(data stored in ACNUC7421 zone)

EMBL: AM269960

ID   AM269960; SV 1; linear; genomic DNA; STD; FUN; 13107 BP.
XX
AC   AM269960;
XX
DT   28-JAN-2007 (Rel. 90, Created)
DT   14-MAR-2015 (Rel. 124, Last updated, Version 5)
XX
DE   Aspergillus niger contig An01c0130, genomic contig
XX
KW   .
XX
OS   Aspergillus niger
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
XX
RN   [1]
RP   1-13107
RA   Pel H.J.;
RT   ;
RL   Submitted (01-MAY-2006) to the INSDC.
RL   Pel H.J., DSM, 624-0295, P.O. Box 1, 2600 MA Delft, THE NETHERLANDS.
XX
RN   [2]
RX   DOI; 10.1038/nbt1282.
RX   PUBMED; 17259976.
RA   Pel H.J., de Winde J.H., Archer D.B., Dyer P.S., Hofmann G., Schaap P.J.,
RA   Turner G., de Vries R.P., Albang R., Albermann K., Andersen M.R.,
RA   Bendtsen J.D., Benen J.A., van den Berg M., Breestraat S., Caddick M.X.,
RA   Contreras R., Cornell M., Coutinho P.M., Danchin E.G., Debets A.J.,
RA   Dekker P., van Dijck P.W., van Dijk A., Dijkhuizen L., Driessen A.J.,
RA   d'Enfert C., Geysens S., Goosen C., Groot G.S., de Groot P.W.,
RA   Guillemette T., Henrissat B., Herweijer M., van den Hombergh J.P.,
RA   van den Hondel C.A., van der Heijden R.T., van der Kaaij R.M., Klis F.M.,
RA   Kools H.J., Kubicek C.P., van Kuyk P.A., Lauber J., Lu X.,
RA   van der Maarel M.J., Meulenberg R., Menke H., Mortimer M.A., Nielsen J.,
RA   Oliver S.G., Olsthoorn M., Pal K., van Peij N.N., Ram A.F., Rinas U.,
RA   Roubos J.A., Sagt C.M., Schmoll M., Sun J., Ussery D., Varga J.,
RA   Vervecken W., van de Vondervoort P.J., Wedler H., Wosten H.A., Zeng A.P.,
RA   van Ooyen A.J., Visser J., Stam H.;
RT   "Genome sequencing and analysis of the versatile cell factory Aspergillus
RT   niger CBS 513.88";
RL   Nat. Biotechnol. 25(2):221-231(2007).
XX
DR   MD5; d1a1dea77703946aad337dde0c77bbf4.
DR   ENA-CON; AM270980.
DR   BioSample; SAMEA3283178.
DR   EnsemblGenomes-Tr; CADANGAT00000399.
DR   EnsemblGenomes-Tr; CADANGAT00000400.
DR   EnsemblGenomes-Tr; CADANGAT00000401.
DR   EnsemblGenomes-Tr; CADANGAT00000402.
DR   EnsemblGenomes-Tr; CADANGAT00000403.
DR   EnsemblGenomes-Tr; CADANGAT00000404.
DR   StrainInfo; 791018; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..13107
FT                   /organism="Aspergillus niger"
FT                   /strain="CBS 513.88"
FT                   /mol_type="genomic DNA"
FT                   /clone="An01c0130"
FT                   /db_xref="taxon:5061"
FT   CDS_pept        complement(join(522..1402,1454..1669,1719..2559,2608..3622,
FT                   3706..3974))
FT                   /locus_tag="An01g04060"
FT                   /note="Function: TFC4 of S. cerevisiae is a subunit of
FT                   transcription factor tau (TFIIIC) involved in tRNA and
FT                   5SRNA gene transcription; TFC4 acts as assembly
FT                   factor,which recruits the initiation factor, TFIIIB, to the
FT                   DNA."
FT                   /note="Remark: TFC4 of S. cerevisiae is also called YGR047C
FT                   or pcf1."
FT                   /note="Title: strong similarity to assembling subunit of
FT                   transcription factor IIIC Tfc4 - Saccharomyces cerevisiae"
FT                   /note="nucleus"
FT                   /note="See PMID 2686985"
FT                   /db_xref="GOA:A2Q8E5"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR039340"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8E5"
FT                   /inference="profile:COGS:COG0457"
FT                   /inference="similar to AA sequence:PIR:A47453"
FT                   /protein_id="CAK36942.1"
FT                   /translation="MDYPDDHHPHHQPPSQEYVYPDIDETIHYPWQGNQPTTQGEASIH
FT                   SVLDPRLYKDLFTGNASQAQDEASLDEDAEAYHDADDSDESLYTFEEEFSNQADEDDEA
FT                   YGRRRRRGTGPFSGRYGARGGKGIRRGPRKPLEPSPEFKILHSEATSAFIDGDYDRAID
FT                   LTKRAIQVNPEMFAAHSLLSEIFLAQGEKDKALTALFSGAHTRPKDPTVWAKVARMILE
FT                   RAGEERQGALNDVIYCYSRIIELDPKNYNARFQRAAIYRELGYNGRAATEYERILKEVP
FT                   HNARALRHLAETYIDLNDVQKAVDQWRVSVKYFTSLEPEDAPEFSWSDVNIYAELYSYL
FT                   GRPFEGLKALKSVSRWLLGRKDDTMWEDFHEDDREWDADDSPRRIKADGYEPRRWPRDS
FT                   YGLGLPLELRIKLALFRLRMGYEHKNEALKLQHHLEWLNPEDTSEHARLYDYGDLFREA
FT                   ADALKDVGLFEEALRFYMPLQQTNEYADVGFFMAMGECCSVLGKLEDAENCFLTVAEHD
FT                   ARHVESRVQLAKLYEGIGMSEEALKYVNEAVLLGRQESRSNRRRKDTRLEQLAVEFKAA
FT                   DAAREDAALRSIAPQPPSADLPAALTTTTTSAAKDTEINEEQRIANVQYLYDKLMQLLP
FT                   QAKEGNAEATEDWLDIADALLREFRSNRVFYPIQRNITFLGYSREAQRKAGRHKGRNFI
FT                   DEMQEMAGRLQESLGSIPDEPLQGAIPTDYYGISFNEWLDLFLQYALTVATQGESDEAY
FT                   DTLAAAADASVWYHSKADTRMIHVCWFTCALRMQDEETLANEARWFIKEYQFVTDTYRL
FT                   FAMLSRLVGDPHRSLFHSSPNMKFMLRQIKAMDFTVPDEVTGERPNRFVRESAYKERAS
FT                   LSTRDETTGEAIPADEMDVALLVLYGHILYSGNSFYPALNYLFRAYALDDQNPAVLLSI
FT                   ALCYIHHSLKRQSENRHYLIMQGLSFMQEYRRVRERPGSLLSERQEMEFNFARVWHSLG
FT                   IAHLAIEGYQLVLDLGAQIQAQSQQTIPHPKDGSDVVMGDTGLEAQAPFVEDFSREAAV
FT                   ALQIIYALNGDYQSAQKVTAKWLVI"
FT   mRNA            complement(join(<522..1402,1454..1669,1719..2559,
FT                   2608..3622,3706..>3974))
FT                   /locus_tag="An01g04060"
FT   exon            complement(522..1402)
FT                   /locus_tag="An01g04060"
FT                   /number=1
FT   intron          complement(1403..1453)
FT                   /locus_tag="An01g04060"
FT                   /number=1
FT   exon            complement(1454..1669)
FT                   /locus_tag="An01g04060"
FT                   /number=2
FT   intron          complement(1670..1718)
FT                   /locus_tag="An01g04060"
FT                   /number=2
FT   exon            complement(1719..2559)
FT                   /locus_tag="An01g04060"
FT                   /number=3
FT   intron          complement(2560..2607)
FT                   /locus_tag="An01g04060"
FT                   /number=3
FT   exon            complement(2608..3622)
FT                   /locus_tag="An01g04060"
FT                   /number=4
FT   intron          complement(3623..3705)
FT                   /locus_tag="An01g04060"
FT                   /number=4
FT   exon            complement(3706..3974)
FT                   /locus_tag="An01g04060"
FT                   /number=5
FT   CDS_pept        complement(join(4512..4620,4718..4797))
FT                   /locus_tag="An01g04070"
FT                   /note="Remark: the predicted ORF is only 62 amino acids
FT                   long."
FT                   /note="Title: questionable ORF"
FT                   /db_xref="GOA:A2Q8E6"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8E6"
FT                   /protein_id="CAK36943.1"
FT                   /translation="MERSNRTSQERKKQEAKRKNDTLPWRASDTLEHHSSTFYIFCNID
FT                   YIDNPIDQDLTISSPFI"
FT   mRNA            complement(join(<4512..4620,4718..>4797))
FT                   /locus_tag="An01g04070"
FT   exon            complement(4512..4620)
FT                   /locus_tag="An01g04070"
FT                   /number=1
FT   intron          complement(4621..4717)
FT                   /locus_tag="An01g04070"
FT                   /number=1
FT   exon            complement(4718..4797)
FT                   /locus_tag="An01g04070"
FT                   /number=2
FT   CDS_pept        join(5675..6176,6235..7517,7572..7628)
FT                   /locus_tag="An01g04080"
FT                   /note="Similarity: the similarity of the predicted ORF to
FT                   the hypothetical protein YOR359w of S. cerevisiae is
FT                   restricted to the C-terminal end of both proteins, but the
FT                   homology in this region is relatively high."
FT                   /note="Title: similarity to hypothetical protein YOR359w
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="GOA:A2Q8E7"
FT                   /db_xref="InterPro:IPR001660"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="InterPro:IPR037635"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8E7"
FT                   /inference="similar to AA sequence:PIR:S67271"
FT                   /protein_id="CAK36944.1"
FT                   /translation="MASHIIGNRNSTPEASKSSLRPPSSSRNLGSHQLRASADMSGFPS
FT                   PLSSRSIRPSSEVYFNQQSQASNNAEDPLDRAAQQWLADIDQYETTLEEMAAATLDQDF
FT                   KDELSAIEQWFRVLSEAERTAALYALLQQTTQVQIRFFIQVLQQMAKSHPMSGLLSPAN
FT                   FGEKDAMSNRLNDAMSKLNVDSSRSSLGRPPPSPGAKRNSGLDSSTINAMFPDAAAAIA
FT                   KKKAEFTQQTGNAPPSNRNSAVFDRTSFVAPTISAPDNSNDTLGQPPVSPWAQRGSEPQ
FT                   PPIARPKSSSGHQPMGQFSQTPSSLRSPLPTQTATIPAPEIDAPLLSPYNVGNASWASM
FT                   TNTPMTATFGQQPQQPQQNSQADMVANATAMKLAALSTVNNRIALDDARKYRRARSNDG
FT                   QGKNSANSHAMSQGGLASPGLPGHSHLVAGQLLNTQQLAALQAQQQAAMAGRRSRPTSP
FT                   GIAMQGAGGLGPMGFTSPQNNGFLAAYDPNNPLMGNGLGALGIGQFGLGGPEGYLSDHS
FT                   EVARGRSPRGRRGSSKPPEDPTDPNLLKDIPSWLRSLRLHKYTENLKDLKWTELVELND
FT                   KALEDRGVNALGARNKMLKVFEQVREAKAEGKLDNIA"
FT   mRNA            join(<5675..6176,6235..7517,7572..>7628)
FT                   /locus_tag="An01g04080"
FT   exon            5675..6176
FT                   /locus_tag="An01g04080"
FT                   /number=1
FT   intron          6177..6234
FT                   /locus_tag="An01g04080"
FT                   /number=1
FT   exon            6235..7517
FT                   /locus_tag="An01g04080"
FT                   /number=2
FT   intron          7518..7571
FT                   /locus_tag="An01g04080"
FT                   /number=2
FT   exon            7572..7628
FT                   /locus_tag="An01g04080"
FT                   /number=3
FT   CDS_pept        join(7955..7963,8063..8743)
FT                   /locus_tag="An01g04090"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8E8"
FT                   /db_xref="InterPro:IPR029008"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8E8"
FT                   /protein_id="CAK36945.1"
FT                   /translation="MALKVVTHQRRNQPAIYSNSDIMLPTYLAIYQLITTTNTIIHPPT
FT                   VHHPKPHNQKQSKCHPQNKNSLSSSTPSSRNLSNTTTGCVKPSPKPTNLLRTLSLTIPP
FT                   ILIPQTLSSLHSLTSFLLGLTAGILSLQSATGFLFYLLGTVFVSALFHALLLYRSGGLG
FT                   AGMYFAGANGEVEGMDERGVVSGKGTKGGGMLRRAAWRDVWFGGGVLSEALSGFILGWA
FT                   GVGGVLR"
FT   mRNA            join(<7955..7963,8063..>8743)
FT                   /locus_tag="An01g04090"
FT   exon            7955..7963
FT                   /locus_tag="An01g04090"
FT                   /number=1
FT   intron          7964..8062
FT                   /locus_tag="An01g04090"
FT                   /number=1
FT   exon            8063..8743
FT                   /locus_tag="An01g04090"
FT                   /number=2
FT   CDS_pept        complement(join(8900..9001,9061..9680,9748..9804,
FT                   9908..10304,10351..10386,10435..10447,10500..10839,
FT                   10899..11229))
FT                   /locus_tag="An01g04100"
FT                   /note="Function: mdr of B. subtilis is a multidrug-efflux
FT                   transporter for e. g. puromycin, nerfloxacin and
FT                   tosufloxa."
FT                   /note="Similarity: the ORF shows strong similarity to
FT                   several multidrug-efflux transporters (especially from
FT                   bacteria) with different specificities."
FT                   /note="Title: strong similarity to multidrug resistance
FT                   protein MDR - Bacillus subtilis"
FT                   /note="See PMID 1675788"
FT                   /note="See PMID 11378963"
FT                   /db_xref="GOA:A2Q8E9"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8E9"
FT                   /inference="profile:COGS:COG0477"
FT                   /protein_id="CAK36946.1"
FT                   /translation="MIKAYKYISQKTKDSKSPAPKPLCAHRSQWYQLESTNREDSESLE
FT                   RPMSGSTKGLSPATGTDKCRLCKEQKHNARVYRVKLIAGLTLPFTLSTLDLTIVATATS
FT                   TIASHFNQFDELNWIITAFSLTSTTFIPIFGQLADVFGRHIVLQTALFFMLIGSVLCAA
FT                   AQTWGMLLLGRALQGVGSAGLNNIIMIILADKVSLKENARNKSIFTIFGGVGYAVGPVI
FT                   GGYLTDSNWRYCFVVPIPIAVLSHIMIFVLLRNDLVEGTMFKKGSRWSSILPALATIDL
FT                   GGSILFIFGVGLIILGTTWGGATYSWSSPQVLAPLIIGAICFIAFFVYEYLLEPGRLFA
FT                   RIFPKHVAMLPYGLFERTDTIWLAIVNFSTGVGYSTSKAGLELLYYIPGLGAIYFCNGF
FT                   PRQTFFPLLMGAVLSTVGLSVVAYAISAQETSLLSGMLVITGAGVGLRLMPSSLHTVGI
FT                   WPERIAPAMSLMQVSLPFGGTLGLTIMTSVFNNKFGRSSALRGLEGTGSSLNVHDTDSL
FT                   AFLDNLPAAVQDSIRMAAKNAIMWAFISIIPIVGLSLLTTTFMGNVWVNVRGKNDGEHV
FT                   GEDDGEGRSEVIHVPYLWALAKGTINTHKRISKPISSNTQPPSPLRQPTLQHSTA"
FT   mRNA            complement(join(<8900..9001,9061..9680,9748..9804,
FT                   9908..10304,10351..10386,10435..10447,10500..10839,
FT                   10899..>11229))
FT                   /locus_tag="An01g04100"
FT   exon            complement(8900..9001)
FT                   /locus_tag="An01g04100"
FT                   /number=1
FT   intron          complement(9002..9060)
FT                   /locus_tag="An01g04100"
FT                   /number=1
FT   exon            complement(9061..9680)
FT                   /locus_tag="An01g04100"
FT                   /number=2
FT   intron          complement(9681..9747)
FT                   /locus_tag="An01g04100"
FT                   /number=2
FT   exon            complement(9748..9804)
FT                   /locus_tag="An01g04100"
FT                   /number=3
FT   intron          complement(9805..9907)
FT                   /locus_tag="An01g04100"
FT                   /number=3
FT   exon            complement(9908..10304)
FT                   /locus_tag="An01g04100"
FT                   /number=4
FT   intron          complement(10305..10350)
FT                   /locus_tag="An01g04100"
FT                   /number=4
FT   exon            complement(10351..10386)
FT                   /locus_tag="An01g04100"
FT                   /number=5
FT   intron          complement(10387..10434)
FT                   /locus_tag="An01g04100"
FT                   /number=5
FT   exon            complement(10435..10447)
FT                   /locus_tag="An01g04100"
FT                   /number=6
FT   intron          complement(10448..10499)
FT                   /locus_tag="An01g04100"
FT                   /number=6
FT   exon            complement(10500..10839)
FT                   /locus_tag="An01g04100"
FT                   /number=7
FT   intron          complement(10840..10898)
FT                   /locus_tag="An01g04100"
FT                   /number=7
FT   exon            complement(10899..11229)
FT                   /locus_tag="An01g04100"
FT                   /number=8
FT   exon            complement(11945..>12991)
FT                   /locus_tag="An01g04110"
FT                   /number=1
FT   CDS_pept        complement(11945..>12991)
FT                   /locus_tag="An01g04110"
FT                   /note="Function: SutB of P. chrysogenum is the major
FT                   sulfate permease involved in sulfate uptake by P.
FT                   chrysogenum."
FT                   /note="Function: in industrial fermentations, P.
FT                   chrysogenum uses sulfate as the source of sulfur for the
FT                   biosynthesis of penicillin."
FT                   /note="Phenotype: disruption of P. chrysogenum sutB
FT                   resulted in a loss of sulfate uptake ability."
FT                   /note="Remark: the N-terminal half of the homolog to SutB
FT                   of P. chrysogenum is located in ORF An01g04210."
FT                   /note="Remark: the ORF is N-terminally truncated due to
FT                   contig border."
FT                   /note="Title: strong similarity to sulfate permease SutB
FT                   -Penicillium chrysogenum [truncated ORF]"
FT                   /db_xref="GOA:A2Q8F0"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8F0"
FT                   /inference="profile:COGS:COG0659"
FT                   /inference="similar to AA sequence:UniProtKB:AF163974.1"
FT                   /protein_id="CAK36947.1"
FT                   /translation="DGIYCTICVSVAVLLFRVAKARGQFLGRVTIHSVVGDHLVQGDGK
FT                   YGPGGFPDAPNDDEGGSRRSIFLPLNHTDGSNPEVEVEQPYPGIFIYRFSEGFNYPNAN
FT                   HYTDYLVQAIFRQTRRTNPFSYARPGDRPWNDPGSRKGKEENRSQRPILRSIILDFSSV
FT                   NNVDVTSIQNLIDVRNQLDLYASPRTVQWHFAHINNRWTKRALAAAGFGYPTPTSDDGF
FT                   HRWKPIFSVAEIEGRASAAAHAEMINNEHAHQNAIKRDIEEGLKHETHMTEREASGIDI
FT                   EASSDNSSTPDDKLARDLKDSKAYRNRRKAAVVQGINRPFFHIDLTSALESALANSPPE
FT                   EPIEEPSA"
FT   mRNA            complement(<11945..>12991)
FT                   /locus_tag="An01g04110"
FT   mat_peptide     complement(11948..12922)
FT                   /locus_tag="An01g04110"
FT   sig_peptide     complement(12923..>12991)
FT                   /locus_tag="An01g04110"
FT                   /inference="protein motif:SignalP:2.0"
XX
SQ   Sequence 13107 BP; 3134 A; 3408 C; 3374 G; 3191 T; 0 other;
     ccccctgctg cttgtgcccc tgcctgtcat gttcgcctct tatgtcatgg tgcatgtgct        60
     gcatatgtga tgatcattac cgcaatcaca gtaaaatagc tacgtagcta gctgccaagt       120
     aagaaggtgg atagttgcca catgatatga caggaagcgg ggaagtaagt actacgtact       180
     aggaagggac ttgacagggt aagagatggt catttgcaca gatacataat tcctacctac       240
     ttgcatgcag gtcatgcggt atgctttctt tgtaagtagc tagaagtagc taaggatgga       300
     caaagtacgt gcatatgctg atggaggtct gagtcctagg tactctatcc gcgtccgtga       360
     gtgtgcatta gcagagcatc cacccatcca tccctaattg cttcgcggca ttagtggttg       420
     aactaaacaa ttagttaagt cgttatgtac agtcactaag tatgggtaca tggtacaggt       480
     gacctccggg gatcaatggt tcgccactag aattctcttg actaaatcac cagccatttg       540
     gccgtgacct tctgggctga ttgataatcg ccgttcaggg catagataat ctgcagcgcc       600
     accgccgctt cgcgcgaaaa gtcctctacg aaaggggctt gcgcttctag ccctgtatcg       660
     cccatgacga catcgctgcc atctttcggg tgcgggatcg tttgttggga ttgcgcttgg       720
     atctgtgcgc cgagatctag cacgagctgg tagccttcta ttgctagatg ggctatccct       780
     aagctatgcc agacgcgagc aaagttgaat tccatttctt gccgttccga taggagactt       840
     cctggtcgtt cacggacgcg tcgatactcc tgcatgaacg acagcccctg catgatgagg       900
     tagtgtcggt tttcggactg gcgcttgagt gagtgatgga tgtagcagag ggcgatggag       960
     agcaggacgg ctgggttctg atcgtccagt gcataggcgc ggaataagta attcagggct      1020
     gggtagaaac tgtttcccga gtaaaggatg tggccgtata gcacaagcag ggcaacgtcc      1080
     atttcatctg ccgggatggc ttcaccagtc gtctcgtccc gcgtagacaa ggatgcgcgt      1140
     tccttgtaag ctgactcgcg cacgaaccga tttggtcgtt ctcctgtaac ctcgtccggt      1200
     acagtaaagt ccatggcctt gatctggcgc agcatgaact tcatgtttgg tgacgagtgg      1260
     aacaaagacc ggtgaggatc accgacgagc cggctcaaca tggcaaacaa gcgataagta      1320
     tcagttacga attgatattc cttgataaac catcgtgctt catttgcaag cgtctcttca      1380
     tcctgcatcc gaagcgcaca agctgggaag gtcagtatct catgcagaat acgatacggc      1440
     aaaggagact cactgaacca gcaaacatga atcatgcggg tgtcggcttt ggagtgatac      1500
     cagacgctgg catccgcagc ggctgcgagc gtgtcgtacg cttcgtcgga ttctccttgc      1560
     gtcgctacag tgagggcata ctgcaagaaa aggtcgagcc attcattgaa gctgatccca      1620
     tagtagtcag ttggtatagc cccttgaagt ggctcgtcag gaatactccc tggataacag      1680
     tcagctatgc tccaatgaca caaaagggta tgaatcacct aaagactcct ggagacgccc      1740
     agccatttct tgcatctcat cgatgaagtt gcggcccttg tgtctccccg cctttctctg      1800
     tgcttcgcgc gaatatccca agaaggttat gttgcgttga atgggataga atactcgatt      1860
     tgaccgaaat tcacgcagca aagcgtctgc tatatccagc cagtcctccg tggcttctgc      1920
     gttgccttct ttcgcttgcg gaagcagctg cattaacttg tcatagagat attgcacatt      1980
     tgctatcctt tgttcttcat ttatctccgt atcctttgca gctgaggtag tagtagtagt      2040
     cagagcagcc ggcaggtcag cgcttggggg ctgaggcgcg attgacctca aggcagcgtc      2100
     ttcacgagcc gcatcagctg ccttgaactc caccgccagc tgttccagcc ttgtgtcctt      2160
     gcgccggcgg ttactacggc tctcctgcct tcctagcaga accgcttcat tgacgtattt      2220
     cagagcctct tccgacatgc caatgccctc ataaagcttt gccagctgca cgcgggattc      2280
     cacgtgccgt gcatcgtgct ccgcaaccgt aagaaagcag ttctcggcgt cttcgagctt      2340
     gcccaataca ctgcaacatt ctcccattgc catgaagaag ccgacatctg cgtactcgtt      2400
     tgtttgttgg aggggcatgt agaaccgcag tgcctcttcg aaaagcccaa cgtctttgag      2460
     cgcatcagcg gcctctcgga aaaggtcgcc ataatcgtac aaccgagcat gttcggacgt      2520
     atcctccggg ttcaaccact cgaggtgatg ctgtagtttc tgtgtcagag aataggccgg      2580
     ctactattcg tatactaaag cacttaccag agcttcgttc ttgtgctcat aacccatcct      2640
     caaccgaaag agtgccagct tgatccgcaa ctccaggggt agaccgagac cgtacgaatc      2700
     tcgaggccac cttcgaggtt cgtatccatc agccttgatg cgtcgaggag aatcatccgc      2760
     atcccattcc cggtcgtctt catgaaaatc ctcccacatc gtatcatcct tccggcctag      2820
     aagccatctc gagacagact tgagggcctt gaggccctca aacggccggc ccagatagct      2880
     gtacagttcg gcgtagatgt tgacatcgga ccaagaaaat tcgggagcat cttccggttc      2940
     tagagacgtg aagtatttca cgctcacccg ccactgatcc acggctttct ggacatcgtt      3000
     gaggtcgatg taggtttctg ccaggtgtcg aagcgcccta gcgttgtgtg ggacttcttt      3060
     caagatgcgc tcatactctg tcgctgctcg tccattgtag cccaattctc tgtagatcgc      3120
     tgctcgctgg aatcgggcat tgtaattctt cggatctagc tcaatgatac ggctatagca      3180
     gtagataacg tcattcagtg caccttgacg ttcctccccg gcgcgttcga ggatcatcct      3240
     tgctacttta gcccatactg taggatcttt gggccgcgtg tgagcgccgc tgaacaacgc      3300
     ggtcaatgct ttgtctttct cgccttgggc caagaagatt tcggacaaga gcgaatgcgc      3360
     cgcgaacatc tcggggttaa cctgaatggc acgctttgtt agatcaatgg cacggtcata      3420
     gtcaccatcg atgaaggcag aggttgcctc cgaatgcaag atcttgaact cggggctcgg      3480
     ttctagtggt ttgcgcggtc ctctcctgat gccctttcca ccgcgcgcac cgtaccgacc      3540
     agagaagggg cctgtgcccc tgcgacgtct ccgaccgtag gcttcgtcgt cttcatcagc      3600
     ctggttagag aactcttcct cactgtgtgc ggtcagcaac agacagaaga ctcaagaaca      3660
     ctcgcatgac gtcgtgatac tagccttgaa ctctcctctg aagacaatgt atagagggac      3720
     tcgtccgagt cgtccgcatc atgatacgcc tctgcatcct catccaagga agcctcatct      3780
     tgagcctgtg aggcgttacc tgtaaaaagg tccttataca ggcgcggatc cagaacggag      3840
     tgaatggagg cctctccttg cgtggttggc tgatttccct gccatgggta atgtatcgtc      3900
     tcatcaatat cgggatagac gtactcctgc gagggaggtt ggtgatgtgg gtgatggtcg      3960
     tccgggtaat ccattttggg atacaagtat tcaggtgact ttactaatac ggactttgtg      4020
     tagcaagact ttgcccggcc actggcccct agaatgcaaa gactggctgg aaactaaaca      4080
     cagacctccc ttgaggagca gatcaccaag taagcagaca gactatccga ggtgtcgtct      4140
     cagtcgtctc aaggatatcg gggagcgttg tgcaagacta tgcgacaaag aagcgatcat      4200
     cattgggttg tagtggagcc acagcaaaca gacaagcaat tggggcttgt atccgaaaac      4260
     acggttggat ggcgttgcaa tagcgtctag agaaggtagt ttagaatcat tcgagaaccg      4320
     tagggaggcg cacaagacaa agggtaaggc ggagcgataa aggaaggccg gatcacggac      4380
     ctggagggag ggtttattca tagcaacatg taagcgccgc caatcccaga ctaaacttgc      4440
     cgatgcagaa aaccggccag accggccgac tgggacgcgt cggaggcagt gggatataga      4500
     agtcagatag gtcagatgaa aggagaagat atagtcagat cttgatcgat gggattgtcg      4560
     atatagtcaa tgttacaaaa gatatagaat gtagatgaat gatgttctag agtatctgag      4620
     ctgaagaaga agaagcaagt aaagaagaag aggttcggcg gagaacaaat taagccaaac      4680
     ataacccaaa ccagccaatc cggtgacttt ttcttacgcc cgccacggca aagtgtcgtt      4740
     ttttcgtttc gcttcttgtt tctttcgttc ttgacttgtt ctgttgcttc tctccatcgt      4800
     cttttccgcc tttcttcgtc tccctctgtc tcggtctctc tccctcttcc ttctcttccc      4860
     cccatctact tactctctct ctctctctct tcccccccat cttccctcac ctccctcgcc      4920
     atcaagtttc tgcttcttcg cttccccccc cttttttttt cttttcactt tcctttttat      4980
     ttgatgctct aggtatcttg cttgctgtgt ttgacacact attgcagata accctgacat      5040
     cctttcgtta aaaaagaaga aaaaaaagaa aaagaaaagt caaaaaaagc gcaacccaca      5100
     cttcccctac actaattcca cccgggaagt cgccgcgttt ctctcgccat ccaccgagga      5160
     ttttcttccg gccatctgtc ttttctcgtt ctctctccaa tcgattgatc aaaacacctc      5220
     ctttgatgct cttgcgattc gcttgattcc tccatcctag aatccgaatc gggcagtgca      5280
     gccactggac tggtctgtgc cccaaacgtc attgtccaga accaacacag ttgggtttct      5340
     cacctcttcc aaccgaaaaa aaaagtgtct ccgtccttag agagatttct cgcttttgat      5400
     cctttgcctc ttgggtgatt cgctatctcc cagcctgcga ccaaaataag aaagacctcc      5460
     tgttccgacc aaccctcacg acacgcaaac tcagcaggtg ctgcaggtgt tttgcagtaa      5520
     ttcttctctt tttgtattta ttttccatcc gggcctcgca taaagggaga ccgacttaaa      5580
     aagaggaaag acattcgaga aaagaaagtc ccattccgag actttccttt gaccctcctt      5640
     gttccagaat actaccctca ttcaatctct acttatggcc agccatatca tcggcaaccg      5700
     caacagcacg cctgaagcct ccaagtccag tcttcgtcct ccatcgtcgt ctcgtaatct      5760
     aggatcgcac cagcttcgtg catcggccga tatgtcgggc ttcccatctc ctctgtcatc      5820
     ccgcagcatc cgtccttcct cggaagtcta cttcaatcag cagtcgcagg cgtcgaacaa      5880
     cgcggaggat ccgttggacc gtgcggctca gcagtggctc gcggatattg atcagtacga      5940
     gactacattg gaagaaatgg ccgctgccac gctggaccag gatttcaagg atgagcttag      6000
     cgccatcgag cagtggttcc gggttcttag cgaggcggag aggactgctg ccctttacgc      6060
     tctgttgcag cagaccactc aggtgcagat tcgtttcttc attcaggtct tgcagcagat      6120
     ggccaagagc catcccatgt cgggactgtt gtctccggcc aactttggcg agaagggtga      6180
     gttgcatatc aatccagaca agcgtgacag gtattaacaa tgttcttttg gcagatgcca      6240
     tgtctaaccg cctgaatgat gccatgtcca agttgaacgt ggacagctcc cggagctccc      6300
     tcggtcgccc cccgccgtcc cccggtgcca agcgcaactc cgggctcgac tcgtccacca      6360
     tcaatgccat gttccctgat gctgctgcgg caattgcaaa gaagaaggct gagttcaccc      6420
     agcaaacggg caatgctcct ccttcgaacc ggaacagcgc tgttttcgat cggacttcct      6480
     ttgtggcacc caccatttcg gccccagaca acagcaacga caccttgggc cagcctccgg      6540
     tttcgccctg ggcccagcgc ggatctgagc cgcaaccccc tatcgcccgt cccaagtctt      6600
     cgtccggtca tcagcccatg ggccaattca gccagactcc ttcgagcctg cgctctccgc      6660
     tccctaccca aaccgccacg atccctgccc ccgagattga tgctcctttg ctctcgcctt      6720
     acaatgttgg aaatgccagc tgggcctcca tgaccaacac ccccatgacg gcgacctttg      6780
     gccagcagcc gcagcagccc cagcagaatt cgcaggccga tatggtggcc aacgcgactg      6840
     cgatgaagct ggccgcactg tcgaccgtca acaaccgtat tgcacttgat gatgctcgca      6900
     agtaccgtcg ggctcgctcc aacgatggcc agggtaagaa ctcggccaac agccacgcca      6960
     tgtctcaggg tggcctggcc agcccgggcc tcccgggcca cagtcacctt gttgccggac      7020
     agctgttgaa cactcagcag ctggcggctt tgcaggcaca gcaacaggct gcgatggcgg      7080
     gtcgtcgctc ccgcccgacg tcgcctggaa tcgccatgca gggtgctggc ggacttggtc      7140
     cgatgggctt cacttcgccg cagaacaacg gcttcttggc agcatatgac ccgaacaacc      7200
     cgctcatggg taacggcctg ggtgcacttg gtatcgggca gtttggcctg ggaggtcctg      7260
     agggctacct ctcagaccac tcggaagtgg ctcgcggccg gtccccgcgt ggtcgtcgcg      7320
     gtagctcgaa gccgccggag gaccccacgg accctaacct cttgaaggac attcccagct      7380
     ggctgagatc gctgcggctg cacaagtaca cggaaaacct gaaggacttg aaatggacgg      7440
     agctggtcga attgaacgac aaggcgctgg aagaccgcgg cgtcaatgct cttggtgcca      7500
     gaaacaaaat gctcaaggtg agttacataa actctcccag gagtgttgag acatcatgct      7560
     aatctttgta ggtttttgaa caagtcagag aagccaaagc cgagggcaag ctcgacaaca      7620
     ttgcgtgatg aagtgcagcc attcattcat tcgacttgac ttaacgtttc tgcttacatt      7680
     ctctctattg cattaattga ctagattggc tttgggcata agtggcagga tccgaaatga      7740
     acctatgagc gatctcatcg gaaatgaatc ttgggaggaa gttgtctagt aatgggattc      7800
     gaacgccatt ggggcagttg aatgagtgac cgacttgagt gacttattga cttattgttt      7860
     gtatggatgt attcacatgt tcatgtagac gtgcgtgggg ctgtgtctca gcatgtcgtg      7920
     ttatgacggc taggatgtta atggtataat catcatggct ttggtaaata taattgtttg      7980
     cagattaaac agacctacag agtagaccta cttctagttc cttttcttcg tagtctacca      8040
     cagtaataat aataatgagt agaaagtagt aacccaccaa aggcggaacc aaccggcaat      8100
     atactccaac tccgacatca tgctacctac ctacctagct atctaccaac ttatcaccac      8160
     aaccaacacc atcatccatc cacccacagt ccaccatcca aaaccacaca atcaaaaaca      8220
     atcaaaatgc cacccacaaa acaagaactc tctctcctca tcaaccccct cgtcccggaa      8280
     tctctccaac acaacaacag ggtgcgttaa accctccccc aaaccaacca acctcctacg      8340
     aaccctctca ctaacaatac cacctatttt aatcccacag acattatctt cattacactc      8400
     cctaacctcc ttcctcctcg gcctcacagc cggaatcctc tccctgcaat ccgccaccgg      8460
     attcctcttc tacctcctcg gcacggtctt cgtgtccgcg ctgttccacg ccctgctact      8520
     ctatcgctcc gggggattag gcgcggggat gtattttgcg ggtgcgaatg gagaagttga      8580
     ggggatggat gagaggggtg tggtcagtgg taagggtact aagggaggtg gtatgttgag      8640
     acgcgcggcc tggagggatg tttggtttgg gggtggtgtg ctgagtgagg cgctgagtgg      8700
     gtttatcttg gggtgggcgg gtgttggggg ggttttgagg tgatttttcc tttcccttgg      8760
     gaggatgcag ggggaaatga taaaaagggt ggggaggggg gaggtgtggt aatggggagg      8820
     gaggagacct aggtgtattt attattgatg tgtgtatgta tgtataattc tatgggttta      8880
     tgctatctat ctatggtgtc tatgctgtgc tgtgttgtag ggtgggttga cggagtggtg      8940
     atggtggctg tgtgttgctt gagatgggct tgctgatgcg cttgtgggtg tttatggtgc      9000
     cctgtggtgt gtgtttgatt agcattctct ctggtaagga tgtaggaaga ggcgatatac      9060
     cttggcaaga gcccataaat aaggaacgtg aatgacttcg ctccgtccct cgccatcgtc      9120
     ttccccgacg tgctctccgt cgttctttcc tcgaacgttt acccagacgt tgcccatgaa      9180
     tgtagtcgtt aagagactca gtcctactat ggggatgatc gagatgaatg cccacatgat      9240
     ggcattctta gcagccatgc ggatgctgtc ttgcactgct gcgggcagat tgtcgagaaa      9300
     tgctaacgag tcggtatcat ggacgttcag cgagctgccc gtcccctcta ggccccttaa      9360
     ggcagaggag cggccgaact tgttattgaa gacactggtc atgatggtca agccgagcgt      9420
     gcccccaaag ggaagcgaga cctgcatcaa agacatcgct ggtgctatcc gctccggcca      9480
     gatgcccact gtgtggagcg aggatggcat caggcgcagt ccgactccag cgccggtgat      9540
     gaccagcatt ccgcttagca ggctggtctc ttgtgcgctg atggcgtaag ccactactga      9600
     gagaccgacg gtgctaagca ctgctcccat gaggagggga aaaaaggttt ggcgagggaa      9660
     gccgttgcaa aagtatattg ctaggtagac accagctata cgcatgacgg ttagtcagtt      9720
     gcaggtctcg attggcaagc gtcttacctc ctagtccggg gatgtagtat aagagttcta      9780
     ggcctgcctt tgaggtagag taacctgcaa ccaagatgta gtaaatgctg ataaagtaga      9840
     agatggagta tgaggctaag acagtgagcg gttgtgcgtg tagcatggat ggctaagttt      9900
     cacataccta cgccagtgga aaagttcact atggcaagcc agattgtgtc tgttcgttcg      9960
     aaaaggccgt atggaagcat cgccacgtgc ttcgggaaga tgcgtgcgaa caatctacct     10020
     ggttcaagga ggtactcgta cacaaagaat gcgatgaagc agattgcacc gatgatcaat     10080
     ggtgccagca cctgaggaga cgaccaggag taagtggcgc caccccatgt agtgcctagg     10140
     atgatgaggc caacaccaaa tatgaaaagg atcgatcctc caagatctat ggtagcaagt     10200
     gctgggagta tcgaggacca tcttgagccc ttcttgaaca tggttccttc gacaaggtca     10260
     ttccgcagca gcacaaagat catgatgtgg ctgaggacag caatctaatc tgatcagcct     10320
     ttgcatagag taaagcaccg tcaaacttac aggaataggc acaacgaagc aatatcgcca     10380
     attgctctat catctcgtta gtaacagtat agagcgtgca accaggctac ccacatcagt     10440
     aagataccta caatgcaatc attagcagtg tacatagcat tctcagatag gccacttacc     10500
     ctccgataac cgggcccaca gcatatccca ctcctccaaa gatggtgaat atagacttat     10560
     tccttgcatt ctccttcaag gacaccttgt cggcaagaat aatcataatg atattgttca     10620
     gacccgcaga gccgacaccc tgcaaagccc tacccagcag cagcataccc catgtctgcg     10680
     cagctgcaca caggacactc ccaataagca tgaaaaacaa cgccgtctgc agtacaatat     10740
     gacgcccaaa gacatcggca agctgaccga atatgggaat gaaggtggtt gatgtgagac     10800
     taaaggcggt tatgatccaa ttcagctcat cgaactggtc tagaaacagc gtacatggtc     10860
     aggaaagaac aatcaggcgc aagagtcttc tgtcttacta aagtgagatg cgatagtcga     10920
     ggtcgcagta gcaacgatag ttaagtccag tgtggagaga gtaaacggca gcgtaagacc     10980
     agcaatgagc ttaacgcgat acactcgcgc attgtgcttt tgctccttac acagcctgca     11040
     tttatcagta cctgtagcag gactcaatcc ttttgtggag ccagacatag gcctttccaa     11100
     ggactcggag tcttcgcggt tcgtcgactc tagttggtac cattgcgagc gatgtgcaca     11160
     aagtggcttt ggtgcgggag acttggagtc tttcgtcttc tgcgatatgt acttgtaagc     11220
     tttaatcatg tcgctagtcc catcagtctc caggtaggat taagagaaat aaagtattct     11280
     ggtggggagg aatggttgca caagctgctg atagaattca atgtactaca ggatgccatt     11340
     gtgtagttat atatggaggc tacaacttca gtttggcctt atatcatgcc aagtcaaatg     11400
     caactgaggc tgtgtagtct agacatatct ccttcgagac atcaatgcga ggcacgaagg     11460
     atatcaacat gatcgatgtc aagtgcatcc catcactgca gtcaagtttt gggccgtttc     11520
     gagcaagtaa tgcgcgcccg tctgattggc cgggaatggt gcctatccgc aagccctacc     11580
     gaatgcggta aggactgcga ggagcctgtc aggctggctg tgactctgcc aactcagcct     11640
     ctaacaacta taatttaact actatgaatc ttgagctcaa aggatgattt ctaggcatct     11700
     aatctatata ggacgtagtt cggataacat gaacgcatta aacaatatat gtacgtcttc     11760
     aacgagtcta tctatataca catagcgaga catcaggggt atagcttcaa tcgacagtaa     11820
     ataaaatcgt aaatccgact cgctccaaag caaaaccccg ggtaaggaaa accatgaaaa     11880
     gtaaatcatc tcgaaactcc agccagggag gatcgttcat cttctatacc gatcgtggat     11940
     caactcatgc gcttggctcc tcaataggct cttccggagg cgaattggcc aaggcactct     12000
     cgagcgcact tgtcaagtca atgtggaaga atggccggtt gatgccctgc accaccgccg     12060
     ccttgcgccg attgcggtat gccttgctgt ccttgagatc gcgcgccaac ttgtcgtccg     12120
     gcgtgctgct gttgtcggac gacgcttcga tatcgattcc ggaggcctcg cgctcggtca     12180
     tgtgagtttc gtgcttgagt ccctcctcga tgtcacgctt gatggcgttc tgatgggcat     12240
     gctcattgtt gatcatctcc gcatgagccg cagcagatgc tcgtccttcg atctcagcca     12300
     cactgaagat tggcttccac cggtggaacc catcatcaga ggtaggtgtc gggtagccga     12360
     aacctgcggc cgccagtgct cgtttcgtcc agcggttgtt gatatgagcg aagtgccact     12420
     gaacagtgcg aggagaagca tagagatcga gctggttgcg aacatcgatc aggttttgga     12480
     tagaagtcac atcaacattg ttaaccgatg agaaatcgag gatgatggag cggaggatgg     12540
     gccgttgcga gcggttctct tccttgccct tccgagagcc ggggtcgttc catggcctat     12600
     caccgggacg agcgtaagag aacgggttgg tgcgacgcgt ctggcggaag attgcctgaa     12660
     ccaagtagtc ggtgtagtgg ttggcgttgg ggtagttgaa gccctccgag aaacggtaaa     12720
     tgaagatacc agggtatggc tgttccacct caacctcggg gttcgagcca tcggtatggt     12780
     taagagggag gaagatagac cgacgggacc cgccctcatc atcgttgggg gcatcaggga     12840
     aaccacccgg tccatacttg ccatcacctt gcaccagatg atcgccaaca acggagtgaa     12900
     tggtgactcg gcccaggaac tgaccgcggg ccttggcaac acggaaaagc aggacagcca     12960
     cggacacaca gatagtgcag tagataccat cctcgatcga ggtgaaaaca gttacgataa     13020
     caccaatgaa gaagatgatt gcatcaaggg gcgagacgcg ccagaattat acacagtgaa     13080
     gggcgaattc gtttaaacct gcaggac                                         13107
//

If you have problems or comments...

PBIL Back to PBIL home page