(data stored in ACNUC7421 zone)

EMBL: AM269964

ID   AM269964; SV 1; linear; genomic DNA; STD; FUN; 62077 BP.
XX
AC   AM269964;
XX
DT   28-JAN-2007 (Rel. 90, Created)
DT   14-MAR-2015 (Rel. 124, Last updated, Version 5)
XX
DE   Aspergillus niger contig An01c0170, genomic contig
XX
KW   .
XX
OS   Aspergillus niger
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
XX
RN   [1]
RP   1-62077
RA   Pel H.J.;
RT   ;
RL   Submitted (01-MAY-2006) to the INSDC.
RL   Pel H.J., DSM, 624-0295, P.O. Box 1, 2600 MA Delft, THE NETHERLANDS.
XX
RN   [2]
RX   DOI; 10.1038/nbt1282.
RX   PUBMED; 17259976.
RA   Pel H.J., de Winde J.H., Archer D.B., Dyer P.S., Hofmann G., Schaap P.J.,
RA   Turner G., de Vries R.P., Albang R., Albermann K., Andersen M.R.,
RA   Bendtsen J.D., Benen J.A., van den Berg M., Breestraat S., Caddick M.X.,
RA   Contreras R., Cornell M., Coutinho P.M., Danchin E.G., Debets A.J.,
RA   Dekker P., van Dijck P.W., van Dijk A., Dijkhuizen L., Driessen A.J.,
RA   d'Enfert C., Geysens S., Goosen C., Groot G.S., de Groot P.W.,
RA   Guillemette T., Henrissat B., Herweijer M., van den Hombergh J.P.,
RA   van den Hondel C.A., van der Heijden R.T., van der Kaaij R.M., Klis F.M.,
RA   Kools H.J., Kubicek C.P., van Kuyk P.A., Lauber J., Lu X.,
RA   van der Maarel M.J., Meulenberg R., Menke H., Mortimer M.A., Nielsen J.,
RA   Oliver S.G., Olsthoorn M., Pal K., van Peij N.N., Ram A.F., Rinas U.,
RA   Roubos J.A., Sagt C.M., Schmoll M., Sun J., Ussery D., Varga J.,
RA   Vervecken W., van de Vondervoort P.J., Wedler H., Wosten H.A., Zeng A.P.,
RA   van Ooyen A.J., Visser J., Stam H.;
RT   "Genome sequencing and analysis of the versatile cell factory Aspergillus
RT   niger CBS 513.88";
RL   Nat. Biotechnol. 25(2):221-231(2007).
XX
DR   MD5; bf0da04cfce82a2e36ded049040dbbb0.
DR   ENA-CON; AM270980.
DR   BioSample; SAMEA3283178.
DR   EnsemblGenomes-Tr; CADANGAT00000477.
DR   EnsemblGenomes-Tr; CADANGAT00000478.
DR   EnsemblGenomes-Tr; CADANGAT00000479.
DR   EnsemblGenomes-Tr; CADANGAT00000480.
DR   EnsemblGenomes-Tr; CADANGAT00000481.
DR   EnsemblGenomes-Tr; CADANGAT00000482.
DR   EnsemblGenomes-Tr; CADANGAT00000483.
DR   EnsemblGenomes-Tr; CADANGAT00000484.
DR   EnsemblGenomes-Tr; CADANGAT00000485.
DR   EnsemblGenomes-Tr; CADANGAT00000486.
DR   EnsemblGenomes-Tr; CADANGAT00000487.
DR   EnsemblGenomes-Tr; CADANGAT00000488.
DR   EnsemblGenomes-Tr; CADANGAT00000489.
DR   EnsemblGenomes-Tr; CADANGAT00000490.
DR   EnsemblGenomes-Tr; CADANGAT00000491.
DR   EnsemblGenomes-Tr; CADANGAT00000492.
DR   EnsemblGenomes-Tr; CADANGAT00000493.
DR   EnsemblGenomes-Tr; CADANGAT00000494.
DR   EnsemblGenomes-Tr; CADANGAT00000495.
DR   EnsemblGenomes-Tr; CADANGAT00000496.
DR   EnsemblGenomes-Tr; CADANGAT00000497.
DR   EnsemblGenomes-Tr; CADANGAT00000498.
DR   EnsemblGenomes-Tr; CADANGAT00000499.
DR   EnsemblGenomes-Tr; CADANGAT00000500.
DR   EnsemblGenomes-Tr; CADANGAT00000501.
DR   EnsemblGenomes-Tr; CADANGAT00000502.
DR   EnsemblGenomes-Tr; CADANGAT00000503.
DR   EnsemblGenomes-Tr; CADANGAT00000504.
DR   EnsemblGenomes-Tr; CADANGAT00000505.
DR   EnsemblGenomes-Tr; CADANGAT00000506.
DR   StrainInfo; 791018; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..62077
FT                   /organism="Aspergillus niger"
FT                   /strain="CBS 513.88"
FT                   /mol_type="genomic DNA"
FT                   /clone="An01c0170"
FT                   /db_xref="taxon:5061"
FT   CDS_pept        complement(join(300..525,838..1151,1314..1394))
FT                   /locus_tag="An01g04840"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8M1"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8M1"
FT                   /protein_id="CAK37018.1"
FT                   /translation="MNRGDGTAVPCLWCRGIQIEWASEHLCPVAPARRYSGPDSRLRMI
FT                   PMSIPTLPGMRQSQKIPNLQRALAGSAPITAPTQTVHVLGNGPRGVEEGSSLRPVRMRV
FT                   SGGQWALPAKGEAKSSRVTNRSIGVLTTRRGGGGGAGACPRSRYTLTPLCNHSEVLFVI
FT                   FPHLSQIGNLLPCPLLSLSLFFSFFLPFLPSIRISNSEVARPA"
FT   mRNA            complement(join(<300..525,838..1151,1314..>1394))
FT                   /locus_tag="An01g04840"
FT   exon            complement(300..525)
FT                   /locus_tag="An01g04840"
FT                   /number=1
FT   intron          complement(526..837)
FT                   /locus_tag="An01g04840"
FT                   /number=1
FT   exon            complement(838..1151)
FT                   /locus_tag="An01g04840"
FT                   /number=2
FT   intron          complement(1152..1313)
FT                   /locus_tag="An01g04840"
FT                   /number=2
FT   exon            complement(1314..1394)
FT                   /locus_tag="An01g04840"
FT                   /number=3
FT   CDS_pept        join(1770..1899,2081..2318,2371..2460,2560..2623)
FT                   /locus_tag="An01g04850"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   BAB09566.1 - Arabidopsis thaliana"
FT                   /db_xref="GOA:A2Q8M2"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8M2"
FT                   /protein_id="CAK37019.1"
FT                   /translation="MQQKYDRSHGILRFPLFGIAHQCGRVAFCLFIGCSPGAWPSQPAI
FT                   QSKVLVSSPRRYRPAVILSGGNGWGQLEKLKLTILDYGITSTIRLPSIHQNLALGAICS
FT                   IGYNVAAIGRSRLITLCSIGVGTGKGGNNKLRQMFKTIGSRSSCSHLCRSPPPSIGVSE
FT                   KIFQASIFPA"
FT   mRNA            join(<1770..1899,2081..2318,2371..2460,2560..>2623)
FT                   /locus_tag="An01g04850"
FT   exon            1770..1899
FT                   /locus_tag="An01g04850"
FT                   /number=1
FT   intron          1900..2080
FT                   /locus_tag="An01g04850"
FT                   /number=1
FT   exon            2081..2318
FT                   /locus_tag="An01g04850"
FT                   /number=2
FT   intron          2319..2370
FT                   /locus_tag="An01g04850"
FT                   /number=2
FT   exon            2371..2460
FT                   /locus_tag="An01g04850"
FT                   /number=3
FT   intron          2461..2559
FT                   /locus_tag="An01g04850"
FT                   /number=3
FT   exon            2560..2623
FT                   /locus_tag="An01g04850"
FT                   /number=4
FT   CDS_pept        join(3064..3077,3175..3230,3305..3414,3495..3511,
FT                   3783..3864,3958..4009,4044..4072,4215..4316,4535..4624,
FT                   4707..4730)
FT                   /locus_tag="An01g04860"
FT                   /note="Remark: ORF classified questionable due to
FT                   implausible gene structure with short, multiple Exons and
FT                   no significant blastp similarity."
FT                   /note="Title: questionable ORF"
FT                   /db_xref="GOA:A2Q8M3"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8M3"
FT                   /protein_id="CAK37020.1"
FT                   /translation="MLPVNLVTEVSVTNWFLNPPKQATDWSAKIRYLSFWKRGASPIQG
FT                   MMIGDLGGRGKRAISVRSGEIYYTQPFTSITFQVPEPHPIPSMSTSVNPWSHMKYKNPS
FT                   TAIELLQVVLSGVKRHSYIALLTQLFYSVTTSKLTPPLFLMYFKRLESTYVNNYNNNNK
FT                   RIYSTSIATTTYYRPGWTEAKCYDQHTT"
FT   mRNA            join(<3064..3077,3175..3230,3305..3414,3495..3511,
FT                   3783..3864,3958..4009,4044..4072,4215..4316,4535..4624,
FT                   4707..>4730)
FT                   /locus_tag="An01g04860"
FT   exon            3064..3077
FT                   /locus_tag="An01g04860"
FT                   /number=1
FT   intron          3078..3174
FT                   /locus_tag="An01g04860"
FT                   /number=1
FT   exon            3175..3230
FT                   /locus_tag="An01g04860"
FT                   /number=2
FT   intron          3231..3304
FT                   /locus_tag="An01g04860"
FT                   /number=2
FT   exon            3305..3414
FT                   /locus_tag="An01g04860"
FT                   /number=3
FT   intron          3415..3494
FT                   /locus_tag="An01g04860"
FT                   /number=3
FT   exon            3495..3511
FT                   /locus_tag="An01g04860"
FT                   /number=4
FT   intron          3512..3782
FT                   /locus_tag="An01g04860"
FT                   /number=4
FT   exon            3783..3864
FT                   /locus_tag="An01g04860"
FT                   /number=5
FT   intron          3865..3957
FT                   /locus_tag="An01g04860"
FT                   /number=5
FT   exon            3958..4009
FT                   /locus_tag="An01g04860"
FT                   /number=6
FT   intron          4010..4043
FT                   /locus_tag="An01g04860"
FT                   /number=6
FT   exon            4044..4072
FT                   /locus_tag="An01g04860"
FT                   /number=7
FT   intron          4073..4214
FT                   /locus_tag="An01g04860"
FT                   /number=7
FT   exon            4215..4316
FT                   /locus_tag="An01g04860"
FT                   /number=8
FT   intron          4317..4534
FT                   /locus_tag="An01g04860"
FT                   /number=8
FT   exon            4535..4624
FT                   /locus_tag="An01g04860"
FT                   /number=9
FT   intron          4625..4706
FT                   /locus_tag="An01g04860"
FT                   /number=9
FT   exon            4707..4730
FT                   /locus_tag="An01g04860"
FT                   /number=10
FT   CDS_pept        complement(join(6205..6498,6543..6602,6642..6755,
FT                   7154..7369,7435..7540,7620..7694,7820..7852,7963..8052,
FT                   8164..8285,8434..8828,8912..9113,9215..9289,9372..9506))
FT                   /locus_tag="An01g04870"
FT                   /note="Remark: ORF classified questionable due to
FT                   implausible gene structure with short, multiple Exons and
FT                   no significant blastp similarity."
FT                   /note="Title: questionable ORF"
FT                   /db_xref="GOA:A2Q8M4"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8M4"
FT                   /protein_id="CAK37021.1"
FT                   /translation="MVYFVSFFLLHFQPRQGRKARKSHGWMLRRLNLMAKAWPLSKTRQ
FT                   GLHEDVASSPKRSHKIESSLATWPKAETGKTQEFVQTEQSLCVLPIRFLLPFQPRRQLA
FT                   VSPLDIRTGSIGPQKKYQCHKWKSVQRAMTAASIFLATVAPEELTQSGQCSAYHGSWWA
FT                   PSHRLLSSHSPYLFLSVPSGRYTPEVFPDGSIGEPGADRQRGGGLPKEELRVVEMASDG
FT                   VVRYGAVRRRRLGKCTVVKVIVARLVQKNLPFQTLFSFISFSLVGLSQAIDPSDPIASG
FT                   ATNQPIRHSLVPVSDPDVPRIGLRATRKWEAAAAPGHAASSWVLFLGWMRTTAHPRLQW
FT                   PTDVPATRYSRCTLIRWHRSRINFFDSGSAVENEACYQLIRNAGNGIKKVWVVEKESFS
FT                   LDLSDLKEDSKLESTTTTTTTIPRHGIKASAALERVHCSSAMVVVSVTGRVNTTYPTSR
FT                   MRDGAFQICGRGSTRKVQVTLAEHIGGTEGILRCSHYRGIIASIPLKGFASAKTKRGED
FT                   GNFVIPSNGYWIDTVNPYISYRAEDGAQQLLCHTKPKEIIGAMPSRASGKDRGTHMVPE
FT                   GEDINPDQRGHPITGFPANSCCVLYVPFNTFTTPSPLPSSQISTSIRYRATSWVSNHLL
FT                   HTS"
FT   mRNA            complement(join(<6205..6498,6543..6602,6642..6755,
FT                   7154..7369,7435..7540,7620..7694,7820..7852,7963..8052,
FT                   8164..8285,8434..8828,8912..9113,9215..9289,9372..>9506))
FT                   /locus_tag="An01g04870"
FT   exon            complement(6205..6498)
FT                   /locus_tag="An01g04870"
FT                   /number=1
FT   intron          complement(6499..6542)
FT                   /locus_tag="An01g04870"
FT                   /number=1
FT   exon            complement(6543..6602)
FT                   /locus_tag="An01g04870"
FT                   /number=2
FT   intron          complement(6603..6641)
FT                   /locus_tag="An01g04870"
FT                   /number=2
FT   exon            complement(6642..6755)
FT                   /locus_tag="An01g04870"
FT                   /number=3
FT   intron          complement(6756..7153)
FT                   /locus_tag="An01g04870"
FT                   /number=3
FT   exon            complement(7154..7369)
FT                   /locus_tag="An01g04870"
FT                   /number=4
FT   intron          complement(7370..7434)
FT                   /locus_tag="An01g04870"
FT                   /number=4
FT   exon            complement(7435..7540)
FT                   /locus_tag="An01g04870"
FT                   /number=5
FT   intron          complement(7541..7619)
FT                   /locus_tag="An01g04870"
FT                   /number=5
FT   exon            complement(7620..7694)
FT                   /locus_tag="An01g04870"
FT                   /number=6
FT   intron          complement(7695..7819)
FT                   /locus_tag="An01g04870"
FT                   /number=6
FT   exon            complement(7820..7852)
FT                   /locus_tag="An01g04870"
FT                   /number=7
FT   intron          complement(7853..7962)
FT                   /locus_tag="An01g04870"
FT                   /number=7
FT   exon            complement(7963..8052)
FT                   /locus_tag="An01g04870"
FT                   /number=8
FT   intron          complement(8053..8163)
FT                   /locus_tag="An01g04870"
FT                   /number=8
FT   exon            complement(8164..8285)
FT                   /locus_tag="An01g04870"
FT                   /number=9
FT   intron          complement(8286..8433)
FT                   /locus_tag="An01g04870"
FT                   /number=9
FT   exon            complement(8434..8828)
FT                   /locus_tag="An01g04870"
FT                   /number=10
FT   intron          complement(8829..8911)
FT                   /locus_tag="An01g04870"
FT                   /number=10
FT   exon            complement(8912..9113)
FT                   /locus_tag="An01g04870"
FT                   /number=11
FT   intron          complement(9114..9214)
FT                   /locus_tag="An01g04870"
FT                   /number=11
FT   exon            complement(9215..9289)
FT                   /locus_tag="An01g04870"
FT                   /number=12
FT   intron          complement(9290..9371)
FT                   /locus_tag="An01g04870"
FT                   /number=12
FT   exon            complement(9372..9506)
FT                   /locus_tag="An01g04870"
FT                   /number=13
FT   CDS_pept        complement(join(9835..10919,10994..11876))
FT                   /locus_tag="An01g04880"
FT                   /EC_number="3.2.1.20"
FT                   /note="Complex: B. thermoamyloliquefaciens
FT                   alpha-glucosidase II is a homohexamer"
FT                   /note="Function: B. thermoamyloliquefaciens
FT                   alpha-glucosidase II is involved in polysaccharide
FT                   meatabolism."
FT                   /note="Remark: a splice site upstream of the start codon
FT                   was detected."
FT                   /note="Similarity: B. thermoamyloliquefaciens
FT                   alpha-glucosidase II belongs to the glycosyl hydrolase
FT                   family 31."
FT                   /note="Title: strong similarity to alpha-glucosidase II
FT                   -Bacillus thermoamyloliquefaciens"
FT                   /note="See PMID 10945254"
FT                   /db_xref="GOA:A2Q8M5"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8M5"
FT                   /inference="profile:COGS:COG1501"
FT                   /protein_id="CAK37022.1"
FT                   /translation="MLYAEDNKLIFRFDDHLLWIQPWGENALRVRATKLASMPTEDWAL
FT                   SSKVTSIEPTISIEEHKDSSITNGKIKATVSQRGKITIYNQKGEKLLEEYARNRRDLKD
FT                   PKCSALEVEARELRPILGGDFHLTMRFESLDPKEKIYGMGQYQQPFLNLKGVDIELAHR
FT                   NSQASVPFALSSLGYGFLWNNPAIGRAVLGTNTMSFEAYSTKVLDYWVVAGDSPAEIEE
FT                   AYSKVTGYVPMMPEYGLGFWQCKLRYWNQEQLLDVAREYKRRNIPLDLIVVDFFHWKHQ
FT                   GEWSFDPEFWPDPDAMIKELQSLNVELMVSVWPTVENASTNYPEMLEKGLLIRHDRGLR
FT                   VSMQCNGDITHFDATNPSARAYVWSKAKQNYYDKGIKVFWLDEAEPEYSVYDFDLYRYH
FT                   AGSNLQIGNIFPKEYARGFYEGMESAGQTNIVNLLRCAWAGSQKYGALVWSGDIASSWS
FT                   SFRNQLAAGLNMGLAGIPWWTTDIGGFHGGDPSDPAFRELFTRWFQWGAFCPVMRLHGD
FT                   REPKPENRPTDSGSDNEIWSYGEEVYEICKKYIGIREELRDYTRGLMKEAHEKGTPVMR
FT                   TLFYEFPADKKAWDVETEHLFGSKYLVVPVFEAGKRSVEVYLPAGASWKVWGQEDVIHE
FT                   GGKEIQVDCPIETMPVFVRV"
FT   mRNA            complement(join(<9835..10919,10994..>11876))
FT                   /locus_tag="An01g04880"
FT   exon            complement(9835..10919)
FT                   /locus_tag="An01g04880"
FT                   /number=1
FT   intron          complement(10920..10993)
FT                   /locus_tag="An01g04880"
FT                   /number=1
FT   exon            complement(10994..11876)
FT                   /locus_tag="An01g04880"
FT                   /number=2
FT   CDS_pept        complement(join(12117..12187,12328..12407,12720..12792,
FT                   12847..13019,13150..13246,13301..13389,13600..13709))
FT                   /locus_tag="An01g04890"
FT                   /note="Remark: ORF classified questionable due to
FT                   implausible gene structure with short, multiple Exons and
FT                   no significant blastp similarity."
FT                   /note="Title: questionable ORF"
FT                   /db_xref="GOA:A2Q8M6"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8M6"
FT                   /protein_id="CAK37023.1"
FT                   /translation="MTLDDSQCDNDDLHVKQHMAKAVIELLVTSGISVTREKSCGGNQV
FT                   DSVSLEALQSAHITSCYRLTYEVEPMLPAISSLCPSQRYDVTERPAQESSAPRRKPRTT
FT                   LADGYQTVPQLPGHFLVLIHRLANGEARLKPGVTPTGAPGDAIFDHMRAIASNSDGVHT
FT                   PDQRSAPSLRSMMGNLTGPVFPPSPLLVISTLPRNFTSSFKECGDEAGQQHARRGVGNT
FT                   VTQAAMRP"
FT   mRNA            complement(join(<12117..12187,12328..12407,12720..12792,
FT                   12847..13019,13150..13246,13301..13389,13600..>13709))
FT                   /locus_tag="An01g04890"
FT   exon            complement(12117..12187)
FT                   /locus_tag="An01g04890"
FT                   /number=1
FT   intron          complement(12188..12327)
FT                   /locus_tag="An01g04890"
FT                   /number=1
FT   exon            complement(12328..12407)
FT                   /locus_tag="An01g04890"
FT                   /number=2
FT   intron          complement(12408..12719)
FT                   /locus_tag="An01g04890"
FT                   /number=2
FT   exon            complement(12720..12792)
FT                   /locus_tag="An01g04890"
FT                   /number=3
FT   intron          complement(12793..12846)
FT                   /locus_tag="An01g04890"
FT                   /number=3
FT   exon            complement(12847..13019)
FT                   /locus_tag="An01g04890"
FT                   /number=4
FT   intron          complement(13020..13149)
FT                   /locus_tag="An01g04890"
FT                   /number=4
FT   exon            complement(13150..13246)
FT                   /locus_tag="An01g04890"
FT                   /number=5
FT   intron          complement(13247..13300)
FT                   /locus_tag="An01g04890"
FT                   /number=5
FT   exon            complement(13301..13389)
FT                   /locus_tag="An01g04890"
FT                   /number=6
FT   intron          complement(13390..13599)
FT                   /locus_tag="An01g04890"
FT                   /number=6
FT   exon            complement(13600..13709)
FT                   /locus_tag="An01g04890"
FT                   /number=7
FT   CDS_pept        join(14085..14228,14301..15584)
FT                   /locus_tag="An01g04900"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   CAC18296.1 - Neurospora crassa"
FT                   /db_xref="GOA:A2Q8M7"
FT                   /db_xref="InterPro:IPR019416"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8M7"
FT                   /inference="similar to AA sequence:UniProtKB:NC65E11.12"
FT                   /protein_id="CAK37024.1"
FT                   /translation="MEVASAQQPSLQLDASNAAPVADTMDASMDIDMDIDLGPLPEAEP
FT                   IETEQTLVATTAVQDGSIDPLNEEAQYEKVHIRGVDELTTDNIKQFAVEHFALEEPSRV
FT                   EWIDDTSANILYSSPEVGLQALSAFTQVSEEEDASALPALRLRSAKLLSTHPDSVLQVR
FT                   SAVKADRKKPRAHEASRFYLMHPEHDPRERLRREFADRRRSGGGDVSDGDYRRRRFDGR
FT                   ELQRRRDRDAGESFSANMYDDTVPASRDRSSDRSRERRGRRGGRDLFPQEEGRLSGRLR
FT                   NRSASPGRDTLMEGGYAEDDRQDRRRFRDRSPQLGRRNEGKELFPSSGAKSSDANAREL
FT                   FPNRTAKELFPQKVSNHRRSDAIDGADETADLFSRRISVPLVDGSQDQQPARRKRDIEL
FT                   FPETTETSGLNIRGAARQDQGMSIRGAANGISIKGRGASVRELFPNKYGSNAGKELFSD
FT                   KIEGRGGPRRRAEDMFS"
FT   mRNA            join(<14085..14228,14301..>15584)
FT                   /locus_tag="An01g04900"
FT   exon            14085..14228
FT                   /locus_tag="An01g04900"
FT                   /number=1
FT   intron          14229..14300
FT                   /locus_tag="An01g04900"
FT                   /number=1
FT   exon            14301..15584
FT                   /locus_tag="An01g04900"
FT                   /number=2
FT   CDS_pept        join(16000..16261,16318..17468,17584..17622,17734..17880)
FT                   /locus_tag="An01g04910"
FT                   /note="Title: similarity to hypothetical protein EAK99938.1
FT                   - Candida albicans"
FT                   /db_xref="GOA:A2Q8M8"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8M8"
FT                   /protein_id="CAK37025.1"
FT                   /translation="MPPPSQNIPLASTLVARFLRTNNYTQTLKAFLQEAGLPSDAGEQS
FT                   GKDDATNWTIENLIEEKKAYDQSKNFERYGDNDKDKDVWTVPAPTKPNIIQTPSSSNLL
FT                   ACSVGQWQRPDAQAEPYLIATGADKHLHLFQTSPGHDLVQSFTGTSEAPILSYIPVQDG
FT                   KYILMTNMSGQLLLQKGAEIIDRRKDHAKYAVKVIAYEQKNNNDTADTFSTTTTIWIAT
FT                   AGWDSKIFLYRMQINDEAPTQIGDPIASIPLLSNPESILFTTHIDNPQDLILLVSRRDS
FT                   SNLYYYHVKPSAVSTTGYECPLIGKQNLAPHSNAWVAFSPSCLALSPHDPGLIAIATST
FT                   LPHMKVMIVRLLFPSAESLESGSAEQEQEPATQAAQAFAALSLQNREDAAILIQANTFA
FT                   PQTAYSTPQVVWRPDGSGVWVNGDDGVVRGLEVKTGKVVTLLKDGHEVGCKIRTLWAGW
FT                   VDGENGGEREEWLFSSIHYQPTWATTQARMEKISTELYTHMPVSSPTSSSTSPPTTLRY
FT                   ENRTSEKQMNHQPRE"
FT   mRNA            join(<16000..16261,16318..17468,17584..17622,17734..>17880)
FT                   /locus_tag="An01g04910"
FT   exon            16000..16261
FT                   /locus_tag="An01g04910"
FT                   /number=1
FT   intron          16262..16317
FT                   /locus_tag="An01g04910"
FT                   /number=1
FT   exon            16318..17468
FT                   /locus_tag="An01g04910"
FT                   /number=2
FT   intron          17469..17583
FT                   /locus_tag="An01g04910"
FT                   /number=2
FT   exon            17584..17622
FT                   /locus_tag="An01g04910"
FT                   /number=3
FT   intron          17623..17733
FT                   /locus_tag="An01g04910"
FT                   /number=3
FT   exon            17734..17880
FT                   /locus_tag="An01g04910"
FT                   /number=4
FT   CDS_pept        complement(join(18097..18132,18206..18308,18586..18637,
FT                   18773..18779))
FT                   /locus_tag="An01g04920"
FT                   /note="Complex: S. cerevisiae L29 is part of the 60S
FT                   subunit of the ribosome."
FT                   /note="Function: S. cerevisiae ribosomal protein L29 is
FT                   involved in the biosynthesis of proteins."
FT                   /note="Remark: an alternative name for S. cerevisiae L29 is
FT                   YL34, or RPL29."
FT                   /note="Remark: the original reference for the isolation of
FT                   S. cerevisiae L29 is Otaka, E. ; Higo, K. I. ; Itoh, T;
FT                   Mol. Gen. Genet. 195: 544-546 (1984) which is not available
FT                   via PubMed."
FT                   /note="Title: strong similarity to cytoplasmic ribosomal
FT                   protein of the large subunit L29 - Saccharomyces
FT                   cerevisiae"
FT                   /note="cytoplasm"
FT                   /note="See PMID 9008165"
FT                   /db_xref="GOA:A2Q8M9"
FT                   /db_xref="InterPro:IPR002673"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8M9"
FT                   /inference="profile:PFAM:PF01779"
FT                   /inference="similar to AA sequence:PIR:S71066"
FT                   /protein_id="CAK37026.1"
FT                   /translation="MAKSKNASQHHNSQKAHRNGIKKPKTHRYPSLKGVDPKFRRNHRH
FT                   ALHGTAKALKERKEGKREIA"
FT   mRNA            complement(join(<18097..18132,18206..18308,18586..18637,
FT                   18773..>18779))
FT                   /locus_tag="An01g04920"
FT   exon            complement(18097..18132)
FT                   /locus_tag="An01g04920"
FT                   /number=1
FT   intron          complement(18133..18205)
FT                   /locus_tag="An01g04920"
FT                   /number=1
FT   exon            complement(18206..18308)
FT                   /locus_tag="An01g04920"
FT                   /number=2
FT   intron          complement(18309..18585)
FT                   /locus_tag="An01g04920"
FT                   /number=2
FT   exon            complement(18586..18637)
FT                   /locus_tag="An01g04920"
FT                   /number=3
FT   intron          complement(18638..18772)
FT                   /locus_tag="An01g04920"
FT                   /number=3
FT   exon            complement(18773..18779)
FT                   /locus_tag="An01g04920"
FT                   /number=4
FT   CDS_pept        join(19872..20003,20080..20102,20195..20325,20436..20524,
FT                   20589..20678,20734..20766)
FT                   /locus_tag="An01g04930"
FT                   /EC_number="3.6.3.14"
FT                   /note="Catalytic activity: S. cerevisiae ATP Synthase delta
FT                   chain produces ATP from ADP in the presence of a proton
FT                   gradient."
FT                   /note="Complex: S. cerevisiae ATP Synthase delta chain is
FT                   part of the catlytic heteromeric complex ATP-synthase."
FT                   /note="Function: S. cerevisiae ATP Synthase delta chain is
FT                   involved in ATP synthesis."
FT                   /note="Remark: the systematic name for ATP16 of S.
FT                   cerevisiae is YDL004W."
FT                   /note="Title: strong similarity to ATP synthase delta chain
FT                   Atp16 - Saccharomyces cerevisiae"
FT                   /note="localisation:mitochondrion"
FT                   /note="See PMID 8026496"
FT                   /db_xref="GOA:A2Q8N0"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8N0"
FT                   /inference="profile:COGS:COG0355"
FT                   /inference="profile:PFAM:PF02823"
FT                   /inference="similar to AA sequence:PIR:S45632"
FT                   /protein_id="CAK37027.1"
FT                   /translation="MSSLRFARSAFRARPSALRVPLQRRGYAEAVSDKIKLSLTLPHQS
FT                   IFKSTGVVQVNIPAESGEMGVLANHVPSIEQLKPGLVEIVEEGGASKKFFLSGGFAVVQ
FT                   PDSQLSINAVEGFPLEEFSIDNVRSQIAEAQKIANGSGSEQDIAEAKIELEVLESLQAV
FT                   LK"
FT   mRNA            join(<19872..20003,20080..20102,20195..20325,20436..20524,
FT                   20589..20678,20734..>20766)
FT                   /locus_tag="An01g04930"
FT   exon            19872..20003
FT                   /locus_tag="An01g04930"
FT                   /number=1
FT   intron          20004..20079
FT                   /locus_tag="An01g04930"
FT                   /number=1
FT   exon            20080..20102
FT                   /locus_tag="An01g04930"
FT                   /number=2
FT   intron          20103..20194
FT                   /locus_tag="An01g04930"
FT                   /number=2
FT   exon            20195..20325
FT                   /locus_tag="An01g04930"
FT                   /number=3
FT   intron          20326..20435
FT                   /locus_tag="An01g04930"
FT                   /number=3
FT   exon            20436..20524
FT                   /locus_tag="An01g04930"
FT                   /number=4
FT   intron          20525..20588
FT                   /locus_tag="An01g04930"
FT                   /number=4
FT   exon            20589..20678
FT                   /locus_tag="An01g04930"
FT                   /number=5
FT   intron          20679..20733
FT                   /locus_tag="An01g04930"
FT                   /number=5
FT   exon            20734..20766
FT                   /locus_tag="An01g04930"
FT                   /number=6
FT   exon            21100..22485
FT                   /locus_tag="An01g04940"
FT                   /number=1
FT   CDS_pept        21100..22485
FT                   /locus_tag="An01g04940"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8N1"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8N1"
FT                   /protein_id="CAK37028.1"
FT                   /translation="MPSAFTKPVAIMQEPKSSDLEYPFCEGSDNPQNSSSQLQYKHPDD
FT                   CPARPIMTRSDTHDTDAFHIFPMDVDKEHSKNPSTSEYKMMGALFNKDTANRQGLPDLS
FT                   NDSVVLENWYESTTGPCSTLDRGTPSLARPENTTLVILNEKSLSERNSRGPVEAKSAWK
FT                   PPRPPKPRFLAHLDVAGFESYENSTPCPMPASRDGPGGHKWLAPRLLQGMDNDISKRRK
FT                   PWSDPKLGPSRYLSRPAKRGAKSYLTKNDLSQPFPGPWPSIDGLLLRQDSRIAKSSPAK
FT                   ICVRDHSNALSSPQEARESNVKRIGNWLGKLLSWVSHLSKLKERGVISISLVGQRSLQH
FT                   PRFGFASYEYSVSFKWSNTSGSIAIHQGQEEINLPAASKNATRLFRADITVPYLAMRIL
FT                   MGFCAVCRSRMSRGVMISFVRLFMRLIGLPVLYFLERLSVSLSIHPRESNTTQSARDQH
FT                   AVF"
FT   mRNA            <21100..>22485
FT                   /locus_tag="An01g04940"
FT   CDS_pept        complement(join(23105..24955,25010..25377,25428..25578))
FT                   /locus_tag="An01g04950"
FT                   /note="Similarity: similarity is from the N-terminal region
FT                   of the predicted A. niger protein to A. thaliana At2g30890
FT                   , which is 500aa shorter."
FT                   /note="Title: weak similarity to hypothetical protein
FT                   At2g30890 - Arabidopsis thaliana"
FT                   /db_xref="GOA:A2Q8N2"
FT                   /db_xref="InterPro:IPR006593"
FT                   /db_xref="InterPro:IPR007128"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8N2"
FT                   /inference="similar to AA sequence:PIR:H84713"
FT                   /protein_id="CAK37029.1"
FT                   /translation="MTADSGLSAAGSSTYASNTLHVGDGTWDSERDTYLLPNLMGINFD
FT                   TMRYNGMGNRFKDMPEYHTLIVVHGVIATIVFLFLVPISVLIIRYYSRWNPFWAFKLHV
FT                   WCQVLTLLLSTVVFVFGWFAVGPKRSLTNPHHGIGLAIYVLVIFQILWGWLVHKIERNR
FT                   RSYHVPLKLVIHRWIGRALAILGLVQIPLGLTLYGSPKVLFILYAVVAFILLAVFFVLS
FT                   YLYDTEGYHMESGGYESRLSYVSGPSAADDHGHSNLGPMAAAGATGAGLASLFRRRSRG
FT                   RPHDYDESHTSFSDEKLSDEGPRRGGKGNLLLKLGAIGGGAWLAKKFFDRRRERDNDTE
FT                   SGRYSRAHTRSDSMTEESLSRLEDGRRPEPTAHTPLNRPPSRPPSRPPSRPPSRPPSRP
FT                   LSRPQSPGSSYLYNSTYLSEAPPRRPSHGLRDALLGAGALAAIKGFFSRRKGDAEQRRV
FT                   EEMRRREMEDERLARANSKRRYPGEGYYPRRDRPASFTATDLSTDLSRPPRGPPHGESI
FT                   VSAAGPPMASGAVDGARSDIPPAPGPPVPPPAASEYPGPAASTHGPTELASGVAAGTAL
FT                   GAASSAHRRRSASRHRSSSRPRSSSRHRDPIASPPVSVKLKMHNDGRHVTLRRLTDEEA
FT                   AASREARRRERRNSRRRAGSASSLSGNEGGSYDRWRRVEELERQQQEQMQREQAAAAAA
FT                   SSGFPATSAAPSSSMPPATSAYYAPPPQNGNGSHMPPPPPPPVPSSHPYGTGSIASPGT
FT                   FTGTEASGDYASNRRRRRAERARARQERQQHGVEFT"
FT   mRNA            complement(join(<23105..24955,25010..25377,25428..>25578))
FT                   /locus_tag="An01g04950"
FT   exon            complement(23105..24955)
FT                   /locus_tag="An01g04950"
FT                   /number=1
FT   intron          complement(24956..25009)
FT                   /locus_tag="An01g04950"
FT                   /number=1
FT   exon            complement(25010..25377)
FT                   /locus_tag="An01g04950"
FT                   /number=2
FT   intron          complement(25378..25427)
FT                   /locus_tag="An01g04950"
FT                   /number=2
FT   exon            complement(25428..25578)
FT                   /locus_tag="An01g04950"
FT                   /number=3
FT   CDS_pept        join(25864..25932,26097..26256,26339..26592)
FT                   /locus_tag="An01g04960"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8N3"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8N3"
FT                   /protein_id="CAK37030.1"
FT                   /translation="MEGGGGLGSMGNRDKRTVAGHQPPVSVYPGQPPADSAICRGRPPA
FT                   YVSMIVIDTIERTLADQGVTLFAMVDALINGRSVCCSMFAGDFQSTDPSYLINSSEAVG
FT                   LSVVLIVKLTLRSSRIDQGSSTKFRSINPPRNRSTRLARNPTPAISQQSWESGQAR"
FT   mRNA            join(<25864..25932,26097..26256,26339..>26592)
FT                   /locus_tag="An01g04960"
FT   exon            25864..25932
FT                   /locus_tag="An01g04960"
FT                   /number=1
FT   intron          25933..26096
FT                   /locus_tag="An01g04960"
FT                   /number=1
FT   exon            26097..26256
FT                   /locus_tag="An01g04960"
FT                   /number=2
FT   intron          26257..26338
FT                   /locus_tag="An01g04960"
FT                   /number=2
FT   exon            26339..26592
FT                   /locus_tag="An01g04960"
FT                   /number=3
FT   CDS_pept        join(26756..26796,26871..26888,26981..27419,27491..27859)
FT                   /locus_tag="An01g04970"
FT                   /note="Function: human CTNS is a lysosomal cystine
FT                   transporter."
FT                   /note="Function: mutations in human CTNS cause nephropathic
FT                   cystinosis, an autosomal recessive disorder resulting from
FT                   defective lysosomal transport of cystine."
FT                   /note="Localization: human cystinosin-green fluorescent
FT                   protein colocalizes with lysosomal-associated membrane
FT                   protein 2 (LAMP-2) to lysosomes."
FT                   /note="Title: strong similarity to lysosomal cystine
FT                   transporter cystinosin CTNS - Homo sapiens"
FT                   /note="lysosome"
FT                   /note="See PMID 9537412"
FT                   /note="See PMID 10673275"
FT                   /note="See PMID 11150305"
FT                   /db_xref="GOA:A2Q8N4"
FT                   /db_xref="InterPro:IPR005282"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8N4"
FT                   /inference="profile:PFAM:PF04193"
FT                   /inference="similar to AA sequence:UniProtKB:AF168787.2"
FT                   /protein_id="CAK37031.1"
FT                   /translation="MATQLEIFVRALSRLLGWIYTFCWSASFYPQPINNFRRRSTTGLA
FT                   IDFPTINVLGFVCYTIYTSAFLYSPVIRHQYAARHPLAEDPTVRFNDFAFALHAVVLSF
FT                   ITYTQFWPFIWGFKVSRHQKVSKPVAGLFWGSIVGVTIVIFIVLGQSPNNGYDPYSWAW
FT                   IDVIYALSYVKLVITIVKYVPQAWVNYKRKSTYGWSIGQILFDLSGGVLSLAQLLLDSS
FT                   FQDDWSGVTGNPIKFLLSNVTIFFDLIFVVQHYILYRDAVDDSGKDRNPSDRTPLLSVS
FT                   DGQPGRS"
FT   mRNA            join(<26756..26796,26871..26888,26981..27419,27491..>27859)
FT                   /locus_tag="An01g04970"
FT   sig_peptide     join(26756..26796,26871..26888,26981..27002)
FT                   /locus_tag="An01g04970"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            26756..26796
FT                   /locus_tag="An01g04970"
FT                   /number=1
FT   intron          26797..26870
FT                   /locus_tag="An01g04970"
FT                   /number=1
FT   exon            26871..26888
FT                   /locus_tag="An01g04970"
FT                   /number=2
FT   intron          26889..26980
FT                   /locus_tag="An01g04970"
FT                   /number=2
FT   exon            26981..27419
FT                   /locus_tag="An01g04970"
FT                   /number=3
FT   mat_peptide     join(27003..27419,27491..27856)
FT                   /locus_tag="An01g04970"
FT   intron          27420..27490
FT                   /locus_tag="An01g04970"
FT                   /number=3
FT   exon            27491..27859
FT                   /locus_tag="An01g04970"
FT                   /number=4
FT   CDS_pept        join(29734..29840,29928..30885)
FT                   /locus_tag="An01g04980"
FT                   /note="Function: Fusarium sp. Tri6 is involved in the
FT                   regulation of enzymes, of the trichothecene toxin
FT                   biosynthesis pathway."
FT                   /note="Remark: the predicted A. niger protein contains a
FT                   zinc-finger-domain in the C-terminus."
FT                   /note="Remark: trichothecenes are sesquiterpenoid
FT                   mycotoxins and act as protein synthesis inhibitors for
FT                   eukaryotic organisms."
FT                   /note="Similarity: the predicted A. niger protein shows
FT                   strong similarity to Tri6 transcription activators of
FT                   several Fusarium species (F. graminearum, F. cerealis, F.
FT                   sporotrichioides)."
FT                   /note="Title: similarity to transcription activator Tri6
FT                   -Fusarium cerealis"
FT                   /note="nucleus"
FT                   /note="See PMID 10635566"
FT                   /db_xref="GOA:A2Q8N5"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8N5"
FT                   /inference="profile:COGS:COG5048"
FT                   /inference="similar to AA sequence:UniProtKB:AB017496.1"
FT                   /protein_id="CAK37032.1"
FT                   /translation="MHPSPPTCDKPFKEIGFIPLRHPESPRYMNYKYRRSRVSRALLSS
FT                   SEPSAMTSRTTINRAMLMVPGGSSTHSTMSSEVQPYLFPAIAFQQAPLSDARSMSGSVP
FT                   YAFDQAQPLHQRKPDVGTHYFQDQESYTPLFSNQTIPPQSFRPDIESFPPAIPTTDGAY
FT                   FPIDQEEWLAIAVSQSPLNPTNTDYYLPESAPSSFSQSRLTPVTTASLSSATTADLDFE
FT                   LDLDLDLDDLQLQSLSDTSSARSQTRDLTNYGIKNPDGTWRCAYPGCSSHAVFRRGCDL
FT                   RKHYNRHRKHLFCRYEGCPQAVRGGFSSKKDRDRHEAKHNPEIPCEWDGCQRVFSRVDN
FT                   MKDHVRRIHKRRET"
FT   mRNA            join(<29734..29840,29928..>30885)
FT                   /locus_tag="An01g04980"
FT   exon            29734..29840
FT                   /locus_tag="An01g04980"
FT                   /number=1
FT   intron          29841..29927
FT                   /locus_tag="An01g04980"
FT                   /number=1
FT   exon            29928..30885
FT                   /locus_tag="An01g04980"
FT                   /number=2
FT   exon            complement(32720..33931)
FT                   /locus_tag="An01g04990"
FT                   /number=1
FT   CDS_pept        complement(32720..33931)
FT                   /locus_tag="An01g04990"
FT                   /product="hypothetical protein"
FT                   /note="Similarity: the predicted A. niger protein shows
FT                   local similarity to the integrase gene in Pseudomonas
FT                   putida (aa 169-317)"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8N6"
FT                   /protein_id="CAK37033.1"
FT                   /translation="MTESYGLDEPRTPGLRPTEIDYLPKVSPPPFDTGDQSPKGGLPKH
FT                   DAEAQFPSSSRKLPEFQKPDSTEGNSVLIRHLEPNRPDIAWFETEHPLQRSTIADDFPV
FT                   LPKIIFGPEKSSVETKEPVDVVARKALNLISPSEPKEGGPSVAPKDLPVAYKEPPRRPS
FT                   IPVEEPALKEEQQQQHTPPNIPHFSHLFQDGKLPDPETRLGKLLIAPSEPAAQLPALHP
FT                   STTASAVNHNLPSLSTALAGVTDVPPPASAGRLNGSSFGPLPPVSASSPPVSRTDPVWE
FT                   HQRLGQIPPPPPQVPPSPYSHLSPASSKDMSAMSSPASQQAYWRPPIKADITYLTSTYE
FT                   TAPQTAKSPATSYPTPTDQTPASTCDRSYNPPTHPNGAVSTGTYKCRHPGCTAAPFQTQ
FT                   YLLK"
FT   mRNA            complement(<32720..>33931)
FT                   /locus_tag="An01g04990"
FT   CDS_pept        join(37614..37630,37671..37689,37749..37835,37908..38168)
FT                   /locus_tag="An01g05000"
FT                   /note="Similarity: similarity is between the N-terminal
FT                   regions of the predicted A. niger protein and the
FT                   polyguluronate lyase gene of Corynebacterium sp. (aa
FT                   7-67)."
FT                   /note="Title: weak similarity to polyguluronate lyase alyPG
FT                   - Corynebacterium sp."
FT                   /note="See PMID 9491925"
FT                   /db_xref="GOA:A2Q8N7"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8N7"
FT                   /inference="similar to AA sequence:UniProtKB:AB030481.1"
FT                   /protein_id="CAK37034.1"
FT                   /translation="MGLRAKPGNLLKLSDRSSLLLIGQSVKPSNHPILDSFRLRPWFGL
FT                   VCVGTLVSIRALPSTVNPNGSGARLKEGPLPFPYQSGKGVSSWFEPDVVEITSRTGSKA
FT                   PSCLLLFVRLPRWNDILIHLKFG"
FT   mRNA            join(<37614..37630,37671..37689,37749..37835,37908..>38168)
FT                   /locus_tag="An01g05000"
FT   exon            37614..37630
FT                   /locus_tag="An01g05000"
FT                   /number=1
FT   intron          37631..37670
FT                   /locus_tag="An01g05000"
FT                   /number=1
FT   exon            37671..37689
FT                   /locus_tag="An01g05000"
FT                   /number=2
FT   intron          37690..37748
FT                   /locus_tag="An01g05000"
FT                   /number=2
FT   exon            37749..37835
FT                   /locus_tag="An01g05000"
FT                   /number=3
FT   intron          37836..37907
FT                   /locus_tag="An01g05000"
FT                   /number=3
FT   exon            37908..38168
FT                   /locus_tag="An01g05000"
FT                   /number=4
FT   CDS_pept        complement(join(38545..38571,38807..38884,38966..39009,
FT                   39080..39094,39202..39244,39458..39511))
FT                   /locus_tag="An01g05010"
FT                   /note="Remark: ORF classified questionable due to
FT                   implausible gene structure with short, multiple Exons and
FT                   no significant blastp similarity."
FT                   /note="Title: questionable ORF"
FT                   /db_xref="GOA:A2Q8N8"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8N8"
FT                   /protein_id="CAK37035.1"
FT                   /translation="MNHDGETDDDLPSPFPYSGILVSVADLWFGWGSSLLFVMREETHS
FT                   ARVSRVEFILGSALRSHSSTLSDEGVAGLPVAKTTPQSTTQ"
FT   mRNA            complement(join(<38545..38571,38807..38884,38966..39009,
FT                   39080..39094,39202..39244,39458..>39511))
FT                   /locus_tag="An01g05010"
FT   exon            complement(38545..38571)
FT                   /locus_tag="An01g05010"
FT                   /number=1
FT   intron          complement(38572..38806)
FT                   /locus_tag="An01g05010"
FT                   /number=1
FT   exon            complement(38807..38884)
FT                   /locus_tag="An01g05010"
FT                   /number=2
FT   intron          complement(38885..38965)
FT                   /locus_tag="An01g05010"
FT                   /number=2
FT   exon            complement(38966..39009)
FT                   /locus_tag="An01g05010"
FT                   /number=3
FT   intron          complement(39010..39079)
FT                   /locus_tag="An01g05010"
FT                   /number=3
FT   exon            complement(39080..39094)
FT                   /locus_tag="An01g05010"
FT                   /number=4
FT   intron          complement(39095..39201)
FT                   /locus_tag="An01g05010"
FT                   /number=4
FT   exon            complement(39202..39244)
FT                   /locus_tag="An01g05010"
FT                   /number=5
FT   intron          complement(39245..39457)
FT                   /locus_tag="An01g05010"
FT                   /number=5
FT   exon            complement(39458..39511)
FT                   /locus_tag="An01g05010"
FT                   /number=6
FT   CDS_pept        complement(join(40180..40258,40331..40421,40599..40709,
FT                   40809..40818,40900..41070))
FT                   /locus_tag="An01g05020"
FT                   /note="Remark: ORF classified questionable due to
FT                   implausible gene structure with short, multiple Exons and
FT                   no significant blastp similarity."
FT                   /note="Title: questionable ORF"
FT                   /db_xref="GOA:A2Q8N9"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8N9"
FT                   /protein_id="CAK37036.1"
FT                   /translation="MGSPHPSPTLPPLLPLQPPTSYYPNRRKVTLCMQEEKKNHTSLIH
FT                   GRRTKAERVQAPVRPAVVLQQQQQQHSHIDDDDAGWSLVSALDPFPFPPSLPSTSAVFS
FT                   VPPRLRPPRPSLIPLFPLPSGPCKTRTIPPLSNDDEDDDDDDGTAAAAL"
FT   mRNA            complement(join(<40180..40258,40331..40421,40599..40709,
FT                   40809..40818,40900..>41070))
FT                   /locus_tag="An01g05020"
FT   exon            complement(40180..40258)
FT                   /locus_tag="An01g05020"
FT                   /number=1
FT   intron          complement(40259..40330)
FT                   /locus_tag="An01g05020"
FT                   /number=1
FT   exon            complement(40331..40421)
FT                   /locus_tag="An01g05020"
FT                   /number=2
FT   intron          complement(40422..40598)
FT                   /locus_tag="An01g05020"
FT                   /number=2
FT   exon            complement(40599..40709)
FT                   /locus_tag="An01g05020"
FT                   /number=3
FT   intron          complement(40710..40808)
FT                   /locus_tag="An01g05020"
FT                   /number=3
FT   exon            complement(40809..40818)
FT                   /locus_tag="An01g05020"
FT                   /number=4
FT   intron          complement(40819..40899)
FT                   /locus_tag="An01g05020"
FT                   /number=4
FT   exon            complement(40900..41070)
FT                   /locus_tag="An01g05020"
FT                   /number=5
FT   CDS_pept        complement(join(41357..42056,42182..42477,42533..42669,
FT                   42795..42840))
FT                   /locus_tag="An01g05030"
FT                   /EC_number="1.-.-.-"
FT                   /note="Title: strong similarity to oxidoreductase OXRD-8
FT                   from patent WO200071679-A2 - Homo sapiens"
FT                   /db_xref="GOA:A2Q8P0"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR041726"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8P0"
FT                   /inference="profile:COGS:COG3173"
FT                   /inference="profile:PFAM:PF01636"
FT                   /protein_id="CAK37037.1"
FT                   /translation="MGKEFRIAEAPRSLSVSLYTAESHVVLDMAGAVRQPIDVPSLERY
FT                   LNLNVPDIKTPLDVKQFGFGQSNPTYQLTTADGSKYVLRKKPPGKLLSKTAHKVEREYK
FT                   IIHALGNTDVPVPKAYCLCEDSSVIGTPFYIMEFLDGRHFTDPAMPGVDPAERTALWQD
FT                   AVRTLAKFHRVVPQKVGLDRFGKPTGYYDRQIATFTAVAQAQAQAVDVETKEPVGELPH
FT                   FMDMVRFFDDKTTQPQDRGTLVHGDYKIDNMIFHKSEPRVIGLLDWEMATVGHPLSDFC
FT                   NLTSPFFLDGVDHKKEMFVPKVVPGLPAREDCIRWYREVSGYDPTGDIPWGDAFFSWRS
FT                   SVIMHGIKARYALRQASSARAAEYARNTEPFALEAWERVKRVRAQLGQKARL"
FT   mRNA            complement(join(<41357..42056,42182..42477,42533..42669,
FT                   42795..>42840))
FT                   /locus_tag="An01g05030"
FT   exon            complement(41357..42056)
FT                   /locus_tag="An01g05030"
FT                   /number=1
FT   intron          complement(42057..42181)
FT                   /locus_tag="An01g05030"
FT                   /number=1
FT   exon            complement(42182..42477)
FT                   /locus_tag="An01g05030"
FT                   /number=2
FT   intron          complement(42478..42532)
FT                   /locus_tag="An01g05030"
FT                   /number=2
FT   exon            complement(42533..42669)
FT                   /locus_tag="An01g05030"
FT                   /number=3
FT   intron          complement(42670..42794)
FT                   /locus_tag="An01g05030"
FT                   /number=3
FT   exon            complement(42795..42840)
FT                   /locus_tag="An01g05030"
FT                   /number=4
FT   CDS_pept        join(43139..43478,43560..43732,43816..43899)
FT                   /locus_tag="An01g05040"
FT                   /EC_number="3.6.1.23"
FT                   /note="Complex: dUTP pyrophosphatases are homotrimeric
FT                   enzymes."
FT                   /note="Function: dUTP pyrophosphatases hydrolyze dUTP to
FT                   dUMP and pyrophosphate, preventing the incorporation of
FT                   uracil into DNA during replication, and are involved in DNA
FT                   replication and DNA repair."
FT                   /note="Title: strong similarity to dUTP pyrophosphatase
FT                   DUT1 - Candida albicans"
FT                   /note="See PMID 7874734"
FT                   /note="See PMID 8223452"
FT                   /db_xref="GOA:A2Q8P1"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8P1"
FT                   /inference="profile:COGS:COG0717"
FT                   /inference="profile:COGS:COG0756"
FT                   /inference="profile:PFAM:PF00692"
FT                   /inference="similar to AA sequence:PIR:S51498"
FT                   /protein_id="CAK37038.1"
FT                   /translation="MTKETTPPPPTTTTTEPTTNTTHEPPSLPASPLAKRTKPNTTEQS
FT                   TEPSTMGSTSTPLPPLQVKKLTPTGRAPTRGSAFAAGYDMYSAKETVIPAKGKALVDTG
FT                   IAIAVPEGTYGRIAPRSGLASKHFIDTGAGVIDADYRGEVKVLLFNHSDVDFEVKEGDR
FT                   VAQLVLERIYTPEVVVVEELAESVRGAGGFGSTGV"
FT   mRNA            join(<43139..43478,43560..43732,43816..>43899)
FT                   /locus_tag="An01g05040"
FT   exon            43139..43478
FT                   /locus_tag="An01g05040"
FT                   /number=1
FT   intron          43479..43559
FT                   /locus_tag="An01g05040"
FT                   /number=1
FT   exon            43560..43732
FT                   /locus_tag="An01g05040"
FT                   /number=2
FT   intron          43733..43815
FT                   /locus_tag="An01g05040"
FT                   /number=2
FT   exon            43816..43899
FT                   /locus_tag="An01g05040"
FT                   /number=3
FT   CDS_pept        complement(join(44146..44773,44824..44941,45001..45213,
FT                   45264..45343,45423..45433,45491..45544))
FT                   /locus_tag="An01g05050"
FT                   /EC_number="2.7.1.35"
FT                   /note="Catalytic activity: pyridoxal kinases convert ATP +
FT                   pyridoxal to ADP + pyridoxal-5-phosphat."
FT                   /note="Function: human PKH is required for the synthesis of
FT                   pyridoxal-5-phosphate (PLP)1, an essential cofactor for
FT                   numerous enzymic reactions of intermediary metabolism, from
FT                   vitaminB6."
FT                   /note="Remark: an alternative name for human PKH is PNK."
FT                   /note="Title: strong similarity to pyridoxal kinase PKH
FT                   -Homo sapiens"
FT                   /note="See PMID 9099727"
FT                   /db_xref="GOA:A2Q8P2"
FT                   /db_xref="InterPro:IPR004625"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8P2"
FT                   /inference="profile:COGS:COG0351"
FT                   /inference="similar to AA sequence:SWISSPROT:PDXK.HUMAN"
FT                   /protein_id="CAK37039.1"
FT                   /translation="MSADLLVPETRVLAVASHVVYGYVGNKMASAVMQLMGCDVAALNT
FT                   VHFSNHTGYRQFKGTRATAEEITALYEGLTQSNLLDFDVMLSGYAPSAAAVEAVGAIGM
FT                   DLQRKAEKNPGSFFWVLDPVMGDQGRLYVNDDVVPAYKKVIRHADLILPNQFEAEVLSG
FT                   IKITSLATLAEAITALHAIYNIPHVIITSVQIASLSDSPLPNTLTVIGSTTRSDGAPRL
FT                   FRIDVPALDCYFSGTGDMFAALTVARFREAVFNADPTLRNTKSWVSPDNVPATELPLAQ
FT                   STRKVLASMHCVLEKTLEARDAELRAIVPDESEKLLSQEDQQKRAHLRESKAAEVRVVR
FT                   HAQYLREPEVEFQASEWRREDLPAQFR"
FT   mRNA            complement(join(<44146..44773,44824..44941,45001..45213,
FT                   45264..45343,45423..45433,45491..>45544))
FT                   /locus_tag="An01g05050"
FT   exon            complement(44146..44773)
FT                   /locus_tag="An01g05050"
FT                   /number=1
FT   intron          complement(44774..44823)
FT                   /locus_tag="An01g05050"
FT                   /number=1
FT   exon            complement(44824..44941)
FT                   /locus_tag="An01g05050"
FT                   /number=2
FT   intron          complement(44942..45000)
FT                   /locus_tag="An01g05050"
FT                   /number=2
FT   exon            complement(45001..45213)
FT                   /locus_tag="An01g05050"
FT                   /number=3
FT   intron          complement(45214..45263)
FT                   /locus_tag="An01g05050"
FT                   /number=3
FT   exon            complement(45264..45343)
FT                   /locus_tag="An01g05050"
FT                   /number=4
FT   intron          complement(45344..45422)
FT                   /locus_tag="An01g05050"
FT                   /number=4
FT   exon            complement(45423..45433)
FT                   /locus_tag="An01g05050"
FT                   /number=5
FT   intron          complement(45434..45490)
FT                   /locus_tag="An01g05050"
FT                   /number=5
FT   exon            complement(45491..45544)
FT                   /locus_tag="An01g05050"
FT                   /number=6
FT   exon            46392..47492
FT                   /locus_tag="An01g05060"
FT                   /number=1
FT   CDS_pept        46392..47492
FT                   /locus_tag="An01g05060"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   EAA66142.1 - Aspergillus nidulans"
FT                   /db_xref="GOA:A2Q8P3"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8P3"
FT                   /protein_id="CAK37040.1"
FT                   /translation="MVSIYTPRARSARQHSQQQQLSILLCTLLALPSVLGSVLPSTAEI
FT                   SSGEIVNADLSAAHTTTTNTDQPLSLSLSPDIFTTTTTNANDDTSNLTLHPRSTTTNTT
FT                   SISTDTTDTSSSTFPTAFDTSLTNNFTTTTCATFFHNLLSNTTLTSCHAISLLLRDSTS
FT                   FFHALTSAPTTSSILDTACASNLTTCSTALTSLASQLLQSSTCLHDYNAGNQAVVSAYT
FT                   DLITYAPIYRATCLQSPETNNYCFVDAVTNTSNSVDYDVYFVPYGSAIDAAPWPTCNEC
FT                   LQATLNVYKEYASVDGQPLAESYLPTARGVNGVCGSGFADVNVTVGVVKDGVSSGGAGG
FT                   RFGGGSWGVMVVVVVGWSVGWVIGVV"
FT   mRNA            <46392..>47492
FT                   /locus_tag="An01g05060"
FT   sig_peptide     46392..46499
FT                   /locus_tag="An01g05060"
FT                   /inference="protein motif:SignalP:2.0"
FT   mat_peptide     46500..47489
FT                   /locus_tag="An01g05060"
FT   CDS_pept        complement(join(47784..49454,49508..49568,49621..50252))
FT                   /locus_tag="An01g05070"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   SPBC776.06c - Schizosaccharomyces pombe"
FT                   /db_xref="GOA:A2Q8P4"
FT                   /db_xref="InterPro:IPR012860"
FT                   /db_xref="InterPro:IPR037516"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8P4"
FT                   /inference="similar to AA sequence:PIR:T40676"
FT                   /protein_id="CAK37041.1"
FT                   /translation="MSISLPYRPADDSTLSLAATTNPSKANGHPRLSPSPSIIHRRTPS
FT                   SSGNSARRRSLGQGPSTLYPRPRRCKSQYPRDSPERHVEYILVASFHIDRGPIMEHQYP
FT                   AAISGDESMLAELMLPDQTHVRSQDWTIFFLHKDTSADADEDDASTGKKKKKKKSRIGD
FT                   AESGDGDSEDVGGSTEEESSDEEEGGEGPPLMYVLNLVNTKQDTSVKRGAVVKAMAICT
FT                   RHSFLHIYKPLLLLALEDYFKNPYPETLASLYDAVNAMDLSLMPRLSLLERLILQASNC
FT                   KDMFIEKFEQMIHQRQVEDGGPFDEEPPSPKRPAAPRYTLPRDTHEFESKIVYNDIPIP
FT                   VKVPTVIWPEVVGDFSLIKLIQIFSTPHAASPQPFPIHPHLTTSGPFTHPIIVLVNAML
FT                   TQKRVIFLGHNRPSGEVAEAVLAACALASGGILRGFTRHAFPYTDLTKIDDLLRVPGFI
FT                   AGVTNPTFANHPEWWDVLCDLPTGRMKISSHIEPAPVTEGLLYFQQQAAMHHHPPPSNN
FT                   ADPSGDNVFMEEVQRSITNRYGENAIRAKWRAYIAKFTRVAAAFEETVYGASNLYVIGP
FT                   NEELSPESPSGLQADPLDPTTLRGHGYVWPDEGSKQRELMASVARIEGWRTTRSYYSFI
FT                   QDIAAMYYPSRPIQKPDLHHHHDRLRALRLPPADAGAIYISFAHAVKDYAGICQLLTVT
FT                   PENQAGLFYLGMGLFHPHQPVREAAVDLLERIAAHPAGRHFWAQLNRFTKLAFFRIKRE
FT                   RDASTQSPASGLGNESFGPQSLVGVALGDSFRRS"
FT   mRNA            complement(join(<47784..49454,49508..49568,49621..>50252))
FT                   /locus_tag="An01g05070"
FT   exon            complement(47784..49454)
FT                   /locus_tag="An01g05070"
FT                   /number=1
FT   intron          complement(49455..49507)
FT                   /locus_tag="An01g05070"
FT                   /number=1
FT   exon            complement(49508..49568)
FT                   /locus_tag="An01g05070"
FT                   /number=2
FT   intron          complement(49569..49620)
FT                   /locus_tag="An01g05070"
FT                   /number=2
FT   exon            complement(49621..50252)
FT                   /locus_tag="An01g05070"
FT                   /number=3
FT   CDS_pept        join(51118..51120,51179..51653,51735..52135)
FT                   /locus_tag="An01g05080"
FT                   /note="Similarity: similarity is from the C-terminal half
FT                   of the predicted A. niger protein to myosin regulator light
FT                   chain from P. yessoensis, which is 100 aa shorter."
FT                   /note="Title: similarity to myosin regulatory light chain
FT                   -Patinopecten yessoensis"
FT                   /note="cytoskeleton"
FT                   /note="See PMID 6706905"
FT                   /db_xref="GOA:A2Q8P5"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8P5"
FT                   /inference="profile:COGS:COG5126"
FT                   /inference="profile:PFAM:PF00036"
FT                   /inference="similar to AA sequence:PIR:A28863"
FT                   /protein_id="CAK37042.1"
FT                   /translation="MVTSNAPFRPSPLSFGSPRPSPFRRPSTPNSHPQGRSSTPGSSPG
FT                   RGYTPVQSPSKLKESYTVEEDDGSSPKSKPRSPIAQPRFTREAPPSPTRGANAPDSSPS
FT                   LMEAKATNMMAASSDAAAKLPPAQLREIREAFQVLDRDNDGLVDKDDVADVLTNVDPTA
FT                   LSKFFPLGGPQTMNFPTFLNTLSQLLAPLSSRQELMNALAAFDEDDSGQIDVDELRDAL
FT                   LHTASEDGDHPLSDREINEVLSGFTGRRAFGGKGARAAGGGKRGEVFRYQDFVSGIMGG
FT                   TENGSTNRRDA"
FT   mRNA            join(<51118..51120,51179..51653,51735..>52135)
FT                   /locus_tag="An01g05080"
FT   exon            51118..51120
FT                   /locus_tag="An01g05080"
FT                   /number=1
FT   intron          51121..51178
FT                   /locus_tag="An01g05080"
FT                   /number=1
FT   exon            51179..51653
FT                   /locus_tag="An01g05080"
FT                   /number=2
FT   intron          51654..51734
FT                   /locus_tag="An01g05080"
FT                   /number=2
FT   exon            51735..52135
FT                   /locus_tag="An01g05080"
FT                   /number=3
FT   CDS_pept        join(53038..53409,53500..53735,53865..54278,54612..54735)
FT                   /locus_tag="An01g05090"
FT                   /note="Complex: S. pombe cdc16 forms a heterodimer with
FT                   byr4, which then binds spglp."
FT                   /note="Function: S. pombe cdc16 is required for p34cdc2
FT                   kinase activity and septum formation."
FT                   /note="Function: S. pombe cdc16 negatively regulates
FT                   septation via Spglp GTPase and its effector cdc7 kinase."
FT                   /note="Function: S. pombe cdc16 together with byr4 forms a
FT                   two-component GTPase-activating protein (GAP) regulating
FT                   Spglp GTPase."
FT                   /note="Localization: using indirect immunofluorescence byr4
FT                   localises to the spindle pole bodies except during
FT                   mitosis."
FT                   /note="Similarity: S. pombe cdc16 belongs to the
FT                   superfamily of cell cycle arrest proteins BUB2."
FT                   /note="Title: strong similarity to cell division control
FT                   protein cdc16p - Schizosaccharomyces pombe"
FT                   /note="centrosome"
FT                   /note="See PMID 9742395"
FT                   /note="See PMID 11271422"
FT                   /note="See PMID 8334988"
FT                   /db_xref="GOA:A2Q8P6"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8P6"
FT                   /inference="profile:COGS:COG5210"
FT                   /inference="profile:PFAM:PF00566"
FT                   /inference="similar to AA sequence:PIR:S35315"
FT                   /protein_id="CAK37043.1"
FT                   /translation="MRGLRKIQSHQILSSHPPSSAHPPSGRLSAGAGELAQPPQLDSPV
FT                   RLRSQRRARSNSDASSREAPAIGTQKRSARKTGSGFGVKRSVLETLLRDGPHQGNLQEG
FT                   LQELRYLVLSTRVEADADGMSTYRIYLWLVLLDVSPVPTDEYLSLIHRGRSPAYTKIRN
FT                   DTFRTMATDPLFKRRVTEASLIRLLNAVAWKLHDAKNKYRGITNESAIYVQGMNVLCAP
FT                   FLYAARSEVEAFALFHSFITRECPGYIRGAMDGVHRGLRLVDQCLEIVEPKLAAYLFSK
FT                   GLQAKLYAFPSVLTLCACTPPLPEVLHLWDFLFAYGTHLNILCIVAQLIRMRDTILESP
FT                   NPNKILRSFPPLDAKEIIALTVLIVRKIPEPLYAELIDHAK"
FT   mRNA            join(<53038..53409,53500..53735,53865..54278,54612..>54735)
FT                   /locus_tag="An01g05090"
FT   exon            53038..53409
FT                   /locus_tag="An01g05090"
FT                   /number=1
FT   intron          53410..53499
FT                   /locus_tag="An01g05090"
FT                   /number=1
FT   exon            53500..53735
FT                   /locus_tag="An01g05090"
FT                   /number=2
FT   intron          53736..53864
FT                   /locus_tag="An01g05090"
FT                   /number=2
FT   exon            53865..54278
FT                   /locus_tag="An01g05090"
FT                   /number=3
FT   intron          54279..54611
FT                   /locus_tag="An01g05090"
FT                   /number=3
FT   exon            54612..54735
FT                   /locus_tag="An01g05090"
FT                   /number=4
FT   CDS_pept        complement(join(55953..56793,56849..57044,57096..57252,
FT                   57310..57390))
FT                   /locus_tag="An01g05100"
FT                   /note="Function: N. sylvestris cp29B exists as complex with
FT                   ribosome-free mRNAs and possibly acts as stabilizing
FT                   factor."
FT                   /note="Localization: N. sylvestris ribonucleoprotein B 29K
FT                   has been identified from a tobacco chloroplast lysate."
FT                   /note="Remark: N. sylvestris ribonucleoprotein B 29K is
FT                   nuclear encoded."
FT                   /note="Similarity: the predicted ORF contains the RNA
FT                   recognition motiv PF00076 (aa 273-314)."
FT                   /note="Title: weak similarity to ribonucleoprotein B cp29B
FT                   - Nicotiana sylvestris"
FT                   /note="See PMID 11038367"
FT                   /note="See PMID 1721701"
FT                   /db_xref="GOA:A2Q8P7"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8P7"
FT                   /inference="profile:COGS:COG0724"
FT                   /inference="profile:PFAM:PF00076"
FT                   /inference="similar to AA sequence:PIR:S20070"
FT                   /protein_id="CAK37044.1"
FT                   /translation="MPFPPREKGRMAKSGRSEEEFVLFLQGIPAHCRWQELKDLVRQTA
FT                   LHIRQAVVYDDQHGFPTGLGQIIVKNEDEAWRTYHRLSTNGWEGQSLVVTLARTSSPTR
FT                   PIAGPTKSPTCVIPPNYVPGYSTPPRSTQNMAVPPSPISPEPILSASPSCPTYPATDYG
FT                   PMVNPLAMPQQPFMPFPTDPVTQQPISGIPPSPAPLRHSFGDAFAIPVFPAYPFPTMPP
FT                   FPDAPAHGGFSLPGRRAHMSGKASYGYNPAFAPQIYHSGGPGPRSSPRRTIFVQNLSPT
FT                   TTDKLLRAFIEESGATVEQSEVSTDPDTGRCKGFARVTLRTADEAKRVVAQYNGINFMD
FT                   AKIRVKIDRSLHLAYSLTRERHAGSAPSANANSPVAKNQGPYGAGNSPRSSSLSSSTST
FT                   SSKSGDHCGPLVVNGSNTGTKAVAT"
FT   mRNA            complement(join(<55953..56793,56849..57044,57096..57252,
FT                   57310..>57390))
FT                   /locus_tag="An01g05100"
FT   exon            complement(55953..56793)
FT                   /locus_tag="An01g05100"
FT                   /number=1
FT   intron          complement(56794..56848)
FT                   /locus_tag="An01g05100"
FT                   /number=1
FT   exon            complement(56849..57044)
FT                   /locus_tag="An01g05100"
FT                   /number=2
FT   intron          complement(57045..57095)
FT                   /locus_tag="An01g05100"
FT                   /number=2
FT   exon            complement(57096..57252)
FT                   /locus_tag="An01g05100"
FT                   /number=3
FT   intron          complement(57253..57309)
FT                   /locus_tag="An01g05100"
FT                   /number=3
FT   exon            complement(57310..57390)
FT                   /locus_tag="An01g05100"
FT                   /number=4
FT   CDS_pept        join(57831..57968,58054..58218)
FT                   /locus_tag="An01g05110"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8P8"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8P8"
FT                   /protein_id="CAK37045.1"
FT                   /translation="MAKSVEVGAEGAAAATAAGRVRRARIRIAKAVRMSEEMETERTVG
FT                   PGAQLVLESLRGKSGPDAWRRLGWVNLDELAKADGEEKVVVIAVEESRKDGVQAG"
FT   mRNA            join(<57831..57968,58054..>58218)
FT                   /locus_tag="An01g05110"
FT   exon            57831..57968
FT                   /locus_tag="An01g05110"
FT                   /number=1
FT   intron          57969..58053
FT                   /locus_tag="An01g05110"
FT                   /number=1
FT   exon            58054..58218
FT                   /locus_tag="An01g05110"
FT                   /number=2
FT   CDS_pept        complement(join(58869..58991,59072..59208,59323..59334,
FT                   59422..59472,59684..59769,59850..59897,59965..60107))
FT                   /locus_tag="An01g05120"
FT                   /note="Remark: ORF classified questionable due to
FT                   implausible gene structure with short, multiple Exons and
FT                   no significant blastp similarity."
FT                   /note="Title: questionable ORF"
FT                   /db_xref="GOA:A2Q8P9"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8P9"
FT                   /protein_id="CAK37046.1"
FT                   /translation="MTSPFTFSPPHPIAPGLTRPNRIGRSGYRSLTPAARALVGCLPSN
FT                   ASRTGGDLSGKVSMHGVDRLLQGSSRPNRGGPRTESRGKAGSDWGDASQARVKMLQSFT
FT                   IRHETSDPKGAIFQATAGLTEEEDDDDGDDNAICISGRCRADGPPSTLFISHQQLDRDF
FT                   VVVVAALRSGGVTLSAKRDVLECIGMRARMKRKEEG"
FT   mRNA            complement(join(<58869..58991,59072..59208,59323..59334,
FT                   59422..59472,59684..59769,59850..59897,59965..>60107))
FT                   /locus_tag="An01g05120"
FT   exon            complement(58869..58991)
FT                   /locus_tag="An01g05120"
FT                   /number=1
FT   intron          complement(58992..59071)
FT                   /locus_tag="An01g05120"
FT                   /number=1
FT   exon            complement(59072..59208)
FT                   /locus_tag="An01g05120"
FT                   /number=2
FT   intron          complement(59209..59322)
FT                   /locus_tag="An01g05120"
FT                   /number=2
FT   exon            complement(59323..59334)
FT                   /locus_tag="An01g05120"
FT                   /number=3
FT   intron          complement(59335..59421)
FT                   /locus_tag="An01g05120"
FT                   /number=3
FT   exon            complement(59422..59472)
FT                   /locus_tag="An01g05120"
FT                   /number=4
FT   intron          complement(59473..59683)
FT                   /locus_tag="An01g05120"
FT                   /number=4
FT   exon            complement(59684..59769)
FT                   /locus_tag="An01g05120"
FT                   /number=5
FT   intron          complement(59770..59849)
FT                   /locus_tag="An01g05120"
FT                   /number=5
FT   exon            complement(59850..59897)
FT                   /locus_tag="An01g05120"
FT                   /number=6
FT   intron          complement(59898..59964)
FT                   /locus_tag="An01g05120"
FT                   /number=6
FT   exon            complement(59965..60107)
FT                   /locus_tag="An01g05120"
FT                   /number=7
FT   CDS_pept        complement(join(60389..60510,60751..60776,60856..60889,
FT                   61060..61156,61250..61471,61564..61699,61904..61944))
FT                   /locus_tag="An01g05130"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8Q0"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8Q0"
FT                   /protein_id="CAK37047.1"
FT                   /translation="MRRDAAIGSMAGVLLLDRPLLWCRQWWVSLISGPWLNSVVGLASF
FT                   HRLVYSLLGVHCAMDWLTVIRWLCAGDSDNNQLDGVTKCKSIMCAHMCVVPYKTSNIAE
FT                   RSARCHGRQTIYPMVTVSAEMSDNPRPSLLRSMVVVGSSELCPEESRAIDGSPNSACLS
FT                   QEVFNSPRTTVLLILVVHATATMGDPTRAAGPWAEGEGEGVPSNHPTKVYGVVWVDRPT
FT                   IEF"
FT   mRNA            complement(join(<60389..60510,60751..60776,60856..60889,
FT                   61060..61156,61250..61471,61564..61699,61904..>61944))
FT                   /locus_tag="An01g05130"
FT   exon            complement(60389..60510)
FT                   /locus_tag="An01g05130"
FT                   /number=1
FT   mat_peptide     complement(join(60392..60510,60751..60776,60856..60889,
FT                   61060..61156,61250..61471,61564..61671))
FT                   /locus_tag="An01g05130"
FT                   /product="hypothetical protein"
FT   intron          complement(60511..60750)
FT                   /locus_tag="An01g05130"
FT                   /number=1
FT   exon            complement(60751..60776)
FT                   /locus_tag="An01g05130"
FT                   /number=2
FT   intron          complement(60777..60855)
FT                   /locus_tag="An01g05130"
FT                   /number=2
FT   exon            complement(60856..60889)
FT                   /locus_tag="An01g05130"
FT                   /number=3
FT   intron          complement(60890..61059)
FT                   /locus_tag="An01g05130"
FT                   /number=3
FT   exon            complement(61060..61156)
FT                   /locus_tag="An01g05130"
FT                   /number=4
FT   intron          complement(61157..61249)
FT                   /locus_tag="An01g05130"
FT                   /number=4
FT   exon            complement(61250..61471)
FT                   /locus_tag="An01g05130"
FT                   /number=5
FT   intron          complement(61472..61563)
FT                   /locus_tag="An01g05130"
FT                   /number=5
FT   exon            complement(61564..61699)
FT                   /locus_tag="An01g05130"
FT                   /number=6
FT   sig_peptide     complement(join(61672..61699,61904..61944))
FT                   /locus_tag="An01g05130"
FT                   /inference="protein motif:SignalP:2.0"
FT   intron          complement(61700..61903)
FT                   /locus_tag="An01g05130"
FT                   /number=6
FT   exon            complement(61904..61944)
FT                   /locus_tag="An01g05130"
FT                   /number=7
XX
SQ   Sequence 62077 BP; 15468 A; 15830 C; 15806 G; 14973 T; 0 other;
     ggagaaaaag tgcgagcaag tctacggtac cgatcagtcg ggcgtcgact aaacgggaaa        60
     atcccaaacc tagttggtta gttcacggcc cttttccgct tcttatggca gactgcagac       120
     catgggcgat ctatccacca gacccagttt cgactgctac tactaggtaa gtatggactg       180
     gcccatgctt cgtcaaagtt caggccctga caggaaaacg ggagcggcag aaacggtctg       240
     gaggtaggcg aatgagcata ggagtggtca tactgaccgg atgggtttcc atgggtcagt       300
     caggcggggc gggcaacctc ggaattagaa attctgatgg aggggaggaa aggcaggaaa       360
     aaagagaaaa agagagagag agagagcagg ggacagggaa gtagattgcc gatttgagaa       420
     agatgcggaa aaatgacaaa gagcacctcc gagtggttgc ataatggcgt taaggtgtac       480
     cgagatcgtg gacaggcgcc cgcaccacca ccaccccccc tcctccttct tctccccagg       540
     caagttgata ggcaaaaagg gccattgtag gcaaaggagc gagtcatggc ttatccagtc       600
     taggtataca ttgcgcttca tctacgattt ctactattga gatgacaatt cttgttgcgc       660
     attgttcaca gctaccaaat actaggtaag tttattttcc ctcctcccaa caccactata       720
     gctactattg cttgcaggaa ttcaattcga gaccatatcc atcagccagc catgaaggcc       780
     tttttttcca ctttttttac cctcgagtaa agtacgagat agatactact acaatacgta       840
     gttagcactc caatggagcg atttgtaacc ctgctacttt tggcctcacc cttggctggt       900
     agcgcccatt ggccgccgct aaccctcatc cgcaccggac gcaggcttga tccctcctcc       960
     actccccgtg ggccgttacc cagaacatga accgtttgag tgggggcagt gattggtgca      1020
     gagccggcta gcgccctttg aagatttgga atcttttggc tttgtctcat acccgggagg      1080
     gttgggatcg acatggggat catacgcaat ctcgaatctg ggccggagta ccttcgcgcc      1140
     ggtgctaccg gctgccaggc ataaggcaag cgcacttacc agagattacc aaagatcgga      1200
     ctcgttctca ccaccgaatt gttagtcagc ttggtcttaa ctccttaagg tgaccaatca      1260
     ttacggcata ttgcctcgga tatcttttct cgctttttcg tttcgtttct tacacacaga      1320
     tgctcactag cccactcgat ctgaatccct ctgcaccaga gacacgggac cgctgtcccg      1380
     tctcctcggt tcattgtcgt tattttctgc atctcgaagt cgatcaggaa cgaagataaa      1440
     ggttttgaag tcgattggct aaggacaata cagtggatgc ccgtgcagtt ggctcagata      1500
     ggtactaagt acgacttact actcctacta ctattatgca gtggattact attactcgct      1560
     tatttcggac gcaacgcttg aaccacattc ccattcgccg tatagagtaa acagaagggg      1620
     agatggatgg gagaaaaaat gggttactac gtaagtagat tttcttcggt ccatccaacc      1680
     agcacccagt atacaagttc ctgactcact ttgacctgca gggttctatc cgggtaaggg      1740
     atccgcgacg agactcacca ttgtaggcaa tgcaacagaa gtatgataga tctcatggaa      1800
     tcctcaggtt cccccttttc gggattgccc atcaatgtgg cagagtggcc ttctgcctct      1860
     tcattggctg ttcgcctgga gcatggccct cccagccagg tactagcctc accctgctct      1920
     gcagctacga agtgcgtaca taaattaaaa aagccccgta tattgtcctt tctacgatga      1980
     ctttggtcac gatcatccgg ggaaggtcgg aagattccaa atgtatcgtg accaacggaa      2040
     agtaccagtg cctttatgag gggttacctg ttttcctaag ccatacagag taaagtgctc      2100
     gtcagctcac cgcgccggta ccgtcccgct gtcatactaa gcggtgggaa tggatggggt      2160
     caactcgaga agctaaagtt aaccatccta gactatggga ttactagtac tattcgcctg      2220
     ccatccatcc accaaaacct tgccctcgga gctatttgtt cgatcggata caacgttgct      2280
     gcgattgggc gatctaggct gatcactctg tgctcgatgt aagagcgctt ggcgaatcga      2340
     cggccctcgt agtgtgtcct cgattcccag tggtgtggga actgggaagg gggggaacaa      2400
     taaacttcgt caaatgttca agacgatcgg atccagatca tcgtgcagtc atctctgcag      2460
     gtctatcatc tactcttctc gtccaaacta ttagcaacta tgaaggcatc gccatgtttt      2520
     gccatgcgtc gtttcttctt gcagtaacta ttgttccagg tcaccaccac cctccatcgg      2580
     cgtctccgag aaaatcttcc aggcttctat tttccctgcc tagcctctcc ccgaactgat      2640
     ggaatttgat aaagattttc tccgtgtgaa gggggagggg aaagaaatta tcggggtcat      2700
     ccgacctgta ttggctgggt ttgtcttgcc acaggctcgc tctcacacac acacacactc      2760
     tctctctctt acagcacaga gcaacagatg gcccccctct cccgccttac atcgtttcgg      2820
     aagtagtgac atacataatt tcttaccgga atgctttgtg ggtaaccaaa tgtcaccttc      2880
     accggctcaa cggaaattca aagctccatt ttttcttagc aaggcgcggt tgacggaggt      2940
     cgcttacagg tgtcaagtca ccggtgggaa agaaaaaaaa tggcacctca ggggaaagag      3000
     tgccacgagt caagccgttg aacgtcatca aatcatggag cgcgcaatgg aaaaacctac      3060
     tacatgcttc ctgtaaagta aggatggaag cgaaggaagg gctgtgtgga cggttggagt      3120
     gtaacttggt cgggcctaat tgtcatcaat accgccatac tggtagtacc gcagcctagt      3180
     tactgaggta tcagtgacca attggttcct caacccacct aaacaggcta gtaagcacga      3240
     acccctgagg acctgaagtc ctgagaactg catgacgtga cgaaccactg ccccatattt      3300
     gcagctgatt ggtctgccaa aataaggtat ttgtcattct ggaagcgcgg ggctagtcct      3360
     atccagggaa tgatgatcgg ggacttggga gggaggggga aaagagcgat ctcggtaggc      3420
     ttttgcaacc tcgtcaaaag gacgagacgc acttagatta atcttgattg aggcgagatt      3480
     aatgcaattg acaggtacga tctggagaaa tgtaattgat ggtctcggct cgcgatagtg      3540
     ttttagctat gctttaacga ggttcaatgg acaatagcat tctccttctt tggatctttt      3600
     agtcattttt ccttttccac cacacccccc tctctttctt gtctttgcct ccacacgcac      3660
     acacaaacac acacacgcac aagctgaaca aaaaatcaaa tcatgttgtg ggccggaccg      3720
     ccaaccaaat cgctcataag catcccgtca actgttgtga cccagtaatt attagtggat      3780
     agatactata cacaaccatt tacctccatt acattccagg tccccgaacc ccatcccatc      3840
     ccatccatgt caacgtccgt taacgtatgt tcccgcccgc ctgggcttac ctcgaatcta      3900
     caaaaaataa actggcgtta ccccgggaaa cagatattta aataaaaaaa aaaaaagcct      3960
     tggtctcaca tgaaatacaa aaatccctcc acagctattg aacttctacg taagtagact      4020
     ccgataaata aacaggggga aagaggtggt tctgagcggt gtcaaacgcc atgtacgtcg      4080
     tgggagggtt acaattctgc catgtggacg ggtacttgcg atctgcctac ctttacctcg      4140
     tggtacggag taccgtgtac acaacgaacg aacaaacgga tttacataca tatttactta      4200
     cttacaggaa caagtcatac atcgccttac ttacacagct tttttactcg gttactacta      4260
     gtaagttgac tcccccatta tttttaatgt acttcaagag actggagtcg acatacgtac      4320
     gtcatttgtc aaagatacta cttagttatt attactccgt actttgtatt aagtaccacg      4380
     aaaatcagag gtgatcgtcc ttttgaaaag accacagcgg cccgccgaaa tatatatttc      4440
     tgaggcagat ggacaactac ttattataca tatgaccaat ccaacagttt caattccaca      4500
     cagctgtaag gtaccatcac tacatacatg aaaggtaaat aattataata ataataataa      4560
     aaggatttac tccacctcta tcgcgaccac cacctactat agacccggct ggacggaagc      4620
     aaaagtaagt cagaaggaat cgtgtactat tgaatatatc acgaaggagc cacaagagtc      4680
     taaatcctag taacgatgat gtacagtgct acgaccaaca tactacttaa cttgcccggt      4740
     ctagtctaac tactttgttt aaccccggtc gatggtcccc gatgtacctt ggccttgggt      4800
     tgccaatcag agacacggga agtatttgag ataaaccctg gttgacccat acctttagcg      4860
     tgcagcactc gggattcttg attgatctcc ctgccacttg ccatattcgg gatatattca      4920
     gcagtgcctg gccgctgaat atattaaatc ttcagctggc tccacgatat tattattgat      4980
     attatttttt gaagcgtaag atgttaattt tggtacctgt ctaactgtgc gctactgatt      5040
     tagttgaata tggtttcttt gagggggaca caaggcagat tttttattat tttttcgcgt      5100
     actacagaag gtcaatagaa atgtaacagt gagcgacaga caacaggttc taagcgagac      5160
     cgcgaccgcg accgaccttg cgtcctgtcc ctccatacgc acacatacat acatgcacac      5220
     agcgtctgca ggacgtcgtg taaccgtcag aaaagaaaac cagtaacgag agaaagaaag      5280
     agggtgagag agaccaagac agatgggcag ggatccccga ctgcaggaca ccctgtatgg      5340
     gggggtcagt tgaagagtgg agcgaacggc tctctcgcat cccgccgctg tttcctgact      5400
     gtcgggcctc caaatctgcg aacctcagga ggtccgagca ccgctgtcag ttagggagtc      5460
     tcttgtcttc cgcgggtgag gaaccaatgg aatttcaaga caggtaaaga agacagaaaa      5520
     taatcactga gacaataacg agtttactat tacgctgcta ttcatctttc tcttttgttg      5580
     aattcgacgc tttcatgtat cttagagata gataacgcat ggctattgat aattcttccg      5640
     cgaaattatt attctttttc ttattcttcc tttttttctc ccatgcgttt accgagtcag      5700
     tagaccccgt ttgtgtacca cagtcccgac acatgccctg tcgatttata ccggcgcatg      5760
     attagaattg gggaacatag tacctgggga cgatgaaaag gattcattgt cttcattcag      5820
     taatagtaaa ctggcggttg cgatcgtaag ttacctacat cgtctgaact agtgttgaaa      5880
     cattctcgag gataggtcga gtccgtacta tgttgttgca tccttctcta cctatcatcc      5940
     ttgcttggtg gcacctagtt ataattttcg aatttatttt gttcatccgt tttccgtatc      6000
     ctagcattgg ggccggagtt cacctggacc ttgatccatg gtcaaaaaaa cggtcaaacc      6060
     cgtcccgtga taacatgtat ggatcgagag gggcggtcca gatctaaggt acgtgtgtgt      6120
     aggtattctg ttgtcctcac ctccctctga cgtcggagaa tgtgcaatca attccggtag      6180
     tacccagtca agggctccca tcgtttagct agtatggagt agatggttag agacccatga      6240
     cgtcgcgcgg tatctgatgg aggtggagat ttgagaagag gggaggggtg agggagtggt      6300
     gaatgtgttg aagggtacat acaggacgca gcaagaattg gcaggaaagc ccgtgattgg      6360
     atgccctctc tgatcggggt ttatgtcttc cccttcgggg accatgtgag ttccccgatc      6420
     tttcccagat gcccggctgg gcattgcccc gattatctct ttgggtttag tgtgacaaag      6480
     gagttgctgt gccccgtcct cccggctgac caggatcccc accgggggtt gtgttacctt      6540
     acttcagcgc ggtaactgat gtatggattt accgtatcta tccaataccc attacttggt      6600
     atctgtaacc aagtagaaac acccagttac ttcactgcca ccacgaagtt accatcctcc      6660
     ccccgcttcg tttttgcgct tgcgaatccc tttaagggga tagaggcgat gatgccgcga      6720
     taatggctac accgcaggat tccctcagta ccaccctttc gtcagaatag taactattcc      6780
     agtatctaat ccagagttca tacgtatgta tacatctggc gtcgggtatt gaactagcta      6840
     tgcctgtctg ccagagtaac caggtagttc cccgtagata actcgatgta tctaagatgt      6900
     tggatggatg atgtatactg atactataca tggatggcta gcaaaaatat ttggagtgat      6960
     gagtggttgt gtaatgctct ttctttcgtc ataggcgagg cacatacaca ttgtgtttgt      7020
     attgtacttc ctgagctgga aagagtacag ggatggaaag aactactctc tctctctctc      7080
     tctttctctt ttcctcagct caagaaaata ctatcttcat catcttcatc atcttcatcc      7140
     tccatgtata tacaatgtgc tcagctagag ttacttggac tttccttgta ctaccccttc      7200
     cacagatctg gaaagcccca tcgcgcatcc tagaggtcgg atacgtcgtg ttgacgcggc      7260
     ctgtcactga tactaccacc atggcagagc tgcagtgaac tctctccaat gcagctgacg      7320
     ccttgatccc atgtcttggt atggtggtgg tggtggttgt ggtggattcc tggaccaatg      7380
     cagattaatg tgatgtgacg gcactattga cttttgtcga aactggaatg caaccagctt      7440
     cgagtcttcc ttgagatctg acaaatcgag tgagaaactc tctttttcca ccacccacac      7500
     cttcttgatt ccattcccag cgtttctaat cagctggtaa ctggaggggg gtcacaagac      7560
     atcatcaaca tcagcatcag catcagcgtt gcccgttgtg cttctatcca agccgttacc      7620
     aggcctcgtt ctccacggca ctcccgctgt caaagaagtt tattcgtgac cggtgccaac      7680
     ggatgagtgt gcacctgcag cctaggtccc gtggtggtca gagagtgatc agagtaacat      7740
     acaactaacg tcctgggacg ggaggccctg ccatctgggg ccaagaggtg aatcatcaat      7800
     aggatggttc acggattacc gactgtagcg agtggcagga acatcagtgg gcctccgggc      7860
     caaccagacc aagccagtgc acccgaataa acccaatcta cccggtcaaa actcaatctt      7920
     cacgacccat tcagccttca gtcccggcgc tgaggtaagg accattggag ccgtggatgt      7980
     gccgtcgtcc tcatccaacc aagaaaaaga acccacgagc tagccgcgtg cccgggagca      8040
     gcggccgctt ccctcctccc aagaaggatt gaatcttggt ccgtttccat ggccttggag      8100
     ccacccgttc ttccttaatt tcccttcttt cccgtcaaat ccccagtctt ctgcggaggc      8160
     taccattttc tagtagccct caggcctatt ctcggcacat ccgggtcaga aactggaact      8220
     agggagtgtc ggatcggttg gtttgtcgca ccactggcaa tggggtctga tggatcaatc      8280
     gcttgctaac atcagcccgg ggagatactg agaataggaa cgatggaaac gatggcgtcg      8340
     cactacttgt ccctaaggat tcagggttaa gctttggcct caatcctttt tttttttttt      8400
     cttctgcaaa aaggaaaaac ccacaaaggt aaccgagaga ccaacgaggg aaaaagaaat      8460
     aaatgaaaag agggtctgga acggcagatt cttctgcaca agccgtgcta cgatgacttt      8520
     gacgaccgtg catttgccga gtcggcgtct acgtacggct ccataacgaa ctactccgtc      8580
     agaggccatc tccactaccc tcaactcctc tttaggcaac cctccccctc tttggcgatc      8640
     cgctcctggc tctccaatcg agccgtcagg gaagacttcg ggagtatacc tgccagacgg      8700
     cacggaaagg aacaaataag gggagtgtga agaaagcaag cgatgcgacg gtgcccacca      8760
     ggacccatga tatgcactgc actggccgct ttgagtcaac tcttccggag ctacagtggc      8820
     taggaaaact ggttgaagcg tgaggaaagc tgaaatggtt acataattcc gcgcgaggcc      8880
     tttcgattcg ctgccagaag ttatggttca ctagacgcag cagtcatagc tctctgcaca      8940
     gacttccact tgtgacattg gtacttcttc tgggggccaa tcgatcccgt tcgtatatcc      9000
     aacggtgaga cggccaactg tcttcttggc tggaaaggaa gaaggaagcg aatagggaga      9060
     acacacaaac tctgttcagt ctggacaaat tcctgcgtct tccctgtttc cgcctattac      9120
     agactagaaa ctattcctcc tattgataaa tccatacgtc tgtggctggg ctgagccata      9180
     catacccttt tctttttcct gccagaaccc aaaccttggg ccatgtggct aagctggact      9240
     caattttgtg gctacgcttg gggctactgg cgacatcttc atggagaccc tggtcgccac      9300
     tagatcgatc gaagaggaaa atgaagaaat ctaagagagc ttccagactc atcttgtaga      9360
     atgttcgcta cttgtctagt cttcgatagt ggccacgctt ttgccatgag attcagtcgt      9420
     cgaagcatcc atccatgcga ctttcttgct tttcttcctt ggcgaggctg aaaatgaagc      9480
     agaaaaaaag aaacgaaata aaccattgac ccaagtattg aaaaaaaagg gtcatctaag      9540
     tcgcctttga atttgtcatt tgcccctccc tagttactgt ttcttgctac ctgatggatc      9600
     gatgcacttt ggctacgata tcccagcgac ttattgtaag ttacctaagg tgtagagtcc      9660
     atcacataca catgctgaca gattgcattt gtgattactt agtgaatgtt ggctgaacta      9720
     atttctccct tctctgacaa tttgcaaatc gatacatcca accctgctcc ggctatacct      9780
     ccccgtcgat acatccagcc atcaccttca ggcaacctaa attattcacg agactcagac      9840
     cctgacaaat accggcatcg tctcaatcgg acagtccacc tgaatctcct tccctccctc      9900
     atggatcaca tcttcctgac cccaaacctt ccacgacgcc ccggccggca aatacacctc      9960
     aacagacctc tttcctgcct cgaacaccgg cacaacaaga tacttcgagc caaagagatg     10020
     ttctgtctcg acgtcccacg cctttttgtc agcgggaaac tcataaaaca gagttcgcat     10080
     gacgggcgtt cccttctcat gcgcctcctt catcaacccc ctcgtgtaat cgcgcaactc     10140
     ctcgcgaatc ccaatgtact ttttacagat ctcgtagacc tcctcaccat acgaccagat     10200
     ttcattatcg gagcccgaat ccgtaggccg gttctcgggc ttgggttccc ggtcgccatg     10260
     caagcgcatc acaggacaga atgcccccca ttggaaccac cgcgtgaaca gctcccggaa     10320
     tgctgggtcc gacggatcgc ctccatggaa gcccccgatg tctgtcgtcc accaggggat     10380
     ccctgccaga cccatgttta gcccggccgc tagttgattg cggaacgacg accacgagga     10440
     tgctatgtcg ccgctccaga ctagggcgcc gtatttctgg ctcccggccc aggcgcaccg     10500
     taggagattg acgatgttgg tttgccctgc ggattccatg ccttcgtaga acccccgcgc     10560
     gtattctttc gggaagatgt ttccgatttg caggttgctg ccggcgtggt accggtagag     10620
     gtcgaagtcg tagacggagt actcgggttc ggcttcgtcg agccagaata ctttgatgcc     10680
     tttgtcgtag tagttttgtt tcgctttgct ccagacgtag gcacgcgcgg atgggttcgt     10740
     agcgtcgaag tgggtgatgt cgccgttgca ttgcatggac acgcggagcc cccggtcgtg     10800
     tcgaattagg aggccctttt cgagcatttc ggggtagttg gtcgatgcgt tttcgacggt     10860
     tggccagacg gagaccatta attcgacgtt tagggattgg agttctttga tcatggcgtc     10920
     tgcgtggtgg tgggttgtgt tagttgttga aataagggtt ctttatatat ctagatgtat     10980
     gtggagaact taccgggatc cggccagaat tcaggatcga agctccattc tccttgatgc     11040
     ttccagtgaa agaagtcaac gacgatgaga tccagtggta tgtttcgtcg cttgtattcc     11100
     cgtgccacgt caagaagctg ctcctggttc cagtatcgca gcttgcattg ccagaaccca     11160
     agcccgtact cgggcatcat tggcacatag ccagtgactt tgctataggc ttcctcgatc     11220
     tcagccgggc tgtctcctgc aacgacccag tagtcgagca ccttggtaga ataggcctca     11280
     aagctcatgg tattcgttcc caacacagct cgtccgatag ccgggttgtt ccacaggaac     11340
     ccgtaaccaa gggaggagag cgcaaagggg acgctggctt gggagttccg atgcgctagc     11400
     tcgatgtcta cacccttgag gttgaggaac ggctgttgat actggcccat tccgtagatc     11460
     ttctctttag ggtccagcga ctcaaatcgc atggttaggt ggaagtcgcc tcctaggatt     11520
     ggtcgcagct cgcgagcttc gacctctagt gcgctgcatt tggggtcctt gagatcgcga     11580
     cgattgcgag cgtattcttc gagcagcttc tctccctttt gattgtagat ggtgatcttg     11640
     ccgcgctggg atacggtggc tttgatcttg ccgttggtaa tgctggagtc tttgtgctcc     11700
     tcaatgctga tggtaggttc gattgacgtg accttggagg ataaggccca gtcttcggtg     11760
     ggcatggaag ccagcttggt agctctcact cggagtgcat tttcgcccca tggctgtatc     11820
     cagaggagat ggtcgtcgaa ccggaagatg agtttgttgt cttcggcgta cagcattgtg     11880
     ttgatgtgat tgtctgggtg ggtgtgcgaa gaatgtaggc tctgaaggtc acaggagtat     11940
     gggaagggtt ctaattgatt taaatctgtc agtctagaaa tgagactgag aggggtgttt     12000
     gaacatgctg tgcaattgca gcccctcacg atgaccggtc taacccaagg caagagcatt     12060
     gacactaaca gttgaacaga tgcagtccaa ttaggagaag gacacaaagt attctgctat     12120
     ggccgcatcg ctgcctgcgt cacggtgtta ccaacgccac gacgggcatg ctgctgacca     12180
     gcttcatctt cgtccagtaa aaaaggcagc gtagagaaac gactgctcta aagcgagtga     12240
     cttgttccgg ccaagagatc ggaagtcgtt ttggtccacg aatagcattc atcggactgg     12300
     aatatggcaa tatagcctaa tcttaaccgc cacattcctt gaatgaggag gtgaagttcc     12360
     ggggaagcgt cgagatgaca agaagcgggg aaggcgggaa cacaggcctg catctggtca     12420
     agattgcatt aatgctatct tgactctacc ttgagtcgac ccatcatcgc ttctttgcta     12480
     gattattaga atgatctata tcatattatc ctaggtggat ggatccacgg ttctgtcttg     12540
     aaaagaagcc ggcggtagcc gttgttgctg tagacggcct tcaatgtcaa tgtagactaa     12600
     tctaccatga tgttcgctct aaatttcgga tcacttacac ttttacgcta caacgatatc     12660
     tacgagtggt attcaatatc gcagtggttt aagcccagca ggaacgtcgg ggcgacaacc     12720
     cggtaaggtt acccatcata ctgcgaagcg acggcgcgct acgctgatca ggtgtatgaa     12780
     ccccatcaga gtctgtaaaa cagactcgtc attcgacaac ggcaatggcg ggagtgacaa     12840
     caaaactaga agcaatggct ctcatatgat caaagattgc atctcccgga gctccggtgg     12900
     gggtaacccc gggttttagc cgggcctcac cgtttgctag acggtggatc agaacaagaa     12960
     agtgacctgg aagttgaggc accgtttgat aaccatctgc tagggtagta cgtggcttgc     13020
     tatatcactt gctggaggct aaatgagaga cttccaatga tgggctgcga acaaacgaaa     13080
     agacatcgcc agcgatgtta tataacacta taacatagcg tcattctctt gtgaattagc     13140
     acatgctacc gtctaggagc agaactttcc tgagcaggcc gctcagtcac atcgtatcgt     13200
     tggcttggac agagagacga tatagctgga agcatgggtt caacctctca tcggtggata     13260
     ctgaaaacat agggaagaac catgttcact ttcgtcacac cataagtgag gcgatagcaa     13320
     ctggtgatgt gagcagactg caaagcttct agagagacac tatcaacttg gttaccacca     13380
     cagctcttcc ttgcatcagg attccccgat taactgcata ttcatggcaa ttatattctc     13440
     ggtgtggaaa ggctggcatc attgttcatg atagaatcag aagcatgtcc tgatgtcgat     13500
     aggagtgttg cttcagggtc agttgtaggc agtgacagac tagtcagata actttgtccc     13560
     gtttggcaca gttttttcac gagcatgcca tgaccttact cccgagtcac tgagatacca     13620
     ctggtgacca gcagctcaat gacagcttta gccatgtgtt gcttgacatg aaggtcgtca     13680
     ttgtcgcact gactatcatc aagtgtcatg gacagcactt ggctatgtga tcagtctgac     13740
     ctgctttatg aggacctgtg aatatcgaca gaataagcgc gctcttctct gagatttgat     13800
     tgatagttga gaatcagtcg agtagatcat ctgtttgaag tgacaaaggg agcatcgaca     13860
     tcatcgcctg cggcagcggc gaaactccgc cggcgactgg tccgggcggt gtagaagaca     13920
     acttcctttc ggcttcactt tacgctcatc tcagcctcct tggcgcccct cttcttctct     13980
     gttttattgc catcgagctt tgttaaagat actctactct gattttcatt ttgttttggc     14040
     attacatcca atacccgcct cttccgacta agtttcctcc ctcaatggag gtagctagcg     14100
     cgcaacagcc ttctcttcaa ctagacgcct ccaacgctgc cccggttgct gacacaatgg     14160
     acgcctccat ggatattgac atggacattg atcttggacc ccttccagaa gcagaaccaa     14220
     ttgagactgt gagtattact attgtctgat ctattacaga ttccagtcgt ccactcctaa     14280
     cgtcttcgtc gactgtccag gaacaaactc tcgtggcaac gactgctgtt caagatggat     14340
     ccatcgaccc tcttaatgag gaggcacagt atgaaaaggt tcatatacgc ggtgtagatg     14400
     agttgacgac agacaacatc aaacaattcg ctgtcgaaca cttcgccctt gaggagccaa     14460
     gccgcgttga atggatcgat gacacatcag cgaacatcct atactcttcg ccggaggttg     14520
     gtcttcaagc tctgtcagca tttacgcagg ttagcgagga ggaggatgca tccgcgttgc     14580
     ctgctctacg gttgcgatcc gcgaagctcc tctctaccca ccccgactct gtgctccagg     14640
     ttaggtcagc tgtcaaagcg gatcgcaaaa agcctcgtgc gcacgaagcc agtcggtttt     14700
     acctcatgca ccctgaacat gaccctcggg aacgcttgcg acgagaattt gcagataggc     14760
     gacgctcggg aggtggagac gtcagtgacg gggattatag acgaagacgg tttgatggtc     14820
     gagaactgca acgtcggaga gaccgtgatg caggcgagag cttcagtgcc aatatgtatg     14880
     atgacacggt gcctgccagc cgcgaccgct cgtcggaccg cagtcgcgaa aggcggggaa     14940
     gacgaggggg gcgcgatcta ttcccacagg aagaaggacg attgtctggt cgccttcgca     15000
     accgtagcgc gtcacccggt cgagatacac tgatggaagg cgggtatgct gaggacgatc     15060
     ggcaggatcg cagacggttc cgcgaccggt cgccccagct cggtcgccgc aatgaaggca     15120
     aggagctctt cccatcctcg ggagccaaaa gcagcgatgc aaatgcgcgg gagctcttcc     15180
     cgaaccgaac agccaaggaa ctctttcctc aaaaagttag caatcatcgc cgttcagacg     15240
     cgatcgatgg cgcagatgag acggcagatc tcttctcgcg gaggatttca gtgcctcttg     15300
     ttgatggcag ccaagaccaa caacctgcgc gccgaaagcg cgacattgag cttttccctg     15360
     agacgaccga gacaagcggt ctcaacatcc gcggggcagc aaggcaggat cagggaatgt     15420
     cgattcgtgg tgcggcaaat ggcatctcaa tcaaaggacg gggcgcgtct gttcgtgaac     15480
     tgttccctaa taaatacggt tccaacgcag gcaaggagtt gttttccgat aagattgagg     15540
     ggcgaggagg accacgacgc agggcggagg acatgtttag ctgagggctt aggttcgggc     15600
     agaccttttt gcaagcaaca tgtcatgttg ctatgtgtat aatttgcctg actggtttct     15660
     ctttggttgt cgctcggctt ttgcttggat ggtggtgcgc aaagttcgat aaaatcggct     15720
     gacatcggtg ataccaatct ttccttctat atatatttta ttcttttgta cttcagccta     15780
     tgcccaatga gaacatccta cctctctact agatgcggta tcttcatgaa gcgtagtgct     15840
     caggaggtct gtttgcgcag gccactttca atccggtgtc ggaaacatag atctggctcg     15900
     agtggagcga tgaagctact agcccgatat atatatcttt cccccagtta tcgctcgaca     15960
     aagtacattc cgttgctcaa ccccagccca acctccaaaa tgccaccccc atcgcaaaat     16020
     atcccactag ccagcaccct cgtggcccgt tttctacgga caaacaatta cacgcaaaca     16080
     ctcaaagctt tcctgcaaga agcggggctc ccgtccgacg cgggagaaca gagcggcaaa     16140
     gacgatgcca ccaactggac catcgagaat ctgatcgagg agaagaaagc ctatgaccaa     16200
     agtaagaact tcgagagata tggtgacaat gacaaggaca aagatgtctg gaccgttcca     16260
     ggtctgtgta acaccttcat gccccgctag aagctagaaa ctaacctgct cttacagcac     16320
     ccaccaagcc caacatcatc caaacgccaa gcagttcaaa cctactggca tgctccgttg     16380
     ggcaatggca aaggccagat gcacaagcag agccatatct gatcgccacc ggcgcagaca     16440
     agcacctcca tctcttccaa acatctcctg gccatgacct cgtccagtca ttcacgggca     16500
     catcagaggc cccaattcta tcgtatatcc cggtccaaga tgggaaatac atcctcatga     16560
     ccaatatgtc aggccagctt cttctgcaaa aaggcgcaga aatcatagac cgccgcaagg     16620
     accacgccaa atacgcggtc aaagtcatcg cctacgaaca gaagaacaac aacgacacag     16680
     cagacacctt ttccaccact acgacaatct ggattgcaac agcaggctgg gactccaaga     16740
     tcttcctcta ccgcatgcag attaacgatg aagcccctac gcaaatcggt gaccccattg     16800
     cctccatccc attactctcc aatcccgaat ccatcctctt caccacccac atcgacaacc     16860
     ctcaggacct aatcctcctc gtctcccgcc gcgactcaag caacctatac tactaccatg     16920
     tcaaaccgtc agcggtctca accaccggat acgaatgccc tctcatcggt aaacaaaacc     16980
     tcgccccgca ctccaacgcc tgggtcgcct tctccccctc ctgtctggcc ctcagccctc     17040
     atgacccggg actcatagcc atcgcaacat caactcttcc gcatatgaaa gttatgattg     17100
     tgcggttgct cttcccctca gcagagagct tggagtcagg ctcggcggag caggaacagg     17160
     agccagcaac gcaagcggcg caggctttcg ctgccctgtc gctgcagaat cgcgaggacg     17220
     ccgcgattct gatccaggcg aatacgtttg cgccgcagac ggcgtactcg acgccacagg     17280
     ttgtgtggag accggatggg tcgggggtgt gggttaatgg ggatgatggg gttgtgaggg     17340
     ggttggaggt gaagacgggg aaggttgtga cgttgttgaa ggatgggcat gaggttgggt     17400
     gtaagattag gacgctttgg gcggggtggg ttgatgggga gaatgggggt gagagggagg     17460
     agtggttggt tagtgggggg tttgataaga ggttggtcgt ttggaaggtt gagtgagaag     17520
     tatagaagct ctaggttata agggacagtc tcatagtata tttctcaaaa cgatatcata     17580
     tagttcagtt caattcacta tcaacctaca tgggctacga ctgtatgtag ccctccgtcc     17640
     atgcaccctc tcgccacggt agagcaaagg gaaagggtgt ttggtaattg gagggcatgg     17700
     ggtcttctct cggcacgtaa ataaatcctt cagcaagcgc gcatggaaaa gataagcacg     17760
     gagctgtaca cacatatgcc tgtttcatca ccaacttcat catcaacttc accaccaacc     17820
     acactacggt atgagaaccg cacgtcagaa aagcaaatga accaccagcc acgggaatag     17880
     atgaagccaa gaaagcaaca ctagagaacc gaatccattt gctttatgtg acaaacccgg     17940
     tcttgcgggg taacccgacg ggatgtgata tcctcatcca tgtattctcg accagtcctt     18000
     tgtcgtcgtt tgtcggtagg aaaggaacaa agcaaatcaa ccaactcaaa tcgctttcat     18060
     ttcttttaaa acgtttctat attagttgga agtaatttat gcgatctcgc gcttgccctc     18120
     cttgcgctcc ttctgtaggg ttgttagtgt cgattccttt tggcttggcc aacaagtttc     18180
     ttgttggatc ggtcacaaaa cgtaccagag ccttagcggt tccgtgaagg gcgtgtctgt     18240
     ggttgcggcg gaacttgggg tcgacaccct tgagggaggg gtaacggtgg gtcttgggct     18300
     tcttgatact gttgatttca aaaggcgatg gtcagtgttc cgatctctct cccgcgttcg     18360
     ttgtagttgt tgtattgatt ccgaggacga atatgctgaa tgctggatat tggtcgatat     18420
     cctccctcat tgagtatcct cttcttcctt atccgttctc tgagcctcaa atctgtcgaa     18480
     gatatcgtcc tctatccaac atcgcagtat tcgtcctctg gcgtttcgtg tggcattctt     18540
     ggaacaaata aagaggtagg aggataatcg gcttataata cgcacccgtt acggtgagcc     18600
     ttctggctgt tgtggtgctg agacgcgttc ttggactctg tgggaattca tgtcagcgat     18660
     acataactct tcgatttgca atggtcgata atcgcattcc ccgcccatga gagacgggaa     18720
     aacgaaaata acggggtttc gaggattttg gagcaaaagg ggtgtcacgt actcgccatc     18780
     ttgtcggatt tgtcgcaact aacagacggt tgacgaggag ttggcgggtg aggttatcct     18840
     gaacggagcg gaaggccaga gtccccaagg caggttcggc tagggctggt tttctgtggg     18900
     atttcgctta ccgagcacgg ctagcgtcct gcccgtccgg tgtctcttca ctgtaggtct     18960
     acttatctag ctactgcttg gggggaactg ttccgactta gggcctagat ttgcatgtgc     19020
     ttgtgattcg agtgctaact acatgaaatt acttacaatg ctaaactgtg tctgctactt     19080
     ataatacctt catggagatg gtggcgcatc ttcaatgttg gggacagtat tgatacctga     19140
     ggcaccatgg aatcccgtga ttgatgacta acagtatggt cggctattaa ctagttagaa     19200
     gttaatgctg gggaaatagt ttcaatggag cacgtgttga ccggtgcttt agatatcaat     19260
     gcagaaagca tatggttggc aaaccattta atcacaaggt ctgagagtct gatatcgatt     19320
     ggagattaga gatatggatg gataaccggt ccatagttat gacgacggga atgttgacag     19380
     ccgagtatca cgtgatattg acatggggcc cccagtattg aatacatgcg gacttggttg     19440
     gatcagactc gacatgactg tggtgatatt gataatgatg gctttatctt ctattccttt     19500
     tacgcgccta gactgctttg actttcccag cttgtaggac tctttagcat aggcttgtac     19560
     aatacgtggt aacaacaacc aagtctggcg gtaggttcac gcccagtatg catctagata     19620
     gaagctacgc accctcagca gagagtgatc ttcgcatacc atacccaagg tcaatagccg     19680
     gagaacaagg agttaagcgt tgtgcaggtc aacgcagcaa ccgagtacgg cggtcttctg     19740
     ttggcgcgtg gcccaccacg tgaccgcccg agccgctagg gaacaaccgg catccgactt     19800
     cgacctttgc aactcccaac tcaggttcaa gagggatact atcaccaccc acccccttcg     19860
     tccattgcaa gatgagctct ctccgcttcg ctcgctctgc cttcagggcc cgtccctccg     19920
     ctctccgcgt tcctctccag cgcagaggtt acgccgaggc tgtgtcggac aagatcaagc     19980
     tttccctgac ccttcctcac caggtacgac tccgattccg ttgagcgctt ctgtgcacct     20040
     gcacgaactt ttgatactga caatttatcc tttcaacagt ctatcttcaa gtcgaccggc     20100
     gtgtatgtag cctcgcattc cgaataggtc gaattcattg gacgaccgtc tttcacccta     20160
     gaccgcccca tactcacgat cctttcccat atagtgtcca ggtcaacatc cccgccgaat     20220
     ccggagagat gggtgttctc gccaaccacg tcccctccat tgagcagctc aagcccggtc     20280
     tcgttgagat cgttgaggag ggtggtgcca gcaagaagtt cttccgtacg tccgaccaac     20340
     cgtgttgata cctgtgccgc gggccgagag ttttcacatc agccgctaca catcgtgtcc     20400
     agggcaaggc tgacatgact atttatgaaa attagtgtct ggtggtttcg ccgttgtcca     20460
     gcccgactcc cagctgagca tcaacgccgt cgagggtttc cctctcgagg aattcagcat     20520
     tgacgtaggt tctaaaccga tcatgcttta ccctgtgcgc agtgctaatc tgtcaatcct     20580
     caacacagaa cgtccgttcc cagatcgccg aggcccagaa gattgccaac ggaagcggca     20640
     gcgagcagga tattgctgag gccaagattg agcttgaggt aagacaaaca ccattaacaa     20700
     gacctgaaca ttctgactga caaccaaaaa caggtgctgg agagcctgca ggccgtcctc     20760
     aaatagatac ctgatgtaca tatccactcg cgacttcaac tttgaacctg tagaattata     20820
     gcaattctca tgaaacactt ttttgcatgc tttcggggca gagacccata aatatctaat     20880
     cttgaaaatt gtctggctga tcaactggtt gctgatgcct ttcggctaca ggcctggatc     20940
     gctctttccg acatagctca ggggagcctt tcatattctc tttccattct tcgtctactc     21000
     ccttctaact tgcccaacac ctaattccgg catcatttgg cccttttgct tcctagttga     21060
     tgctaaaaaa gcaaacgatt cacttctggg gtggcaatga tgccgtctgc gttcaccaag     21120
     ccagttgcaa tcatgcagga gcccaagtcc agtgacctgg aatatccctt ctgtgaaggc     21180
     tcggacaatc cccaaaactc ttcgagtcaa ctccagtata aacatccaga tgactgtcct     21240
     gcccgcccga tcatgacccg cagcgatact catgatactg atgctttcca catatttcca     21300
     atggacgtgg ataaagaaca ctcgaaaaac ccttcaacct cagaatacaa gatgatggga     21360
     gctctcttta ataaggacac ggcgaaccgc caaggattgc ccgatctatc caatgattca     21420
     gttgtgcttg aaaattggta tgagagcaca accggacctt gcagcacatt agaccgaggg     21480
     actccgtctc tagcgagacc ggaaaacaca accctcgtta tactgaacga gaaaagctta     21540
     tctgaacgca atagtcgcgg tcctgtggag gccaaatcag cgtggaaacc gcctagaccc     21600
     cctaaaccac ggttcctagc acaccttgac gttgccggct tcgagtcata tgagaattca     21660
     acaccgtgcc caatgcctgc ctcgagagac ggccctgggg gtcacaaatg gctggcacct     21720
     agattgctgc aaggtatgga caatgatatc agcaagcgac ggaaaccatg gagcgacccc     21780
     aagctcggcc catctcgata tctatcccgg cctgccaaac gtggcgcaaa gtcttacctc     21840
     accaagaacg atctgagcca gccgttcccc ggcccctggc cttcaattga tggcttgcta     21900
     ttgcgccaag attcaaggat tgctaagtcg agccctgcca agatatgcgt ccgggaccac     21960
     agtaacgcct tgtcaagccc ccaagaggca cgagagtcaa atgtgaagcg cataggcaac     22020
     tggcttggga agctacttag ctgggtttcg cacttatcga agcttaagga acgaggcgtt     22080
     attagtatat ccttggttgg gcagcgatca cttcagcacc cacgtttcgg atttgcatcc     22140
     tacgaataca gtgtgagctt caaatggtca aatacgtcgg ggtctattgc aatacatcaa     22200
     ggacaagaag agatcaacct acctgctgcg tcaaaaaatg ccacccgtct cttccgggct     22260
     gatattacag taccgtatct cgctatgcgg attctcatgg gcttttgtgc cgtctgccgg     22320
     agccgtatgt ccagaggagt catgattagc tttgtgcgac tcttcatgag actcatcgga     22380
     cttccggttc tgtatttttt agagagattg agcgtcagct tgtccattca cccaagggag     22440
     tctaacacga cccagagcgc aagagatcaa catgcggttt tttgatcaat ggcctgaatg     22500
     atatcttgct ccaattgcta ctgacgatac cttgcagacg tgaaagatgt caaattttta     22560
     tttttcatta aggacaataa agcatcacaa tatgaacgac atggcaaccg ttatatgcag     22620
     gaatcggaaa ggcaaatgaa aacatcacgg ttaaaggagc accgactcct actgcctatg     22680
     agctagcact gtccattccc tcatagcagt atcttatcac aaaccaatag ccaaacaaaa     22740
     ccaacagttc atatccattc ccttgctcat tgcaaccgtt gtgcatggct gctttcatag     22800
     cgtcattacc ggacatcacc agacaagaag ctcttcccga gcacagatat tttcaacaag     22860
     cacgaatcat agtttccaga agaaccaaca accgagacgg cgagtcattg gcacttgtac     22920
     gtcataacgt atttcaagat tgacatgaag gggtaaaatc aaaaagaaaa aagcaaattc     22980
     tcggaaagga actaaacacc aaggagaaaa tgggcatgaa atcatcaagg ttgctataca     23040
     ggggaagagg aagaggaaaa gaaaaaggga agtgtcataa gttatagcag gagataccgt     23100
     ttcatcaagt aaattccaca ccatgctgtt gtctttcctg acgtgctcga gctctctccg     23160
     ctcgtcttcg tcgacgattg ctcgcatagt ccccgctcgc ttccgtccca gtaaatgtac     23220
     ccggagacgc gatactccct gtcccataag gatggctaga tggcaccggg ggcggcgggg     23280
     gcggcggcat atgactcccg tttccgttct gaggaggtgg tgcatagtag gcggacgtgg     23340
     cgggaggcat acttgatgat ggagcagcag aagtcgctgg gaagcccgag gaagccgccg     23400
     ccgccgcagc ctgttctcgt tgcatctgtt cctgttgctg gcgctccagc tcctcaacac     23460
     ggcgccagcg gtcatacgag cccccttcgt ttcctgatag cgagcttgca ctgccggcgc     23520
     gacgacggga attccttcgc tctcttcgtc tcgcttcgcg actggcggca gcttcttcat     23580
     ccgttagtct ccggagagta acgtggcggc cgtcgttgtg cattttcagt ttgacagaaa     23640
     cggggggaga tgcgatggga tcgcggtgac ggctgctact cctgggccgg ctgctgcttc     23700
     ggtgacggct ggcgctgcga cggcgatgtg ccgatgacgc agcacctagg gctgttccgg     23760
     ctgctactcc tgaggcgagc tctgtaggac cgtgtgtaga tgctgctggt cctgggtatt     23820
     ccgatgctgc tggtggggga acgggtggcc ctggtgcagg cggtatgtct gagcgtgcac     23880
     cgtccactgc tccggatgcc attgggggtc ccgctgctga gactatggac tcgccgtgcg     23940
     gcggaccgcg gggtggccgg gacaggtctg ttgaaaggtc cgtggctgtg aatgatgccg     24000
     gtcggtcacg tcttgggtaa tagccctctc cggggtagcg ccgcttgctg ttggcccggg     24060
     ctagccgctc gtcttccatc tcccgacggc gcatctcttc cacgcgacgt tgttctgcgt     24120
     cgcccttgcg acgcgagaag aagcccttga tcgctgcaag tgcccccgct ccgagaagag     24180
     cgtctcgaag tccgtgggat ggcctgcgag ggggagcttc ggaaagatag gtgctgttgt     24240
     acaggtacga agagcctggg ctttgaggac ggcttagagg tcgacttggt ggtctgctgg     24300
     gaggtctgct gggaggtctg cttggaggtc tgcttggtgg acggttgaga ggagtatgcg     24360
     ctgttggctc gggtcgccgc ccatcttcca gtctactcaa gctttcttcg gtcatgctgt     24420
     cgctccgagt atgagctcta ctgtatcgac cggactccgt gtcgttgtct cgttcgcgtc     24480
     ttctgtcaaa gaatttcttc gcgagccagg caccaccgcc aattgcacct aatttcagaa     24540
     gtaagttccc tttgccacca cgccgtggtc cttcatcaga aagcttttca tctgagaaac     24600
     tggtatgcga ttcgtcataa tcgtgtggtc tgcctctgga acgacgtctg aagagcgaag     24660
     ccaggccagc tccggtcgct cctgcggcag ccatgggtcc gaggttacta tgaccatgat     24720
     catcggcagc cgagggccct gagacatagc tgagtcggct ttcgtatccg ccgctctcca     24780
     tgtgatatcc ttctgtgtcg tatagatatg acagcacaaa gaacactgcg aggaggatga     24840
     aggcgacaac agcgtagagg ataaatagca ctttaggcga gccataaagg gtgagcccca     24900
     atggtatctg aacaagacct aggatggcga gggcgcgtcc aatccatcga tgaatctgtg     24960
     atgtagaagt tagccttagg gcggaacatc gaacggccac gcaacatacc acaagcttca     25020
     agggaacatg gtaactcctc ctgttcctct caatcttatg gacaagccag ccccacagaa     25080
     tctgaaagat cactaggaca tatatcgcaa gtccgatacc gtgatgcggg tttgtcaggc     25140
     ttctctttgg accgacagcg aaccaaccga acacgaacac gacggtgctc agcaacaatg     25200
     tcaggacctg gcaccagaca tgcagcttga aggcccagaa aggattccat cgagagtagt     25260
     atcggatgat caagacagag attgggacga gaaaaaggaa gacgattgta gcgatgacgc     25320
     cgtgaacgac tatgagggta tggtattcgg gcatatcttt gaatcgattt cccattccta     25380
     acatatgtaa gcgtatttgc gcctcataga gctataacct tactaaccat tgtatcgcat     25440
     tgtgtcgaag ttgataccca tcagattagg gaggagatat gtgtcgcgct ccgagtccca     25500
     cgttccatcg ccgacatgca gtgtatttga agcgtaggta ctgctccccg cagcggagag     25560
     gccagagtcg gccgtcatga ttgctggaga ccttgagctc ttataatttc cgattgacgt     25620
     ggattcctcc cgatctcatt gacactggaa tgttcgaact accgacggag atctagcgag     25680
     atcccccact ccgaagaatg caccatgcgc tgatgggaaa ggtcgaagga aatcgatagc     25740
     agtggcgtcg acttgagttc ctggggaatt tgtttgcaga ggctaaaacg cgaccgagcc     25800
     cagtgttgca atggttgttt atctttcgag gaataagaag ctagcggtga gtgataggta     25860
     tagatggagg gtgggggagg gctaggtagt atgggtaaca gggataagag aaccgtggca     25920
     ggtcaccaac ctgtatagcc aacaaatgaa gaccacttag atgggatgaa aagaaagaat     25980
     agcactgaag cagaggaacg gatcgtggga cagggaagcg gataaccgcc gaacgatcga     26040
     gatgcagggc aagcaagccg cttcatcgca acaactgttt tccatatgcg gtttagcccg     26100
     tcagcgtata tcccggacaa ccaccagctg actcagccat ctgccgcggg cgaccgcctg     26160
     cgtatgtgag tatgattgtc atcgacacga ttgaacggac cctcgcagat caaggagtta     26220
     ctttattcgc gatggtcgat gctttaatta atggacgtac tgatcccgat ggaagctggg     26280
     gcacagctac taactgatga cacagtctca cgaaaactgg ttgctatcca aatagcaggg     26340
     tcagtgtgtt gctccatgtt tgctggagat ttccagagca ccgatcccag ttatttgatc     26400
     aatagtagtg aggccgttgg tctttctgta gtattgattg ttaagttaac cctgcggtcc     26460
     tcgcgcatcg accaaggcag cagtactaag tttaggtcaa ttaatccacc caggaaccga     26520
     tccaccagac ttgcaaggaa cccaactcca gcaattagcc agcagagttg ggaaagcggt     26580
     caggccaggt gaccgcaatc gcgtgctttc cgtatcttat cagctgctct ctccgccagc     26640
     gatccacccc atcctccctc cttgaggcat atagatagcc tctccatctt gctgcagtgc     26700
     ccttcctacg ccctcctata caaagaaaca gcaggagagc tacaaggagc taaatatggc     26760
     aactcagcta gagattttcg tgagggcgct ttctcggtat gttttttttc cctctgaatc     26820
     tctcgcctta tctcttttgt acaatgtact aacacaccat ggcaatgcag cctactcggc     26880
     tggatatagt acgtctttaa gcccgaagtt ctcagggaag atactatcac gacaggcgtg     26940
     agacttcagg agattgtaca tactgattac ctctcttcag cacgttctgt tggtctgcgt     27000
     ccttctatcc ccagccgatc aacaacttcc ggcgacggtc gacaacgggg ctggcaatcg     27060
     actttcctac catcaacgtg ctgggcttcg tgtgctatac catatatact tccgctttcc     27120
     tttactctcc cgtgatccgt catcaatatg ctgctcgtca cccacttgct gaggacccga     27180
     ccgtgcgctt caacgacttt gccttcgccc tacatgctgt cgtccttagc ttcatcacgt     27240
     atacacagtt ctggccattc atctgggggt tcaaggtctc tcgccatcag aaagttagca     27300
     agccggtagc aggccttttc tggggctcta tagtcggcgt cacgatcgtg atcttcatcg     27360
     ttctcggtca gagcccaaat aacggctatg acccatactc ctgggcgtgg atcgatgttg     27420
     taagtagccc aaggatttgg aaatggctat cccgcatgtg ctctaacccc taactcctgg     27480
     gtcaatctag atatatgccc tttcttacgt gaaactggtc atcaccatcg tgaagtacgt     27540
     acctcaagcg tgggttaact ataagcgtaa atccacatac ggctggagta tcggacagat     27600
     cttatttgat ttgtctgggg gtgtcttatc ccttgcccag ttgctgctgg attctagctt     27660
     ccaagatgac tggagtggag tcacaggaaa tcccatcaag ttccttttgt cgaacgttac     27720
     catctttttc gatctgatct ttgtggtaca gcactatatc ctctacagag atgcagtgga     27780
     cgatagcggt aaggaccgga acccgagtga tcggactcct ttgttgtccg tgtccgacgg     27840
     acagcccggg cgcagttagt gtttagactt ccgtctctcg tggtggtcaa atgtcagaaa     27900
     tttggaacgc ttcggcggcc ccgacccgtc ggcggtcccg gtttcttgga tggattgaat     27960
     ataagcacgt tgtttttgtt tggagggtct tgtgtgtcat gtgaagagca tcgagctggt     28020
     tgacataaat tttcgctttt acgattttcg gtcggatgat gactgaggct gagattctgt     28080
     gacatgtatg acctcataga cctctccgcc aacacagccg aacggagcaa ccgtctggga     28140
     aaatggctgt agctcgtata cagtgtctac ggcctggatg accatgcgaa gctcaaaata     28200
     gtcatgtgtg ttggttgggg aggaatgata gaacggctta tcaattgcga caatgtattt     28260
     ttggaacaat gtctttggct ctctccgcga aagtgtatct acacatccac accgcgatgt     28320
     aacatggcag tgacacgcga tctaacccgg cctaggccag atctgcaaac tcgatggagg     28380
     tcagtccaag aagactcaaa gactactgga cctggcgaca ccgctctttg gcacccggtc     28440
     catgctgaca gcgaccctct ttccgggcct tcctgcgtgc aatcctccag tcccggggcc     28500
     ccgtcaccta gaaatactgg caaccaaggc ccgacggcag ggatcatggg cacaaaggct     28560
     taagtccatc tggcggtaag ccaaaatgat ctgcattctc agccatggtt atagcgtcga     28620
     aatgcacgcc cctttgggaa taagcgtggg ggcctgacct acccgtccaa gtaaatatag     28680
     cgaatagttg acgtcgtcca accttcaatg gcgagggaca ttgcccaacg atatgactcg     28740
     tatgccgact attttcttag tttgatgcct tttttgcctt gcctcctacc ctgttgggcc     28800
     atcctgggat cggatcacct ggaactttgt ttagaaggtt gtcgctcggc gctgaggctc     28860
     agacggcatt tagactttcc atccaagttc cccataaacc agagagttcc gcatgcatat     28920
     gtacgatgca gtggccggaa caagtacacg acacagccaa tcatcgcgca gcctcgtccg     28980
     tccatacgct ggtccgccga ctccccgtac ggacgcgccc tatcagcgcc gagcaaaagg     29040
     tcctgcaacc actggattgg ggctcaaacg tcatcctcat gtccagaact gtctgtatta     29100
     cccatcatca cttgtctggt gccttatgga agtatcctgt gacgctcttc acctcagccc     29160
     tatcaaagag tcggacttaa gcggcaatgg aacacttgct acttctacat aagccgcgag     29220
     agtcctgttt tggcacggta aaccggaaag gcaaagagaa aagaaaacgt acataccaaa     29280
     aaacagagca ttactattga tctgcttggg cactgtgcct cagattggat ggatcgtctc     29340
     taagcaaatg tgtcatccga atagggttgg ttctacattt tcagccgcag tgcatgacaa     29400
     ttcattagtt ctgcatgcct attcgagtta ccaatcacct cgcagccgaa taaacgttcc     29460
     ccttggcttt tggagagttt agacacggga atcccgagct gcatttccag ggcaaacgtg     29520
     ggagccacca gcgatgaagg ccaataccaa agtcaatggt acagtgacat cgacgtccta     29580
     atcccgatta ttgatcatct gtgaagagat tcgctcagct acccgttgac cgtcagccct     29640
     gggggatgtg catagccaca tctgacattc gagacactcc tgaagataag aatgttggag     29700
     taccacggct tctactggct ttaaatatcc agaatgcatc caagcccacc aacttgtgac     29760
     aaaccattca aagaaatagg cttcatccca ctgagacatc ccgagtcccc tcgatacatg     29820
     aactacaagt accgccgaag gtacgtccat ggacaaagat acattggtga gacccgtgcc     29880
     cggcggaata aatcccccca tactgattag cctcagaaca agcgcagccg cgtgtccagg     29940
     gcacttttat ccagttccga accatccgca atgacctcta ggactacaat caacagagcc     30000
     atgctgatgg tgcccggcgg ctcctcaacc cacagtacga tgtcgtcaga ggtgcagcca     30060
     tatctttttc ccgctatagc ctttcaacag gcccccctgt cagatgcccg cagcatgtct     30120
     gggtcagttc cctacgcctt cgaccaagca cagcccctcc atcaaaggaa accagacgtt     30180
     ggaacccact actttcagga ccaagagtcc tatacaccct tattctcaaa tcagaccata     30240
     ccaccacagt cattcagacc cgatattgaa tcctttcccc cagccatacc aaccacagac     30300
     ggtgcatact tccctatcga tcaagaagaa tggctcgcga tagcagtatc acagtcacct     30360
     ctcaacccta caaatacaga ctattacctc ccagagtcag ctccatcctc cttctctcag     30420
     tcacggctaa cccccgtaac caccgcatct ttatcttccg ccaccaccgc agaccttgac     30480
     ttcgagcttg atctcgacct cgatctagac gatctccaac tccaatccct atccgacacc     30540
     tcctccgccc gcagccagac gcgagatcta accaactacg gcattaaaaa tcccgacgga     30600
     acctggcgct gcgcatatcc cggctgctca tcacacgccg tcttccgtcg gggctgtgat     30660
     ctccggaaac actataatcg tcaccgcaaa catctctttt gccggtacga agggtgtccg     30720
     caggctgtgc ggggcgggtt ctccagcaag aaagacagag atcgacatga ggcaaaacac     30780
     aacccagaaa taccttgtga gtgggacggg tgtcagcggg tatttagtag ggtagacaac     30840
     atgaaggatc atgtgaggag gattcataag aggagggaga cttgatgatt tctcttttcc     30900
     tcacccttat aattttccca tcctctctcc ctccttcctt cttactttcc tactgctgcc     30960
     cctccccttc atgaaaatac tttcacatta acattttttt ctattgaaca aaaccaaacg     31020
     ggatatacac agttccggga ctgtatggag ataaatggga ctaacggcgc gatttactgg     31080
     tttttgagga aaggaatcat ttggatttga tttggtttgg tttttacctg gtttcatctg     31140
     gaaattcaag cgacggcaaa attggccacc agcactgcgg gacagtgaca ggcaattctg     31200
     agaactactt actaccttac caactaaatt gactcatcat ctacttttta ctgtacttat     31260
     acgtgtcttc ttttgagacg ttcccacttt tcttggtttt tctttttcag ccttgccaat     31320
     tttatgcttt ctgacgtggt gtgaactaaa cagcactaca acactcacac tccaaattgg     31380
     tcgatatact gaatctcgtt gttccttctt agttgcagaa atatattttc ttcccaatcg     31440
     tctgatctca attcatatgt agccagctag ccggttcagg tagctagtca aatggggtaa     31500
     attcaaattc aaatcaagac atcgtaaata aaaggaaatt gaagaaacca tcgataaaac     31560
     gcctctcgtt accatccaca gatatgataa atttgggggg taaaagaaaa ggaagatgag     31620
     gacgccagaa cctcctatat gtatagtctg aggaagaagc gaaggggaaa gtaagataag     31680
     gtcgcaaatt gggtagttgg aaatctgaag cgaagatgaa gatgaagaat tgaaaaaggg     31740
     gtgaaacggt gtaaagagaa gatgagggaa acaagtaaga aacacggcaa aacgcccact     31800
     agcaaagtct tgtacaaacc cgtgcacact tcgccagatt acttagcaag acgaacgggg     31860
     gaatcaaact attcgaacac aagaagcgaa tgacatgatg cgagcaatgc aggaagatga     31920
     acgaagtgaa taaaaagtag atcaaggctc taacaacatc tggtatcact gaaaaggggg     31980
     tagtcgaata gatgtggaaa agaagggggt tatgggtgga ttgcttagtt agtgggaagg     32040
     ttcgtaatgc atgtgcagtc agtatacatg aatgccatga tagtcgataa taacagataa     32100
     aagtattgac tgcgttatcc tcacaccgtc gcatggacgg ttgtttgaga aagtcaatcc     32160
     ttcatctcag gataaatcaa cgcgaacgga cgctgtcgct aatgcaatat cgtataatgg     32220
     taacctgcac ttttagagca tatcgctgag ccgatgatga aaatgatgat gaggcctata     32280
     tgggtaatag gttcacggaa cattatttcg acggcggcgt ccacgcgtac taccctctgg     32340
     cctttgcgat agaacctgcc taagagccgg atcatctcgg ctcttgtcaa cgtggtggac     32400
     tttgacgtgt ctggatgggg tgacttgtga gctggcttgt ataataatct atgcattcga     32460
     gtaaagtctt accgttgcag attgtccggt cgagggtatt tgtgctgctg gtctggacag     32520
     aatgggcata catatccagg cgaattatgg acgaggccgt gtcggatcat ctcattcttc     32580
     cgtttgaatc ctttcccgcc gggtccacgc ggacagccag ctatgggaca gaaatgcgga     32640
     cgatcctgag aatgaacatt tgcatgggag ctgtacatgc gataagcttg ggttacgggg     32700
     ccggtacacg tgagactgct tacttcaaca ggtattgtgt ttggaacggg gctgcagtgc     32760
     agcccgggtg acggcatttg tacgtgcctg tggagaccgc tccgttcgga tgcgtggggg     32820
     gattgtatga ccgatcacag gtggatgctg gagtctgatc tgtcggggtg ggatagcttg     32880
     ttgcggggct cttggctgtc tgcggtgcag tctcatacgt tgaagtgaga tacgttatgt     32940
     ccgccttgat aggcggccgc cagtaagcct gctgggatgc gggcgacgac atagccgaca     33000
     tatccttcga gcttgccggt gacaagtgcg agtaggggct gggcgggact tgtggcggag     33060
     gaggcggaat ttggcctaag cgttggtgct cccagacagg atctgtcctt gacaccgggg     33120
     gggaagaagc tgagactgga ggcaaagggc cgaaagacga gccattcaag cgtccggcac     33180
     tagcaggtgg tggtacatcg gtaacaccag ccaatgccgt tgaaagagag ggcagattat     33240
     ggttcacggc gctcgccgtt gttgatgggt ggagggcggg gagctgagct gctggctccg     33300
     atggtgctat cagcaacttg cccaggcgtg tttcaggatc aggtaatttc ccatcttgaa     33360
     acagatgaga gaaatggggg atgttaggcg gcgtgtgctg ctgctgctgt tcttctttga     33420
     gcgcaggttc ttccactggg atagacggtc ggcgtggtgg ttccttgtaa gcgactggaa     33480
     gatccttcgg ggctacggat gggcctcctt ccttgggctc gctcggactg atcaaattga     33540
     gagcttttct cgcgaccacg tctacaggct ccttggtctc cacggaggat ttctctgggc     33600
     cgaatatgat cttaggaaga accggaaagt cgtccgctat agtgctgcgt tgaagcggat     33660
     gttcagtttc gaaccaggct atgtcaggtc ggttaggctc tagatgtctg atcagcaccg     33720
     agttgccctc agttgaatcg ggcttttgga attccggcag cttacgcgaa ctgctcggaa     33780
     actgtgcctc tgcatcgtgc ttgggtagac cgcccttggg tgattgatcc ccggtatcga     33840
     atggaggcgg tgacaccttt ggtaagtaat caatctctgt gggccgcaac ccaggggtgc     33900
     gaggttcatc gagaccgtat gattctgtca tgaaggcggc ggttttaggc gcatcaggtg     33960
     cgccgcccct tactgttcga tttggcctgc ctgtcccgtt cgagtgcccc gaagtgtttc     34020
     agaacactgt cttcagcccg gaaaatagac tgccgttcca acggcttgcc aagcaagata     34080
     ggacacgatc cacttgtcga tcccagatgt gctggcacca tgttagcatg cacacagact     34140
     agagaaagtg gtggcacgac atagagaagg acaacgttgg atatgaatag agtacagatg     34200
     ggccagcttg tgcaacgctc tcccggggag aaagaaagta ggtcagagaa ggggggatgg     34260
     gacaccagac gagcctgcag gacatgggaa gaaactcaga agagcgtgca aaaatcccgg     34320
     aggcggcgag tagcagccta gttttgtaaa atctccaacg gcaccaagag ctggcccaat     34380
     tgcgacaata tccaggatgc aagtttggcc acggatagcc aaggaaaggg aagaagcaag     34440
     gtgacaattg atagcaagca aaccgccagt tgaacgatac ggggggtttc ttattactga     34500
     tgctgcgcaa ttggaacgac gggggaagga gatgcaaaat aggctcacct gctgtcagga     34560
     accgagaaag ccgcaggaac cgcgcaatga ggctcaattg aaagcgattg cacgtcagga     34620
     ctcagtcaac cacggcacca ccgggcgcat agatcaataa atcatgcgcg cgggaattcc     34680
     gagccgcgtg gataaaactg ggggaggaga ggatgggggg ttgggtggga gggaggggaa     34740
     agaaagcagt ttaggataag gttgaacgct cagtggtggt gatgacgata agggaggtca     34800
     cgatgtcacg gctcgggtcg aaaagaagaa tcaaagaaga ggtggaggtg caaggatcag     34860
     agattggaaa aattcatcgt ctaacggcgc cagcagcaga acggtagtgg tcgcgagtaa     34920
     agaataataa gagtggtgta gtaataataa taataatggc agaaaagagc gataatctta     34980
     ggcccgagca ataatgatga ccgtgtccgg taatcaaggg acgctggaac gaatagtggc     35040
     cgatgaagct aatggtccca gcaagcgggt taatgacacg cttggcaggt ggtaaaaggg     35100
     aaaaggaaaa aggttaaggg tatggccgcg gagcggtcag caggtagttg cgctggaacg     35160
     gccgaaccga ggggaaggat cacagtagta ataaaggaaa aacgaggtgg gaaaaggcag     35220
     atggagacac acggatagtt tagttagttt agtttggcgt ggccgtcgtg gtggtagtag     35280
     aattgaggag aacgctgaga atcaatccac tcagaactga aggtgatcca ccggccgggc     35340
     tggaaaaacg cgggtggaga aagcagcagg tttggtttct ggttgacggt tgaggtaggt     35400
     agacagcaag cagcagcagc agcagtactt ccgttaggag aaccagaact gtagggaaga     35460
     actggcaagg tcggcaggag aggggagtaa gtagtagtgg ccgtagtaaa gtagcaaaga     35520
     ggtacaaaat ataatagttg cagtggttct ggttggctgt ttcgtctggc tggctgggct     35580
     tgggctagct gggggggaag ctgagctgac tgatttattg tctctggctc tcttctgttc     35640
     tgcctattcg gcagctctcg tcgggtcccg attcttgttt ttattacttc ctcttccttt     35700
     tcgtcttctt tctttttggt gtttgttctc ttttcttttc ccttggctgg tcagatgcgg     35760
     aggctctgtt ggcgtgcttt ccaagtaaaa cgttagtcag tccttggttc tgttgtccct     35820
     tgaagacact agtgaggctc caaaggaaat ttggttttag attactttta aaagggcatt     35880
     gggtgcccac agcaacaaaa tagtagaaac tggaacaaga gaattatgaa gaagaatccg     35940
     caggacaagg cggaagaaga cggagggaat gaatgaagct gactctccag acgcgcgcgc     36000
     cactgcgtgc agacaggcaa acaaagtggg gtgagcatgg agggagggac aacaccatca     36060
     acccgggtgg agagaggaaa caagcaaaat ttctacctac cgacaataat cctagttaag     36120
     acaatcaacg accattcacg cttttcttgc cggggcggga taagtaaagt aagagcgcca     36180
     aagagggtga gaagaggtaa ggggacggag aggggaatgt cttgtgtatg tgtgagatga     36240
     gggagggagc aagaaaggcg ggttcagagt gtctctcgca gcaagctagc tgtctgatct     36300
     agtctgtctg tctgtctgcc tgtctgtctg tctgtgtagt agtgagtgga gtggagtgag     36360
     tgagtgagtg tgtgtttcct tcagcatgct cacctttttt ttccgttcct tttcccaccc     36420
     cctcgccgac cactgcttgg agcaggaaga ataatgccac gtccacgagg ccgacccgcg     36480
     gcgactagac taggcccaaa agggctccac ttctgaggct ctctgcatgg ccagcgatga     36540
     ttggtcacca cgcgcgggca cagtttaaga ggctgaattg ttcatctgca ccgaaccgtc     36600
     gtagaacttg gctgctgctc cgagtgaagg gaagggggtg tgggtgggag ggaaggagcc     36660
     gtggatgcgt tggccagcat tttcctcgtt tctctactaa cttccatggc ccaactcgaa     36720
     gcttttctca tcagatgatg cggctgtctt tctgactgac tccttccttt cccctcttct     36780
     ccgatcggat aaaatctatc gatcgaggat ttaatctacc cttgccctac tgtagaaaac     36840
     cccccttccc tctacggtta acaatatacc tataatatag tccacaggtt ttattaataa     36900
     atggcccgtc cgcgatcact aacagttcat ttccctaaat aaaaaaagaa aaaaaaaaaa     36960
     aaattctctc taattttccc caaccacaac ggccggctaa ggtcgtactc gggtctctaa     37020
     ggcgacaagg ctgcagtcca cagctggatg gctgaccgcc acgggaaagg acgcgcccca     37080
     gtgttccttc cagtcctccc tactggacaa gcctccgcct ggtccgtcac acaacctgca     37140
     gaaggggctc gcacgatagt ccagagcagg aatctgcatc atgtgcggag ggcagtgtga     37200
     tgagtggcat atgtggaagg gaggaggcgc ctcaaagtga gaatgaggct aaaagagaaa     37260
     aagtaaaaat gggcatcgaa aataaatata ataaatcaaa ttcaagaaaa caaaaattga     37320
     ttgttgtaca tttttggatt tttctgaaaa gaaagacgaa atgaagagaa gaaaaaaaaa     37380
     aaaaacacct caatgagatg cactggaaat agaataatca acagcctcgc tctaagagtt     37440
     acaacggaat tacaacggac ccagtgctcc tgactagcag aagatagact taaccacaac     37500
     agctgccgct tttgctaaac taacgtcgtc gcccgtaacc cctccgactc cgactccgac     37560
     tactttgtgt gcgagcagga tcgaggatac ggctgcaccg agtacacaga ggaatggggc     37620
     tcagagccaa gtaagttact agcagggcta aaaacaaaaa gaaaaaatag gccagggaat     37680
     ctacttaagg tacgtgcttt gactgtggta ttttggctgt cagagagcgt agtggactga     37740
     ctaactagct ctccgaccga tcttcattat tattaatcgg tcaatcagtc aaaccatcaa     37800
     accatccaat tcttgattcc ttcagacttc ggccggtgag taaatctctc ggttgatagt     37860
     tcccgttaga tagatacttg gtgtgtctgt ctaattttga catccagtgg tttggtttgg     37920
     tttgcgtcgg aactttggtt tcgatccgtg cattacccag taccgtgaat ccgaacgggt     37980
     ctggggcacg gttaaaggag ggtcccctcc cctttcccta ccagagcggg aaaggtgtga     38040
     gtagttggtt tgagccggac gttgtggaaa ttaccagtag gacgggatca aaggctccat     38100
     catgtctatt gctatttgtg cgcctaccga gatggaatga cattcttatc cacttgaaat     38160
     ttggttgaga gaacggcgca aactgaatgg agagatcgat caaacatggc atggcaacag     38220
     cagaagagaa gaagcactgc aaagacaagc acaagccgtg tttgatgtgc gcacccaccc     38280
     actcaccccc tcgtcaaacc ggccatgtaa aaatttctga catgcagaag aggaggtaag     38340
     tagttagaga gggagaggga gaggaagcag agatgtgagt aagaggggtt ttttattccc     38400
     accttgcctt attcaggaag gtcgatagtg agaagaggta cacactcgac taggatgatg     38460
     aggactagtg tttgccccta gctggcgcgc gggagggacg gagggggagg gggggaggat     38520
     tagaccacgg agtaatgatt tagtctactg tgtagtactc tgaggagtag tctagtaaga     38580
     caattcttag ctgaacacaa cagaaaaaaa ctggttcaag ctggacaagg ccgcaagttc     38640
     caactgtcac tctgcagatg atcgggacgt atcgcaacac ggccccacgt ttcccctctc     38700
     ttcttttctc ttgtctttct ggctggctgt ctagctgtcc gtctcttcct tcccttctct     38760
     actccttagt ttgctccact cgtcgtcagt gcaccgactt cctcacttta gccaccggca     38820
     ggccagcaac gccttcatcg gacagggttg aagaatgcga tcgcagtgct gatcccaata     38880
     tgaactgcag gtatccccat ctacatacat tattattagc atgccgacgt tgcattcatc     38940
     ggatggagag cagcagggta cttacctcga cacgactcac tctagccgag tgagtttcct     39000
     ctctcatgac tataatcttg acagcagttc gaccgcgaaa atgatatatg attttcccca     39060
     aaagggaaca acaacatacc gaataacaag ctagctagct tacaatacaa tccctctaac     39120
     tcaaatcata ttgaagatat agtagagccc acccactaag aaactaacat cctcaggtag     39180
     caactacagc gggctactta cagccccatc caaaccaaag atcagctaca ctaactaaaa     39240
     tcccctagat taaccaaata tttcccacta ctaagtagtc tatatctaga gtcacacacc     39300
     aaacagggag catttaatgg tccatccaat aaccacccgc taatcaacta gaggcggccc     39360
     gccccgaagc aaatccatca ttgctctgcc tctcttcccc tcctctctcc tcttctcact     39420
     tatactagtt actaccaacc ccctcagtta gctaaacaga atatggaaat ggactaggta     39480
     gatcatcatc agtttcgcca tcatgattca tttctgcatg tgaacatata catatagacc     39540
     atctactctt tagcgactga aacgtcaaca gggatatata gaacaagtaa cacaattctc     39600
     cgtagtactt agtagataaa ccccatccat gttaacattt aggctccaga gtaaagccaa     39660
     ttggccaaca cgactagttc acggcaaatt aactcacttc tggtaaagta ctccgtactc     39720
     aacgaaggat tatattgagt tagatcctga acgcggaact tgagcgagag atacacagga     39780
     gttagtaaat aattttcaaa ccccgatcga tcgagagaaa aagaaagtac atcaactcat     39840
     acactacttt agcaacttca ccgcccccaa aattgaacca ttgttgtaga ctactatctg     39900
     caggaaagaa aggccagcag atctgaaggc gataaaaaaa agcaaaaaac aaaactgaaa     39960
     attaaaaaat aaaaaaagag gggaaaatta gccagcaaag agaaacagac aaggcgaagt     40020
     tagaagaaga ggtggaggtg tgagagcctc ggggggttct ggtccattcc agccggaggt     40080
     tccacgcccg ccactgacgt tgctcaaagg gaaaaaaaaa agaaaaataa gaaactaaaa     40140
     aggatttgaa ggaaaaaaga aaaattagga aaaagaaaat caaagggctg cggcggctgt     40200
     tccatcatca tcatcatcat cctcatcatc gttactcaag ggtgggatgg tccgagttct     40260
     ggcgctagac tcttaaacga tgagaaaaga tgttactact acaccatcta tctacttagt     40320
     tcggaggaac ttgcaggggc cagaagggag gggaaagaga ggaataaggg agggacgggg     40380
     aggacggaga cggggaggaa cggagaagac agcggaagta cctaacacta cttctataac     40440
     cacggagtta tagtaaaata gcactaaata tatttactag ggctggtatc aagggaaaag     40500
     aaaaccaagg aaatgcaggc ccgggagccg cacccaatta agtgccgcaa gccccgattt     40560
     gcggttggcg ctcgtgctga ctctcgcccg ttaactactg gggagggagg gggggaaggg     40620
     gaatggatct agcgcagata cgaggctcca tccagcgtca tcatcatcga tatgggaatg     40680
     ctgttgttgt tgttgctgca gcaccacggc tctaggtaag ccgtgctgcg tatttagctt     40740
     cctttgctaa ctagtttagc tgactagcta gagagctagt tagtagttag cacaccactt     40800
     tcataaacct ggcctgacct gactccaacc accgcccccc acccacccac ccccctgcta     40860
     gtttagtgcg atgctcacag cggccgacgc cgggcttact ggcgcttgga ctcgttcggc     40920
     ttttgtacgc ctcccgtgaa tgaggctagt gtggtttttc ttttcttctt gcatgcatag     40980
     ggtcaccttg cggcgatttg ggtagtacga tgttgggggc tgaagtggga gtagaggcgg     41040
     aagagtaggt gaaggatgag gcgagcccat tctacttagt actcgggatt tgattgttaa     41100
     ctttgctttc gaaatgctta cttcttccgt tcggaatctc cgactggcaa ggctatttat     41160
     cattcatggt tgtgtgtctg tgtgccggct taccgtccat acatacctac aagggtggtc     41220
     atgccacggg acagggaaaa agacaactaa atcatgatat cgactccaca ccagggtact     41280
     agaccttgtg aagcaatgta aactctatgg gagaattaat ttatgtctgt tcggcttgac     41340
     gaaaaaagaa aactagttac agcctggcct tttgacccag ctgggctcgc actctcttaa     41400
     cacgttccca agcctcgagc gcaaaaggct ccgtatttct agcatattcc gcagcgcggg     41460
     cactactggc ctgcctcagg gcataccggg ccttgatacc atgcataatc accgagcttc     41520
     tccaggagaa gaaagcatca ccccatggga tatccccagt ggggtcatac cccgacacct     41580
     cacgatacca acggatacag tcctctcgag cgggcaagcc aggcactacc ttcgggacga     41640
     acatttcctt cttgtggtcc accccgtcca ggaaaaaggg actagtgagg ttgcagaagt     41700
     cggacagagg gtgccccact gtggccattt cccaatccaa gaggccgatg actcgcggct     41760
     cggatttgtg gaatatcata ttatcgatct tatagtcacc gtgcacgagc gtgccgcggt     41820
     cttgcggctg cgtcgtcttg tcgtcaaaga aacgcaccat gtccatgaaa tgaggcaact     41880
     ctccgacagg ttccttggtc tccacatcca cggcttgtgc ctgcgcctgt gcaactgctg     41940
     tgaaggtggc gatctgtcga tcatagtacc ccgtcggttt tccgaaccta tccaacccga     42000
     ccttttgggg gactacccgg tggaacttgg ctaatgtccg gaccgcatcc tgccatctgt     42060
     tggtaggggg ggcgtgtgtg tggttagctc caatttttcc cgctttcatg taacagtagc     42120
     cgcgccaggc gggttgtatc atcccgaaga ggcaggggga ggggggcaag ggatgacgta     42180
     caatgctgtt ctctctgccg ggtcgacccc gggcatggca ggatcagtaa agtgtcgtcc     42240
     atctaggaat tccatgatgt agaagggggt tccgattacg ctactatcct cgcagagaca     42300
     gtaggctttg gggacgggca cgtcggtgtt tcctagggca tggatgatct tgtactcgcg     42360
     ctcgactttg tgcgcagtct tggagagtag cttgcccggg ggtttcttgc ggaggacata     42420
     tttgctaccg tcggcggtgg tgagttgata cgtaggattg gattgaccaa agccaaacta     42480
     gagactgtga gttgtgtggc caggacagta attcggaagg gtcattgtat acctgcttca     42540
     catccaaggg ggtcttgata tcgggtacat tgagattgag atagcgttcc agggagggaa     42600
     catcaatagg ttggcgcacc gctccagcca tatccaagac aacatgagat tcagcagtat     42660
     acagcgagac tatgcaccac caccaacttc tataagacgt agcaaaagcg gagaacaagt     42720
     cacgctgggg atggaataaa cccggggata gctccgatct caagccagcc agccagccac     42780
     ggcccgcggc tcacctgaaa ggctgcgggg agcctcggct atcctgaatt ccttacccat     42840
     ttagatctag tggcatactc actgttactc agtatcagaa tcaaacagcc caaacccgcc     42900
     aagcccatta aaacgcgcct cgcgtccact ctcaccgcca gacgcgttcc cccaaatcga     42960
     ttgccagcaa tcaaaccaaa aaataaaaga acccaccatg aagggcctcg ccctcgccct     43020
     cgcatctcgt cgatttacac aacacaccgc atttccaaca ctccattttc ctcttcaata     43080
     tttcttcagc cgaagaagaa cccactctcc tttctctcca ctacacacca cccagataat     43140
     gaccaaggag accacccctc ctcctcccac caccaccacc accgaaccta ctacaaacac     43200
     aactcacgag cccccctccc tccccgcctc tcccctcgcc aagcgcacca aacccaacac     43260
     caccgagcaa tcaacagaac cgtccacaat gggttcaacc agcacccctc tcccccccct     43320
     ccaagtgaag aagctcactc ctaccggccg cgccccgacc cgcggctctg ccttcgcggc     43380
     cggatacgac atgtacagcg ccaaggagac cgttattcct gctaagggga aggcgttggt     43440
     tgatacggga attgcgattg ctgtgccgga ggggacgtgt atgttttcca ccttaccccc     43500
     ctctacatct accctgatgt cgggaatgaa tagctgatta tgatattgtg gtggtataga     43560
     cggcagaatc gcccctcgct ccggcctcgc ctcgaagcac ttcattgata ctggcgcggg     43620
     cgtcatcgat gcagactacc ggggagaggt caaggttctt ttgtttaatc attcggatgt     43680
     ggatttcgag gtgaaggagg gagatcgcgt tgcgcagttg gttttggaga gggtatgtca     43740
     ttttacctcc cttcttcttc ttttatatta tttcaatggt tgtggttggg gtcaattgct     43800
     aattgtgagg tctagatcta tacccctgaa gttgtggttg tggaggaatt ggcggagagt     43860
     gttcgtggcg ctggtgggtt tggaagtact ggtgtttaat tgggattgct tcgacaaggt     43920
     ttatgttata gatatggcgt gtatggtttg aatgatatcc gtacaattgg aatacaatac     43980
     aatacaatta cacgagtgag atgagataat tagcatccat atagtattct gaagattgta     44040
     ttggtttgtc cgtcactgca tttcatcatg actggtggta tataatgaac acccgtctat     44100
     aactaatcta taatgctcaa acaattcgcc tcccatcgtt aagaatcaac gaaactgcgc     44160
     cggcagatcc tcccgtcgcc actcgctcgc ctgaaactcc acctccggtt cccgcagata     44220
     ctgcgcatgc cgtaccaccc gtacctctgc cgccttgctc tcccgcagat gcgccctctt     44280
     ctgctggtcc tcctggctga gcagcttctc gctctcatcc ggaacaatgg cgcgcaactc     44340
     ggcatctctc gcctctagcg tcttctccag cacgcagtgc atactcgcca gcaccttccg     44400
     ggtagactga gcaaggggca actccgttgc agggacattg tcgggcgaaa cccatgattt     44460
     ggtgttgcgg agggtgggat cggcgttgaa cacggcctcg cggaaccggg ctaccgtgag     44520
     tgcggcgaac atgtcgccgg tgccgctgaa gtagcagtcc agggcgggga cgtcgatgcg     44580
     aaagagacgc ggggcaccgt cggagcgggt ggtcgagccg atgacggtga gggtgttggg     44640
     gagcggagag tcggagaggc tggcgatttg cacggaggtg atgatcacgt gggggatgtt     44700
     gtatatggcg tgaagagcgg taatggcttc agcgagggtg gcgagggagg taattttgat     44760
     gccggagagg actctgctct ggttagaagg agaagcagga gtaaggaaag agggatggct     44820
     tactcggctt cgaattggtt ggggaggatg aggtctgcgt ggcggatgac cttcttgtat     44880
     gcggggacga cgtcgtcgtt gacgtagaga cggccttggt cgcccattac ggggtccaga     44940
     actgtgcatg gttattaatg ccatcacata gaacagagag agagagagag ggcagctcac     45000
     cccaaaagaa ggaaccggga ttcttttccg ctttgcgctg gaggtccatg ccaatggccc     45060
     cgacggcctc gacggcagct gcactgggcg catagccaga gagcatgaca tcaaagtcaa     45120
     gtaaattgct ctgcgtgaga ccctcataga gcgcggtgat ctcctctgct gtggccctag     45180
     tgcccttgaa ttgtctataa ccagtgtggt tacctggagt ttgtcagtag ggcggtttac     45240
     gcagaggata tatgcctgct tactgaagtg aacggtgttc agggcggcga catcacagcc     45300
     catgagctgc atgaccgcac tggccatctt attgcccaca tatctgatcc gtcagtatat     45360
     gcaagcatgc gatgtgatga gacatcatga tagatagagg tgttatcaga tatgacacat     45420
     acccgtagac aacctagacc cttgtcagca atgcatggga tacgccaatg gtggttgggg     45480
     agaaacatac atggctggcg acagccaaga ccctggtctc agggacgaga agatcggcgg     45540
     acatgatgaa atgaagggga gctggtggag gagaagaaga ggagcaggcg ggcaaggaag     45600
     ggaactcgat gtcattcctt cctttgggtc ggcgataggc gaggtggacc tcctggtttt     45660
     gccgcgctgc tgattggccc acagggccgg tgtgcagccc gtgctcagtc gggagttttt     45720
     ttttatctta ttaagggatt ccatccggca gttcttctta gtagataacg ttacttactg     45780
     gttatttgga caatcggtgc tggagaaaga agaatatctt ggtccccccg agtcagtcgt     45840
     gacgctaatt ctggtggcgc cagtttcaga cgagaacaca acaggcagaa taaccgaact     45900
     gctcagctat cttgtgaaaa gttctctgct ttgtactagg agcaaggagt ccaatcagtt     45960
     gccctgctaa gaataaaccc cgggagtcca gactctttgc ccgtcggtct agtctcgact     46020
     gttccatcca gcctatacca cttatgcccg tttttctttg gcgcacggct cactccgtca     46080
     ggcacgcccc tgaccctgct cgtgtgtgtg tcttgtccac tatgtgccat ggctttaatc     46140
     ccgttgtgtg attgatcccg ttgtagtacc gtagcctcat gggttagatt aaagctggtt     46200
     ccctcccccg tccatgggtg ccctaattca tccatccatc catccccctt gccctgccac     46260
     cgagcagtca tttcaggatc atgtaatttg ttcacatcca cactcctttt gatttctttg     46320
     cctgctatat actacacaca ctctctttag actgaactct gattactcag agccattcaa     46380
     tcatcaccac catggtgtcc atctacacgc cccgtgctcg ctcagcacga caacattcac     46440
     aacaacaaca actatccatc cttctctgca ccctacttgc cctcccatcc gtgctaggat     46500
     ccgtgctgcc atccaccgca gaaataagca gtggggagat cgtcaatgcg gatctctccg     46560
     cagcacatac caccaccacc aacacagatc aaccactatc actatcacta tcaccagata     46620
     tcttcaccac cacaaccacc aacgccaacg acgacaccag caacctcacc ctgcaccccc     46680
     gcagcaccac caccaacacc acatccatat ccaccgacac gaccgacaca tcatcatcca     46740
     cattccccac cgccttcgac acctccctaa ccaacaactt caccaccacc acctgcgcca     46800
     ccttcttcca caacctccta tccaacacca ccctgacctc ctgccacgcc atctcgctcc     46860
     tcctccgcga ctcgacctcc ttcttccacg ccctcacctc cgcccccacc acctcctcca     46920
     tcctcgacac cgcctgcgcc tcgaacctca ccacctgcag caccgctctc acctccctcg     46980
     cctcgcaact tctccaatca tccacctgcc tgcacgacta caacgccgga aaccaagccg     47040
     tcgtatccgc ctacactgat ctcattacct acgcgcccat ctaccgcgcc acgtgcctgc     47100
     agtctccaga gacgaacaac tattgctttg tggatgcggt aacgaatacc agtaattctg     47160
     tggactatga tgtgtatttc gtgccgtatg ggagtgccat tgatgcggcg ccgtggccca     47220
     cgtgtaatga gtgtttgcag gcgacgttga atgtgtataa ggagtatgcg agtgtggatg     47280
     ggcagccgtt ggcggagagt tatttgccga cggcgagggg ggtgaatggg gtgtgtggga     47340
     gtgggtttgc ggatgttaat gttacggtgg gggtggtgaa ggatggggtt agtagtggtg     47400
     gtgctggggg gaggtttggg ggaggcagtt ggggggtgat ggtggtggtg gttgtggggt     47460
     ggagtgttgg ctgggtgatt ggggtggttt aggtgagggt atgatgttat atgatgtgat     47520
     atggttatgg ttttacttgg gggggaaaag ggattatcta atgtctatat ttaaactcta     47580
     atatctacat tcacttatct ccgtttcata gtatgtggaa aataatgtct tattcaaaac     47640
     caggtatatc cagcccgtag gcaaataaat gtatcaaaca gtgcagaaga atatcacaat     47700
     gtggttgcca ctatatcatg tcgttacaaa tagtcatgat acgaataatc ggagggttgg     47760
     tgaagaagga tattgaggag gagctaactc cgtcggaaac tgtcgcccag cgctacccct     47820
     accaggcttt ggggcccgaa gctctcattc cccaagcctg acgctgggct ctgtgtcgat     47880
     gcgtctctct cccgcttaat ccggaagaag gccagcttgg tgaaccggtt gagctgcgcc     47940
     caaaagtgtc gtcccgccgg atgcgccgca atgcgctcta ggagatcgac cgccgcctcg     48000
     cgcactggct ggtgcggatg gaacaatccc atgccgaggt agaagagtcc cgcctggttc     48060
     tccggagtca cggtcaagag ttggcagatg cctgcgtagt ctttgaccgc gtgtgcaaac     48120
     gaaatgtaga tcgcccccgc atcggccggc gggagcctca gcgcccgcag ccggtcatgg     48180
     tgatgatgta ggtccggctt ctgaatcggc cgtgagggat aatacatggc tgcaatatct     48240
     tgaataaagg aataatacga tcgcgtcgtc cgccagcctt caatccgcgc caccgacgcc     48300
     atcagctcgc gttgcttgga cccctcgtcc ggccacacat aaccgtgtcc acggagtgtt     48360
     gtcggatcga gtggatccgc ctgaaggccg cttggacttt cgggcgaaag ctcttcgttg     48420
     ggtccgataa cgtaaagatt ggatgcccca tagactgtct cctcgaaggc tgcagcaacc     48480
     cgggtgaact tggcaatata ggcgcgccac ttcgcccgga tggcattctc gccgtatcgg     48540
     ttggtgatgc tgcgctgaac ctcctccata aagacattgt ccccactggg atctgcattg     48600
     ttactcggcg gtgggtggtg gtgcatggcg gcttgttgct ggaaatacaa gagtccttcg     48660
     gtgactgggg ccggctcaat gtggctgctg atcttcattc ggcccgtggg caaatcgcag     48720
     agcacatccc accattcggg atggttggca aaggtaggat ttgtgacgcc agcaatgaaa     48780
     ccagggaccc tcagcaggtc atcgatcttc gtcaaatcgg tgtacgggaa tgcgtgtctg     48840
     gtgaacccgc gcaatatgcc gcccgacgca agggcgcacg ccgccaacac tgcctctgcc     48900
     acttcgcctg aagggcgatt atgccccagg aatatcactc gcttctgagt caacatggcg     48960
     ttgacgagga caatgatcgg atgggtaaag ggcccgctcg tagtgaggtg gggatggatg     49020
     ggaaacggct gtggcgaggc cgcatgcgga gtagaaaaga tctggatgag cttgatgagg     49080
     gaaaagtcgc ccacaacctc cggccaaatg accgtcggca ccttgacagg aataggaatg     49140
     tcgttgtaga cgatcttaga ctcaaactcg tgggtatctc ggggtagcgt gtatcgaggg     49200
     gcggctggcc ttttcgggga cgggggctct tcgtcaaaag gcccgccatc ttcaacttgt     49260
     cgctggtgga tcatctgctc gaatttctca atgaacatat ccttacagtt gcttgcctgc     49320
     aagatcagtc gttctaaaag cgatagcctc ggcattaacg acaggtccat ggcgttcacg     49380
     gcatcgtata acgatgcgag cgtctccggg taggggttct tgaagtaatc ctccagggcc     49440
     aagagaagta aaggctgtca tgaccggtca gctccatcac atgcgccgtt cttttgggtg     49500
     aacctacttt atatatatgt aggaaagaat gtcgcgtaca aatcgccatg gctttgacga     49560
     ctgcaccact gtgattgttc agtattgacc aggcagcccg gaaaccatag aaggacatac     49620
     cgtttgacgg aagtatcttg cttcgtattt acaaggttga gcacatacat caagggtggc     49680
     ccctcgccac cctcttcttc gtcgctgctc tcctcttcgg ttgacccgcc tacatcttcg     49740
     ctgtccccgt cgccgctctc cgcgtcccct atccgggact tctttttctt ctttttcttg     49800
     ccagtactag cgtcgtcctc gtcggcatcc gcgcttgtgt ccttgtgcaa gaagaagatc     49860
     gtccagtcct gactccgaac gtgcgtctga tcgggaagca tcagttccgc tagcatactc     49920
     tcgtcgccac tgattgcggc gggatactga tgctccatga tcgggccgcg gtcgatgtgg     49980
     aacgaggcca caaggatgta ctcgacatgt cgctcgggcg aatctcgggg gtattgcgat     50040
     ttgcatcgtc gcggtctggg gtaaagagta gagggacctt ggcccagcga gcgacggcgc     50100
     gccgagttcc ccgaactact gggggtgcgc cggtggatga tggaagggga aggggatagg     50160
     cggggatggc cattggcctt ggaaggattg gtcgtggccg caagcgagag ggtggaatca     50220
     tcagcaggtc ggtagggtag tgagatgctc attttctggc cggggaacag ggggtcgagg     50280
     tgggcacggg ggtcattcag atcgagagcg gatcgggggt ggcaagtgat agctccagag     50340
     gaccggcgaa caatgagcac gaggataacg ataatagcag catactcgat caattatccc     50400
     agtagaaaac cgaggcgacc tgactcaggc aactgatact gttagactgt cagtcattgt     50460
     cggggttcga gagccagggt ggacggggtg ggaggttcgt cgatcggagg attagtcggg     50520
     atagactcag gggaaaaaga aaggggacga gagcctccaa agcccacgca ccgacgatga     50580
     tctccacagc ggggaaaggc gacgggagac aaaccagcac caccgaccgc catggcctca     50640
     atgcacgcag ttgggggaag agtgcaagta gattgcaatg ggacgcaatg ggcacgggga     50700
     aattctaggc catgagatct agaccacaag ataaaacact tgcttttaga tcgatgataa     50760
     taatagagga ggaggatacc aataatctga gatggagtga tcggatctct ttctccgtgc     50820
     agttcgattg agggaacttc agacttgcag aactgccgct tcttgccttt cttgggcccc     50880
     gcacgtgccc cctccgtatc ggcccgactt gaacccccga agccttgttg tttgtttggc     50940
     tgcctttccc ttctgggaac tatgtaatgg atatctccat ccccattcta tcctgccatc     51000
     ttcccctctt gatccctctt cgctgtgggt aatcttcctc ccccaatctg atagggaaca     51060
     atcctgtaca gttgcatatc atcgtcatat tcattttctc accattgtta cttcatcatg     51120
     gtaagtgctc actctcccat tccctccttc cggactccgc tcaccgccgt atctccaggt     51180
     cacctccaac gcccccttca ggccatcgcc attatcattt ggctcccctc gaccctcccc     51240
     ttttcgccgt ccttctacac ccaactccca tccacaaggc cgctcaagca cccctggcag     51300
     ttcccccggc cgcggttaca ctccggttca gtcaccgagc aaactcaagg aatcatacac     51360
     cgtcgaggaa gatgacggtt catcacccaa gagcaagccc agaagtccca ttgcacagcc     51420
     tcggttcaca cgagaggcgc ccccttcgcc aacgaggggc gccaatgcgc cggattcgtc     51480
     gccgtcgttg atggaagcca aagctacgaa catgatggcg gcgtcatctg acgcagcagc     51540
     taaactaccc cccgcacaac tgcgggaaat ccgagaggcc ttccaagtcc tggaccgaga     51600
     taacgatggc ttagtagata aggacgacgt ggcggatgtg cttacgaacg tgggtatgta     51660
     acggaaggct agctagtcga tcattttcgg gcgatgacac atgatactga cgcaatgctg     51720
     ctcgacaggc caagacccga ctgccctttc caagttcttc cctctaggag gtcctcaaac     51780
     catgaatttc cccaccttcc tcaataccct ctcacagctg ctcgctcctc tttcttcccg     51840
     ccaagagctc atgaatgcct tggcggcctt cgacgaagac gatagcggtc agatcgacgt     51900
     cgacgagctg cgcgatgccc tcttacacac agcatccgag gatggagacc accctctaag     51960
     cgaccgggag atcaatgaag tgctcagtgg atttacgggg cgccgagcat ttggcgggaa     52020
     aggtgctcgg gcggcgggcg gagggaagag gggggaggta ttccgatacc aggactttgt     52080
     cagtgggatc atgggaggga cggagaatgg atcgacgaat cgccgcgacg cctagtagat     52140
     agccgcaacg gcggagtggg aattattgct tatagttcgg taacggcgtt cggatgatga     52200
     gggataccga tagttaggga acccgactgg ctctggcagc cattgacctg caattctgga     52260
     tctgcgtagg agacgacaaa cgacaacaac aacaacaaca tgactacttg ctatatcgta     52320
     gatacctttc agggcagctc catcttcggg aagttaaaca tgactgacag ccaggaacat     52380
     gtcacgatgg aaataaagtt gacagggcga gaataagaca agactcgtgg gcccgcgagg     52440
     attaaggcca ggaatttccc atggcaactg agcttttttt gctcgcgtcg tcgcgtgtcc     52500
     ccgcattccg tccgtcggca aaaaaaagcc cgccatcaga ttgaaactct gagagggaga     52560
     gagagagaga ctaaaagtta gtgatgatcc caagctgcag cagaaccccc taagaatcca     52620
     ttggtttctt gcatcgtccc cggcgtcgtt tcttttctcc aaccattcat tctcccctcc     52680
     caatcctata actactcact actttcacat gatataaatc tctcaggatc cctttttttc     52740
     ttttctttgt ctatcattat tattagtctt gtattcatgg atcatcttcc tgtccctctt     52800
     tgatccggtg tttcaaggga agatggtttt gtctctgcgc cagacgcaga cccccaatcc     52860
     ttgctgatcc aatcgagcgt ctgtccgtca cacctgcagc agagcccact cttcctctcc     52920
     ctccaccccc agcccagcat ggcgccctcc gaatcctctt cttctccctc gtccttccat     52980
     cccacccagg cccagcttaa tctcgctgct ctggctgggt caccttcacc gcggaccatg     53040
     cgaggcttgc gcaagatcca gtctcaccaa atcctctcat ctcacccacc ttcctcagct     53100
     catccgccgt cggggcgctt gtctgctggc gccggggagc tcgcccaacc tcctcagctg     53160
     gactcgcccg tgcgactgcg ctcgcaacgc cgggcgcgct ccaacagcga tgcctcgtct     53220
     cgggaggccc ctgcgatagg aactcaaaag cgatcggcca gaaagacagg ttctgggttt     53280
     ggagtcaagc gctcggtctt ggagactctc ctccgggacg gtccgcacca gggcaacctt     53340
     caggagggtc tccaggagct ccggtacctc gttctctcga cacgagtcga agcagacgcg     53400
     gatggcatgg tataatagcc cgaccccccc tcccccctcg tgctcattct gcccctcgtg     53460
     gaatgaagag caacacgtcc actaacacta tcgcgacagt ccacctaccg aatctacctt     53520
     tggctcgtcc ttctcgatgt ttctcctgtt ccaaccgacg aatacctctc cctcatccac     53580
     cgtggtcgct cgccagccta cacgaaaatc cgcaatgata cattccgcac catggccaca     53640
     gaccccctat tcaaacgccg cgtcacagaa gccagcttga tccggcttct caacgctgtc     53700
     gcatggaaac ttcacgacgc gaagaacaaa taccggtcgc gattgcgtcc gtcgtcccgt     53760
     cttcgagaga ttgagctctt aatcaacaca cccccgagca ttgaagaaga accctcccca     53820
     tccggaacac caggtagcgt tgccagcagt cgcggcggcg gcagcgggat tacaaacgaa     53880
     tctgcgatct acgtccaagg catgaacgtg ctctgcgctc cgttcctcta cgccgcccgc     53940
     agcgaagtcg aggcctttgc tctgttccac tcgttcatta cacgcgaatg tcctggttac     54000
     atccgcggcg ccatggatgg ggtccatcga ggtctgcgct tggtcgacca atgtttagag     54060
     atcgtcgaac ccaaattagc ggcgtacctc ttctccaagg gcctacaggc gaaattgtat     54120
     gcatttccgt cggtgttgac cctctgtgcg tgcacgcctc ctcttccgga ggtgcttcat     54180
     ctttgggact ttttgttcgc atacggaacg cacctaaata tcttgtgtat tgtggcgcaa     54240
     ttgattcgaa tgagggacac gatcctggaa agtccgaagt atgtttactt tttgtttttt     54300
     cttaacattt tcccttgcct tttacctttc ctactctggt tcattccccc ttttcatgtt     54360
     tgtttttgtt tttctcgtcc gcctcatcct ctcgaaaaag caataccata ccaccaaaaa     54420
     caaaacaaaa gacggggaaa aataagacaa atcacatccc ctcagagcac agccccgaca     54480
     cacaagtccc tctgagagaa taattctcct gggcatgata tgataccccc caaacccaaa     54540
     acaaagcccg cagcagatat cccagagaca ttgtgatgtg aggtaacagc gctaacgtga     54600
     tccatccaca gtcccaacaa aatcctccga tccttcccac cactcgacgc caaagagatc     54660
     atcgccctga cggtcctgat cgtccgcaag atccccgagc cgctgtacgc tgaattaatc     54720
     gaccatgcca aatgatgatg gcatcacttt tctttccctt ccctgttttc cagctagcta     54780
     gctagccagc cagccagaga gcccagctac ggcttcagct acagccagcc agccagccag     54840
     ctagctagcc acgaaaacca accctaagca cctaccacct actaccacca tctaacccac     54900
     cgaattcgcc acctaccact cggacccaga cccagactcc gacccaaaca atattccgca     54960
     ttgggactaa tgtgtccgtc ccgtccggcc gtccgtctct ccgtcccacc actacctgcc     55020
     tacttatatt aacgcctctt attttaccct tttcactttc tcacgtacgc gcgccggatc     55080
     taacgatgac ctaattgaga cgtctcgtac ttaccctttt tgtacttgta ttttacattt     55140
     ctttttcttt ttcccttttc gtcttttttg aacagtttct ggcgtttttt ttgtttttcc     55200
     ttttctcatg ataactaacc gactaaccta acctactgac taccattact gtatgtatta     55260
     ttgattgtta tgagagcatg atatcattga tggaactgac tgagatatga gaaaaagatg     55320
     gaaaaagcag aaaaaggaaa aagaaagaaa gcatatagga gcagtgattg attgatggag     55380
     atgaggggat gtattctaga tggagatgtt gatttttttt gattgattga ttgattgatt     55440
     gaccatgtta tttaaaggtt aactaactga ctaccggtcg ggttggtcag atagatgaga     55500
     tgagatgcga tgactcatga gtgaaatgat gaaattgatt gaatgcatca tgctacttgc     55560
     agacagattt cgatttcttt gaattgatag aataaggata cactactaga acatgacttc     55620
     taaccaacca accaatcatt ctatctatgt tatgtatgta atcaccgttt gaacgccccg     55680
     ggacgccgta aatctcactc tggcagtcat tggaaacctt gcacataagt agagatataa     55740
     gaataaaacg atcatgcaca tgtaactatg atcacatcca attccagagc acatcaaaca     55800
     tagactgatt caaccccatg atcccgttct atcccgtcct taccctctgc agaaaacaat     55860
     gatgatgatg ataagatatc tgtttatcga ctattactat ataggccggc cagtcaatac     55920
     ttccgtcaga agtagtgatg gaatgtgtgc ggctaagtag ccactgcctt ggttcccgtg     55980
     ttggacccat tgacgactag gggtccacag tggtcgcccg atttcgacga cgttgacgtc     56040
     gatgaagaca gcgatgatga cctcgggctg ttgccagcac catatggtcc ttggttcttt     56100
     gcgaccggac tgttcgcgtt agctgatggt gccgaaccgg catgtctctc gcgggtcagg     56160
     ctgtaagcga gatggagact ccggtcgatc ttgacgcgaa ttttcgcgtc cataaagttg     56220
     atgccgttgt actgcgctac aacacgcttg gcttcatctg ctgtgcgtag ggttacccgt     56280
     gcgaagcctt tacagcggcc ggtgtcggga tccgtggaca cctcggattg ctccactgtg     56340
     gcgccacttt cttctatgaa ggcgcgaagg agcttgtcgg tcgtggtggg actgagattc     56400
     tgcacgaata tagttcgtcg tggggaagaa cggggacctg ggcccccgga atggtagatc     56460
     tgcggcgcga acgccggatt gtagccgtag gaagctttgc cggacatgtg ggcccgacgt     56520
     ccgggtagac taaaaccgcc atgtgctggg gcatcaggaa acggcggcat ggtcggaaaa     56580
     ggatatgcgg ggaagacggg aatagcgaaa gcgtcgccga aggagtggcg gagaggagcg     56640
     ggcgagggcg ggatgcctga tatgggctgt tgtgtgactg ggtctgtggg gaaaggcatg     56700
     aaaggctgtt gaggcattgc taggggattg accatggggc cgtaatcagt ggctggatat     56760
     gtcgggcagc ttggactggc agacaagata ggtctatgag ttgtcagttg tcgcctgagg     56820
     aagaagggga gccacttcct gtacttactc gggggaaatg ggagacggag gcactgccat     56880
     gttttgtgtt gatcgtggcg gagttgagta gcctggtaca tagttgggcg gaattacgca     56940
     ggttggactc ttcgtgggcc cagcaattgg tcgtgtaggt gagctggttc gtgctaaagt     57000
     gacaacaagg ctctggcctt cccagccgtt ggtagaaagc ctatctagaa gcaccctgtc     57060
     agctaatttc taaccatctg agtttcatga cgcacggtag gtcctccatg cttcgtcttc     57120
     gttcttcacg atgatctgtc caagaccggt tgggaatcca tgctggtcat cgtagaccac     57180
     tgcttgacgg atatgtaagg ctgtctggcg gactaggtcc ttgagctctt gccaacgaca     57240
     gtgcgccggt atctgcaccc atggttagac aaggccgcgt gtatgagatg taccacgtgc     57300
     gagacatacc ccctggagga atagaacaaa ttcctcttct gaccttccag attttgccat     57360
     ccgccccttc tcgcgtggag ggaaaggcat gatagtgtgg tatagtaggg ttcgatatgt     57420
     cagatcccct gagatttcgg agaatgaatg aagaggaggt ggaccccgtg agtttaaaag     57480
     cttgtgatct tctatcaaac ggactagttc cgagtccttt aagcttcaat gcgcaagatg     57540
     gacggagtta gcaggggggg tagtggccta gaagctagaa tataagtatc ggggtttggt     57600
     ctgacggtct catgcccggg tatgaccaat gatgcccaag gggactatgc ttactggttc     57660
     gtccttgaca accccgatcg ctaatcagac aatcacgtac tgtttgaaat aaagaagccg     57720
     atccacagga aaaataagag atcgaagacc agtgcttcgt gggttttatg tcaagacagg     57780
     aagacaagcg cccgggttga tcgacctcct acatcgaaag aggcccaccg atggcgaaaa     57840
     gtgttgaggt cggtgctgaa ggagcagcag cagcaaccgc ggcaggtaga gtaaggaggg     57900
     ccagaataag aatagcaaag gcagtaagaa tgtccgagga aatggaaaca gagaggacag     57960
     taggacccgt gaggataaga ttagtggaac gaggccagaa agcagagtga aaatagacga     58020
     aagccaccga tgcatccgct gacgaattaa aagggggcgc agttggtgct ggagagcttg     58080
     cgagggaaat ccgggcctga tgcctggaga agactgggat gggtcaactt ggacgagctg     58140
     gcaaaggcag atggggagga gaaggtggta gtgatcgcag ttgaggaatc gaggaaggac     58200
     ggggtccaag caggctgatg atgatatgtc atgcatgatc aacagtgatg gataagaaaa     58260
     gatggagact cactattgag cttgagtggc cgaagaagaa gtgatggagc caggaaaaaa     58320
     aacaagatga gaaaaaagga agtaaattac taactagttg gatgaattga atgaaggaag     58380
     agatgggggg aaaagaaatg aagagaaaaa gaaaagaaaa aaaagtaaat atagttagtt     58440
     agttatttag tatgatggct gactgacttg ctgggcataa actaataatc agtcattcag     58500
     tcagccagtc tgtcaatcag agccagtaaa tataagatga attgagagat ttctatttgt     58560
     agttactgta ataataaatt tcacagagta gtactgcgtg aggttgaact aactagcagc     58620
     caatacgcct caggtagcac caggaaaaag tactgtcaga gactagagaa gcagtgagag     58680
     agagacgcag aggaagtata tccttgattt aatcctgcaa tgattggtga agatcggaaa     58740
     gtaaatgacg atgagaatag ggacacagtc tcaacaaaac aaaccaaccc aacatcatcg     58800
     attcagcttt tcattcaatg gcactcactc ttcaacacca acttcaataa cctccatagg     58860
     cccataactc atccctcctc ttttctcttc atccgcgccc tcattccaat acactcgagt     58920
     acgtcacgct tggcggacag ggttacaccg ccagatctca gggcagccac aacaacaaca     58980
     aagtccctgt cctgttctgg agtcagagaa gtctaataaa ttagtttcga atcaaaagaa     59040
     ttgacacaaa tgcattaact agagaatata ccaattgctg atgggaaata aaaagagttg     59100
     atggtggacc atccgccctg catcgccctg aaatgcaaat ggcattgtca tcaccatcat     59160
     catcatcctc ttcttcggtc agccctgcag tagcctggaa tattgcccct caaagaaggg     59220
     cagccaacca aaataagaag agatcgagca ttttaccgca cagctgatgc gataagaaga     59280
     aaggtgtttc ttttttttct ttttgttctg tttccttctc accctttggg tcaccttcac     59340
     catattaaga aagctgcact gcaaacaaaa atagaatagc ctcagccctg aaatgggggt     59400
     ggtggagtta cacagtcgga cttgtctcat gtctgatcgt gaaagactgc agcatcttca     59460
     cccgggcttg acctctaacc cccctctctc ccctctctca ttcggtctct cattgctgca     59520
     ctagtaggtc gggttaattg tctcgtctca gcccatatcc ccacagatag tcatccagga     59580
     ttgcatcgca gcagagatca caacgcattg aaatgaattg aagaaaaagc agatcagcca     59640
     gaatacccaa gcaagcgagc ttcacaagca gcctattgaa cacttgcgtc tccccagtcg     59700
     gatccagcct tgccccttga ttcagttctt ggaccacccc gattcggccg ggaagatcct     59760
     tgaagcagcc tgcatatgag gtatccattc caacgacagt ccgtcagtca tcgcctaagt     59820
     aggtccgccg tcttgccgcc cgggagtacc tgtccactcc atgcatcgaa accttgccac     59880
     tcaggtcacc gccggtgctg agcgatacat ccaaaagaat gtcacacggc agctggccgt     59940
     atatggttaa aaaagtgtag tcaccgggaa gcgttggacg ggagacatcc aaccaacgcc     60000
     cgggcagcag gcgtcaggct ccggtaaccg ctgcgaccaa tgcggtttgg tctagtgaga     60060
     ccaggagcaa taggatgagg agggctgaaa gtgaatgggg atgtcatcgt atccctctta     60120
     cgggaaccta cagttggaaa aaagaataaa ataaaagaga aagttatcag gaaagccact     60180
     ctaaaaagcc aggcactgga ttgaactgcc gagataagcc gctgcaatcc gagtctaatc     60240
     tgtccgattc aagtaggggt ggttgtctgc ttcaggcgcc tgagatctcg cctgtgtgtt     60300
     tgttttgtcc atttgattaa gcccagatga gtcacgatca agagagcaga tcgcagacta     60360
     tctagctacc tcccccccgg aaactccgct aaaattcgat agtcggacga tcgacccata     60420
     caacaccgta gactttagtt gggtgattac taggcacgcc ctcgccctcg ccctccgccc     60480
     acgggcccgc ggctctggta ggatctccca ctagcaactg agtatacgtt ggaagactcc     60540
     atacccaacc aggcgaacaa tctagaaggg atcgaggatt tcacgaccca tcagggtccc     60600
     gcgggcctta aacttgaagc tagaagatgc tatccatcgt ggctggctcc agatctgttt     60660
     ctctctctct ccacttggga tgggactatc ttaaacccat ccatattccc gatcagggaa     60720
     tacgctggag gttccgggtg gattacttac ttgtcgcggt cgcgtggaca actaagcttt     60780
     gatcgtgtca ctgccgtacg aggaggttaa aatatcctgt ccctccgtgc ctggtcccgt     60840
     ctaccgatta catacatgag cagcacagta gtccgcggac tattgaacac tacgacctat     60900
     tccatgtctg agtggaacct caacgatgtg aagatggatc tcctgtgatc gtagctacgg     60960
     ggtgtaatcg gtgttctgcc gtggaccgaa aagtcagatt gctcggtttc tttggatcgt     61020
     aacgttgctt tgatactgaa tctcgaagtc atgacttacc ttcctgactg agacaggccg     61080
     aattgggaga tccgtcgatc gccctcgatt cctcaggaca caactcgcta gacccgacaa     61140
     ctaccatgga acgaagctat gaagaacgag ctctacctgt cacatgcaat ggaacttagc     61200
     agccaccgac tggctcgcaa ttggcaataa tgcccttcct gtcactaacg aggctcggtc     61260
     ggggattatc tgacatttcc gctgacacgg tgaccatggg ataaatcgtc tgccgaccat     61320
     gacaccgggc agaccgttct gcaatatttg aggttttata cggtaccacg cacatatgcg     61380
     cgcacatgat actcttacac ttggtgacac catcaagttg attattatct gagtctccag     61440
     cgcacagcca ccgaattaca gtaagccaat cctgaggctt tccccctccc ctcattgcct     61500
     gccacccccc ttctgccctt cgggcggttt ctccccatct cccagtgcta accccgatag     61560
     caccatagca cagtggaccc cgagcagaga gtagacgaga cgatgaaacg aggccaaacc     61620
     cacgactgaa ttgagccacg gcccactgat cagcgacacc caccattgcc gacaccacaa     61680
     aaggggtcgg tcaagcaatc tttcgggtgt ggcttgaagg gccgcccgtc acaacctcca     61740
     ttaggtaatc cagcgtgaat ttctctcttt gctatctgag cctgcaaaaa gcaaaagcta     61800
     gtctaatgtg agtgatctcc gcgtcccaga cggctgaatt gctgtccctg actcgctcgg     61860
     ggttcgaatc gggctctgaa tttctgatac acacaagcgt gacaagacac ctgccatcga     61920
     tccgatcgcg gcatctctcc tcatgcgggg cgacgccagt gtacttactt gctcacactt     61980
     acgtgtccgt gttacaggca accaggctaa tgtcccataa ctgtaagggg gaagaggggt     62040
     gggcaaaggg aaatggaaaa gatggagggg taaaagg                              62077
//

If you have problems or comments...

PBIL Back to PBIL home page