(data stored in SCRATCH zone)

EMBL: AM269962

ID   AM269962; SV 1; linear; genomic DNA; STD; FUN; 54374 BP.
XX
AC   AM269962;
XX
DT   28-JAN-2007 (Rel. 90, Created)
DT   14-MAR-2015 (Rel. 124, Last updated, Version 5)
XX
DE   Aspergillus niger contig An01c0150, genomic contig
XX
KW   .
XX
OS   Aspergillus niger
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
XX
RN   [1]
RP   1-54374
RA   Pel H.J.;
RT   ;
RL   Submitted (01-MAY-2006) to the INSDC.
RL   Pel H.J., DSM, 624-0295, P.O. Box 1, 2600 MA Delft, THE NETHERLANDS.
XX
RN   [2]
RX   DOI; 10.1038/nbt1282.
RX   PUBMED; 17259976.
RA   Pel H.J., de Winde J.H., Archer D.B., Dyer P.S., Hofmann G., Schaap P.J.,
RA   Turner G., de Vries R.P., Albang R., Albermann K., Andersen M.R.,
RA   Bendtsen J.D., Benen J.A., van den Berg M., Breestraat S., Caddick M.X.,
RA   Contreras R., Cornell M., Coutinho P.M., Danchin E.G., Debets A.J.,
RA   Dekker P., van Dijck P.W., van Dijk A., Dijkhuizen L., Driessen A.J.,
RA   d'Enfert C., Geysens S., Goosen C., Groot G.S., de Groot P.W.,
RA   Guillemette T., Henrissat B., Herweijer M., van den Hombergh J.P.,
RA   van den Hondel C.A., van der Heijden R.T., van der Kaaij R.M., Klis F.M.,
RA   Kools H.J., Kubicek C.P., van Kuyk P.A., Lauber J., Lu X.,
RA   van der Maarel M.J., Meulenberg R., Menke H., Mortimer M.A., Nielsen J.,
RA   Oliver S.G., Olsthoorn M., Pal K., van Peij N.N., Ram A.F., Rinas U.,
RA   Roubos J.A., Sagt C.M., Schmoll M., Sun J., Ussery D., Varga J.,
RA   Vervecken W., van de Vondervoort P.J., Wedler H., Wosten H.A., Zeng A.P.,
RA   van Ooyen A.J., Visser J., Stam H.;
RT   "Genome sequencing and analysis of the versatile cell factory Aspergillus
RT   niger CBS 513.88";
RL   Nat. Biotechnol. 25(2):221-231(2007).
XX
DR   MD5; a95443f0e550abbc916923639aa194e9.
DR   ENA-CON; AM270980.
DR   BioSample; SAMEA3283178.
DR   EnsemblGenomes-Tr; CADANGAT00000414.
DR   EnsemblGenomes-Tr; CADANGAT00000415.
DR   EnsemblGenomes-Tr; CADANGAT00000416.
DR   EnsemblGenomes-Tr; CADANGAT00000417.
DR   EnsemblGenomes-Tr; CADANGAT00000418.
DR   EnsemblGenomes-Tr; CADANGAT00000419.
DR   EnsemblGenomes-Tr; CADANGAT00000420.
DR   EnsemblGenomes-Tr; CADANGAT00000421.
DR   EnsemblGenomes-Tr; CADANGAT00000422.
DR   EnsemblGenomes-Tr; CADANGAT00000423.
DR   EnsemblGenomes-Tr; CADANGAT00000424.
DR   EnsemblGenomes-Tr; CADANGAT00000425.
DR   EnsemblGenomes-Tr; CADANGAT00000426.
DR   EnsemblGenomes-Tr; CADANGAT00000427.
DR   EnsemblGenomes-Tr; CADANGAT00000428.
DR   EnsemblGenomes-Tr; CADANGAT00000429.
DR   EnsemblGenomes-Tr; CADANGAT00000430.
DR   EnsemblGenomes-Tr; CADANGAT00000431.
DR   EnsemblGenomes-Tr; CADANGAT00000432.
DR   EnsemblGenomes-Tr; CADANGAT00000433.
DR   EnsemblGenomes-Tr; CADANGAT00000434.
DR   EnsemblGenomes-Tr; CADANGAT00000435.
DR   EnsemblGenomes-Tr; CADANGAT00000436.
DR   RFAM; RF00005; tRNA.
DR   StrainInfo; 791018; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..54374
FT                   /organism="Aspergillus niger"
FT                   /strain="CBS 513.88"
FT                   /mol_type="genomic DNA"
FT                   /clone="An01c0150"
FT                   /db_xref="taxon:5061"
FT   CDS_pept        complement(join(<1..437,505..1048,1112..1257,1328..1628))
FT                   /locus_tag="An01g04210"
FT                   /note="Function: SutB of P. chrysogenum is the major
FT                   sulfate permease involved in sulfate uptake by P.
FT                   chrysogenum."
FT                   /note="Function: in industrial fermentations, P.
FT                   chrysogenum uses sulfate as the source of sulfur for the
FT                   biosynthesis of penicillin."
FT                   /note="Phenotype: disruption of P. chrysogenum sutB
FT                   resulted in a loss of sulfate uptake ability."
FT                   /note="Remark: the C-terminal half of the homolog to SutB
FT                   of P. chrysogenum is located on An01g04200."
FT                   /note="Remark: the ORF is C-terminally truncated due to
FT                   contig border."
FT                   /note="Title: strong similarity to sulfate permease SutB
FT                   -Penicillium chrysogenum [truncated ORF]"
FT                   /db_xref="GOA:A2Q8G0"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR018045"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8G0"
FT                   /inference="profile:COGS:COG0659"
FT                   /inference="profile:PFAM:PF00916"
FT                   /inference="similar to AA sequence:UniProtKB:AF163974.1"
FT                   /protein_id="CAK36957.1"
FT                   /translation="MSQDLMTKTGHGLAKVLGIKLPYRDPLGAHSDPVTRGESTFSYGT
FT                   VDTYSYLEPEPTTAEWLKEICPTWHDVLMYFYRLFPFLSWITKYNLQWFFGDLVAGVTV
FT                   GAVVVPQGMAYAKLAELPVQYGLYSSFMGVLVYWFFATSKDITIGPVAVMSTLVGTIVL
FT                   QAQKEIPDVPGHIVASCLAIICGAIVCALGLLRLGFIVDFIPLPAISAFMTGSALNIAA
FT                   GQVKKLLGESADFSTRGSTYMIIINSLKYLPTAGIDAALGVTALAMLYIIRSGCNYGAR
FT                   KYPRHAKVWFFASTLRTVFVILFYTMISAAVNLHRKDNPMFDLLGSVPRGFQNAAVPVV
FT                   NARIIKVFASQLPACVIVLLIEHIAISKSFGRVNNYTIEPSQELVGIGVTNLLGPFLGA
FT                   YPATGSFSRTAIKSKAGVRTPLAGCITAIVVLLAIYALTAVFFYIPQAALSGVIIHAVG
FT                   DLITPPNTVYQLLARTRP"
FT   mRNA            complement(join(<1..437,505..1048,1112..1257,1328..>1628))
FT                   /locus_tag="An01g04210"
FT   exon            complement(<1..437)
FT                   /locus_tag="An01g04210"
FT                   /number=1
FT   intron          complement(438..504)
FT                   /locus_tag="An01g04210"
FT                   /number=1
FT   exon            complement(505..1048)
FT                   /locus_tag="An01g04210"
FT                   /number=2
FT   intron          complement(1049..1111)
FT                   /locus_tag="An01g04210"
FT                   /number=2
FT   exon            complement(1112..1257)
FT                   /locus_tag="An01g04210"
FT                   /number=3
FT   intron          complement(1258..1327)
FT                   /locus_tag="An01g04210"
FT                   /number=3
FT   exon            complement(1328..1628)
FT                   /locus_tag="An01g04210"
FT                   /number=4
FT   CDS_pept        join(3569..3648,3689..3955,4172..4308,4394..4626)
FT                   /locus_tag="An01g04220"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8G1"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8G1"
FT                   /protein_id="CAK36958.1"
FT                   /translation="MSGSHKPTPTPAKQAAVVQANGTVLTTWNLNGRTRPRLPFTFSNE
FT                   TLPTWLGSIVVLELLGTKLPFPSDKHGSPTRQLTCCLLIYNPIVCLARLTQPQMERDIL
FT                   SLTGHVDGGFRPCELRRFPRIAPSILSLRDAAVEGNHWKINLMWFDACRRSIDIERFAG
FT                   SSSAIVALSLGCAEIPLQLVYYTPAAAASPCYGQFHRTMSPTIHIPTFVCRYLHFLADL
FT                   SAQGQIRQNAAANPTS"
FT   mRNA            join(<3569..3648,3689..3955,4172..4308,4394..>4626)
FT                   /locus_tag="An01g04220"
FT   exon            3569..3648
FT                   /locus_tag="An01g04220"
FT                   /number=1
FT   intron          3649..3688
FT                   /locus_tag="An01g04220"
FT                   /number=1
FT   exon            3689..3955
FT                   /locus_tag="An01g04220"
FT                   /number=2
FT   intron          3956..4171
FT                   /locus_tag="An01g04220"
FT                   /number=2
FT   exon            4172..4308
FT                   /locus_tag="An01g04220"
FT                   /number=3
FT   intron          4309..4393
FT                   /locus_tag="An01g04220"
FT                   /number=3
FT   exon            4394..4626
FT                   /locus_tag="An01g04220"
FT                   /number=4
FT   CDS_pept        complement(join(5951..6341,6403..7071,7133..7518))
FT                   /locus_tag="An01g04230"
FT                   /note="Title: strong similarity to hypothetical WD-repeat
FT                   transcription regulation protein SPCC18.13
FT                   -Schizosaccharomyces pombe"
FT                   /db_xref="GOA:A2Q8G2"
FT                   /db_xref="InterPro:IPR028884"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8G2"
FT                   /inference="similar to AA sequence:PIR:T41156"
FT                   /protein_id="CAK36959.1"
FT                   /translation="MSAHFQHPLQCLRLVQRSTANLLIGSAGSKLYSYSAETGQRLAVW
FT                   PEDVASSETKPVDAESAPEQGPPEKKRKVSSSDSPTIEKPAWSNIPIVTGTASGEHIIA
FT                   LTAEDKCVRVFQLQEDGSFVQLSQRVMPKRPSAITLTDDDDTILCGDKFGDVYSLPLIP
FT                   SDKLPAITKSLRSAKLSHPAATNLTVHTKGNRRALEQQLRLASEGKRDEKSSGPTFEHK
FT                   ILLGHVSLLTDMAYVSLPVDENKKRSYILTADRDEHIRVSRGPPQAHVIENYCLGHTAF
FT                   ISKLCVPQWAPQYLVSGGGDNYLLVWKWAEGRILQKVSLVDEASESTEVAVQGIWATSL
FT                   GNLRIILVALHGSSRLQCFTLESDGSLKTQASIQLSGNVLDLTPVEKDNTILVSVDSIR
FT                   QPDSTQEWRTSPSSPSTLIEAFHIKSGTDSLEWEPTAASVTDKINSTGTEEVPATTEEK
FT                   QRKELNDSLYGLGHLRKRKGEDE"
FT   mRNA            complement(join(<5951..6341,6403..7071,7133..>7518))
FT                   /locus_tag="An01g04230"
FT   exon            complement(5951..6341)
FT                   /locus_tag="An01g04230"
FT                   /number=1
FT   intron          complement(6342..6402)
FT                   /locus_tag="An01g04230"
FT                   /number=1
FT   exon            complement(6403..7071)
FT                   /locus_tag="An01g04230"
FT                   /number=2
FT   intron          complement(7072..7132)
FT                   /locus_tag="An01g04230"
FT                   /number=2
FT   exon            complement(7133..7518)
FT                   /locus_tag="An01g04230"
FT                   /number=3
FT   CDS_pept        join(7854..8027,8085..8154,8219..8913)
FT                   /locus_tag="An01g04240"
FT                   /note="Remark: P0 of S. cerevisiae belongs to the family of
FT                   rat acidic ribosomal proteins P0."
FT                   /note="Remark: P0 of S. cerevisiae is also called A0,L8300.
FT                   8, YLR340w and ribosomal protein YL10e."
FT                   /note="Similarity: the ORF overlaps with the EST seq id
FT                   NO:3822 of patent WO200056762-A2 from A. niger."
FT                   /note="Title: strong similarity to cytoplasmic acidic
FT                   ribosomal protein P0 - Saccharomyces cerevisiae"
FT                   /note="cytoplasm"
FT                   /note="See PMID 2681177"
FT                   /note="See PMID 3287327"
FT                   /db_xref="GOA:A2Q8G3"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR030670"
FT                   /db_xref="InterPro:IPR040637"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8G3"
FT                   /inference="profile:COGS:COG0244"
FT                   /inference="profile:PFAM:PF00428"
FT                   /inference="profile:PFAM:PF00466"
FT                   /inference="similar to AA sequence:PIR:R5BY0E"
FT                   /protein_id="CAK36960.1"
FT                   /translation="MGGKSATKAAYFEKLKALLDEYKTVFIVGVDNVSSQQMHEIRLSL
FT                   RGEGVVLMGKNTMVRRAIKGFVNDNPEYERLLPFVKGNVGFIFTNGDLKATKEKILANR
FT                   VAAPARAGAIAPGDVWVPAGNTGMEPGKTSFFQALGVPTKIARGTIEITTDLKLVEAGS
FT                   KVGPSEATLLNMLNISPFTYGMTIQQVYDQGQCFSSAVLDIEESQLLEAFSSAINTITT
FT                   ISLAVSYPTIPAVMHSLVNSYKKVLAVAVETEYSWPEIEELKDRIANPDAYASAAPAAA
FT                   AAPAAGGAPAAEAPKEEEEESDEDMGFGLFD"
FT   mRNA            join(<7854..8027,8085..8154,8219..>8913)
FT                   /locus_tag="An01g04240"
FT   exon            7854..8027
FT                   /locus_tag="An01g04240"
FT                   /number=1
FT   intron          8028..8084
FT                   /locus_tag="An01g04240"
FT                   /number=1
FT   exon            8085..8154
FT                   /locus_tag="An01g04240"
FT                   /number=2
FT   intron          8155..8218
FT                   /locus_tag="An01g04240"
FT                   /number=2
FT   exon            8219..8913
FT                   /locus_tag="An01g04240"
FT                   /number=3
FT   CDS_pept        join(9732..9786,9842..9883,9982..10905,10955..11025)
FT                   /locus_tag="An01g04250"
FT                   /EC_number="4.1.1.37"
FT                   /note="Catalytic activity: Uroporphyrinogen-III <=>
FT                   coproporphyrinogen + 4 CO(2)."
FT                   /note="Function: the T. terrestris homolog catalyzes the
FT                   sequential decarboxylation of the four acetyl side chains
FT                   of uroporphyrinogen to yield coproporphyrinogen, an
FT                   intermediate in protoheme biosynthesis."
FT                   /note="Title: strong similarity to uroporphyrinogen
FT                   decarboxylase from patent WO9925839-A1 - Thielavia
FT                   terrestris"
FT                   /note="cytoplasm"
FT                   /db_xref="GOA:A2Q8G4"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8G4"
FT                   /inference="profile:COGS:COG0407"
FT                   /inference="profile:PFAM:PF01208"
FT                   /protein_id="CAK36961.1"
FT                   /translation="MQHQFEPLKNDLLLRAARGEKVQRPPIWVMRQAGRYLPEYHEAKA
FT                   GRDFFECCRDPEVASTLTIQPIDRYAGLIDAAIIFSDILVIPQAMGMQVEMVDKKGPHF
FT                   PEPLQSPDDGQYEKVMQKDVDVKSELDYVYKAITLTRHKLQGRVPLIGFCGAPWTLLCY
FT                   MVEGGGTKLFVQSKKWIYKYPKESQALLQKIAEICVEYLALQVAAGAQLVQVFDSWAGE
FT                   LSPAAFKSFSLPYLRHISANLPKKLKEMGLEPVPMTVFAKGAWFGLEDLCESGYNVVGL
FT                   DWLHDPAEARRIANGRVTIQGNADPGVLYGGREAITEAVETMVRGFEKGKQGWIANLGH
FT                   GVTPFVNPDDLKFFFEEIHRLTV"
FT   mRNA            join(<9732..9786,9842..9883,9982..10905,10955..>11025)
FT                   /locus_tag="An01g04250"
FT   exon            9732..9786
FT                   /locus_tag="An01g04250"
FT                   /number=1
FT   intron          9787..9841
FT                   /locus_tag="An01g04250"
FT                   /number=1
FT   exon            9842..9883
FT                   /locus_tag="An01g04250"
FT                   /number=2
FT   intron          9884..9981
FT                   /locus_tag="An01g04250"
FT                   /number=2
FT   exon            9982..10905
FT                   /locus_tag="An01g04250"
FT                   /number=3
FT   intron          10906..10954
FT                   /locus_tag="An01g04250"
FT                   /number=3
FT   exon            10955..11025
FT                   /locus_tag="An01g04250"
FT                   /number=4
FT   CDS_pept        complement(join(11125..11146,11224..11489,11559..11717))
FT                   /locus_tag="An01g04260"
FT                   /EC_number="3.5.4.1"
FT                   /note="Catalytic activity: cytosine + H(2)O <=> uracil +
FT                   NH(3)."
FT                   /note="Remark: strong similarity to cytosine deaminase FCA1
FT                   - Candida albicans."
FT                   /note="Title: strong similarity to cytosine deaminase FCA1
FT                   - Candida albicans"
FT                   /note="See PMID 9000374"
FT                   /db_xref="GOA:A2Q8G5"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8G5"
FT                   /inference="profile:COGS:COG0590"
FT                   /inference="profile:PFAM:PF00383"
FT                   /inference="similar to AA sequence:SWISSPROT:FCA1.CANAL"
FT                   /protein_id="CAK36962.1"
FT                   /translation="METDPGFIAAVEEAKQGAAEGGVPIGACLVSKDGKILGRGHNMRV
FT                   QKGSPVLHAEMSALENSGRLPASAYEGATMYTTLSPCDMCTGACILYKVKRVVVGENKS
FT                   FMGGEDYLKSRGKEVVVLDNAECKQLMEKFMKEKPELWNEDISV"
FT   mRNA            complement(join(<11125..11146,11224..11489,11559..>11717))
FT                   /locus_tag="An01g04260"
FT   exon            complement(11125..11146)
FT                   /locus_tag="An01g04260"
FT                   /number=1
FT   intron          complement(11147..11223)
FT                   /locus_tag="An01g04260"
FT                   /number=1
FT   exon            complement(11224..11489)
FT                   /locus_tag="An01g04260"
FT                   /number=2
FT   intron          complement(11490..11558)
FT                   /locus_tag="An01g04260"
FT                   /number=2
FT   exon            complement(11559..11717)
FT                   /locus_tag="An01g04260"
FT                   /number=3
FT   CDS_pept        complement(join(11810..11875,12304..12501,13047..13188,
FT                   13287..13467,13572..13657,13704..13741))
FT                   /locus_tag="An01g04270"
FT                   /note="Title: similarity to EST SEQ ID NO:4107 from patent
FT                   WO200056762-A2 - Aspergillus niger"
FT                   /db_xref="GOA:A2Q8G6"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8G6"
FT                   /protein_id="CAK36963.1"
FT                   /translation="MEQAKQRGLETKEGEESRRREGGQVRGGRKKEELERERVRPGPGT
FT                   NRPLICRTSAVKTRQEFQDGRIKYRRYDGAKLREYRNAGEDERPRFNWLELELYRKRLN
FT                   GVVLFASTSPVTRSLDGPSVASDCFDAIPCPSTAFAPFPSLTIALGKKKACRDSPPGDS
FT                   SRSPIAGWLRFNWLMPGVLYCSSAAAEAINGSIPEYQTEIGFCGSCHDRGSELRTSSPM
FT                   RVSPAVNHTEFAPS"
FT   mRNA            complement(join(<11810..11875,12304..12501,13047..13188,
FT                   13287..13467,13572..13657,13704..>13741))
FT                   /locus_tag="An01g04270"
FT   exon            complement(11810..11875)
FT                   /locus_tag="An01g04270"
FT                   /number=1
FT   intron          complement(11876..12303)
FT                   /locus_tag="An01g04270"
FT                   /number=1
FT   exon            complement(12304..12501)
FT                   /locus_tag="An01g04270"
FT                   /number=2
FT   intron          complement(12502..13046)
FT                   /locus_tag="An01g04270"
FT                   /number=2
FT   exon            complement(13047..13188)
FT                   /locus_tag="An01g04270"
FT                   /number=3
FT   intron          complement(13189..13286)
FT                   /locus_tag="An01g04270"
FT                   /number=3
FT   exon            complement(13287..13467)
FT                   /locus_tag="An01g04270"
FT                   /number=4
FT   intron          complement(13468..13571)
FT                   /locus_tag="An01g04270"
FT                   /number=4
FT   exon            complement(13572..13657)
FT                   /locus_tag="An01g04270"
FT                   /number=5
FT   intron          complement(13658..13703)
FT                   /locus_tag="An01g04270"
FT                   /number=5
FT   exon            complement(13704..13741)
FT                   /locus_tag="An01g04270"
FT                   /number=6
FT   CDS_pept        join(13887..13922,13992..14061,14139..14957,15018..15334)
FT                   /locus_tag="An01g04280"
FT                   /note="Function: Haploid S. cerevisiae cells carrying the
FT                   disrupted YDJ1 gene are inviable for growth in liquid
FT                   media."
FT                   /note="Function: YDJ1p from S. cerevisiae is involved
FT                   mitochondrial and ER import."
FT                   /note="Function: YDJ1p from S. cerevisiae is required for
FT                   normal growth and disruption of its gene results in very
FT                   slow growing cells that have pleiotropic morphological
FT                   defects."
FT                   /note="Localization: YDJ1p from S. cerevisiae
FT                   cofractionates with nuclei and also microsomes, suggesting
FT                   that its perinuclear localization reflects association with
FT                   the ER."
FT                   /note="Remark: has similarity to family of dnaJ heat shock
FT                   proteins."
FT                   /note="Remark: synonyms for Ydj1 from S. cerevisiae are
FT                   Mas5 and YNL064c."
FT                   /note="Similarity: the ORF also shows strong similarity to
FT                   expressed sequence tag seq id no:6895 of patent
FT                   WO200056762-A2 from Aspergillus oryzae."
FT                   /note="Title: strong similarity to dnaJ protein homolog
FT                   Ydj1 - Saccharomyces cerevisiae"
FT                   /note="cytoplasm"
FT                   /note="See PMID 11014801"
FT                   /note="See PMID 11689685"
FT                   /db_xref="GOA:A2Q8G7"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8G7"
FT                   /inference="profile:COGS:COG0484"
FT                   /inference="profile:PFAM:PF00226"
FT                   /inference="profile:PFAM:PF00684"
FT                   /inference="profile:PFAM:PF01556"
FT                   /inference="similar to AA sequence:PIR:S26703"
FT                   /protein_id="CAK36964.1"
FT                   /translation="MVKETKFYDILGVPPTASEAQLKTAYKKGALKYHPDKNTNNPEAA
FT                   EKFKELSAAYETLSDPQKRSLYDQLGEEGLEHGGAGGGMGAEDLFAQFFGGGGGFGGMF
FT                   GGGMRDQGPKKARTIHHVHKVNLEDIYRGKVSKLALQKSVICPGCDGRGGKEGAVKSCT
FT                   GCNGSGMKTMMRQMGPMIQRFQTVCPDCNGEGEIIREKDRCKRCNGKKTTVERKVLHVH
FT                   VDRGVKNGHKIEFRGEGDQMPGVLPGDVVFEIEQKPHPRFQRKDDDLFYQAEIDLLTAL
FT                   GGGTINIEHLDDRWLTVTVAPGEVITPGAIKVIKGQGMPSYRHHDFGNLYIQFDVKFPE
FT                   KDQLKNLELLEQVLPPRMEQSQPPQDAMIEDFELEDIDGSESSQARAHGAASAMDEDDE
FT                   DVPPGAERVQCASQ"
FT   mRNA            join(<13887..13922,13992..14061,14139..14957,15018..>15334)
FT                   /locus_tag="An01g04280"
FT   exon            13887..13922
FT                   /locus_tag="An01g04280"
FT                   /number=1
FT   intron          13923..13991
FT                   /locus_tag="An01g04280"
FT                   /number=1
FT   exon            13992..14061
FT                   /locus_tag="An01g04280"
FT                   /number=2
FT   intron          14062..14138
FT                   /locus_tag="An01g04280"
FT                   /number=2
FT   exon            14139..14957
FT                   /locus_tag="An01g04280"
FT                   /number=3
FT   intron          14958..15017
FT                   /locus_tag="An01g04280"
FT                   /number=3
FT   exon            15018..15334
FT                   /locus_tag="An01g04280"
FT                   /number=4
FT   tRNA            complement(16099..16213)
FT                   /gene="tRNA-Met (CAT)"
FT                   /locus_tag="An01e04290"
FT                   /product="transfer RNA-Met (CAT)"
FT                   /inference="profile:tRNAscan:1.4"
FT   CDS_pept        complement(join(16711..17442,17502..19294,19357..19435))
FT                   /locus_tag="An01g04300"
FT                   /note="Title: strong similarity to protein fragment SEQ ID
FT                   NO:54638 from patent EP1033405-A2 - Arabidopsis thaliana"
FT                   /db_xref="GOA:A2Q8G8"
FT                   /db_xref="InterPro:IPR007234"
FT                   /db_xref="InterPro:IPR039766"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8G8"
FT                   /inference="profile:PFAM:PF04100"
FT                   /protein_id="CAK36965.1"
FT                   /translation="MSATTTTTTPGQMPSNGEVPLDPLDAADYDPIDHLNAIFSHPSTL
FT                   SSVSQVSQSLREYEDELDNDIGALVEDQVTSNAESVERIQAAKADLTELFKKIDDVRDR
FT                   ASRTELAITEMTADIKQLDNAKKNLTLSMTVLKRLQMLTTAYDQLRSLGRTRQYRDCAQ
FT                   LLQAVIQLMAHFKSYRSIDQIALLSRNVADIQRELLEQVCEDFELAFAKGEVGQKRHVL
FT                   SEGCLVMDALGDHAKSRLVTWYCNFQLREYRQVFRNNEEAGSLDNISRRYAWFRRILKN
FT                   YDEEYAPIFPASWRVNEILANIFCEGTREDFKGILSRSVRNGQTIDVNLLLSCLQETLD
FT                   FEHSLERRFVSPSRPSTDTFASSEAPVFGQAISEAFEPYLSVWVEAQDKQLAALIPKYR
FT                   QQPAKPPDEEFDSHIVISSSTDLFTFYRHSLQQCAKLSTGASLAELAKVFAKYLDQYAQ
FT                   VLLYYISERPTGHTPSKVPGTEDLILVLNTADYCYTTCNQLEEKIKGRLDKNLKQSVDL
FT                   QSQADSFMGIASAAVRGLVRKVEIDLEPCWREMRNTPWNRLEGVSDQSSYVGELMSKTQ
FT                   TRCSELLQLLHKQQYARAFADHVVELISNVFIATIFQCKPVAETGAEQMLLDAYTLKTG
FT                   LSSLLPSPAPAGFVKRVNASFAKIEALLKTLQVQPSPPEALVQAYLVHIADQNNANFRK
FT                   ILDLKGIRSRQDQNHLIELFQIHRASDRYAANLQQSNPILTAMQASATPSSGTVSQGLG
FT                   LGTAAASIGASTRFDPTMLGSAIISAAKDGVDRFGTPMSSANTTNLTPGGSAISGALTS
FT                   PASTPGPLGQAQPQGGESTTAAGNLNENLKNIGKFFRRDLGGFGGRFGRSGDDGN"
FT   mRNA            complement(join(<16711..17442,17502..19294,19357..>19435))
FT                   /locus_tag="An01g04300"
FT   exon            complement(16711..17442)
FT                   /locus_tag="An01g04300"
FT                   /number=1
FT   intron          complement(17443..17501)
FT                   /locus_tag="An01g04300"
FT                   /number=1
FT   exon            complement(17502..19294)
FT                   /locus_tag="An01g04300"
FT                   /number=2
FT   intron          complement(19295..19356)
FT                   /locus_tag="An01g04300"
FT                   /number=2
FT   exon            complement(19357..19435)
FT                   /locus_tag="An01g04300"
FT                   /number=3
FT   CDS_pept        complement(join(20206..20253,20308..21813))
FT                   /locus_tag="An01g04310"
FT                   /note="Function: the S. pombe homolog Mex67p participates
FT                   at various common steps with Rae1p export complexes in
FT                   promoting the nuclear cytoplasmic export of mRNA."
FT                   /note="Similarity: S. pombe Mex67p has similarity to the
FT                   human mRNA export factor Tap."
FT                   /note="Title: strong similarity to mRNA export factor
FT                   mex67p - Schizosaccharomyces pombe"
FT                   /note="nucleus"
FT                   /db_xref="GOA:A2Q8G9"
FT                   /db_xref="InterPro:IPR002075"
FT                   /db_xref="InterPro:IPR005637"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR018222"
FT                   /db_xref="InterPro:IPR030217"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8G9"
FT                   /inference="profile:PFAM:PF03943"
FT                   /inference="similar to AA sequence:PIR:T43683"
FT                   /protein_id="CAK36966.1"
FT                   /translation="MLQLNGFSFAGAPLTTEKYDPSTGGLLDQPMLSAMAQNGGTSSAA
FT                   ETKAKMTTILGKRYTQQTKLLDLSKLGTDPDLLAMGIFGSTSTESKFFPALMKVWELNF
FT                   DNATARREAVESVSLAHNQLANITAVTALASTIPDLKNLDLSNNEFKDAQSLIGWRWKF
FT                   RNLEFLDLSNTPFSADPTFKDTMLKWYPKLRFLNNVEVRTAEEIAAQKKTPIPVQPPHF
FT                   QDDSQIAENFVRAFFAGYDNDRSGILNSVYDNHTTFTLNVNTSAPRAQQTETAPWDAYI
FT                   KKSRNLLKISHLPARMSRVYTGAEKIRELWTSLPATRHPDIATRPEEWLIECYPIPGLP
FT                   DISGQSSTGVGGLLIMVHGKFDEINGAKVETRSFDRTFIIGPGGGMGGIRVVSDILCLR
FT                   AYGGHEAWIPEVPPAVPQAAPPAAPAPAPAAPAAPAALPVAIPGAPEGYGMPAPGKADA
FT                   QVQQEQLVLQMSSNTRMTLQYSEMALSGNGWNMEAALKNFEELKAQGTLPPEAFLPAAV
FT                   "
FT   mRNA            complement(join(<20206..20253,20308..>21813))
FT                   /locus_tag="An01g04310"
FT   exon            complement(20206..20253)
FT                   /locus_tag="An01g04310"
FT                   /number=1
FT   intron          complement(20254..20307)
FT                   /locus_tag="An01g04310"
FT                   /number=1
FT   exon            complement(20308..21813)
FT                   /locus_tag="An01g04310"
FT                   /number=2
FT   CDS_pept        join(23354..23546,23614..23794,23877..24428,24507..24801)
FT                   /locus_tag="An01g04320"
FT                   /note="Complex: part of the Erv41p-Erv46p subcomplex
FT                   associated with the COPII vesicle coat."
FT                   /note="Function: S. cerevisiae Erv46p is involved in ER to
FT                   Golgi vesicle transport."
FT                   /note="Remark: a splice site upstream of the start codon
FT                   was detected."
FT                   /note="Remark: alternative gene names for the S. cerevisiae
FT                   homolog ERV46 are FUN9 and YAL042W."
FT                   /note="Title: strong similarity to COPII vesicle coat
FT                   component protein Erv46 - Saccharomyces cerevisiae"
FT                   /note="intracellular transport vesicles"
FT                   /db_xref="GOA:A2Q8H0"
FT                   /db_xref="InterPro:IPR012936"
FT                   /db_xref="InterPro:IPR039542"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8H0"
FT                   /inference="similar to AA sequence:PIR:S51977"
FT                   /protein_id="CAK36967.1"
FT                   /translation="MPAKSRFTRLDAFAKTVEDARVRTTSGGVITIASLLVILWLVWGE
FT                   WADYRRVVVMPELVVDKSRGEKMEIHLNVTFPRLPCELLTLDVMDVSGEQQTGVVHGIN
FT                   KVRLTSAAEGGRVIDVKALELAKHLDPDYCGECYGATAPAGASKPGCCNTCDEVREAYA
FT                   QQQWAFGKGENVEQCELEGYAERIDAQRREGCRLEGVLRVNKVVGNFHIAPGRSFTSGN
FT                   MHVHDLANFFDADLPDAEKHTMTHEIHQLRFGPQLPDELSDRWQWTDHHHTNPLDGTKQ
FT                   ETNEPGYNYMYFVKVVSTSYLPLGWDPLIETHQYSVTSHKRSLMGGDASDEGHKERLHA
FT                   ANGIPGVFVNYDISPMKVINREARPKTFTGFLTGVCAIIGGTLTVAAALDRGLYEGVSR
FT                   MKKLHSN"
FT   mRNA            join(<23354..23546,23614..23794,23877..24428,24507..>24801)
FT                   /locus_tag="An01g04320"
FT   exon            23354..23546
FT                   /locus_tag="An01g04320"
FT                   /number=1
FT   intron          23547..23613
FT                   /locus_tag="An01g04320"
FT                   /number=1
FT   exon            23614..23794
FT                   /locus_tag="An01g04320"
FT                   /number=2
FT   intron          23795..23876
FT                   /locus_tag="An01g04320"
FT                   /number=2
FT   exon            23877..24428
FT                   /locus_tag="An01g04320"
FT                   /number=3
FT   intron          24429..24506
FT                   /locus_tag="An01g04320"
FT                   /number=3
FT   exon            24507..24801
FT                   /locus_tag="An01g04320"
FT                   /number=4
FT   CDS_pept        complement(join(25857..28850,28915..29072,29132..29482,
FT                   29560..29575))
FT                   /locus_tag="An01g04330"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   YLR187w - Saccharomyces cerevisiae"
FT                   /db_xref="GOA:A2Q8H1"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8H1"
FT                   /inference="profile:PFAM:PF00169"
FT                   /inference="similar to AA sequence:PIR:S51432"
FT                   /protein_id="CAK36968.1"
FT                   /translation="MGRSRVLSLMSVFGGSSRKDNLSQHHRTSSASLTLNNPPRRVDTP
FT                   SSDTPSPLDASPITGTPHVERRVTSRPESTLFSHNPPLLEFSQDTPPELQPIFGYLNSH
FT                   ANKLYHEGYFLKLNDLDIHGRPCADRQWVECYAQLVGTALSLWDAAALDAAEESEDVCP
FT                   TFINLADASIKMLETLPTRNQGAQSLKNILSICSAGQNRYLLHFNSFHSLTQWTAAIRL
FT                   ALFEHTSLYEAYTGSIIAGKGKGLNSIRTILDRHRYKHEDWARVRFGAGTPWRRCWFVI
FT                   TPPNEKEFQKAQKSIKKKSAYDRAPRLITGDIKFYDTKKTKKAKPIATITDAYAAYAIY
FT                   PQSRALIEQSTLVKIEGKITVHGQTESTTDGFVFVMPEVHPAVSGFEMMLRFLVPTFDT
FT                   FNLYGRPTRLIAATNHIKSIMFAFPNQRRYGYLDILDISSLMQTPGSQDWNEAEWRQQL
FT                   KEATARRMAAAGSRTSSISASKPRFRATMPNRQPNGRTMTHQRNCTSPVNQLDSNQSND
FT                   AVAPGAPRDASISPIHHSRASSDTAGFASIRRQAQAAEVSPASSAQELVARGSERPGTS
FT                   GVDDHRSTGSDRNQRLDPDDEPLGHHFRSTSPPSPVIQPPAFTHAPGEMPAMRPQPSPD
FT                   LRKANNRMSDATLTQLLAASGSMNLLGASFPSGSHETIRESNQPSPLTPNTGSDQQGAP
FT                   SLLSDTSEKRVTLQEQGPPTPEDRSSDFGPPLTLPKRSSLRLDTTKAVKRKPLPAQQIR
FT                   ESDAASVAGEPSYDDLRHTVDEEVLNWVGSRQFSLTSPDIESHQDEESIYDDASANSPD
FT                   YASTRGSVYSKRSVRSVTRPRMGVMKTVGSGPPRQDLVIGDAHYTVDEPKLELSAEIPS
FT                   IDFGPTLTYLPTTGRPNTGDTLKKSMHQRSDSNATEKQFSYQAERQHSRSPSSNVMWQP
FT                   GMTAPRPTTPGRLTAEQFVQQRSAPSPPIATHNRTLSSTPPPPRPVSGDWTNNSRPQSH
FT                   LSGSRDAPPRPRSRGANSIMNYNELSSHLSAREQEHVARMTGAPLLDISNVNKAQPTPV
FT                   NPMGLVGAIDAREREKKTIREGLSNQMVQHAIVQRQQNWQQQQMASNASAAAYNQGSHY
FT                   SLYNMPTANRTWDALNQPYRPDEPRRQSWYGQFASQQAQTPPIYQQNPPYGQHPGYSGN
FT                   ASTLHY"
FT   mRNA            complement(join(<25857..28850,28915..29072,29132..29482,
FT                   29560..>29575))
FT                   /locus_tag="An01g04330"
FT   exon            complement(25857..28850)
FT                   /locus_tag="An01g04330"
FT                   /number=1
FT   mat_peptide     complement(join(25860..28850,28915..29072,29132..29444))
FT                   /locus_tag="An01g04330"
FT   intron          complement(28851..28914)
FT                   /locus_tag="An01g04330"
FT                   /number=1
FT   exon            complement(28915..29072)
FT                   /locus_tag="An01g04330"
FT                   /number=2
FT   intron          complement(29073..29131)
FT                   /locus_tag="An01g04330"
FT                   /number=2
FT   exon            complement(29132..29482)
FT                   /locus_tag="An01g04330"
FT                   /number=3
FT   sig_peptide     complement(join(29445..29482,29560..29575))
FT                   /locus_tag="An01g04330"
FT                   /inference="protein motif:SignalP:2.0"
FT   intron          complement(29483..29559)
FT                   /locus_tag="An01g04330"
FT                   /number=3
FT   exon            complement(29560..29575)
FT                   /locus_tag="An01g04330"
FT                   /number=4
FT   CDS_pept        join(30024..30096,30180..30337,30420..30536)
FT                   /locus_tag="An01g04340"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8H2"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8H2"
FT                   /protein_id="CAK36969.1"
FT                   /translation="MAEKAEGNESESEGKERQGERYRATQADERWRTINLLTQSKTWVL
FT                   NVVSVTSVTGLIVGSAACFLLSSFETEGEWIWSRREREDIPFERAGQMVKTKPQNNSIR
FT                   HAGWTCGSILG"
FT   mRNA            join(<30024..30096,30180..30337,30420..>30536)
FT                   /locus_tag="An01g04340"
FT   exon            30024..30096
FT                   /locus_tag="An01g04340"
FT                   /number=1
FT   intron          30097..30179
FT                   /locus_tag="An01g04340"
FT                   /number=1
FT   exon            30180..30337
FT                   /locus_tag="An01g04340"
FT                   /number=2
FT   intron          30338..30419
FT                   /locus_tag="An01g04340"
FT                   /number=2
FT   exon            30420..30536
FT                   /locus_tag="An01g04340"
FT                   /number=3
FT   CDS_pept        complement(join(31082..31139,31460..31684,31767..31874,
FT                   31973..32083,32264..32419,32506..32546,32641..32754,
FT                   32935..33000,33086..33238))
FT                   /locus_tag="An01g04350"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8H3"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8H3"
FT                   /protein_id="CAK36970.1"
FT                   /translation="MAMSQFRLSIFGVPTVTPVHRTLQDVCEGTGTGSPPPEWGSYCMP
FT                   STRNILGKPITELVHKPKLNCSRLHRVGARRESRRTTLVKIDCIMTTARLILQSCPNDT
FT                   LQGNEDQEKLFPRWVPTAEVILEQTKRGNTLAGGSRAGVCTTECVHPVEHLRVEVRASR
FT                   KGYDLITRGADQPQANAAATLGEAKIADGYSAMSAAEEGPLLINCFARIAGGICFRNYS
FT                   YLYRLGLSCDLEIHSNHCRQFWTFMASREASRQDHLMPCGTAGLWQCASGLLTPGPFLF
FT                   LTVALHSSVHKGQGTRRRLSLPIHPSNRTMIYPRSRTNTFALRGGINWDNPPGHPWVAR
FT                   MAD"
FT   mRNA            complement(join(<31082..31139,31460..31684,31767..31874,
FT                   31973..32083,32264..32419,32506..32546,32641..32754,
FT                   32935..33000,33086..>33238))
FT                   /locus_tag="An01g04350"
FT   exon            complement(31082..31139)
FT                   /locus_tag="An01g04350"
FT                   /number=1
FT   intron          complement(31140..31459)
FT                   /locus_tag="An01g04350"
FT                   /number=1
FT   exon            complement(31460..31684)
FT                   /locus_tag="An01g04350"
FT                   /number=2
FT   intron          complement(31685..31766)
FT                   /locus_tag="An01g04350"
FT                   /number=2
FT   exon            complement(31767..31874)
FT                   /locus_tag="An01g04350"
FT                   /number=3
FT   intron          complement(31875..31972)
FT                   /locus_tag="An01g04350"
FT                   /number=3
FT   exon            complement(31973..32083)
FT                   /locus_tag="An01g04350"
FT                   /number=4
FT   intron          complement(32084..32263)
FT                   /locus_tag="An01g04350"
FT                   /number=4
FT   exon            complement(32264..32419)
FT                   /locus_tag="An01g04350"
FT                   /number=5
FT   intron          complement(32420..32505)
FT                   /locus_tag="An01g04350"
FT                   /number=5
FT   exon            complement(32506..32546)
FT                   /locus_tag="An01g04350"
FT                   /number=6
FT   intron          complement(32547..32640)
FT                   /locus_tag="An01g04350"
FT                   /number=6
FT   exon            complement(32641..32754)
FT                   /locus_tag="An01g04350"
FT                   /number=7
FT   intron          complement(32755..32934)
FT                   /locus_tag="An01g04350"
FT                   /number=7
FT   exon            complement(32935..33000)
FT                   /locus_tag="An01g04350"
FT                   /number=8
FT   intron          complement(33001..33085)
FT                   /locus_tag="An01g04350"
FT                   /number=8
FT   exon            complement(33086..33238)
FT                   /locus_tag="An01g04350"
FT                   /number=9
FT   CDS_pept        join(34766..35369,35426..36192)
FT                   /locus_tag="An01g04360"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8H4"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8H4"
FT                   /protein_id="CAK36971.1"
FT                   /translation="MDLICSSPVVPAPIQEMVAEPIDIILDEPTDTCAMVEEKAEEIIE
FT                   AENERLDQLMIEFTRGFDPGTFVDEVSNSLPGILKDIFPGSYEHLLSMLFESDDKMHAT
FT                   QMKLEEWLLKRYPQVLNKIDTERQETNITDETYFGAEIEILRKMLAFLRKESDKPVFWL
FT                   NSRRASPSKAREQLEASIRVIELFKSDVMVAMKLDTEDRKIYNPLPVSTERTALLSIKQ
FT                   LRIDACKASLSWEGYMDSAIVLTSFFHAYKAYTCAHKPDKARAWGWLPPQGLAPPRLSA
FT                   EIAQVGDLVRWEFEHENGAFDLLLKTALWLGLARGLPAVHLFCDVARLFTTHKPSPTAN
FT                   EPYIRFLRHLAQTRVSIAGIKSTPSTPVPFKQSDENTNRGYFEDVVDSDKNLEKDLTKT
FT                   LSLLRINTARDIKLTATPPKCSFRKKAKMIEKACAVEENHTEKWPQKDPASQGNSFS"
FT   mRNA            join(<34766..35369,35426..>36192)
FT                   /locus_tag="An01g04360"
FT   exon            34766..35369
FT                   /locus_tag="An01g04360"
FT                   /number=1
FT   intron          35370..35425
FT                   /locus_tag="An01g04360"
FT                   /number=1
FT   exon            35426..36192
FT                   /locus_tag="An01g04360"
FT                   /number=2
FT   exon            complement(37662..39200)
FT                   /locus_tag="An01g04370"
FT                   /number=1
FT   CDS_pept        complement(37662..39200)
FT                   /locus_tag="An01g04370"
FT                   /note="Function: the C. albicans homolog CATFIIIA is
FT                   involved in initiating transcription of the ribosomal RNA
FT                   5S gene."
FT                   /note="Similarity: C. abicans CATFIIIA belongs to the
FT                   superfamily of transcription factor IIIA proteins."
FT                   /note="Title: strong similarity to transcription factor
FT                   CATFIIIA from patent WO200028037-A1 - Candida albicans"
FT                   /note="nucleus"
FT                   /db_xref="GOA:A2Q8H5"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8H5"
FT                   /inference="profile:COGS:COG5048"
FT                   /inference="profile:PFAM:PF00096"
FT                   /protein_id="CAK36972.1"
FT                   /translation="MSTISARYPSELKTHRCPFDGCTKAFNRPARLQEHLRSHNNERLF
FT                   RCTHDDCDKTFLRASHLSHHIKSAHTGIRDYVCDRPGCGKSFVTGSRLRRHIAAHDGRD
FT                   KYRCTEFPPCDETFRKHSTLQKHIMSVHLKQKPFSCPHIDATTGQKCPMAFDTAGHLRA
FT                   HESRIHTEKRFTCTECTQQAEQANPSSSETPALTTVTFPTYALLQAHIRTVHPPQCPNC
FT                   NLTCSTARELRRHLEVSHGNVSLEERKVFPCTIPGCDSSFTKKGNLTVHIRTVHQGEKR
FT                   FVCGETDLSMSKRVVGWTGADGCGKRYGSKLALEEHIRTAHLGFPNAKAERRQRLGLNK
FT                   TPNPQQTAPSALAALTGEGYAEETGRQITCFIEGCPHRFHRNYDLWVHMGSKHGCTEDE
FT                   IRDMFMQRALLADSNEPVTGDMFGIYGLEFDNDDSSAPYEPYIIHADSKAGLYTMGSGG
FT                   DPTNNENNPGDFPSNFADAMIQDVDVDVSSSSKIPSADDMAMIDPLLAYNMADS"
FT   mRNA            complement(<37662..>39200)
FT                   /locus_tag="An01g04370"
FT   CDS_pept        join(39790..39824,39953..40246,40319..40438,40510..40543)
FT                   /locus_tag="An01g04380"
FT                   /EC_number="2.7.7.6"
FT                   /note="Complex: S. cerevisiae Rpo26p is essential for the
FT                   assembly of RNA polymerase I and RNA polymerase II and for
FT                   the stability of the largest subunits of these enzymes."
FT                   /note="Function: the S. cerevisiae homolog RPO26 catalyses
FT                   DNA-template-directed extension of the 3'-end of an RNA
FT                   strand by one nucleotide at a time."
FT                   /note="Title: strong similarity to 23 kD subunit of
FT                   DNA-directed RNA polymerase I,II,III Rpo26 - Saccharomyces
FT                   cerevisiae"
FT                   /note="nucleus"
FT                   /db_xref="GOA:A2Q8H6"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR006111"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR020708"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8H6"
FT                   /inference="profile:COGS:COG1758"
FT                   /inference="profile:PFAM:PF01192"
FT                   /inference="similar to AA sequence:PIR:RNBYR6"
FT                   /protein_id="CAK36973.1"
FT                   /translation="MSDYGDHDAEETYDYEPEQEYDDNEPEDFLNPEDVDVAEGGADEY
FT                   GEGSYAPAVNGNHIVASGDPNAGYAGKVMEQTREKKVPNDQRQTTPYMTKYERARVLGT
FT                   RALQISMNAPVLVDLEGETDPLQIAIKELNQKKIPLIVRRYLPDGWYEDWTCEELL"
FT   mRNA            join(<39790..39824,39953..40246,40319..40438,40510..>40543)
FT                   /locus_tag="An01g04380"
FT   exon            39790..39824
FT                   /locus_tag="An01g04380"
FT                   /number=1
FT   intron          39825..39952
FT                   /locus_tag="An01g04380"
FT                   /number=1
FT   exon            39953..40246
FT                   /locus_tag="An01g04380"
FT                   /number=2
FT   intron          40247..40318
FT                   /locus_tag="An01g04380"
FT                   /number=2
FT   exon            40319..40438
FT                   /locus_tag="An01g04380"
FT                   /number=3
FT   intron          40439..40509
FT                   /locus_tag="An01g04380"
FT                   /number=3
FT   exon            40510..40543
FT                   /locus_tag="An01g04380"
FT                   /number=4
FT   CDS_pept        join(40774..40913,41005..41079,41292..41338,41675..41956,
FT                   42084..42156,42287..42638)
FT                   /locus_tag="An01g04390"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8H7"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8H7"
FT                   /protein_id="CAK36974.1"
FT                   /translation="MLTLFRLAQSRPFVRNLLLWKQNDVFTSEPDRALHRGGLGCRINI
FT                   DGWMLWGSDATASMASTPHMAPFPHSRCLAQCVAHEYLLRVIATFSCAVTGYIRSTYQA
FT                   DQQVLTDPWFAHLFFCQPIFIGDDAVLFRDPDPERRPITPRYFNPAFSGLRVSASRGLE
FT                   SSIFLVAADTSRWASPVRRIRTSVAFAKNEQVNGPGTGWTKKKASLCFPQFLMLVFSLL
FT                   QLPDNTSRHVPGEKKELCGSVPRQVTPSLTRNPLVAGPVGSLPTMGHQPEPGSLDCLHS
FT                   HSQGISQHEWPPESGPPYSVLVESAFLAPKLSLSRGLEALP"
FT   mRNA            join(<40774..40913,41005..41079,41292..41338,41675..41956,
FT                   42084..42156,42287..>42638)
FT                   /locus_tag="An01g04390"
FT   exon            40774..40913
FT                   /locus_tag="An01g04390"
FT                   /number=1
FT   intron          40914..41004
FT                   /locus_tag="An01g04390"
FT                   /number=1
FT   exon            41005..41079
FT                   /locus_tag="An01g04390"
FT                   /number=2
FT   intron          41080..41291
FT                   /locus_tag="An01g04390"
FT                   /number=2
FT   exon            41292..41338
FT                   /locus_tag="An01g04390"
FT                   /number=3
FT   intron          41339..41674
FT                   /locus_tag="An01g04390"
FT                   /number=3
FT   exon            41675..41956
FT                   /locus_tag="An01g04390"
FT                   /number=4
FT   intron          41957..42083
FT                   /locus_tag="An01g04390"
FT                   /number=4
FT   exon            42084..42156
FT                   /locus_tag="An01g04390"
FT                   /number=5
FT   intron          42157..42286
FT                   /locus_tag="An01g04390"
FT                   /number=5
FT   exon            42287..42638
FT                   /locus_tag="An01g04390"
FT                   /number=6
FT   CDS_pept        join(42920..43104,43167..44295)
FT                   /locus_tag="An01g04400"
FT                   /note="Similarity: has similarity to the monocarboxylate
FT                   transporters of the major facilitator superfamily."
FT                   /note="Title: strong similarity to hypothetical protease
FT                   Mch5 - Saccharomyces cerevisiae"
FT                   /db_xref="GOA:A2Q8H8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8H8"
FT                   /inference="profile:COGS:COG0477"
FT                   /inference="profile:COGS:COG2271"
FT                   /protein_id="CAK36975.1"
FT                   /translation="MGTNADYDEKAVAGSLAANNNGDVHELPTPSDEKPLEEPIFDTGF
FT                   KSWIQVLGSFFLFFNSWGVINTWGAFQTYYEQNLLSNMSSSNIAWIGSLQAFLLMLFGV
FT                   VTGPLFDAGYFRALLTFGSIMLPFGLMMTSLATKFWQLILAQGICIGLAAGCLFVPSVA
FT                   ILPQYFKKRRGLANGLAASGSSIGGVIYPIMFDQLQHKVGFPWATRAIGFLCFGTCCIS
FT                   YSIMRMRFQPTEKRKLVQLAAFKEPHFVMFCIGMFLGFLGFYNFLFYIQSYAIDTGIVG
FT                   STLGFYLLSMLNAGSTVGRICPNFIADHTGPLNVLTPAATATAILAFAWIGVHNAPGII
FT                   VLSVLYGLCSGGFVSLPPVVMVTLTKDIRDLGTRLGMVFAITSVGLLIGTPIGGAILSN
FT                   SGSYLGVQLFTACCLITSASVFAALRFSRSGMRLAARV"
FT   mRNA            join(<42920..43104,43167..>44295)
FT                   /locus_tag="An01g04400"
FT   exon            42920..43104
FT                   /locus_tag="An01g04400"
FT                   /number=1
FT   intron          43105..43166
FT                   /locus_tag="An01g04400"
FT                   /number=1
FT   exon            43167..44295
FT                   /locus_tag="An01g04400"
FT                   /number=2
FT   CDS_pept        complement(join(44903..45074,45202..45433,45518..45686))
FT                   /locus_tag="An01g04410"
FT                   /EC_number="2.3.1.-"
FT                   /note="Title: strong similarity to N-acetyl transferase
FT                   NACTH from patent US6017744-A - Homo sapiens"
FT                   /db_xref="GOA:A2Q8H9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8H9"
FT                   /inference="profile:COGS:COG0456"
FT                   /inference="profile:PFAM:PF00583"
FT                   /protein_id="CAK36976.1"
FT                   /translation="MSSIRRMSPTDLLSLNLTNLDPLTENYDLGFYLNYLMRWPSLFSS
FT                   VQDRQEGIVGYIMGKLEEQPASMRHSEHYTPWHGHITVLTVAPAWRRLGHARRLTERLE
FT                   QGSDINDAWFVDLYVRAGNKVAVGMYKGMGYSVFRRVVNYYSDDPTGFSDSGEDAFDMR
FT                   KPCSRDKKLQHIRDNGEEFLVDPIHVS"
FT   mRNA            complement(join(<44903..45074,45202..45433,45518..>45686))
FT                   /locus_tag="An01g04410"
FT   exon            complement(44903..45074)
FT                   /locus_tag="An01g04410"
FT                   /number=1
FT   intron          complement(45075..45201)
FT                   /locus_tag="An01g04410"
FT                   /number=1
FT   exon            complement(45202..45433)
FT                   /locus_tag="An01g04410"
FT                   /number=2
FT   intron          complement(45434..45517)
FT                   /locus_tag="An01g04410"
FT                   /number=2
FT   exon            complement(45518..45686)
FT                   /locus_tag="An01g04410"
FT                   /number=3
FT   CDS_pept        join(46281..47002,47092..47665)
FT                   /locus_tag="An01g04420"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   CAE76116.1 - Neurospora crassa"
FT                   /db_xref="GOA:A2Q8I0"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8I0"
FT                   /protein_id="CAK36977.1"
FT                   /translation="MPSIPPPLTISHRHTRSRSSNIDIDPISPGTYAPNGFSYRSPRSP
FT                   HTPRSSIPSSPVDVRPHHTQSFNGSHRMSGDFGGAGNEGGGLGNLADELADAWEEEEGG
FT                   YGYTSGQDTGAPDAQYVDRSDDEDAYHRMGTGARTPSSGYSSERNSSLQPPRPKTRNGA
FT                   HRHRRHESQYDGSDYGNDSDFEEADMPPSLEMQMAEIESLARRGLENNGSENDFVIQRA
FT                   VEALRDLGGQSGIENNAMRLITAHSSITSHLTHQTRALQTLTHPLLFSPFPLLSSDAID
FT                   ALIPLIDEELLPNLPYPFPEQPRHSSRPTTPSQSPALNPLVSLQTLVSQTSDITLSLRG
FT                   LSDTLYESRQLTSTASRRLRSARELVADLRREEEGVEEGTRWIERGDWDRRLRDREAGR
FT                   VCGDVVSGFEAVCGEWREKLFGAAAGAEVAAA"
FT   mRNA            join(<46281..47002,47092..>47665)
FT                   /locus_tag="An01g04420"
FT   exon            46281..47002
FT                   /locus_tag="An01g04420"
FT                   /number=1
FT   intron          47003..47091
FT                   /locus_tag="An01g04420"
FT                   /number=1
FT   exon            47092..47665
FT                   /locus_tag="An01g04420"
FT                   /number=2
FT   CDS_pept        complement(join(49185..49701,49776..52150,52233..52457,
FT                   52588..52629))
FT                   /locus_tag="An01g04430"
FT                   /note="Title: strong similarity to translation initiation
FT                   factor eIF-3 - Schizosaccharomyces pombe"
FT                   /note="cytoplasm"
FT                   /db_xref="GOA:A2Q8I1"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR027512"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2Q8I1"
FT                   /inference="profile:COGS:COG0542"
FT                   /inference="similar to AA sequence:PIR:T39716"
FT                   /protein_id="CAK36978.1"
FT                   /translation="MPPPPHIKPENVLKRAQELIAVGQAPAALNVLHEHVTSKRTRSSP
FT                   IASLEPVMLLFVELCVDLRKGKAAKDGLYQYKNIAQNTNVGTIEVVLKKFIELAEKKVT
FT                   EAQAKADEIQSSLESAAPSSNVDDLEAIETPETILLATVSGEQSRDRTDRAVVTPWLKF
FT                   LWETYRTVLEILKNNARLEVMYQTTALQAFQFCLKYTRKTEFRRLCELLRNHVQNAAKY
FT                   SAQMHAINLSDPDTLQRHLDTRFQQLNVAVELELWQEAFRSIEDIHTLLSLSKRPAKNV
FT                   MMANYYEKLARIFLVSENYLFHAAAFSRYYNLLRQSAAALAAGQGTKKENPSVTEADMT
FT                   KAASFVLLSALSIPVISTSRSRGALVDVDEVRKNKNTRLTNLLGMASPPTRAVLFKDAL
FT                   NKGLLKRARPEIRDLYNILEVDFHPLSICKKITPILKQIGADPEMEKYVLPLQQVILTR
FT                   LFQQLSQVYESVELKFVYELAQFPDPFQITPSMIEKFIMNGCKKGDLAIRVDHISGVLT
FT                   FDTDVFSSAKALHPGSAAGSAESEVGSVQRLQNTPAEIARLQLTRLAKTLHVTCMYVDP
FT                   SYNEARLQAKRAALARAEAGAAKEHEETLARRVIIEKKKEAATDALQRKQREEETRKRI
FT                   RTQQLQEAEKQRLLDEHREREKKRIKDEQDRIRQQELKKQLEELKTGVKGIDISELDLN
FT                   ELDANRLRAMKLAQLEKEKNELNDRIRTTAKRIDHLERAFRREELKHVPEDYEKQKQRD
FT                   MEIYEATKAEALKEAEDKHKEAVALKHRLSRLVPQFNSFRKEVSEKRHEEFEKRRKAAE
FT                   RDFEAKKMQRIKEVQERRRRERAEREEEERRRKEEEERIRREEEERTAKEEERRRVLAE
FT                   EKAKREEERKRLDELAAKQKQREEEAEARRAARRTGGAEPEAAPERAAPTERTAPRLNL
FT                   APRTGGAGPSWRERQAAKEAAGGTPAAPAAAAPEPAREEPAPVRRTGGYVPPHLRSGAS
FT                   ATPAAPAPAPSTERYVPRAMREAGSSQPPSRTQTPGSSSDKPEESKPAAGKWVPRWKQQ
FT                   QGGQ"
FT   mRNA            complement(join(<49185..49701,49776..52150,52233..52457,
FT                   52588..>52629))
FT                   /locus_tag="An01g04430"
FT   exon            complement(49185..49701)
FT                   /locus_tag="An01g04430"
FT                   /number=1
FT   intron          complement(49702..49775)
FT                   /locus_tag="An01g04430"
FT                   /number=1
FT   exon            complement(49776..52150)
FT                   /locus_tag="An01g04430"
FT                   /number=2
FT   intron          complement(52151..52232)
FT                   /locus_tag="An01g04430"
FT                   /number=2
FT   exon            complement(52233..52457)
FT                   /locus_tag="An01g04430"
FT                   /number=3
FT   intron          complement(52458..52587)
FT                   /locus_tag="An01g04430"
FT                   /number=3
FT   exon            complement(52588..52629)
FT                   /locus_tag="An01g04430"
FT                   /number=4
XX
SQ   Sequence 54374 BP; 12974 A; 13786 C; 14146 G; 13468 T; 0 other;
     gggacgagta cgcgccagta attgatacac agtgttgggg ggcgtgatca aatcgccgac        60
     agcgtgaatg ataacaccag aaagggcagc ttgggggata tagaagaaga cggcggtcag       120
     ggcgtagatg gcgagcaaca caacaatggc ggtgatacag ccggccaagg gagtacgaac       180
     acccgccttc gacttgatgg cggtccggga aaaggatccg gtagcagggt acgcgcccag       240
     gaaaggacca agaaggttgg tcacaccaat accgaccaat tcttgggacg gctcgatggt       300
     atagttgttg acacggccga atgacttgga aatggcgatg tgctcgataa ggaggacgat       360
     gacgcaagca gggagctgac tggcgaaaac cttgatgatc ctggcgttga caacaggaac       420
     agccgcattt tggaaacctg aggggcacga atattaagtt agtttcctat cctcagagac       480
     agatatatca ggtatcaaac gcacctcttg ggacactgcc cagaagatca aacatcgggt       540
     tatccttgcg gtgaaggttg acagctgcac tgatcatggt gtagaacagg atgacaaaga       600
     cagttcgcag cgtcgacgcg aagaaccaca ctttagcgtg gcgagggtac tttcgagcac       660
     cataattgca acccgaacgg ataatgtaca gcatggccaa ggctgtgaca ccaagggcag       720
     catcaatacc cgcagtagga aggtacttca gcgagttgat tatgatcata taggtcgagc       780
     ctctggtgga gaaatctgcc gattctccca gcagcttctt gacttgaccg gcagcgatgt       840
     ttagagcgga tcccgtcatg aatgccgaaa ttgcaggaag gggaatgaag tcaacgatga       900
     agccgagccg aaggagaccg agggcacaga cgatggcacc acagatgata gccaggcaag       960
     atgcaacgat atgccctggg acatccggga tctctttctg agcctgaagc acaatcgttc      1020
     cgaccagcgt ggacattaca gcgacgggct agaaggcata ttgttagaag gtttgactcg      1080
     aaagcggcag gtattagaag aggacaccta ccccgatagt gatatccttg gaagtggcaa      1140
     agaaccaata aaccagtaca cccatgaacg atgagtagag accatactgc actggtagtt      1200
     cggcgagttt ggcataggcc attccctgag ggacaacgac agcaccgaca gtcacacctg      1260
     gtgaataaag tcagatcctt tcgccacaca tacacacaga gcaccaggac ccgatgtagc      1320
     aacttaccag caacaagatc accgaagaac cattgcaggt tatacttcgt gatccatgag      1380
     aggaagggga acagtctgta aaagtacata aggacatcat gccaggttgg acagatttct      1440
     ttgagccatt cggcagtggt cggttccggc tccaaataag agtatgtatc aacggtgccg      1500
     tatgagaagg tcgattcgcc acgagtgacg gggtcggagt gagctccaag gggatcccga      1560
     taaggcaatt tgatacccag gactttggcc aggccgtggc cagtcttggt catgaggtct      1620
     tgcgacatgg ttgtcacgaa ggcctcggat ggaaggacgg gactgattct agggcaagac      1680
     ggtgccccga gccacttgga cagtggaaat ttggcgttga cgaccggagc tgctcaacga      1740
     caatgctcga gtgattgaaa aagagaattc cagattcctc caaggtaata tatcttccag      1800
     gggtgtattt aggcaagccc catggcaagg ttgatggcaa acgatataaa agtggaggcg      1860
     gcaggtagtg tggttttaaa atgaatatcc gaagccaagc gccgatgtcg tgatcgggag      1920
     ctatgaacgc gaaatatcaa aatgcccact cgaccctctt ttcaacgtca ggatccaggc      1980
     tacacgagca agatgaactc aaaaagatct atcagataaa tatggaaatg atagaagcag      2040
     atgaaagaac aaaagtccaa gcaaagcaca cgcggctttc tgagttccgc taggaaatat      2100
     aatgtagatg tggcgcacgg ggaaaaatgt ggtcgagcgg aagatgagac cagcagatcc      2160
     gtcccacgca agtgtttcaa caacacaaat agccacagaa gcaaaaatga gaagaaggat      2220
     aataatgaac aagcagtgaa agtagttcga ggggagtcag tccagagagt tttaaagtga      2280
     ttagacttgt cagaaggagt aaggtgacac gggtctccgt gggggagagc ggacgtcgca      2340
     acgggagttg atgcaagccg atcaatgagt attctacgcc aaaatggcat tgacaacgac      2400
     gaccatgata cgactattat taaccgggaa gggagcatca gcaagaaacg cgcagtgatg      2460
     gggcagctga tccaccaggg atcgtcaagg gcaaaagcac gccgtctgga atattcacag      2520
     gcccgtcgtc aacacgcagc taaggaaaaa ttccctagcc tgcagggagg ccaagctcgt      2580
     cagagaaagc tggcgtaaga gcgccgttta ggtgggtttg gccgggggtc tggaagcgaa      2640
     agatgacgat gagccgtgga gccggtgccc gcccactggc cggggcccat ggtttgcgca      2700
     ttgcatatga gggagtgtgt atcaagtgtg caagtcgagc atccgggaca ggattaacct      2760
     ccggctggtt cactgatttg gtattcatca ttatgataat atggttcact actcgaaaag      2820
     agccgaacgg atggagttct gtctcggtag tcgcaaccca ccatgacgat tgaaaaaggg      2880
     aatgtttctc tccagaatgg atccagttgg aattgtccga cgttcgcaga ggggaggagc      2940
     caaaagggaa agtaagttgg agtggactcc atccgccata ttgccaaggc acaccgccca      3000
     ccggaattgg gtcagcatta gggtatgggc caatgagaat ggtccctgac tactggagag      3060
     cagcatccgc ggcgggcagg cggcgaccaa tgggaatagt gcgagaacac gccatcgctc      3120
     cgactgatgg tgaaagatgg ccggtccacg tgtgggcggc gcggtttcgt ccaagtatcg      3180
     gctgggccgt tctgttaggt tccctcttcc catttccccc cttgttgaga agatggaact      3240
     tctccgtaac ttcctggtcc ccctcctcgt ttttccctct gtttgcctcc tggactgact      3300
     tgccgccaat aatctccttt tttttttttt tttttttttc tattttttcc cactttattt      3360
     ccttagtaat ctatctccga tgcccggatg acgagtacac atctcgtatc ggcctggact      3420
     tccagaatcg gtttctttct ggagagctac gatgtagatc tggataaatg aattttcagg      3480
     gtcatcgaag atgactctac atactccatc ctactcattg taatccgata taaattaaat      3540
     ataatttcca catgtccatg gcagcaatat gtctggaagt cacaaaccta ctcctacgcc      3600
     tgctaagcaa gcggcagtag tacaagcgaa cgggacagtc ttgactacgt accaccgttt      3660
     atttactctg taactgtgga tgcaacagat ggaatttgaa tggacggaca agaccaagat      3720
     tgcctttcac tttttccaac gagactttgc cgacctggct tggcagcatc gtggtcttgg      3780
     aattgctggg aaccaaactt cctttcccat cagataaaca tggaagcccg acaagacagc      3840
     ttacctgctg cttgctgatc tacaatccca tagtctgtct cgcacggctc acccaacccc      3900
     aaatggaaag agatattctg tctctaacag gtcatgttga cggcggcttc aggccgtatg      3960
     caccatcact tctgaacctt gttggctttt ccattagcaa ctgcattggt tctaaaaatc      4020
     atccaaccca acgctgcatc tataaaattt atgcgaccag gatgtctcct cggagcagct      4080
     accttccaac caatcaaaca gatcgtgctg accagggagt gtctcagaag gattgcccgg      4140
     cttagctggt gcatatgtac ctaaaaaata gctgcgagct aaggaggttc cccagaattg      4200
     cgccatcgat cttatcacta cgtgatgcgg ctgtcgaggg aaaccattgg aagattaatt      4260
     tgatgtggtt tgatgcatgc cgacggagta tagacatcga acgattcggt gagcagcacg      4320
     tccttcggtc cgaccgtgtc caaaatgaag agccactttt gtagattaat ctctcattac      4380
     tctgactaaa cagcgggatc ctcttccgca atagttgcct tgtcccttgg ctgcgcggag      4440
     atacctctcc aactagtcta ctacacccct gcagctgcgg catctccgtg ctatggacaa      4500
     ttccatcgaa cgatgagccc aaccattcac attcctacct tcgtgtgccg atacctccat      4560
     ttcctcgcag acctatcagc gcaaggacaa atcagacaga acgccgctgc aaatcctacc      4620
     tcctaaataa cttaacatat gcgacgttct cgtggccgaa cttgatcaac aaaaagtccg      4680
     gtctgctgac aagaattcac agcacatgcg aacattagag cctcctccat ctagcggaaa      4740
     tgtgctcatt atacatgaag ttgatcgagt cgcctcataa gaacaaccat agaaggagct      4800
     aagtgagaca tacggttctg gcacagaccc agactaactg ccaacaacaa tgatctgcaa      4860
     accttgatcc tatccatcga agtcatccat ctaaagttca ataactgtct tgcgtgacag      4920
     ccgtcaactt tagttcaacc atgtagccat ctcccacata ccccgctacc atgggttcga      4980
     tagcttaacg tgcttaactg tccgtgtgac tatattgcat tcatctgaat cagttctaat      5040
     attctcctct gatgtttggc gtctcactgc ggagaaggtc acgagataca actgacctgc      5100
     aagtgctttg ttgtctgggt ccttgcagag cacatgaccg agcttgggtg tacccctcca      5160
     atggagcgta atactacgtt tgagttaatc tggcatctac aagtcatcta accagcaacc      5220
     cgctgatata cgatactaac cggcatcatc tacgtaaatc ttcttgggtc caacttttta      5280
     tcatctgctc aacaataacc atgacagatg aaatggactg cgcagcttac acttttctcg      5340
     actgcatcct gcacttgaag gattctgcag ggttacagtg cagataggtt actaccatgc      5400
     tgtgagaggg tctagcaaca tcagctgccg tatgatgcag cccgattctg aatttctgac      5460
     tcctggtata gcactacagc atcctattca ggtagcgcat ggggagcggg ggaggaagac      5520
     ctcgcttaga cagatatact ttgaattgaa gttcacggga tcaaatattg aggacagctg      5580
     aatcttatgc atagagtatt catcattaaa gcaagcataa cgcatgttgt agtgctctat      5640
     gatgccatga cgagggtgaa catcgaagca ttaggaacga tggtagagta tgtgcccatg      5700
     agatagaata catacccacc actgctccat cttgtccagg aatttcaccg tatagctagt      5760
     tcctcgctgt actaattact tctcttatat tgatgttgaa agtaacggtt gaaagaaaag      5820
     gcactgcata gacgctagca aaaccgaagc attccaataa ctcgttgacg gctggcaggt      5880
     atatacattc ctcacgacga gtatattatc tattcgcaaa aaaccaaacc ttttactcta      5940
     ttttccctgt tcactcatct tcacccttcc tcttccgaag atgccccaat ccatatagcg      6000
     agtcgttcag ttccttgcgt tgcttctcct ctgtggttgc tggaacttct tccgtgccgg      6060
     tggagttgat cttgtcggtc acggatgccg cggtcggctc ccattccaag ctatcagtgc      6120
     ctgacttgat gtggaatgct tcaattaggg tggaggggga ggaggggctg gttctccatt      6180
     cttgagttga gtccggctgg cggatagagt cgacggagac aaggatagtg ttgtctttct      6240
     cgacgggggt aagatcgagg acgttgccgg aaagttggat ggaggcttgc gttttcaagc      6300
     tgccgtcaga ttccagcgtg aagcattgca gacgggagga tctactccgg ttagaacatg      6360
     tacttgggta atgaataaat gggaggcgta aagaagactc acccgtgaag cgcgacgagg      6420
     atgatacgca agttccccag cgatgtcgcc cagatacctt gcactgcaac ctccgtagat      6480
     tctgatgcct cgtctaccaa agaaaccttc tggaggattc ggccttcagc ccatttccaa      6540
     acgagcaggt agttgtcacc tccaccggat acgagatact ggggtgccca ctggggcacg      6600
     caaagcttgc tgatgaatgc tgtgtggccc aagcagtagt tttcaatgac gtgggcctgg      6660
     ggaggaccac gggagacacg gatatgttca tctcggtccg cagtcaggat gtagctgcgc      6720
     tttttgtttt catccaccgg aagggagaca taagccatat ccgtaagcag cgacacatgg      6780
     ccaagcaaga ttttgtgttc aaaagtcggg ccagaggact tctcatccct ctttccttca      6840
     ctagctagac gcaattgttg ttccaaagct cttcggttgc ccttcgtgtg cacggtcagg      6900
     tttgttgccg ccgggtggct gagttttgcg ctcctgaggg attttgtgat cgcaggaagc      6960
     ttgtcacttg gaatcagtgg caatgagtag acgtctccga atttgtcacc acacaggata      7020
     gtgtcgtcgt catcagtgag ggtaatggcg gagggtcgct tgggcataac tctgtataaa      7080
     gcatgagttt ctgaatggtg tatcggagta aatgaactgc ggtttcactc acctctggct      7140
     caattgaaca aaggaaccat cttcctgaag ctggaataca cgcacgcact tatcttcggc      7200
     ggtaagcgca attatgtgct ctccgctcgc agtgccagtt actatgggga tgtttgacca      7260
     agcaggcttc tcaattgttg gggaatctga tgaagaaacc ttccgcttct tctctggggg      7320
     tccctgctcg ggagcggact ctgcgtcaac aggcttggtt tcactcgaag cgacatcttc      7380
     tggccaaacc gccagccgct ggccagtttc tgcggagtag gagtagagct tggagcccgc      7440
     tgaccctatc agcaggttcg cagttgacct ctgcaccaag cggaggcatt gcaagggatg      7500
     ttgaaagtgc gcagacatct tggaagaatt cactgatagt gtaactcaag gatatataga      7560
     agcacgtagc aaggcctctt ctccgccgtc gcagtagatc gccgtaaaaa gtcgatgtcc      7620
     cgccgcaatc aaggccgcat ctccgcgcgc ctgaccgcct tcctgactga gccggaggaa      7680
     agtgggccac acgtgactgg aaaacaagcg aggccacaac taagaatttc ctaaaatcga      7740
     cgcgaccttc cgtacttttc gaacttcatc gtcacgattc agatcggaca accacgaaag      7800
     tcgaaacatt tcacttgccc ttaaacatcc tatcttcagc gaattaagga gacatggggg      7860
     gcaagtctgc taccaaggcc gcttacttcg agaagctcaa ggcccttctc gatgagtaca      7920
     agacggtctt cattgtcggt gtcgacaatg tcagctctca gcagatgcac gagattcgtc      7980
     tgagtctccg tggcgagggt gtcgtcctga tgggtaagaa caccatggta tgatgatcct      8040
     ctgaaaccac cggtgcccgt tccgcatgct gatgagttgt ccaggttcgc cgtgccatca      8100
     agggcttcgt caacgacaac cccgagtacg agcgtctgct ccccttcgtt aagggtaagt      8160
     gaagttgctt ccagagtctg cggcgatgtc aattggctaa catttgcctt ccgcacaggt      8220
     aacgttggtt tcatcttcac caacggtgac ctcaaggcca ccaaggagaa gatcctggcc      8280
     aaccgtgtcg ctgctcccgc tcgtgccggt gccatcgctc ctggcgatgt ctgggtcccc      8340
     gccggtaaca ccggtatgga acccggtaag acctctttct tccaggctct tggtgtcccc      8400
     accaagattg ctcgtggtac cattgaaatt accaccgacc tcaagctcgt tgaggctgga      8460
     agcaaggtcg gtccctccga ggccaccctg ctcaacatgc tgaacatctc tcccttcacc      8520
     tatggtatga ccatccagca ggtctacgac cagggtcagt gcttcagctc tgctgtcctg      8580
     gacattgagg agtctcagct cctcgaggcc ttctccagcg ccattaacac catcaccacc      8640
     atctccctgg ctgtcagcta ccccactatc cccgctgtca tgcactccct cgtcaacagc      8700
     tacaagaagg ttcttgccgt tgctgttgag accgagtaca gctggcccga gattgaggag      8760
     ctcaaggacc gtattgccaa ccctgacgct tacgcctccg ctgctcctgc cgctgccgct      8820
     gcccctgctg ccggtggtgc tcccgccgct gaggctccca aggaggaaga ggaggagtcc      8880
     gatgaggaca tgggcttcgg cctcttcgac taaacgtctc gtgtcaatgc tgcacgggat      8940
     acgactgcca tgtattagat acttttcttg ccggtcttga cgattgggta aatgaaaatg      9000
     attgtcatgg tcatgaaaca atgatcttct ttcatctaga tagggacgta gtcgcgttcc      9060
     ctgatctgat gaactgaaaa aggtgagctt caatcatttg gttttccttg cttcgcatac      9120
     atgcccactc cccggtgata tgatgataca tttttaaccc agagctactt gctttgacga      9180
     acaaaaacag caacaacaaa cactctaatt ttttgctgac accattccat tcaacttgcc      9240
     atttgtcacg cattactttc aatggtctga tagctaacag ctttcaggtt cacagattca      9300
     atgtagcccc ggacgtaagg ccgtcgcgct gttcattacc tcagaggctt gtcctggggt      9360
     ttgtgttcaa gtagcgacta gaagagcgta gtacttgagg ctgttgtttg ttgcgaagga      9420
     tttgtggggc attgtattgg tcgtcgctgt cgggacgcga gggaggaata ttctcggtac      9480
     ttaatagcac atacatgtca ataaaatcaa catcgcattg cctcatagtt attctcgagc      9540
     tgcgtaaatt atgccatctt aatcgaagta gagtaagcag atgttccaga cttgcgaacg      9600
     gcttgaagct tacctgagcc acggacgacc agtcgagttc cggcccgagg ccgcgaacgg      9660
     tggcaggact tgcatgtcga aggcccctcc tccgcaaggt cccctccatc actcacacat      9720
     cccacatcaa aatgcagcat caattcgagc cattgaagaa cgacctcttg ctgagggctg      9780
     ctaggggtaa ttctgatttt aaaccattat attcaaagag atgggactga tatcattgca      9840
     ggcgagaaag tccagcgtcc tccgatatgg gttatgcggc aaggtacgcc tctctctaca      9900
     aactactctc ttcgcactct tacgagtccc ggatccaagt atgtctctct tataactgac      9960
     cacattgtgc ttcttatata gctggccgtt atctccccga ataccatgaa gccaaagccg     10020
     gccgcgactt tttcgaatgc tgccgcgacc ccgaagtcgc atcgacgttg acgatccagc     10080
     ccatcgaccg ctacgccgga ctcatcgatg ctgcgatcat cttctccgat attctggtca     10140
     ttccccaggc catgggaatg caggttgaga tggtcgacaa gaagggaccc cacttccccg     10200
     agccgctcca gtcgcccgat gatggacagt acgagaaagt gatgcagaag gatgtggatg     10260
     tcaagtcgga gctcgactac gtctacaagg ccattaccct cacccgccac aagctgcagg     10320
     gtcgtgtgcc gttgatcggc ttttgcggtg ccccgtggac tctgctgtgc tacatggtag     10380
     agggaggcgg cacgaaactg ttcgtccagt cgaagaagtg gatctacaag taccccaagg     10440
     agtcgcaggc tctcctgcag aagatcgccg agatctgtgt tgaatacctg gcgcttcagg     10500
     ttgctgctgg tgctcagctg gtacaggtct tcgattcctg ggcgggtgag ctgtctccgg     10560
     ccgctttcaa gtcattctct cttccctacc tgcgtcacat ttcggcgaat ctgccgaaga     10620
     agttgaagga gatgggtctg gagcctgttc cgatgacagt cttcgcgaag ggtgcgtggt     10680
     ttggtcttga ggatctctgc gagtcgggct acaatgttgt tggcttggac tggctgcacg     10740
     accccgctga ggctaggcgg attgccaatg gtcgtgtgac gatccagggt aatgctgacc     10800
     ctggtgttct ctatggagga cgcgaggcta tcacggaggc tgtggagact atggttcggg     10860
     gattcgagaa gggcaagcaa ggctggattg ccaacttggg tcacggtgag cactgccaca     10920
     gctgggttat tcaataaatg ctaatgtatc acaggtgtga ctcctttcgt caacccggat     10980
     gatctcaagt tcttcttcga agagatccac cgtctgacgg tctaaattgg gtgctcaatg     11040
     cgaccagaac tagctttcaa ttctttatta tgtacatgag agcctagcca gcaatatagt     11100
     tgacaccttc acgaattcaa aagctcagac ggaaatgtcc tcattcctgc aaagacatcg     11160
     tacagtcagc gtacattcca acaaaagact agaccagtcc agtgagatgc atgggaaacc     11220
     taccaaagct ccggcttctc cttcatgaac ttctccatca gctgcttaca ctctgcatta     11280
     tccaaaacca caacctcctt cccacggctc ttaagatagt cctcgccacc catgaagctc     11340
     ttgttctcgc ccacaacaac gcgcttaacc ttgtagagga tgcaggcacc ggtgcacatg     11400
     tcgcatggcg acagggtcgt gtacatagta gcgccttcgt aggccgaagc gggcagacga     11460
     ccggagttct cgagcgcgga catctcagcc tatgacggta gagattagaa ttagaacccc     11520
     agacgaccct cagaaggcaa gggatgggat caacgaacat gcaacacggg actacccttc     11580
     tggacgcgca tattgtggcc gcggcctaga atcttgccat ccttggagac caaacaagct     11640
     ccaatgggca caccaccctc agcagcgcct tgcttggctt cttccacagc agcgatgaat     11700
     ccgggatcgg tctccatgat ggtatgtgct tgttgtatgc tgtattgaga tatgaaatat     11760
     agagcgattg gaggggtaat tgggagagag atagaaagat ggggtagcat caagacggag     11820
     caaactctgt gtggttaact gccggactga cccgcatcgg gctggacgtg cggagctcca     11880
     tgataacaag atagctgctg tcattgagac tgatagagga cgttgttaca ttcgtattga     11940
     atagtatttt catggataat gtgtgcatgt gatagacttt cttgggttat ggtatgcata     12000
     aagtgcttct ttggtgtgct tggggatcga catgcataag cgtaagaaag atgcttaata     12060
     tttcatgcct tgtatacaac tataactgaa tacaaattga gctgattgta tatgagacat     12120
     ccgatctaga tgcatagagc ccgatggtaa cgtccttatc acttgtaacc attaattcac     12180
     agtttcacaa tttacaagat caaactggca gtggctgata aactcggggt tcatctcgcg     12240
     cagaccccat gccacgcact atttactagt atatcttctt atcgcagaga ttgttctctg     12300
     aacctctgat ccacgatcat ggcaagaacc acagaagcca atttctgtct ggtactccgg     12360
     aattgaacca ttaattgcct ctgcagcagc agaagaacag tagagtacac caggcatgag     12420
     ccagttgaac cgaagccagc cggcaattgg ggatcgcgac gaatctccag gtggggaatc     12480
     ccgacaggct tttttcttcc cctccttccg catcgagcta atcgcctctc cttatcgata     12540
     agccggcaat caaccaccgc ccgccacaat tccaagtgcc tgaggcaaat ggcgctgtgt     12600
     gccaggaaga aaagaatctg acttgggaga caaaggcaga tccgggcggc tacatcaaac     12660
     tttaatttta cagtttcctt attttctttt tctttttttg tgcttggagt ttccgggtgt     12720
     aatatactgg gtaggtattt tatacatgta agatgatgag tagtgatggt ggatggaggg     12780
     atgctacaca atacaccgca gtaagtagta gtacttagta gtagtagtat gaagacgagg     12840
     atccccgtga atggtgtatg attggaccgt aatacccagg tagaccttgc cgcatcctac     12900
     cgaggcatga aagaactagc ttacttagga ccacccctcc ctactgtagt atcgaacaag     12960
     atagaaaagt cccggtgata catttggtca gacatccaga aatgggatgc aaccaacgct     13020
     ctccgtggtc acgaaccggt aattaccagg gcgattgtca gcgatggaaa gggtgcgaaa     13080
     gcggtggaag gacacggaat cgcatcgaag cagtcggaag ccacgctcgg gccatcaagg     13140
     ctgcgggtga cggggcttgt cgaagcaaag agaacaactc cattcagcct gagacgttgt     13200
     catcgtggac atgccaattt gttcaaaagc atacgacgat ctctcctttc atgttaagat     13260
     ctgatctttt cagaaccact atccaccttt ttctatataa ttccagttcc agccagttga     13320
     agcgcggtcg ctcatcttct ccagcatttc tatactcccg gagtttcgcc ccatcgtatc     13380
     tccggtattt gatacgccca tcttgaaact cttggcgagt cttcactgcg ctcgtgcggc     13440
     aaatcaaagg tcgattggtg cctggtcctg gtaatcagat tacacatacg ataccctctc     13500
     acttgtctca gccgccgccc tgtcgccgct ttctctcttc tctctctcgc tctcctggct     13560
     ttgattatca cccggacgga ccctctctct ctccaactct tccttcttcc ttccacctct     13620
     tacttgtccc ccctcacgcc ttcgagactc ctctcccctc gtctcctcaa actcctccct     13680
     ctttttcaag gatttctcta cactccttgg tttcgagccc tctttgtttc gcctgttcca     13740
     taccccggtg taaggttttc taggatcgga ttgccccgtc tcgtccctcc gaaaagttct     13800
     tgtttcttct atattttccc tcggcttctc cccgtcgccc aactttcgcc tttcgatttt     13860
     tttctctctt ctagacacag atcacaatgg tcaaggaaac taagttctac gacatcctgg     13920
     gggtatgttc tgggttttcg ccaagtttgg ctggttttgc acgtcacaga aactaacggt     13980
     gaggcggtta ggttcccccg acggcctctg aggcccaact caagactgcc tacaagaagg     14040
     gtgccctgaa gtaccaccct ggtaagtcaa cttgaatcgc gaaagcggtg cttttcacga     14100
     aagatctagg ggtctttact aacgcgatat ctttacagac aagaacacaa acaaccccga     14160
     agccgctgag aagttcaagg aattgtctgc cgcttacgag accctctccg atccccagaa     14220
     gcgtagcctc tacgaccagc tcggtgagga gggtcttgag catggcggtg ctggcggtgg     14280
     catgggcgcc gaggacctct ttgctcagtt cttcggcggc ggcggtggtt tcggtggcat     14340
     gttcggtggt ggcatgcgtg accagggccc caagaaggct cgtaccatcc accacgttca     14400
     caaggtcaac ctcgaggata tctaccgcgg taaggtctcg aagctggctc tgcagaagtc     14460
     agtcatttgc ccgggttgtg atggtcgcgg tggtaaggag ggtgctgtca agtcgtgtac     14520
     cggctgcaat ggttccggta tgaagaccat gatgcgccag atgggtccca tgatccagcg     14580
     cttccagacg gtttgccccg actgcaatgg tgagggcgag atcatccgtg agaaggaccg     14640
     ctgcaagcgc tgtaacggca agaagaccac cgtggagcgc aaggttctcc acgtccacgt     14700
     tgaccgtggt gtgaagaacg gccacaagat tgaattccgc ggcgagggtg accagatgcc     14760
     tggtgttctg cccggcgacg ttgttttcga gattgagcag aagccccacc cccgcttcca     14820
     gcgcaaggac gacgacctct tctaccaggc cgagatcgac ctgctcactg ctcttggcgg     14880
     tggtaccatc aacattgagc accttgatga ccggtggttg accgtgaccg tcgctccggg     14940
     cgaggtcatc actcctggta tgtgcttccc ccttccagcc tcgacttcag cgcatcagtc     15000
     taacgttatc tctgcaggtg ctatcaaggt tatcaagggt cagggtatgc cttcctaccg     15060
     ccaccacgac ttcggcaacc tctacatcca attcgatgtc aagttccccg agaaggatca     15120
     gctcaagaac ctcgagttgc tcgagcaggt cctgcctcct cgtatggagc agtcccagcc     15180
     cccgcaggac gccatgatcg aggactttga gctggaggac attgatggca gcgagtcgtc     15240
     tcaggctcgc gcacacggtg ccgccagcgc catggacgag gatgacgagg atgttcctcc     15300
     tggcgctgag cgtgtgcagt gcgcatcgca gtaaacgggg ggtttagatg aggagtgatg     15360
     atgttgtgct ggggcttgat gaaattcgct tatgatacca tgtgaggggt ttcggccccg     15420
     gtactgctcg gttctgttat gttcgcgcga tgacttattt ctgcgatggc gtttgcacta     15480
     agattcggga gatgaaatgg agattccttt ttcgttggat gcgttttcca ccatcatcat     15540
     cctcatcacg cagtggttac ccatactata atgttctctt ttcctttttc tgtcattggg     15600
     aatgggggct tctgggactt gatgagtgat gagacgatgt tatatgagtc agcttctttt     15660
     tccctttctt gactccggga aaacatgtcg gagggttgag cgtttcttag tttatagact     15720
     acacagcacg gcttgggtat atcatgcttc tgggttcaga cctccgtgta gcgatataga     15780
     gtaatcttga gaccaatggc tatacacccc ctatgccaac atctaactac ctcatggtat     15840
     ccgtaaataa attgcgatat tcaaactacc tccctcgctt cgccatgcaa tcgttcatac     15900
     acgacaccaa ggcaaaaatg aaaaaatgaa aacaaaacca aaaataaaaa atacctccac     15960
     acacaacact caaaatctac caaacaatac acaccagcat agtattttat ttacctgccc     16020
     catctcggcc cgcataacca ccacccccac tacccctcca ccacgaaaat tcttcaaatc     16080
     aaaagaagaa aaaagaactg tcctcaggga ggttcgaact cccggccttg ggatatccag     16140
     gaaatgtatg tttcctagtc atattcaatg attgatatga gacccacgtg ataaccaact     16200
     acaccatgaa gacagaggtt atgtcagccg gtcgaagaat tcggtatatg tcctcagatc     16260
     gtgggtaggg aggagttaca ttggacgggt agttactact taacttgggt tgttttgggt     16320
     agggataact tacgatttag ctggcttgct agatacttag ttaataaggg tataggaagg     16380
     agccgaaagc ggctggatat gagtacatta ctatgtatat agtggtgtat tgataggatt     16440
     gtgggcgtta ttcgtactag ggttcattat caagtttgag ttgatgctag aagtaagact     16500
     cggggttttg gtaattttct atgaaatgag tggtggtaat gggtagaagt aaccagaaaa     16560
     tgggctttcg gcctcaaacg gtggtcttga tgtatgatat tagaatagag ctacgaagcg     16620
     aatgggtaat atagatacaa aacgatggtc aaatacacat gatatatgct attcgctaag     16680
     aagggtgtaa aatatacata aaaagtagta tcaattgcca tcatcaccac tccgtccaaa     16740
     cctgcctcca aacccaccga gatcacgacg gaagaatttc ccaatattct tcagattctc     16800
     gttcaggttc ccagcggcgg tcgtgctttc cccgccttgg ggttgtgcct gtcctaacgg     16860
     cccaggggta gaggccgggc tggtcaaggc gccggatatg gcgctgccac ctggggtcag     16920
     gttggtcgtg ttggctgagc tcatcggcgt cccgaatcga tctacaccgt ctttggcggc     16980
     ggagatgatg gcggacccaa gcatggtagg gtcgaagcgg gtggaggcgc caatggatgc     17040
     tgcggccgtg ccgaggccga gaccctgcga gacggtgccg gatgaaggtg ttgcggaggc     17100
     ctgcatggcg gtcaggatag ggttgctctg ctggaggttt gctgcatagc gatcagatgc     17160
     gcggtggatt tggaaaagtt ctatgaggtg gttctggtcc tggcgactgc gaatgccctt     17220
     aaggtcgagg attttgcgga aattggcgtt gttttggtct gcgatgtgga ccagataggc     17280
     ctggacaagg gcctcgggag gagacggttg aacttggagg gtcttgagga gggcttcaat     17340
     cttcgcaaag ctggcgttga cgcgctttac gaaacccgct ggcgcggggc tggggaggag     17400
     cgacgagagg ccagtcttga gggtgtaggc atccagaagc atctaataac atctgttagt     17460
     ttcaatgaat gtcacgatgt cagctatgac agtgagccca cctgctctgc accggtctcc     17520
     gcaaccggct tgcattggaa gatagtcgca atgaatacgt tcgatatcag ctccacaaca     17580
     tggtctgcga atgcacgggc atactgctgc ttatgcagca gctgcaacag ttcagagcat     17640
     cttgtctgtg tcttggacat cagctcgccg acataggagc tttgatcgct tacgccctcc     17700
     agccggttcc agggtgtgtt gcgcatttcc cgccagcagg gctccaggtc aatctcgacc     17760
     ttacgaacca gccctcgaac agctgcagat gcaatgccca tgaatgagtc cgcttgactt     17820
     tgtaggtcca ccgactgttt gagatttttg tccagcctac ccttgatctt ttcctctaac     17880
     tggttgcagg tcgtatagca atagtccgcg gtgttgagca ctaggataag gtcctcggta     17940
     cctggcacct ttgagggagt gtgacctgta ggccgttcac taatgtaata aagcaggacc     18000
     tgtgcatact gatcgagata cttcgcgaat accttagcca gctccgcaag gctggcgcca     18060
     gtagatagct tcgcgcattg ctgcaacgag tgccgataga acgtgaaaag atcggtggaa     18120
     gaggatataa cgatgtgcga gtcgaattct tcatccggtg gcttcgcggg ttgttgccgg     18180
     tatttaggga taagcgcagc cagctgcttg tcctgggctt ctacccagac gctcaggtag     18240
     ggctcgaacg cctctgagat ggcttgaccg aagactggtg cctcactcga ggcgaacgta     18300
     tccgttgaag gccgggatgg actgacaaac cgccgctcga gagaatgctc aaagtccaat     18360
     gtttcttgta gacaagacag tagcagatta acatcgatgg tctggccatt gcgcaccgat     18420
     cgagagagaa tgcccttgaa gtcctctcgc gtgccctcgc agaaaatgtt cgccagaatc     18480
     tcgttgaccc tccaggatgc gggaaagatg ggcgcatatt cctcatcgta gttcttcaag     18540
     atccgcctaa accaggcata ccgccgcgag atgttgtcca gtgaaccggc ctcttcgttg     18600
     ttcctgaaaa cctgacgata ttcacgtagc tggaagttgc aataccaagt caccaacctg     18660
     gacttcgcgt gatcacctag cgcatccatg accaagcagc cctccgagag cacgtgcctc     18720
     ttttggccaa cttccccttt cgcgaacgcc aactcgaagt cctcgcagac ctgctccaga     18780
     agctcccgtt gtatatccgc aacgtttcga ctaagcagcg caatctgatc gatcgagcga     18840
     tacgacttga aatgcgccat cagctgtatg accgcctgta gcagctgagc acagtcgcgg     18900
     tactgccgcg tccggcccag agaacgtaat tggtcgtagg ctgtcgttag catctgcagt     18960
     ctcttcagga ccgtcatcga cagcgtgagg ttcttcttcg cattatccag ctgtttgata     19020
     tccgccgtca tctccgtaat ggccagctcc gtcctggacg cgcggtcgcg cacatcgtca     19080
     atcttcttga acagttcggt caagtcggcc ttggcggcct ggatgcgctc gacgctctcc     19140
     gcattggaag tgacctggtc ctctaccagt gcgccgatat cgttgtcgag ctcgtcctca     19200
     tattcgcgga gggactggga cacctgggac accgacgaca atgtggaggg gtgggaaaag     19260
     attgcgttca aatggtcgat cggatcatag tccgctgtga cattgggtct attagcaagc     19320
     tccccgatgg gataggttgt caatggcagc cctcacctgc atccaaagga tcgaggggga     19380
     cctctccgtt ggagggcatt tggccggggg tggtggtggt agtagtggcg gacattccat     19440
     tagctcctga gcgtcaacgc cagacacatg ctgcaatgcc agctaagggg catccgccaa     19500
     ttcaacatgt aaacatagac ccaagagcaa gggctgccaa aggagcgaaa agaacctgaa     19560
     aatgacaagc tgtaaggacc gcggggaggt tgttgacgcc ggagccgcag gtcgggaagt     19620
     tggcgacaac tcagtccggc tccgtcaatc agtcagtcac gggcagctct tagtcttagc     19680
     gctttgcccg cgccgccggg cctcgtcatc gcctcttgtt tgttcgtcgg aaccaggaca     19740
     ggcgcaagat aatcctacga ttttataaaa gccaagtcta caagctactc agacagatag     19800
     atggataggt caagtggtat caatttggag gccattcctc cccctagaat cgaccctagg     19860
     tttctgttat gattaaacca ccccttgtac tgcaggtctc gtctatatgg acatgaaaat     19920
     ggtcgtagtc ttttagtgta caacgaaaga aaattaaagc aattgtaacg agctccgaag     19980
     ccattcgccc aagccatgca tcagcaaatc acaaataaag agacagttga ctccgatcaa     20040
     acaccaccag gaacctcccg acgagagtcg gggatgcgaa gaccagacaa gtctgggaga     20100
     gagtcgctcg agaagttgtt ccccgtccat ttggtatatc ttcttatttt tatttttatt     20160
     tttcttttgt tcttttcgta tttggccctg tcctccttgg tcaaactaca ctgctgcggg     20220
     tagaaaagcc tccggaggca atgttccctg cgcctgcaaa agcttgttag cgcatgatcg     20280
     tagacggaga atacacttcg aacttacctt aagttcctca aagttcttca gtgcagcctc     20340
     catattccag ccgtttccag acaaagccat ctcagagtac tggagggtca ttcgagtatt     20400
     agagctcatc tgaagtacta gctgctcttg ctggacttgt gcgtctgctt ttccaggcgc     20460
     tggcatgccg tagccttcgg gagcacccgg aatggctact ggtagtgccg caggggctgc     20520
     aggggctgcg ggtgctggtg ctggtgcagc tggaggtgca gcttggggta cggctggtgg     20580
     aacctcagga atccatgcct cgtgtccacc ataggctcgc aagcagagaa tatcactgac     20640
     gaccctgatt ccgcccatac caccaccggg cccgatgatg aatgtcctat cgaaactgcg     20700
     agtttcaacc ttggccccat taatctcgtc gaacttcccg tgcaccatga tgagaagtcc     20760
     accaacaccc gtggagctct gcccggaaat atcaggaaga cccgggatag ggtagcactc     20820
     gataagccat tcttccgggc gcgtcgcaat gtcaggatgt ctagtcgcgg gaagactagt     20880
     ccacaactcg cggattttct ccgcaccggt gtatacccta gacatgcgtg caggaagatg     20940
     gctgatcttg agaaggtttc tgcttttctt gatatacgca tcccagggcg ctgtttctgt     21000
     ttgttgggcc ctgggagccg atgtattcac attgagagtg aacgtcgtgt ggttgtcgta     21060
     gacactgttg agaatgccgc ttcggtcgtt gtcgtagccc gcgaagaaag ccctaacaaa     21120
     gttctctgcg atctgagagt cgtcctggaa gtgcggtggt tgcacaggaa tcggcgtctt     21180
     cttctgcgcc gctatttctt ctgcggtacg gacttcgaca ttgttcagga accggagctt     21240
     gggataccac ttcaacatgg tatccttgaa agtagggtcg gcgctgaacg gagtgtttga     21300
     gagatcgaga aactcgagat tgcggaattt ccagcgccat ccaatcaagg attgcgcatc     21360
     tttgaattca ttgttggaaa gatccagatt tttcaggtct ggaattgtcg atgctagtgc     21420
     cgtcacagct gtgatgttgg caagctgatt atgagcgaga ctgacactct ccactgcctc     21480
     tcgacgcgca gtggcattgt cgaaattcag ctcccaaacc ttcatcagtg ccgggaagaa     21540
     tttcgactcg gtggatgtgc tgccaaagat tcccatagcc aagagatccg gatcggttcc     21600
     caatttcgaa agatcgagta attttgtctg ctgggtgtag cgcttgccga gaattgtcgt     21660
     cattttcgcc ttggtctcgg cagcagagga tgtgccgcca ttttgtgcca tagcagacag     21720
     cataggctgg tccagcaacc caccagtaga cgggtcatac ttttcggtgg taagaggggc     21780
     acctgcaaaa ctaaacccat tgagctgaag catcctttcc aacaactctg gccgaataga     21840
     gacgataaga gcgtcgcctt caacccgcga ctaatgaacg ttagtaaggc ataagggacc     21900
     ttgcgagccg cgccattcat ccaaaagaac aaacgccagg agagactaag aaagtgccga     21960
     tcgtcgttct gaacgcacca cccctgcaaa cgagagcaca tcggagagga cgaagctgat     22020
     aattgatgtc ggtgaccgcc agttctggtg ttgcacatac ctttgtaatc cttgcgcgtg     22080
     tgccagcttt cgagtcgggt gggctgagtt ttttctcgag gaaggcgatg agggattcga     22140
     gaccgccgtc gcggttagat gctgccttgc tttgtttcca gccacgaaca ataacctgtt     22200
     ccagaccact tccccgtcct ccttgtcgga tgttcgcttg agtgtctgag ttgctggaga     22260
     tggccttctg gatcgcatcc atggctttgt tcgctgcctg cgaccggcca gaatcgccac     22320
     gaaccttctt tccacggttt cgtgcagagc cagcatccat catcagatca ccttctcggt     22380
     cgacccgggt cgtagcaccc cgcttgcgga tgcccccacg atccgaaccc cccgagcgac     22440
     cgcgagatcc ttttccgccc ttcatgctga tagaggcgag attttttttc gtagtaaggt     22500
     ttcgtaagaa gacagagggc gaaggagaga atggtagaag ttgagtgttg tggaggcgaa     22560
     acgagcgctg ctcgccttta gtagttcgag atcggatcaa taaaacatac aacgatcgat     22620
     tcgaagaggt ttcgtaggaa ggaataggaa gaaggagtgt aagcgagaga gatactcgat     22680
     gcgataatcg agaaatcgag aacggtccca gttaagcaac tgcgaacctc gatgtggagg     22740
     aggagtgtta tgagagggaa ggaagagaag caagaagatg gagtcagcgc agaaaaagtg     22800
     acgttgaacc accaaaagca gtgcccgcga agctgtgcat agtcacgtgg gcggccaagc     22860
     gcaggcccac cacgtgattg tgcaccaggc accgggcgat tggccaatca gaggctgtag     22920
     tctgtccttt ggcacgggcg gtaatacaca ataccgatgc accaaagtgg gcagagacaa     22980
     ttacgcggct agtcccgatc tggtagtggc atccatcgga ggagtggctg tttctccgct     23040
     tcattaacag gacagctgga gcttccatcg gcctgtttcc ccaaggactg tctgcttgtt     23100
     gatcgtccta agtcgtgcgc aaatcgcgac ttcccgtcct tgttcattct ctcaatccga     23160
     cttggtccgc gtatgtttgc cctcgtcttc attcttccct atccattgat ccttcctcga     23220
     actattcagc ttacatacgg ttctctccaa caggcttcat tcccgcgggc actagctggt     23280
     ctttagtcgg accaacgatc ctttgtctat atccccaaac actccttcgt attcatgtcg     23340
     atcaattaga gaaatgccgg cgaaatcgcg attcacaagg ctagatgcct ttgctaaaac     23400
     agtggaggat gcgcgcgtcc gtaccacatc cggaggtgtc atcaccatag cctcgttgct     23460
     ggtcatcctg tggcttgtgt ggggtgaatg ggcggattac aggcgggtgg ttgttatgcc     23520
     cgaattggtg gttgataaat caagaggtaa gaatggctta gcgattgctg gacggccagg     23580
     cacgactcga tggctaatga acccttcgta caggcgagaa gatggagatt cacctaaacg     23640
     tgaccttccc tcgtcttccc tgtgagctcc tgactctgga cgttatggat gtctctggcg     23700
     agcaacagac cggtgttgtc cacggtatca acaaggtgcg ccttacttct gccgcagaag     23760
     gaggccgcgt catcgacgtc aaggccctgg agctgtaagt tgcaatctca atccgctctt     23820
     gtcaatgcca attgcaccgc taacgctgaa tcccctagtc actccaagga tgagagtgcc     23880
     aagcacctcg accccgatta ctgtggtgaa tgttacggcg cgactgctcc cgccggtgca     23940
     agcaaacctg gatgctgcaa cacctgcgac gaagttcgtg aggcctacgc acagcagcaa     24000
     tgggcattcg gaaagggcga aaacgttgag cagtgtgagc ttgagggcta cgcggagcgc     24060
     atcgatgcgc aacgccgcga gggctgccgc cttgagggtg tcctccgtgt gaacaaggtg     24120
     gtcggcaact tccacattgc tccgggtcgc agtttcacca gcggaaacat gcacgtccat     24180
     gacctcgcga acttcttcga cgccgatcta cctgatgctg agaaacacac catgactcac     24240
     gagatccacc agctgcggtt cggacctcag cttcctgacg agctctctga tcgctggcaa     24300
     tggactgacc accaccacac caaccctctg gacggtacca agcaggagac aaacgagccc     24360
     ggatacaact acatgtactt cgtgaaggtg gtgtcgacct cttacctccc cctgggctgg     24420
     gatccgctgt tctcgtcctc catccactcc gcttacgacc aggcccctct tggctcccat     24480
     ggcattgcct acggtgcgga gggcagcatc gaaacccacc aatactctgt gacctcgcac     24540
     aagcgctcgc tgatgggcgg agacgcctcc gacgagggcc acaaggagcg tctgcacgct     24600
     gccaacggca ttccaggcgt cttcgtcaac tacgacatct cccccatgaa agtcatcaac     24660
     cgcgaggccc gtcccaagac cttcactggt ttcttgactg gggtgtgcgc catcatcggt     24720
     ggtaccctga ccgtcgcggc agccctagac cgtggtctct acgagggtgt cagtaggatg     24780
     aagaagctcc actcgaactg agcgtagagc aagcaaatac ccgaaaaaaa aatagtgaaa     24840
     cagaacaaat aaaaccacaa cccgctaaac acaaaagaaa atacaaagaa agaaaacaaa     24900
     cagacagaac ccatggagag cgttgtatgg agtacaggga aagaagacag acagacagac     24960
     aggggacgaa agggcaagaa aggacggatg aaagggagaa ctccggaagt tcaggcgtta     25020
     catttttcag tcacctacat tgattgcatt ttttgaccca ttttattttt ggtcggggga     25080
     aaactcattg atacaccttt tcatctacat cattggattt ttggtttact tggtgtttca     25140
     ataagccata gcacgtataa cagcacgcga gatctagcca ttgcatgggt actacctacc     25200
     tacagacagt gtattggttg atttaattga ttgataagtt gctactaagt atgctggtcc     25260
     ttggaaaacg ccactgcact aagtagtact acttagctct agctattgtt ggatttgatt     25320
     ggttctgatt aactactagt acgacttagt aaccattgtg ccctaagaac attgttattc     25380
     aagtcttgga aggaagatca aaggaactat attttacgtt cattggtcgg atcaaactct     25440
     tttaacctat ggtttctttt aatttatcat tggacatctg cttgagaaag aaagaaaaat     25500
     tcttaacttg agcatgagat atggccaccc aatgccagga gtgcaatggc actctttgga     25560
     aagcgataaa tacaacctaa ctatgccatg ctcgcaagag aaggaacgtt cccgaacata     25620
     ctccgtagac ccaatgaaaa tgatcgcttt cacccaacca agtccaagat atagagcagg     25680
     tagcctttca ggtgtggaaa cgtctaattc taatatgtag agaaagctca cggggctaat     25740
     gcaagtgaag taaagcaaag aagggattag atcatgaaat tacgccaaag agagtaaaat     25800
     gcgataggat agacaatagg agatgagatc agaaggaggg gctgaaagta accggctcag     25860
     taatgcaggg tgctggcatt gccagagtag ccgggatgtt ggccataagg cgggttttgc     25920
     tggtagattg gaggagtctg cgcctgctgt gatgcgaact gtccgtacca agactggcgt     25980
     cggggctcgt ctggccggta aggctggttg agggcatccc acgtgcggtt cgcagtgggc     26040
     atattgtaga gactataatg gctgccctga ttgtaggcag ctgcggaagc attggaagcc     26100
     atctgctgtt gttgccaatt ttgctggcgt tgcacaattg catgctgtac catttggttg     26160
     gacaggcctt ctcggatggt ctttttctcg cgctcacgag catcaatcgc tcccaccaga     26220
     cccatagggt ttaccggagt cggctgggct ttgttgacgt tggatatgtc gagtagaggt     26280
     gcaccggtca tacgagccac atgttcctgt tcacgagctg agaggtgtga cgacagttca     26340
     ttatagttca tgatgctgtt ggcgccgcgg gaacgtgggc gaggcggtgc atctcggctg     26400
     ccagacaagt gtgactgagg ccgagagtta ttcgtccagt ccccggaaac aggccgaggg     26460
     ggcggcggtg tagaggaaag ggttcggtta tgcgtggcga ttgggggact tggggctgat     26520
     cgttgttgca cgaattgctc cgctgtaagc ctgcctggag tggtgggacg gggtgcagtc     26580
     atacccggct gccacatcac gttgctactt ggagatcttg agtgctgtcg ctctgcctgg     26640
     taagagaact gcttttctgt tgcatttgag tcgctccttt ggtgcatgga tttcttcaaa     26700
     gtatcgcccg tattgggacg tccagttgta ggtagataag ttaaggtcgg cccgaagtcg     26760
     atgctgggga tttcggcact gagttccagt tttggttcat caacggtgta atgcgcatcg     26820
     ccgatgacca agtcttgtct cgggggaccc gatcccacgg ttttcatgac tcccattctg     26880
     ggcctagtga ctgacctaac cgagcgcttg ctgtagacag acccccgagt actggcataa     26940
     tctggagaat ttgcagacgc gtcatcatag atgctttcct catcctgatg gctctctata     27000
     tcaggcgaag tgagcgaaaa ttggcgagag ccgacccaat tcaggacctc ttcatcaaca     27060
     gtatgacgta ggtcatcgta gctaggctcc cctgcaacac ttgcggcatc ggattctcgg     27120
     atctgttgcg caggcagagg cttccgtttc acggccttgg ttgtatccaa acgaagactc     27180
     gatctcttcg gcaaagtgag cggtgggccg aagtcactcg aacgatcctc aggggttggt     27240
     gggccttgtt cctgaagggt aactctcttc tcgcttgtat ctgataagag cgatggcgca     27300
     ccctgttgat cagagccagt gttaggtgtt agcggactag gctggttgga ttccctgatc     27360
     gtttcatggc tgcctgaagg gaaagaagcg ccaagtagat tcatgcttcc agaggcagcg     27420
     agaagctgtg tcagggtagc gtcagacatc ctattatttg cttttctcaa atccggtgaa     27480
     ggctgaggtc gcattgcggg catttctccc ggtgcgtgtg tgaaggctgg cggctggatt     27540
     acgggagatg gaggagaggt tgaacggaag tgatgtccaa gcggctcatc gtcggggtca     27600
     agtcgctggt tcctgtcgct cccggtgctt ctatgatcgt ctaccccgct agtaccaggg     27660
     cgttcgctgc cacgtgccac aagttcctga gcggaggatg ctggggacac ttcggcggct     27720
     tgcgcttgtc tcctgatgga agcaaatccg gcagtgtccg aagaggccct gctatgatga     27780
     attggagaga tggaagcatc acggggggca ccaggcgcga cagcgtcgtt ggactggttg     27840
     gaatccagct ggttaactgg ggaagtgcag ttgcgttgat gcgtcatggt gcggccgttg     27900
     ggttgtctgt tcggcattgt agccctgaag cgtggcttac tcgcagagat actgctcgtc     27960
     ctgcttccag cagccgccat gcgacgcgct gtagcctcct tgagttgctg tctccattcc     28020
     gcctcgttcc aatcctgact tcctggtgtc tgcattagac tagagatgtc taaaatatca     28080
     agatagccat agcgcctttg attggggaag gcaaacataa tgctcttgat atggttggtg     28140
     gcggcaataa ggcgggtggg ccgcccataa aggttgaacg tgtcaaaagt agggacgaga     28200
     aaccggagca tcatttcaaa cccagaaacc gcaggatgga cttcgggcat gacaaagaca     28260
     aacccgtctg ttgtcgactc tgtttgtccg tggaccgtaa tctttccttc aatcttgacc     28320
     aaggtcgact gttcgatcaa cgccctcgac tgaggataga tggcgtaagc ggcgtaagca     28380
     tcagtgatgg tcgcaatagg cttcgctttc ttagtcttct tcgtatcata gaatttgatg     28440
     tcgccagtta tgagtcgggg cgctcgatcg tatgccgact tcttctttat tgatttctgc     28500
     gctttctgga attccttctc gttcggggga gtaatcacaa accagcaccg tctccagggc     28560
     gtgcctgccc caaacctcac gcgggcccaa tcctcgtgtt tgtaacggtg gcgatccaag     28620
     atggttctaa tactgttgag acctttacct ttgcccgcaa tgatcgaacc cgtatatgcc     28680
     tcatataagg atgtatgttc gaacaaggcc agtcgtatgg ctgcggtcca ctgggtcaga     28740
     gagtggaaag aattaaagtg cagaaggtat ctgttttggc cagcggaaca tatactcaag     28800
     atgttcttca gagactgtgc tccttggttt ctcgttggta gtgtttcaag ctagaccggc     28860
     gacagtcaat aatcaaaagc aagagccgca acatctgaga ttgcattatc tcaccatctt     28920
     tattgaagca tcagctaagt taatgaaagt agggcagacg tcttccgact cttctgcggc     28980
     gtccagcgct gcggcatccc ataaagaaag agcggttccg acaagctgcg catagcattc     29040
     aacccactgg cgatcagcac agggacgacc atctgcgata atctgtaatt aatatgacat     29100
     tggactataa caaaacccat gggatacgca cgaatgtcca aatcgttcaa cttgaggaaa     29160
     tagccttcat ggtatagctt gttggcatgg ctgttcagat atccgaagat tggttggagc     29220
     tccggagggg tatcctgcga aaactccagc aacggaggat tgtgagagaa cagcgtcgac     29280
     tccggccgcg atgttacccg tcgttcgaca tgtggagtcc cggttatcgg cgaagcatcg     29340
     agaggcgagg gggtatccga agaaggcgtg tctactcttc gcggaggatt gttcagtgtg     29400
     agagaggccg aggatgtccg gtgatgctgg ctgaggttgt ctttacggga cgatcccccg     29460
     aagaccgaca tgagagaaag cactggtagc gcaaggggtg tcaatcaccg tcatctgtag     29520
     ttcgtagggg aagtataaga ggatatgcta atgacctacc acgcgagcga cccatgatgg     29580
     ccaaacttgg ttatagccca aagagataac agaactgaag accggcttcc agctcactcg     29640
     gaaaaagtag gatttgtgtt atctgtgtta cacaacgaac atgcagtctg cgcggaaggg     29700
     ttggggccga atagtgctgc tacggaaata aatggggaga gaacgagagg cgaaagagta     29760
     ggcgaagaag aaagaagtgt gtactgagtc cagctcctcc gcacggagat agcgacgatg     29820
     tgtccggacc cgccaatact agatcaggaa gtttgattcc atcaagttcc cggtgggaat     29880
     tgggggaggc gcccaaacga aagacaggag cggaagggca aataagaccg cggcaatgct     29940
     ggaacaagtg ccaagatagc ggatgatggc gcaaagtcag ctttgcaagc gcctgactag     30000
     gccacttgat gtctcaggac tcgatggcgg agaaagcgga ggggaatgag tcggaaagcg     30060
     aaggaaagga gaggcagggg gagagatata gagcgagtga ggcgacagag agggaaacaa     30120
     aatagaaaaa aaaagggcaa gctggacaga aggaagcata gaggatcagt gaaaggaagc     30180
     acaagccgac gagcgttgga ggacgatcaa cttacttacc cagtctaaga cgtgggtctt     30240
     gaatgttgtg agtgtaacaa gtgttaccgg acttatagta gggtcggctg cttgttttct     30300
     tctttcctcc tttgagactg aaggagagtg gatctgggtg ttatttgttg ctattgtttg     30360
     tcaacattcc gaatggaggt gccacataaa acaccctcgt agtaattggg tataggaagt     30420
     cacggcgtga gagggaagac attccctttg aaagagccgg tcagatggtg aagacgaagc     30480
     cgcagaataa ctccatccgt catgctggat ggacctgcgg gtcaatactt gggtaagtat     30540
     ggttgtgtgt tatgtgttac ggtaccgcga agtggttctg gcccggcttg tctgcctggc     30600
     ggctggcgtc atcgcatgtg gctacaatcc gacttgaaac taatgtgcct cctttacact     30660
     aaagatggtc ccagacggac gggccagtct cgcatttcgt ttttattatt gcccttttct     30720
     tttcctttcc tctttttaaa ctccgatccc ctgcccctgc tgcttgaatc tcccttcccc     30780
     caagagtcat ctcagtgcga tcggcatgga tcatagaaaa ataactgcag gtcacctaac     30840
     aaagtacggg gtaatacccg ggatattagt tattgcctgg cttgctgcaa gagatgaatt     30900
     gacaataaat gggtcactag taggaccagc gaaccgaatc gctagtaatc aaaaggaaac     30960
     agtgctaata aaatgatatt ataatgataa taaaaataat caccataata ttcattagaa     31020
     aagaaataag aaatggacac ctatgtggta ttattgagtc agtatttact gtcattcccc     31080
     gtcagtcagc catccgagca acccatgggt ggcctggtgg attatcccag tttatcccac     31140
     taaaaaagca cgccccccgc gtaactgact ctggcactgc ctccaatcag ctcatgctgt     31200
     gaataaaaat aagaggccaa tccaatggtt gcatcccacc atctcgccaa atatagaaac     31260
     gtaggcctgc atgtcttaac tacgactgcc acttcccagc caattccacc ggcggtcctt     31320
     tgcttttgcc tctgctcatc aattcatgtt tctcgcccac gaggtgagga gaggagacaa     31380
     cgtacacgcc aagcacagcc taaccagtca tcgtatctgc tggtctctta tctagcagcc     31440
     agaaaaaact tagactgacc ctcgtaatgc gaaagtatta gtcctcgagc gagggtatat     31500
     catggtacga ttggatggat ggatggggag ggaaaggcgt cgtcgtgtcc cttgtccctt     31560
     gtggacggaa gaatgcaagg cgacagtcag aaagaggaat ggtccgggag tcaataatcc     31620
     actggcgcac tgccacaggc ccgccgtgcc acacggcatc agatgatctt ggcgggaagc     31680
     ttcactgaat acttctttag cagctcatcg atagttagtc cgctgtgctc cttgtttccc     31740
     aacttgattt tcacactata aataaccggg atgccataaa tgtccaaaat tgcctgcagt     31800
     gattggaatg gatctccaag tcgcagctca gaccaagcct ataaagataa gaatagttcc     31860
     ggaagcatat acccctgctg aggtacgagg ctaagattaa ggtgaacttg tttagtttga     31920
     atctaaaatc ataagcggct ggggttggat attgttagtc gtatgtcggt accctgctat     31980
     ccgagcaaag caattaatta gcaagggtcc ttcctctgct gcggacattg cagagtagcc     32040
     atccgcaatt ttagcctcgc ctaaagtggc tgcggcattt gctcttggaa gaccttagag     32100
     attgggttga gcaaagagca tcaactttat tcttgatgct gcaggttatg taaccttaac     32160
     gcaggcggta atcaggattt gccccgttga taagacgcct tattattgct cagcatcctc     32220
     tcccctcgac caaagccacc gataaaataa attgttagtt tactgtggct ggtcagcacc     32280
     acgagtgatc aaatcatatc cttttctaga agcacgtact tctactctga ggtgttcaac     32340
     agggtgtacg cactctgtag tgcaaacccc agcccgtgac ccaccagcca gggtgtttcc     32400
     cctcttagtc tgctcaagac tgcggagctc cccaaagatg atcgcaggct tgacgcgcaa     32460
     actcctagca gcgatcattg ctggttagga gataatttcg gcaacatgac ctcagctgta     32520
     gggacccagc gcgggaaaag cttctcctac cacgtaggca tatcctgtgc tcgccagtaa     32580
     tttcgatgat ccaaccagtt ttcctccatc atgtttcccc gcttacgaaa atttactcac     32640
     ttgatcttcg ttcccttgga gcgtatcatt gggacacgat tgcaggatca gccttgcggt     32700
     tgtcatgatg caatcaatct tgactagggt ggtacgacgg ctttctctcc tggccttacc     32760
     gcagactaag actcagtttt gaagaagggg cgatacaacg tacaaactac aaagaaggag     32820
     atgatgatga aagagtgaag atcccccaag tccgaagcga tcttctgcca catgagtctt     32880
     gctctgtttc acttttgacg gaggccctcc ctgtctccac ttgctttagc acaccccgac     32940
     tcggtggagt ctgctgcaat tgagtttcgg cttatggaca agctcagtga taggtttacc     33000
     ctcggtgagc gtgtttcacg tatagtcatt ttaactgcat acagaaggta gtggcagttc     33060
     ggttgcttgc tgtcaatata tttaccagta tatttctagt agagggcata cagtacgagc     33120
     cccactcagg gggaggggaa cctgtacctg ttccttcgca gacatcctgc agggtcctat     33180
     ggactggagt gactgtcgga accccaaata tcgataatcg aaactgcgac attgccatgc     33240
     ttctcacctt gtcagatatc tgtgcctgcc aaggccatat ctgtcggctg tcatgtgcct     33300
     tttagtgttc tcatgggtca aagggtcttc tgacctacaa catcgtaata tagccctgac     33360
     gaaaatgaca tgtctaggca aatgcatttc caaatacttc gaattcatca catttgtacg     33420
     ttggctggat gcaaatttca tcagtcttga gtttgagacc ctccccccca ccagtatcgg     33480
     acgtataagg ctacataaag cttccgcaga atgtaaaaac caggaaaaca catcgtggtg     33540
     tttgtcaagc taaagcagtc gggcttttgc aatctaaatc ggaggggcta atatgagtac     33600
     ctgatcatct tagtgttctc ccgtatctga catttggtca tctgcccatc acgtctcata     33660
     ccctggtgac tcgtgggtat gggtcgacgg tattgaatca tgtcgtgaag actatctttg     33720
     ctgcaactcc atgttacctc aggcataaac tgtcaccgga tcctagactg ggtcgcgcag     33780
     tcatctttga ttactagcgt caggtccgat ttcgtgatct gaagaggtcg acttttcgat     33840
     tgtgttgtca ctcttcatgt tcatgtggat tcgtacaagc ttccctgctc gaacctagtt     33900
     gtggatgcac ttatcaggga tatcccgtga tatggaggat actcggcata aatcgtaggg     33960
     tctcagtcgt aagtactaac tccactgacc agtctggacg gtgaggttcg tgggagtccg     34020
     acaggtctcg ctttgctcaa cttacatcaa taccgttctt tagcatcgta tagccgtctg     34080
     caaatactta tctcatctgc gattttccca agagaaggta tactggagtg ttatctaaga     34140
     tgacacacct gaaaatgaag gaaaggactt gaatatctct gccagtcctt catggcatcc     34200
     tatggctatg gtattctcac cttatgggta agctgacgct ggtactaacc aaggcaaaag     34260
     agtcctggta catccattta tattgctggc attagtggga ctaagtgatg ggcagagtgt     34320
     gtctttccct accgtcaatg caactctctg gttttcactg ggcctttcat tcactgcgcg     34380
     tgtcaggact tgcttctgct cctcttcact cccctctcgc ttgaccttgt gttcgcttgt     34440
     atacttgcta ctcgaatctc atttcgcttc ctttgttgaa tccttccaaa accaactttt     34500
     cgagattccc taatcgcgtc ttcatatcat caactcatct ccctctcccc caagcatacc     34560
     tgaagtgtgt gaacactttt agaaagcaca tcctggtctg cagggcagac tgtcaaagga     34620
     ttggaaaatc cgcagtgcct tcgacaataa caggtagtct cttggtgtgt tattcttcct     34680
     ccctttcata ttctctttca atctcaaacc taaccaacgt cgaatataag gtcaaaattt     34740
     ggtatgcctt gatcggactg tcgccatgga tctcatctgc tcttctccgg tcgtccctgc     34800
     accgattcag gagatggtcg ccgagccgat cgacatcata cttgatgagc ctacggacac     34860
     ctgtgcgatg gtggaagaga aagctgagga gattatcgag gctgagaatg agaggcttga     34920
     ccaactgatg atagaattta ccagaggttt tgatcctgga actttcgtcg atgaggtctc     34980
     taactcgctc cccggtatcc tcaaagatat attcccaggt tcctacgagc atcttctgag     35040
     catgctgttc gaaagtgatg acaagatgca cgctacccag atgaaactag aggaatggct     35100
     tttgaaacga tatcctcagg ttctcaacaa gatcgacacc gaacgtcaag aaacgaacat     35160
     aaccgatgag acgtatttcg gggctgagat tgagatcttg aggaagatgt tagcattcct     35220
     gcgcaaggaa tctgataagc cggtgttctg gctcaactct cggcgtgcaa gtcctagcaa     35280
     agctcgtgag cagcttgaag catccatcag ggtcatcgaa ttgttcaaaa gcgatgtcat     35340
     ggttgcgatg aaactggaca cggaggacag tgagtgacaa tcccaagttg aacctgtgaa     35400
     aacccatcag tctaaagcag cataggaaaa atctacaatc ctcttcccgt gtccacagaa     35460
     cgcaccgctc tgctgagtat caaacaactt cggattgacg catgcaaggc ctcactttct     35520
     tgggaaggct atatggactc tgccatcgta ctcacttctt tctttcacgc ttacaaggcc     35580
     tatacctgcg cacacaagcc ggacaaagcc cgtgcatggg gctggctccc accccaggga     35640
     cttgcgccgc cacgcttgtc cgcagagata gctcaggtag gcgacttggt aagatgggag     35700
     ttcgagcatg agaacggagc cttcgatctt ttactcaaga ctgcactttg gctgggtttg     35760
     gcgagaggcc tcccagctgt gcatctgttc tgtgacgtcg ctcgactttt cacgactcat     35820
     aagccctccc caacggcaaa cgagccatat atccgatttc tgcggcatct ggcccagaca     35880
     agagtctcca ttgccggaat caagtccacg ccgtccactc ctgtcccatt caagcagtcc     35940
     gacgaaaata ccaatcgcgg ttacttcgaa gacgtagttg attcagacaa aaacctggag     36000
     aaggacctaa caaagaccct ttcattgctt cgcatcaaca cggccaggga tataaagcta     36060
     actgctacgc ctcccaaatg ctcgtttcgc aagaaggcga agatgatcga gaaggcttgt     36120
     gctgtggaag agaaccacac ggagaagtgg ccccagaagg atccggcaag tcaagggaat     36180
     tcctttagtt aggtcacttt gcattccttt gctaacattg cgtcctccca gcttcctgtg     36240
     aaatctcctt ctccgattcc tgaggaacct gaaccggcta cgccccctca agagacgcag     36300
     cctgattttc ttgatcagat cgaatacgtc tcagtctgtc cttggtgact aaacatcttg     36360
     ggctttcagg atttacgagc catatcagaa caccctcacc catatgtcag ctgcgatctg     36420
     aacaacatac tttacgaacg tctttgatcg atctcacatg agaattgaaa ctcaaaagaa     36480
     aatctctcca ctctgtcgaa agcaagaaga aggtatggta atcaaagttc agtccattga     36540
     ttggcaaacg cgagccatgc ttcagaaaac ccacaaaacc ccatcagttg ttatggattc     36600
     ctctcatttc cttcaatagc catcccaatc tccagggtgc accagtttcg acactatgac     36660
     acttaccgta cgcccatgtc attgccaaat tgctctaact ctggcagtca agagcagtag     36720
     gcgaagaccg tgggccggag aagctgacat tatcgtcgaa acaggggcca atccaggatc     36780
     gatgaagaag atgcaaactc gctatcccat ctcctttctt tcccacttta tgtattaggc     36840
     aaaatgacaa aaaagcaaag tcatatcacc tcacctcaca gtggttcacc actatagctc     36900
     atttgttgac gtttttcctg attcacgctc acttcacatc acccaccgtc tgtatgtgca     36960
     atcgtaagct gactttacta tctacagggc aaccctcttt tttcacctcc tagggagatc     37020
     gccgcggcaa ccgtgcaacg tttgtgaaaa gggtctgatg acatcgtttg ggacccgcct     37080
     ctttattgtt cttgttcgtg attgtattac tttaactcat tcattcatta cccttgctgg     37140
     ccaaggtgcc tgcatgcatt gttgtgtata ctactgacta cccatttttt gcttgactct     37200
     ctatttgaaa atctcctctc tcgacttgat gccgcttcgc cggccggacg gctggcggct     37260
     tgactataca tgatgctgac gacactgatg acattgcatg gaatgtcaaa atgacttact     37320
     gatgtattcc cctatccttc atttctcctt gtctattatg catgttgaaa ctggtgcagc     37380
     gcatcttggg gcctgatggt gtgggagacc tgttgcattt cgcatttaac tcatctagag     37440
     gcactaccta gctagaggct cgatcattcg agacaaaacc atggatagag aggagggtag     37500
     gagtcaaaag ggagagtgtg aaaaccaaaa atagacacta gagatgattc attatattta     37560
     ttttacgtat cttctgctcg tgaagtaacg ttatgtagcc cgaaattgtg acaaaacaaa     37620
     cgtaggtaga ccggatatgg tagtaagaga aaagaatgcc cctatgaatc cgccatatta     37680
     tacgccaaca aaggatcaat catcgccata tcatcagcac tgggtatctt agaagaagaa     37740
     gaaacatcga catcgacatc ttgaatcatg gcatcagcaa agttgctggg gaagtcgccg     37800
     gggttgtttt cattatttgt ggggtcacca ccactgccca tcgtatatag accagctttt     37860
     gaatctgcat gtatgatata cggttcatat ggggcggagg agtcatcgtt atcgaactcg     37920
     agtccataga taccaaacat atcgccggta acgggctcat tgctgtccgc caatagcgcg     37980
     cgctgcatga acatatcgcg aatctcgtcc tcggtgcatc cgtgcttact ccccatatgg     38040
     acccacagat cgtaattccg gtggaaccgg tgcggacagc cttcgatgaa gcaggtgatc     38100
     tgtcggccgg tttcttcggc ataaccctca cctgtgagag cggccaatgc ggaaggagcg     38160
     gtttgctgag ggttcggtgt cttgttcaga ccaagacgct gtcgacgctc agccttggcg     38220
     ttgggaaagc cgaggtgcgc ggtgcgaatg tgctcctcca gggcgagttt actcccgtag     38280
     cgttttccgc agccgtcggc tcccgtccag ccgacgactc gcttggacat ggaaaggtcg     38340
     gtctcgccgc agacgaagcg cttctcgcct tggtggacgg tgcggatgtg cacagttagg     38400
     tttccctttt tggtgaagct gctatcgcaa cctggtatgg tgcaggggaa gacttttcgc     38460
     tcttccagac tcacgttacc gtggctgacc tccagatgac ggcggagctc tcgggccgtg     38520
     gaacaggtca ggttgcaatt gggacattgt ggggggtgga cagttcggat gtgagcttgg     38580
     aggagggcgt aagtcgggaa tgttactgta gtgagagcgg gagtctcgga tgatgatggg     38640
     ttggcctgct cggcctgctg agtacactcc gtgcaggtga atcgtttctc ggtgtggatg     38700
     cgactctcat gagctcgaag gtgtcctgcg gtatcaaatg ccattggaca tttctggccg     38760
     gtagttgcgt cgatgtgcgg gcaagagaag ggtttctgtt tcagatgcac gctcatgatg     38820
     tgtttttgga gcgttgagtg ttttcggaag gtctcatcac aaggcggaaa ctctgtgcag     38880
     cggtacttgt ctcttccatc atgagcagct atatgtcgac gaagccgtga gccagttaca     38940
     aagctcttcc cacatcccgg acggtcgcat acgtaatctc tgattccggt atgggcgctc     39000
     ttgatgtgat ggctcagatg cgatgctcgg agaaacgtct tatcgcaatc gtcgtgggta     39060
     caacggaata gtcgttcatt gttgtgtgag cgcaagtgtt cctgtaagcg tgctggacgg     39120
     ttgaaggcct tcgtgcaacc gtcgaaaggg cagcggtgag ttttcagctc tgaaggatat     39180
     ctagcggaga tagtcgacat cggagtagct ggagtctcat gaagactacc gctagcgaca     39240
     ctggagtcat ccgaaaagtc atactcgggg tcggagtgct tttcttcata tattgggtct     39300
     ggagtatatg aaagacattt agtatcagcc ggaatctaga ctcggtctct aggcatatct     39360
     taccgacatc gtccagcgtt gtccggcttt gtacccgctt cgggttgggg aggtcccccg     39420
     aggcttttcg cttctgagcc atagctccgc ggtccttcag accatccaag cctgactaat     39480
     gagcactgga ctggcgacag gaaggaaaga agattgaagg aaaaagtgat ggctgcacga     39540
     cgacatccag aaattttgcc gaggcggtga acagcggcac ccaaagaaga ctagcgccgg     39600
     acgagcgaca ggaacttttt ccggattctg agggtcgcga cttcgatttc ttcacgagga     39660
     agaaaagccc gtcgcaacag tttatcgtct cgtccccaac ccggcccggt cgcggtgctg     39720
     ccattgtctt cattgctgtc atattcgatt ggtgtttcat cccaattttg ttcaacttaa     39780
     tccgccacca tgtctgacta cggagaccac gacgctgagg aaacgtaaga gaccggtacc     39840
     ccatgagagc ttgagcttgc gcaggtcaat gctgcgcgtc tgcgttacat atcgatggcc     39900
     gtcatttttg ctaggtggaa attccgatgt tctgactagg attgtcttat agttacgact     39960
     acgagccgga gcaggagtac gatgacaacg agcccgagga cttcttaaac cccgaggatg     40020
     tcgacgtcgc agaaggagga gccgatgaat atggcgaagg ctcatacgcg cctgctgtca     40080
     acggaaacca cattgtcgct tcaggcgacc cgaatgcggg gtatgcgggc aaggtcatgg     40140
     aacagacacg ggagaagaag gtcccgaacg accagcgcca gacaactcca tacatgacca     40200
     agtacgagcg cgcgcgtgtc ctgggtactc gggcgctgca gatcaggttc gtctcggcaa     40260
     tcgatgcagc atcaagcatg ggctgaggag cgcaatcgga tgctgaccat gtttttagta     40320
     tgaacgcccc ggtgctcgtc gatcttgagg gcgagacgga tcctctacag atcgccatca     40380
     aggagttgaa ccagaagaag atcccactga ttgtgcggag atatcttccc gacggatggt     40440
     aagcggacct tctccatgtg tgtttaacga tttgacgtat tcgatctaat cactatttct     40500
     gtggtacagg tacgaggact ggacttgcga agaattactc tagacgcgga gacgacatag     40560
     gtggttgtat ttttccaaat ggcttcttct tactttattg tgtatgtgtt tggtctaagg     40620
     atctttccct ctgggcagca tagcgtttgg agtttcggag tagggtagcg ggccatactg     40680
     gcctaggcag ccactgggac actgggaaga caaagaaaac tcaaaagaat aacgcactgc     40740
     agtctatata tcagtaaaat tcaaaaaagt ttgatgttga cattgtttcg tttggcacag     40800
     tctaggcctt ttgttcgcaa tctactgctt tggaagcaaa acgacgtctt cacatctgag     40860
     ccagacagag cgctccacag aggtggactc ggatgtagaa tcaacatcga cgggtctgtt     40920
     ttcgtgtcct gattgggatg gtgactccaa attggagatg aaggaggtag cagaaaaggt     40980
     actttgtgtt tggcactgtt gcagatggat gctttggggc tctgatgcaa ctgcaagtat     41040
     ggcgtcaact cctcacatgg caccgttccc acattcccgg tagataagtt gtctcgcgag     41100
     cattcctctc tgagatatga catgctccag atgctcgcat caggctgcga cgggtccttg     41160
     tagcacatga tggcctatcc tgtattcgcc tcattcttat tgaccacgtc ataaagtcgt     41220
     ttgacttgtt aagtgcttcg acatccctgc tcttgaaaac ctccacagaa cacgtaggaa     41280
     tcataagaga gatgcttagc ccaatgtgtt gctcatgaat acttgctaag agtcatcggt     41340
     aagttgatct aggcgacaca aatgcctcat tcggagtata aatgggacga gtaggatcgc     41400
     ttgctcgata gacattattt gtacggactt cggtccgcgc ttctctgacc gccagtgaat     41460
     cggctgaaac agccgagtcg gagagcacag ttcgaacatc gtggcttgtc tcgcattgcc     41520
     gaactgcacg aaaagcacta atgcaagatg acatcccgtg attggcggca tgtggtcagc     41580
     ccattattga gcaacacaac ttctctcttc tgctcggttt caaggcatgg atagcctggt     41640
     atgaattctt ttcatgcttt ctcgaatcgg tcagccactt tctcttgcgc agtcactggt     41700
     tatattcggt ctacgtatca agcagatcag caagtgctca ccgatccgtg gtttgctcac     41760
     ctttttttct gccagccgat cttcatcggc gacgacgccg tcttgtttcg ggacccagac     41820
     ccggagcgaa gaccgataac tccgaggtat ttcaatcccg cattttctgg cttacgagta     41880
     agtgcttcga ggggtctcga atcaagcatc ttccttgttg ctgctgatac ttctcggtgg     41940
     gccagtccag tgcgcagtag gcattgctat cattattttc tctatcgcca gatacactgt     42000
     tcttcaaggt taactggact agagatggat agaccgaccc ttgacctgtc aagcctggac     42060
     gatgtgatat attcgtgttt caggaattcg aaccagcgtt gcattcgcca agaatgagca     42120
     ggtcaacgga ccaggtacag gatggactaa aaagaagtga tatgcagttc ggccctccgc     42180
     ctggataaat cggcacgctg tcacactaaa agcccactat ctgcagtcat cctccaatcg     42240
     tgcttatgca gagcatacct gcaataaccg tagttgtgaa gcgcagggcg tccctttgct     42300
     ttccccaatt tctcatgctc gtgttctcac ttctccaact ccccgacaac acatcaagac     42360
     atgttcctgg ggaaaagaaa gagctctgtg gctccgtccc tcggcaagtg actccatcgc     42420
     ttacccggaa cccgctcgtt gctggtccag taggctctct tcccacaatg gggcatcagc     42480
     cagagcctgg ttcacttgac tgtctccatt cccactccca ggggatcagt caacatgaat     42540
     ggccacctga gagtggaccc ccctactcag tcttggttga gtctgctttt ctagctccca     42600
     agcttagtct tagccggggc ttggaggcac taccttaata aatttttact gtgtgccgct     42660
     atgattcatt tctaatcaca gtatatagtg tgagcctgac ctccacctgg gctcgacctc     42720
     ctccttgctc ctagtccccc ggtcctaagg aatctatctt acgtagctac tcaagctctc     42780
     tgtgagtgct gtttgggctg tgttcacgtc gactgccacg gggattatct gatccgctgt     42840
     ctgtttcgcc ctccaaccct tacctttatc gtccactcca ccagacggtc cgtctgatcg     42900
     cttattatcg gggtggaaaa tgggaaccaa tgctgattac gacgagaagg ctgttgcggg     42960
     atccctcgct gcaaacaaca atggcgatgt ccatgagctt cctaccccgt cagatgagaa     43020
     acccttagaa gaaccgatat ttgataccgg ctttaagtca tggatccaag tgctaggttc     43080
     tttcttcctt ttcttcaact catggtatgt gaggccctat actcaagtat catgtagggc     43140
     atcaactgac gaaggatgac ggccaggggt gtcattaaca cctggggtgc tttccaaacg     43200
     tattatgaac agaacttgtt gtcgaacatg tcatcgtcca acatcgcctg gattggctca     43260
     ctccaggctt tcctactcat gctttttggt gtggtaacag gacctctctt cgatgcaggc     43320
     tacttccgtg ctctgctcac gtttggaagc attatgcttc cctttgggtt gatgatgacc     43380
     agtcttgcta ccaagttctg gcagctgatc ctggcccagg gtatctgtat tggcctggct     43440
     gccggatgcc tgttcgttcc atccgtcgcc attctgcccc agtacttcaa gaagagacgc     43500
     ggcctggcca atggtcttgc cgcttcgggc agcagtatcg gaggtgtgat ctacccgatc     43560
     atgtttgacc agttgcagca caaggtgggc tttccctggg cgactcgagc tattggcttc     43620
     ctctgtttcg ggacctgttg catttcatac agcatcatgc gtatgcgctt ccagccgaca     43680
     gagaagcgca agctggtcca gttggctgcc ttcaaggagc cgcatttcgt gatgttctgc     43740
     attggcatgt tcttgggttt ccttggattc tacaacttcc ttttctacat ccaatcctac     43800
     gccatcgata ccggaattgt cggttccacc ctcggattct acctgctgtc catgttgaat     43860
     gcggggtcca ccgttggacg tatctgtccg aatttcattg ccgaccacac gggtcccttg     43920
     aacgtcctca ctcctgcagc caccgctacc gccatcctcg cctttgcttg gatcggagtt     43980
     cacaatgctc cgggcatcat cgttctttcc gtgctgtatg gtctctgctc cggcggtttc     44040
     gtgtcacttc cgccggtcgt gatggtgact ttgaccaagg acatacggga cctgggaact     44100
     cgtcttggca tggtgttcgc aatcacctct gtcggattgc tgatcggtac acctatcggc     44160
     ggagccattc tgagcaactc gggcagctac cttggagtgc agctcttcac agcctgctgt     44220
     ctcattacgt ctgcctccgt ctttgccgcg ctgagattct ctcgctcggg tatgagactt     44280
     gccgcgcgtg tgtgagcgcg atctgacaac acactactcc tattccctct tcaactacgc     44340
     cgcgaccaca tcgacccgcc tcgatgagga ccgatacctt aatacttgat gacccaaaag     44400
     gattgcatat tccattcaag cattgcattt gcatcatgca tcatgggaga accggttttt     44460
     ctttttctgg gatgataaaa gtttgatctt ttgatacgat agataagatt caagactaga     44520
     ctagaacata ttgcttaatg tattacgatc catattggtt gattgaaagt atttgacagc     44580
     atggatacca tccccaagcc tgtttggatt tagtgactac aattctcata agaaatctat     44640
     tcaagccgtc tccctagtcc cactcaacat gcatagcacg acatggcatg atacgtccgt     44700
     tcatcaaccc agcatagaaa taatagtaat ggaaacgccc aaacaccaaa tgctcgaaac     44760
     aaccgaccga caagccattt ttctcttata taattcctca acctttgttg ccggcctcac     44820
     ttccatcata tgtatatata cctagacccg tccgatccat ccatcatcac tccccaagcg     44880
     aagcgtagag agaggaactc ctctacgaaa catgaatcgg atccaccaag aactcctccc     44940
     cattgtcccg aatatgctga agtttcttat cgcgactgca tggcttgcgc atatcaaagg     45000
     catcttcacc tgaatccgag aagcctgttg ggtcgtcgct gtagtaattt actactcggc     45060
     ggaagacaga gtatctgcgt gaaacacccc tattagcacc atcatcatct ctatgtggag     45120
     aaccatagaa aagagaacag aagaaattct ggacagggga agctcaaaaa agaaaaagta     45180
     gaaaggaggg tataaactca ccccatgccc ttatacatcc ccacggcaac tttattcccc     45240
     gctcgcacat agagatcgac aaaccaggca tcgttgatat cggagccttg ttccagacgt     45300
     tcggtgagac gacgcgcgtg gccgagacgg cgccatgcgg gcgcaacggt taaaacggta     45360
     atgtggccgt gccagggcgt gtagtgttcg gaatggcgca tcgaggcggg ttgttcttca     45420
     agcttgccca tgactgagta ttcgtattag tcgtgatcct tgcaatacgg agggtctata     45480
     tcatgtgttg ttcagggtgt ggttggaaag aactcactgt aacccacgat gccttcctgg     45540
     cgatcttgaa cgctgctaaa gagggacggc catcgcataa ggtaattgag gtagaatccg     45600
     aggtcgtagt tttcggtcaa tgggtcgagg ttggtgaggt tgagggacag gaggtccgtt     45660
     ggggacatgc gccggatgga gctcattgtg ggtgtggtgt tttgcgggag aagtgagcgg     45720
     tggttttcaa gaagatagtc taataaatgg aggggaagat gaagcaattt gggggagttg     45780
     atcggcgagt caatcggggc ttgggcggtc acggggagga gatctttttg agggtcgggc     45840
     ttctttctcc ctctccttct gtgcccccct cattattatt attattgttg gtgtctctgc     45900
     tattttctct ctctctctct gtctctctct ttctctttcc ggctcattct ctatttcttt     45960
     ttcgactctt tcgttctcgg gatagccggt ctcgattctt cgttccttta ccttttcctc     46020
     ctttctcccc gtcctttaga actgactgcg tggaaaagca tcctggtgat gcggtcggcg     46080
     atccaccatt gatttccgtt cccctgttcg ttatttgctt cgcggcagcc acttaacgat     46140
     ttgcaaagaa tctacaacaa accaccccct gtttcgcttg tttagaccgt cgaagtcttt     46200
     ccgtcaaact atccccttga ctctcaaacg agcacaccgc atcctcgtcc ttctcctttc     46260
     ccctccttta atcctgcaac atgccgtcca tcccacctcc cctgactata tctcaccgcc     46320
     atactcggag tcgctcctcc aacatcgaca tcgaccccat ttctcctggc acctacgctc     46380
     ccaacggctt ctcctaccgg tcgcctcggt cgcctcatac gcctcgttca tccatcccct     46440
     cttctccggt ggatgtccgc cctcaccaca ctcaatcatt caatggctcc catagaatgt     46500
     cgggcgactt cggcggtgca ggaaacgaag gcggcggact aggaaacttg gcagatgagc     46560
     ttgcagatgc atgggaggag gaggaaggtg gttacggata cacgtcgggc caggatactg     46620
     gggcccctga cgcacagtac gtggaccgca gtgacgatga agatgcatac caccgcatgg     46680
     gcaccggggc ccgcacaccc tcatcgggct actcgtcgga acggaattct tccctgcagc     46740
     ctccgaggcc caaaacccgt aatggtgccc atcggcaccg gcgacacgag tcgcaatatg     46800
     atggctccga ttatgggaat gactcggatt tcgaggaagc ggatatgccg cctagcctag     46860
     agatgcagat ggcggagatt gagagtctgg ctcgtcgcgg attagagaac aatggcagcg     46920
     agaatgactt cgttattcaa cgggcggtgg aagctctccg ggatcttggc gggcagagtg     46980
     ggattgaaaa taacgccatg aggtaggtgg atctgttgtg gtctgtgact tggcaggctg     47040
     ttctgtctgc tcggaatcat agctggctaa cacatctttc tttacattca gactcatcac     47100
     cgcacactca tccatcacct cacatcttac ccatcagacc cgggcacttc agaccctcac     47160
     ccaccctctc cttttctcgc catttccgct cctttcctca gacgctatag atgcgctcat     47220
     tcctctcatc gacgaagaac tcctgcctaa cctcccctat cctttcccgg aacagccacg     47280
     tcactcctcg agacccacta ccccctccca gtcaccggcc ctgaaccctc ttgtctcgct     47340
     gcagaccctt gtgtcgcaga catccgacat caccctgtcg ctccgaggcc tgagcgatac     47400
     gttgtatgag tcgcggcagc taacgtccac tgcatcacga cgactccggt ctgctcgcga     47460
     actcgtagcc gacctccgcc gcgaggaaga aggtgttgaa gaggggactc ggtggatcga     47520
     acgaggcgac tgggaccgcc gacttcggga tcgcgaagcc ggccgagtct gcggagacgt     47580
     agtcagtggc ttcgaggcgg tgtgcggtga atggcgtgag aagctctttg gagcagctgc     47640
     tggagccgaa gtggctgctg cttgagatga ctattcccta aaggtaaagg ggagggataa     47700
     tggatataga caaggacgga tgctaccagt ttctttcttc tcatgggata aatttttttt     47760
     tgtctttttc ctttttgttg cccttgacac cccagatata atgtctcgag tactactgcc     47820
     agagatagcg gccatacccc cttttgcaat tttcctttct agtatataga ttatttcatc     47880
     tgggttcatc ctgttcatgt tcacccacct acatattcca gaacttcatc catcgaatcc     47940
     aagcaaagca tgatcatatt gagtgtcaaa atctctcatc gataatatct caagatccgc     48000
     acatccaaac ctccaatttc caatttgaca ccatagaagt acatacaatt aaattcccca     48060
     catccctggt atctttctta tcaaacgtta tcgcaatttc caagcgaact tcatagatcc     48120
     tgaagaatga ctgatacatc ttcacctttc ccttttacgt actctggtct gcgtaccaat     48180
     tcgtgttacc aaacccctaa caaatccccg agtaatctgt cacaggtaca gtttcaccaa     48240
     ctgcacggtc tgtttcaggt attgatgaca agacagatac ccttttccct gtctacctac     48300
     caacctacct atttcttgta ttggaatcaa gctagagcat tgggggggaa taaaaaagaa     48360
     aagaaaaatg tagatggtca cactgaactg aggaaattat agcaacgaac ggcactgcca     48420
     gtctggggat tagtaattag aggtataact ctgtattcac atatggtaag gaatggaagc     48480
     aaggtggaga gggcattatt tttttggggg tgcgggggaa aagggtttat agacgatatg     48540
     taggtatgta ggtagtatga aatagttact actatgcact tagtgggttc tgaaacgaat     48600
     caccagtggt tttcatgacg atcatactct atctacttat tgtgtaacat gattactgtg     48660
     tagtgattct cacactacaa ttcaaatatc aacgtaaaga acgaaagaaa atactatgca     48720
     tttggtaaga aaccatgaga tcgggtaatg taagaacaaa tcaatcaatc aattgacatg     48780
     gcatgcccag aaaaagaaaa ttaaaatcaa gcagtggggg gaggaggcaa agagctttaa     48840
     ctacaacctc atggtaaaaa aaacccccga tgtctttctc tgtctctctc ctcacaaagg     48900
     ttcatacctc atcgactaaa acaactaaaa gacgtagtag gaacaggttg gaggaagaag     48960
     aaaagaaaaa aatcgtaccg ggtttgaggc taaggaggaa aaaggtacta tgcgaacatg     49020
     aagatgggga ggcggggcgg aaaagtgttt gaaggtggat gagagttgtg tgttatacca     49080
     caaggatgaa agagagagag aaaaaagaga aaagaggaag gttgactcaa atcacgcgcc     49140
     ctttcatcaa acatcccaag aactttttca tgtcatcatg cgatttactg gccaccctgc     49200
     tgctgcttcc atctgggcac ccacttgcca gcggcaggct tggactcctc gggcttgtcg     49260
     gagctggagc cgggggtctg cgtgcgggag gggggctggg aagagccggc ctcgcgcatg     49320
     gcacggggaa cgtagcgctc cgtggaagga gcaggagcag gggcagcagg ggtagcactg     49380
     gcacccgagc gcaggtgagg aggcacgtag ccaccagttc tgcgcacagg agcgggctcc     49440
     tcgcgggcag gctcgggagc agcagcagca ggagcagcag gagtgccacc agcagcctcc     49500
     ttggcagcct gacgctctct ccagctggga ccagcaccac cggtgcgggg agccaggttg     49560
     agacgaggag cagtgcgttc agtaggagca gcacgctcag gagctgcctc gggctcagca     49620
     ccaccggtcc ggcgagcggc acggcgagct tcggcttcct cttcacgctg cttctgcttg     49680
     gcagcaagtt catcgagtct cctgtaaggc gggttagcaa ccagtggttt tgcgcggatt     49740
     gagtgatggt tgagatggaa tgggggaata ctgactttct ctcttcctca cgcttggcct     49800
     tctcctcagc caggacgcgg cggcgctcct cctccttggc ggttctctcc tcttcctcgc     49860
     gacggatgcg ctcctcctct tccttgcggc ggcgctcttc ctcctcacgc tcggcccgct     49920
     cacggcgtct gcgctcctgg acctccttga tacgctgcat cttcttggcc tcgaagtcac     49980
     gctcagcagc cttgcggcgc ttctcgaact cctcgtggcg cttctccgac acctccttgc     50040
     ggaagctgtt gaattgaggc accaggcggc tgagacggtg cttgagggca acggcctcct     50100
     tgtgcttgtc ctcggcctcc ttgagggcct cggccttggt ggcctcgtag atctccatgt     50160
     cgcgctgctt ctgcttctca tagtcctcgg ggacgtgctt cagttcctca cgacggaagg     50220
     cacgctccag gtggtcaatg cgcttggcgg tggtgcggat gcggtcgttg agctcgttct     50280
     tctccttctc cagctgagcc agcttcatgg cacggaggcg gttggcatcc agctcgttca     50340
     ggtcaagctc gctgatgtca atgcccttga cgccagtctt gagctcctcc agctgcttct     50400
     tcagctcctg ctggcggatg cggtcctgct catccttgat gcgcttcttc tcacgctcgc     50460
     ggtgctcatc caacagacgc tgcttctcgg cttcctgaag ctgctgggtg cggatgcgct     50520
     tgcgagtctc ctcctcgcgc tgcttgcgct gcagagcatc ggtggcagcc tccttcttct     50580
     tctcgatgat gacgcggcga gccagagtct cctcgtgctc cttggcggca ccagcctcgg     50640
     cgcgagcgag ggcggcacgc ttggcctgca ggcgggcctc gttgtacgag gggtcgacgt     50700
     acatgcaggt cacatgcagg gtcttggcca ggcgggtgag ctgcaggcgg gcaatctcag     50760
     cgggggtgtt ctgcaggcgc tggacggagc caacctcgct ctcggcggag ccagcggcgc     50820
     tgccggggtg cagagccttg gccgaggaga agacgtcggt gtcgaaggtg aggacaccgg     50880
     agatgtggtc gacgcggatg gcgagatcgc ccttcttgca gccgttcatg atgaacttct     50940
     cgatcatgga gggggtgatc tggaaggggt cggggaactg agccagctcg tagacgaatt     51000
     tgagctcgac cgactcatag acctgagaca gctgctggaa gagacgggtc aggatgacct     51060
     gctgcagagg caggacgtac ttctccatct cggggtcggc accgatctgc ttgaggatgg     51120
     gggtgatctt cttgcagatg gacagggggt ggaagtccac ctccaggatg ttgtagaggt     51180
     cacggatctc ggggcgggcg cgcttgagca gacccttgtt cagggcatcc ttgaacagca     51240
     cagcacgagt ggggggagag gccataccca acaggttggt gagacgggtg ttcttgttct     51300
     tgcggacctc atccacatcg accagggcac cgcgggagcg ggaagtgctg atgacgggga     51360
     tggacagggc ggacagcagg acgaaggagg cggccttggt catgtcggcc tcggtgacgg     51420
     aggggttctc cttcttggtg ccctggccag cagccaaagc ggcagcggac tggcggagga     51480
     ggttgtagta acggctgaag gccgcggcgt ggaagaggta attctcgcta accaggaaga     51540
     tacgggccag cttctcgtag tagttggcca tcatgacgtt cttggcggga cgcttgctga     51600
     ggctgaggag ggtgtggata tcctcaatgc tgcggaaggc ctcctgccac agctccagct     51660
     cgacggcaac gttcagctgc tggaaacggg tgtccaggtg gcgctggaga gtgtccgggt     51720
     cgctgaggtt gatggcgtgc atctgagcgg agtacttggc ggcattctgg acgtggttgc     51780
     ggagcagctc gcacagacgg cggaactcgg tcttgcgggt gtacttgaga cagaactgga     51840
     aggcctgcag ggcggtggtc tggtacataa cctcaagacg ggcattgttc ttgaggattt     51900
     cgagcacggt gcggtaggtc tcccagagga acttgagcca aggggtgaca acagcacggt     51960
     cagtgcggtc gcgggactgc tcaccggaga cggtggcgag caggatggtc tcgggggtct     52020
     cgatggcttc cagatcgtcc acgttggacg aaggggcagc ggactcgaga gaagactgaa     52080
     tctcatcggc cttggcctgg gcctcggtga ccttcttctc ggcgagttcg atgaacttct     52140
     tgagaacaac ctataccggt gcagggttag atgctgttgg tcgggggagc atgaaagggg     52200
     gatgtagtgt gtaaaagaaa aatttctcct acctcgatcg ttccgacgtt ggtgttctgg     52260
     gcgatgttct tgtactggta gagaccatcc ttggcggcct tgcccttgcg aagatcaaca     52320
     cacagctcaa cgaagaggag catcaccggc tccagagagg cgatggggct gctgcgcgtc     52380
     cgcttggagg tgacatgttc gtgaaggacg ttgagggcgg cgggggcctg gcccacggcg     52440
     atgagttcct gagccctctg cggacagaat accggtcagc atgaattttc catcaccata     52500
     tggtttccca tcccattccc acgacgacac atcacttcga cattataatc gagatagtat     52560
     tcggaagaag taaccgggct ggcgtacctt gaggacattt tcaggcttga tgtgaggcgg     52620
     aggcggcatg gtgggcgaga tagcgggttg ggataagcga tcacaatatg gtggatgagg     52680
     acgacgatgc tatccttcga ctgggagaag gtcgagaggg aagaaaaggc acgtcggatc     52740
     gcacaacgac gggcgggcag caggggagtc gagggcgaaa agagccttga ggatagaaag     52800
     gctgccacgc gacggtcggc gagaaagacc cagacaagaa aacgtcaggc agtcaatctt     52860
     gttgagaaag acagacaagg gcgactctct cttctcgctc tctgactctc tcgttgtgcg     52920
     aaccgcgaaa attccggccg ccgccgttcc cactttgggt taagcgatgc gggtcacgtg     52980
     gtatccccgt gtttatggct tgggattcac ggagttgccc catggaatga atcgtagtag     53040
     tcatatattt ctttccattc cattgaagac atacctctat tttggtcgat attccccatt     53100
     ttgagagtgg cggttgtgct cctcagccac ctcggggagc tgttctcatt cctccctcgt     53160
     ctcgcctccg taactcggca gtgggggaca ctgtttggcc cgtttgagac gatcacttgg     53220
     aaggaaggaa gaacaggttg taatgaacgc gtccaagctt ctgaaccatc gactagtgtg     53280
     tctagataga aataaaacat acgattgaca gggttgcgac agcaaacgag agtgctgctg     53340
     ctgctgctga tgaagaaggg ggcgggagta taatcaggag ccacggagta ctagtatggg     53400
     ggggaaagag tgctcaggga ttggatggta tggatcaagc agtgatccat ccacgtgagg     53460
     ctaatgagcc tcctccataa aatcatgcta caacaaacaa ttcaattcat ggctataata     53520
     agaatcagag gtgcaaagaa agctgcatga gggagggtgc aaccttgacg caaaacggaa     53580
     aaacgcctgt tagaaagcct tttgtgctga ctgcatccga gctatccagt tagttagtta     53640
     tccagctacc aactaaagtg actagttcag ttcagggggg gaagaagaag aattatggat     53700
     tccagtggga aatgaacgga ttgcccctgc gactcacaga ccacctcttc tctcgctcgc     53760
     tcgctctctc tctttctctt tctccaatat actgctactg ccagtaattc ctccccccca     53820
     aactactact aaccaaactc aactaatact aagactaaac taacttccca ttttccctct     53880
     cttttccctc cttccccccc ccctcttttt tccctttttt ccctttttcc ctccggtcca     53940
     gcagtagtcg ttcgctttcc tttttgccca gcaaatcctc ctggttcttc ctgctctccc     54000
     taattcttct tcttcttcct cttcttactt actttgtctg attcttactc acgttcaata     54060
     tcgtgaagtc gagttcagcc tctcttcccc cttccattca ttctttagaa atcaattcct     54120
     cggagacccc ctctctcttc ttcaggttcc ctccctcctc cggtcgctgt tcccacttac     54180
     attccctctt ccctccctcc ctcataatcg tctccatccc caaagttcct cctcccacca     54240
     ccaccacctc ctcccttttc gcgtccgccc gccgttcccg cccggctttg cttttcccct     54300
     tacttcctgc cggctcgacg cgcaaaaaag aaccttaagc tgagccgccc gaccgatcct     54360
     gctgaatcca ccac                                                       54374
//

If you have problems or comments...

PBIL Back to PBIL home page