagct ggctgtcgca cgggtagctg accatgagac     83460
     aggcaaaagg caccttgttg ccgtgccggt ttggcgagtc gctgggactt tttttacctg     83520
     gggcatacat tactcgattg ggtgcgtcgt gcatcgcaac ttgaagccgg cgcgaatcca     83580
     agcgcgagtc ccgtgctggt ggagagggca aagaggagga gaaagccatc gagcgtccag     83640
     tcagcgtcgt tagggcatcg acccagggag aataaatccc tcatacaaac cgctcttagg     83700
     ccgacgtcgg ccattaaggt acaaggctct aactcttagt cgtcttagct gcaggccaat     83760
     gacaccaccg cagcaggact tttgatcctg ggcgcggagg tcgataagcg gacgtattac     83820
     tcctaatcct aatcctgggt agctcagtcg gtgtttgtta ggttaatgct attcttatcc     83880
     ggcgttgatc ccggcgcctg cctgcctgtc aacctctcac agtagcagta gcagttatac     83940
     catagtaccg cgccgaaaaa gtggccctga ggcattcgcc caccaaagac acaatcccat     84000
     tcatgctctc tggtctgttc gtctccataa tcgatctcat ggcggtccac tcgcacgcgc     84060
     gacagttcag aatctccacc gactgctgct ggtggttcga tcaccaatat gcaagctagc     84120
     catcctatcc cagaaaaggc tgggggagga agaaccggat ggggttgagg acggttgttc     84180
     gtatgccaca tagcatttcc tcttccgggt ggccggtgac cgtcgcggtg gcagactata     84240
     cctgcctact gtacaaaatt cttgttcccc ttctcatcct tgtaagagtc aactttgggg     84300
     tttgggtttt aattaagatt taatttcatt tatttatttc tcttttttat ttttctttcc     84360
     ctttttcgtt gtttcttttt cttcgggttt tgcttgcttt ccctcggccg tgctgttcag     84420
     caagagatct tcagctcttc aatgggcatc gaaagtttgc acgctgttca cgagcacttg     84480
     gaagaatcat tgtatatagt ttatatttct tattctgttt ttcctttccg tcgacggtcg     84540
     gagtttattt gcggaaagtc tgtttcgatc ttggcttcta ggccgcgtag cacatatacc     84600
     agatgtattc ggaacataag tgtacataag tagcatgtac cttgtatctt gttctcgatc     84660
     caagtgcgga gagtccgtgt tggcggtcat ggatgaggat ccttcggaga ggactgagag     84720
     agagagagtg tgtgtgtggt agccaagcat gggtcgccaa aggtcgcatt tcctccccca     84780
     acagcggcat atgcaatgtg taacgggggt gaaactggcc cttcaaccca cgccgtgtaa     84840
     gcaacaataa taacaagcat acttagtaaa tgaaccaggg ccggaaagcc caaaagggca     84900
     actggagtcg taagactctc gagcaacgaa ggatcgtgta aatgggccga ccccgttggt     84960
     tcgtgaaagt gatcagtact agtacagtag tactactcca aggaatgccg atagttagta     85020
     cttccccagc agtttttctt cttattccca tgactggctg agatttggat cggtcctgat     85080
     tgctgggatc gaggcaaaag cgggcaaagc agcataagaa aaaacattcc cgagacgcgc     85140
     agattggctg ctgcgattgt gggaagctgc atctcccgga gcagccatgg cactgagtgg     85200
     gggttatccc tgaatcgcat gaagcttgtc ccagcacttg aaggcttcgc gaggcgttta     85260
     gcagtctagc tgcacccccc atcctcagcg accgtggatg tgcaggtttt ttgattgtaa     85320
     gcccgttggt ggtggatggg gtggaattag cccgctcgat ggtctccgct ttggagatcg     85380
     ctaccctggt tctgagctcg gtgaaccgcc gcccggctgt cagtcatagg agagaaagtg     85440
     atgcagtttg ggtctctact gtgtatttct ctggttctgg cgctgaccgc ttgtcccagt     85500
     tgctttgcca tcgggcatgg atctggtcat catcgccata ctgctttttt tccctcttcc     85560
     ttgtctccat tcttccggag acaatctatc cacaacacag tccagtctgg gaaagacggc     85620
     acgatcgcct gaagggaagg aacgggatct gagatgcact tttgatcgtt tctagtccgg     85680
     atttgggggt ggtcttggca cgggtctcgt atgtacggcg tatgtatgag catcggtctg     85740
     tatgtatgga taccaggccg atcccgatgg gttttcctgc ttcctttttc cctctcacac     85800
     tttccatcac tgccactcgc tgaacatgct gagcctttct tgtcgggaat gcctaaacaa     85860
     ttctaaactt agtggccccc aaggctgaga tcctagagat gaatggacaa gttgctggat     85920
     gagacgaaac tctatctcca gaattggctg ctacctgggt gaccatccct gggatgatca     85980
     ctgtggagtt acccggggga agacaagaac tcggctgtca aaccaccagc gacaaaacta     86040
     tccaagatcg tgctattgtt tgaggaaccc attgaacaac gatccatgac tactagttcc     86100
     cagtccttat ttgcatagtt cagatctaat ctggttattt ctggcaacaa tggtctgatc     86160
     tctgatcacc ttggagtccg aatatgttgt acagccaaga gccaactatt cccgcccaga     86220
     ccgactgtca ctcccagctg ttgtcaatca ggtggcggtg cttctagtca acaacatact     86280
     tggggtctgt agcatggctt gaggttctca tatactcatc attctcattt ggaccgatct     86340
     aggtaccagc tttcctgggt acggttatcg gaaccaacct tgagaggtga gcgtggcaga     86400
     ttgaagacat ggaaaccacc tgcttgtccc attgccagtc gctgtaaccc catcaaactc     86460
     tccgagactc gagagcgtca tgatcgaatc ccggtcacag tcggggaatt ttattgattt     86520
     tcatggttct cttgatgtgg tagccgttgt aatgtagtac tctggggtag agttggtgct     86580
     acgtactgaa gagttcagtt cctcaagttc acctcgtcat agcagggggg ttaggggtct     86640
     agtcggtccg agaaactggg atagaatcgt cgagacttct cttgcagttg gttcgcagtt     86700
     cccagtgatg tctgtagcaa gcaggcaagt ttgtcgttct ggcccgcatc atcggcatca     86760
     cacgagatgc tcctacggta ctggtaacta ctgcttcaga ctgagataac cttcaagact     86820
     gccgtgacac agcatgacta gggggaaacc ttacgtcaca gggccaagac catcgctttc     86880
     cggatcagga accaccagat ttaagcccag ctagggaaag tctcggcaaa tgcaatagtg     86940
     agcaatgaca agaaatacca agcattgtta ttgggattgt aaaacaataa tagcaaccag     87000
     cagggggaaa gggaggcagt gtcttgaaga acttgaattg ttgtcacttt gtctagtctt     87060
     tgagaatgag gcgtgatgcc aagcaccaca ttggtagcac tataatgatg attgtcctct     87120
     gggtgttatt ttggcctcct aacaaaatta ccatgttagt ctggtttggt gtgctgtgta     87180
     tggagtaggt agggtggtgg tgtgtggtgt gtattcctgg agctgcgacc gaccgaatca     87240
     gtcggaagag gtagctacgc cgaggaacct agtaccttaa gaaaccactt tcacgcataa     87300
     gcagcgcata aagtaagctg atgggatgtg atgctaggct taattcaatg ctcgatgcaa     87360
     tatttatgtg tggccagtca aaaggtcaag ggtcgttagc ccaacaaagc ggccgctgaa     87420
     acggcttcgg cgcgactccg acggggttca ttttggtcct cccacggtca agttgtcggg     87480
     tctgcttgcc gtggtcgccc tcgtaattac cctggcatta cccgccccga cggtcggtag     87540
     ggcaactttc ccacacacaa cagtagcagc tcgtgccgct atgatgcctg ccctggctcc     87600
     tgcgctgtct tgtcctcgtg ggggttcatt ccttctcatt gagtagccgc cctccttgtc     87660
     tgacagcctt tctttgctct ggaccttccg ttattcgctg tcttggtgaa aacccttgag     87720
     attttgtacg acattccgat cagataaaat atccttttcg ctgaatatgt tctagaaaac     87780
     aaagaatgga tcaccccctt acttttcatt ctctggttct tcggccacta ctatagtttt     87840
     ccaagacctt agtgtagatg gagggggggt gatgtttttt tttatggcag cttttcccga     87900
     ttaagaccac agtaagtatg gtctgggata atttcttact gaccgggtta gtaagatcga     87960
     ggttagcccg ccttggtagc caacctccaa aatgcctcat agtcttttgc tttttgtact     88020
     tcggtgctgg cttgccccat ggatgaaacc ggctcgttac aaaaccggtg actcctgaat     88080
     caggtcaaag gaacaacagt catatctcgc agatctcagc agacaatgag atccgtgatc     88140
     ctcaactaga tattcctttg aatgactctt ctccaatcct ttatgactcg gagcctcttc     88200
     cctccatgac ggggtttttg cttgacggta attgcctact agtaagtagc atgacggctg     88260
     tgtattgacg ggagcgtaaa gaataccaag gtattggtac tggccagcgt cacgtagccg     88320
     caggaaccga agcatgcatg gatttggcga ggaaaacgac agggtgggtc tgggcttggc     88380
     ggggttggtt ggactgagcg tctctcgtcc gcctgcagaa ggaaggaaaa gaagccccag     88440
     agaagatccg aaattgtaat cgtgggtaat gggcgtggtg ctcttttttg ttttcccacc     88500
     atttttccct gccctccttc ggccttaccc tgccgtgcca gtgtgtggcg accactcctg     88560
     accaccccaa cccggtcact cgctcacaaa cctggcgccg ctctcccgcc tcttttaccc     88620
     tgcgaatcgt catttactcg ctgaggctgc gcctttttac ccgccctcct tttggctggt     88680
     gactctcaat acctcgttca tacgcagtac tgagcgtatg gtaacaatac tacggcgaca     88740
     acccccgagg atttctttgg tttttgattt ttgatttttc ttttaataat aaattttgat     88800
     tttcgaattt taatttttta atttttttta ttttcgcctt tccgcaaacc actccccccc     88860
     ccctccctta attacatttt tattttccga tcatctctac attcctcctt ctctccatct     88920
     caatcccacc tagcactgcc aacacattgc acctgcgaaa ctctttcgac gcgtcttctt     88980
     cttctggcgc tctttgagct gccaatcttt gaagaaggcg taagtccatc tcttggccgc     89040
     atacctgacg ctcttctcct tttcttggac ctactaaact actatactac gcctctttcc     89100
     tactactaca ccatgtgttc tatatcatga caatcatcgt cctactaagg acacccttca     89160
     tttccgccct ctgggtcgat cagtgctact attgatcgat aacgagagtg catcttctat     89220
     tttactcttt gattgatgca attattcttc attcttctct tccctaacaa tcaacccatc     89280
     ttgaataccc tcataatact acctaccgcc accatttcat cgagtcacac tatactacca     89340
     ccgccaaccc tccacctaac cttttgacac cgcacctcaa caccttccac ctacttgttc     89400
     ctgtcttccc tcttactatt aatataccta atcttcgaag ggatggcgca cttgcgtggt     89460
     ggtgaaagaa catttgcctc aatacataac ctactgaaga tgctactctc acctcatcag     89520
     tccagcaagt ctgcccctca ggaagctgac atggtcgagg acattgatga gccccctgat     89580
     catcggtttc tgaacacgtc gatgaacaac atggacgacg gtgtcgttta cgtcaagtcc     89640
     accgccgcca tgactgaccg gaaggagtcc ctcctcaccc gcgccctcaa gagcagcccc     89700
     cctccaagcc cagccgatcg tcattcacca tctcaggagc actccttcta ccgctcctac     89760
     acctatacca acatcagcgg catctctaca gccgagttga ccagcgatgg tggcctcaca     89820
     agcccctctc tatccaatac acccagcccg cctctgccct ctcacttgtc caacaacacg     89880
     tcttcgatgg gtgataagag aaaggcggag gcggtggaag tgggcgagtc ggctgtcgag     89940
     gcgaacctgg gacgcaagcg gtgtatcagc ttcgcctgcg gacgcaaagc cgaggagcag     90000
     aagccacaga acccttcacc acagcgtcca gtcacgaaga tccatgacgc cagcgttaca     90060
     ccaactgagc ctaagcggag gaccgttctc acctttgttt gcccggcacg ggatcccgaa     90120
     actcgccggg agaggtcgcc acttcgcggt ggctgcaggc cgcgtccccg cgggtcgcct     90180
     gctcccatgg cgcgcaaggc ttccccggag aaggctgctc cctcaccggt gagcaaggct     90240
     tcccaggagc agaagattga tcgccggggt gtcccgacca aggggttggg taagttcgaa     90300
     gagtccgagg ctactcgctt tcacgaattt gccagctccg tcgaggaaga tgacgagtgg     90360
     gtaacgaagt ccggagagta ttcggagaag attacgctta atgactgtat gaagaaagag     90420
     aatgctatta ggaagctggg agaggaagcg gaggaagagg cgctcgaaga agatgacgaa     90480
     gatgatgttg aggactccga tgacgactcg accgttcacg atttctcttc tgatgacgga     90540
     aatgaatcgg ataatgaagc tggttttgca gagtcagacg agagtgatga tggttcggaa     90600
     tacgattttt gggctccgac cagcactact gctgccacca gccctcaaaa tgccgacatc     90660
     gctcgccacc ctttcagtcg ccgcgactcg aacacgtctt tcgattctgc caacgatgtg     90720
     cagcagcagc aaagatggtc gcctgtctta tctgccaaga caactagccg atcgcccatg     90780
     aagatcccaa agttgcgtcc tggcacacct aaccttcccg acagtacgga cttcgtctgc     90840
     ggaactttcg acgaagaccg gcctctggag gctgcctaca agtcttgcat cgagcagcgc     90900
     cgtctttcca agcaaattgt catccctcaa gatatcgatc ccagctttcc cacttcggat     90960
     cctgaagatg aggaggatga ggaggatgat attgaggaat ctgtgatgga tgaaggacct     91020
     cggggacgga ctggtagaga ctctgcgcag aagccttctc ctcgtacgtc tcccagacgt     91080
     atggtctcac ctccgcctcg ccgtcagggt cgttcctcgc caaagcgtct tcgctctccg     91140
     ccgccgccga tgaagctgcg gtcttccaag gatgacctgg catctgcgga tgaggcccct     91200
     gctgtgccgt cgcggggact gaacatcagt gaactggtgc aacgtcccgc gatgtctcgt     91260
     accaagtccc tgcctcggac gcccaaccct ttcttcacta gtttggacaa gtctcaccgc     91320
     tggtctggca ttgtccctgt ttacgaatcg ccggagcgcg agtcgtcacg cacccgtgag     91380
     gtgcacacca gaggtcccat cgatattgtt gagggtctcg agaagaaacg ccagaaacga     91440
     aaggagaagt tctggcgtca gcattgccgc aaagctgcca aggagcagat ggtacggcga     91500
     ccgatccccg gaaaaggtgc tgaacggatg aaggagcttg gcctcgaagt tgctgagagg     91560
     tgcagagctt acggcgttgg agagaacgcc cagctcgtcc tatctgttta gacctcaaat     91620
     tccgcgtggg attcgataaa ttcttgtaca tagttcgaat ttttcttatc accctttcag     91680
     tcgtccactt tcatgaccag cggaccgacg tggtgtacaa attccaattg agcgttgttc     91740
     gctacacccc ttgtcttcga tgttgctatt cttgtcctca caacgtgtcc atcggatttc     91800
     tattcgcacg gagggtcccg tctgcattta caggggtggc tacctttgat tcttcctttt     91860
     tcgcccgtcc ccctttcttt tcgctcttct tctcattata catagcttgt ttattccttc     91920
     ttttcttcat tgttcacgtc cgcgctgctg agcggcggat ttgacgtttc ggtcggcatc     91980
     attgctcggt tagcctgggt tgcatggagg cggtttgctg cgcgtatacc cccgtttgct     92040
     ttcgttatcg aatttgtaga tacagagcga atgacatgtg tcattgaata tgccaacgta     92100
     tgatgaacta ctcttgcgta tattagacgg tagaaccagt tcgggtttcc gttgaaataa     92160
     tgtagtagtt tcacagtgtt ccaaacgact cgatcggggc ggatgatctc ccggcggctg     92220
     agttggctta agcgctcggc taagcgtccg ggcaagcgaa agtccaacgt caactgtcgg     92280
     cgaccgcaac ctggctcctt ctcctgctct tatctccagc ccagccgttc accaccgcca     92340
     tttggcccat tttgcaccct gcctcgtgct gctacccgat ccgcaaatcc atagtctgag     92400
     gttctgagtc gattttcacc atgtggctca ttaactggtg taggtagtct cctgttttgc     92460
     catccgccga cttggccccg atcaggtggt ctgcagacct gccctgcacg ctcttggatc     92520
     cattggatcc tcatcgtttc tcttctgttc acagtgtctc tcgtatgcca atttactgat     92580
     ttatcttttc cgaatagtct acgatctcct ggcctccctt ggcctgctca acaagcacgc     92640
     caagctcctg ttcctcggtc tcgataatgc cggaaagacg accctcctgc acatgctgaa     92700
     ggtatgtgag cttcctttag tcgcaggcaa gctctgcttt gatggcaaca atggtggata     92760
     tggtatcgcc tgggatcgac tccgatcgca agggaatgcc accacggcag ggatagagcc     92820
     gcgagagatg tggacgataa gctaacatct gtgtttgata atagaacgac cgggttgcca     92880
     tcctccagcc cactgctcac ccgagtacgt atcacccgca cgaacatgcc agcgagggac     92940
     tattcgacag cgaccgagga gaatcgattt tcatgaacat gggctaaccg cactccttga     93000
     atacagcatc cgaagaactc gccatcggca acaaccgctt cacgaccttc gacctgggtg     93060
     gtcaccagca gggtgagtaa cacacctcgt agccccgtgg tatagatcga aacaagaaaa     93120
     ctaaatgtag caattcttgt taaatagctc gtcgtctgtg gaaggactac ttccccgaag     93180
     ttagcggtat cgtcttcctc gttgacgcca aggaccacga gcgtttcccc gagtccaagg     93240
     ccgagctcga cgctctcctt gccatggagg agctggctaa ggttcctttc ctgatcctcg     93300
     gaaacaagat cgaccacccg gatgctgtta gcgaggatga gctgcgccac cagcttggat     93360
     tgtaccagac cacgggtaag ggcaaggttc ctctcgaggg aatccggccc attgaggtgt     93420
     tcatgtgcag tgttgtcatg agacagggtg agtgggattt ttcatatcca aaccaatgtc     93480
     gaccaggagc taatcgttct gtgccttgta ggatacggtg aaggtatcag atggctgtct     93540
     caatacgtct aagtcagcta gctcgcttgc tagccagctg ttgactttat tgttgcgata     93600
     tatcccgact actctatttt tgttctccta tccctctact cccgacgatc tccctcttaa     93660
     acgcaatcct ctcatcttcc tccgaaccct ccttggaggg tgtaggaatt ccatatatcc     93720
     caatccaatc caatccaatg cagttcaatg agatgaactc cactccgtcc aatcagacag     93780
     gccatcacaa ctgcctggaa gaaagtactc gctaggcata atagtcccat gacccatcta     93840
     caatatatct cgattgttca accatttaaa tggtcatgtc acctacactg attcatacta     93900
     tgatgttgtg tgcttttttt ttcggagttt gatcttttga cgatgtttcg atcagttctt     93960
     ggtgctttat cacgctgtcc ctttcatctc gttgtagcca cctttcctct tgttctctct     94020
     gcgttcgcct tccaagacca aacaatcaac caacaaagca aataaaaaaa acaaagacat     94080
     atccttcccc ctgactttct ccctttttct tcacctatac tgtaacaatc tagttcagtc     94140
     accccctttc accgcttgct tgcttctgtt ctctagatac gaccgagtac gcagaaacga     94200
     gaattccaaa tatacaaaac ccctagaata cattcatcca tccatctcac cacaggcagt     94260
     agtagtgtat gaagagttac tactattcgg acatgtttcc tactacttca gtcatgagtc     94320
     ccaatccact actactattt ctggcaaatc cacatactac acacaagtac tcagtacatc     94380
     tgatagtaaa gacagatggc tgactagata gtagataatc gatagaaagg agtcccgagt     94440
     tccatacgaa gaaacgaaaa gtctaattac taacttagtt aacaattact atgcatatag     94500
     tcagcctact aatactttac taattaattt taccattcat cccgggttcc cgactggtag     94560
     gagaatctag ggaaaaaaat acggagaaat agagaccaag gttagataga tagatagacc     94620
     ggataggata ggatagttgg tacaaataat acacacgcac acacgtatac acacacgatg     94680
     tcacacgaga cgaatacaat accccggcga gagagaaaaa aacaagacgt cattcaggca     94740
     caacgataac ccctttcccg atctgtacat tcccatacat ccttccattc cattccagtt     94800
     tgatttggtt tgtatccttc tcccccgctt ttccgctcat tgaggtccac ttccgtgata     94860
     ggtaggtagt agtttgctgc gtagtttgaa tgttgggttg gcggattgtc gtttgtttgt     94920
     cgattgcatt gatttccatt gacaagctag ctgaatgcaa tttcacggat cggtgtctgc     94980
     tgggtagggt aggggtatag acagtgtggc tagatgggcg aagggaaaaa ggaagaggac     95040
     ggggaggagg atcttggttt tggacgctcg aaagaaacgg gcgtgtcgtt gcttatttgg     95100
     ttggcattac actcacagga agattttgaa taaaaaacgc acttggaaaa caccagatgc     95160
     agcccgtcgc ttccccttcc tgtcaaatga attcggacaa cacaagttgg acaatgggaa     95220
     gaaaaagaaa aggaaaagga gtaaaaaaaa aagggaagtt gaagaatgaa gatcaacaag     95280
     aatgagaaaa caccaacccc tacttggagc agaaactacc ttccatatag aaatgaaaca     95340
     cattcagcgg gaaatcaatg actgggggag tcgctggagt ctggtatgcg cggagggaaa     95400
     aattgagacg ttctgcgtgt cgtgaggttc tcgggcggct ggggtgtact gctgctgccg     95460
     atcgtctaat gtatggccat cgaatgtcgt tgggatttgg gtctctcgtt gtagtgtgac     95520
     attgtgtggg agttatgacg tttttatctc cgcccgaacc tgctgcacat ggaaaagctc     95580
     gtatgattcc ttacttcttc ttttgctttc gcggaggagt gatgggcctg cctgagctca     95640
     tgcccccgta aacgtacttt tgtttctttt ctgctggctt caagatctat tgcgagaaaa     95700
     aatacccgtt agttccaaaa ccaatccctt cactaaagta caaagtagtt tggttgggac     95760
     ctacctggaa ggaacaaagt aggctctcgt cgacgctcat catcgcacca gcgttgtcga     95820
     actcgccaca gtagttggga gcactgaata gcgtaaccag ctgtctcttg gagaagaact     95880
     catagccatc ctcgacgacc tggtgtgcgc gacatatcag gtccatatca tgcttctgga     95940
     ggaaccgcga cacgacgtcc ggaccaaatg tgaaggatac accccgatcg ttctcgctcc     96000
     agccagtaat gtccttatcg ggatcggacc agagcaagtc gcaaagaaga ccgcagtcgg     96060
     gaatctatcg tcgttagcag gcgaagctca aggcttcagg gagcccggca gagattttta     96120
     aacgttccca ggacccttat gataacaaac gaaaggagtc                           96160
//

If you have problems or comments...

PBIL Back to PBIL home page