(data stored in ACNUC11299 zone)

EMBL: AM269986

ID   AM269986; SV 1; linear; genomic DNA; STD; FUN; 130160 BP.
XX
AC   AM269986;
XX
DT   28-JAN-2007 (Rel. 90, Created)
DT   14-MAR-2015 (Rel. 124, Last updated, Version 5)
XX
DE   Aspergillus niger contig An01c0390, genomic contig
XX
KW   .
XX
OS   Aspergillus niger
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
XX
RN   [1]
RP   1-130160
RA   Pel H.J.;
RT   ;
RL   Submitted (01-MAY-2006) to the INSDC.
RL   Pel H.J., DSM, 624-0295, P.O. Box 1, 2600 MA Delft, THE NETHERLANDS.
XX
RN   [2]
RX   DOI; 10.1038/nbt1282.
RX   PUBMED; 17259976.
RA   Pel H.J., de Winde J.H., Archer D.B., Dyer P.S., Hofmann G., Schaap P.J.,
RA   Turner G., de Vries R.P., Albang R., Albermann K., Andersen M.R.,
RA   Bendtsen J.D., Benen J.A., van den Berg M., Breestraat S., Caddick M.X.,
RA   Contreras R., Cornell M., Coutinho P.M., Danchin E.G., Debets A.J.,
RA   Dekker P., van Dijck P.W., van Dijk A., Dijkhuizen L., Driessen A.J.,
RA   d'Enfert C., Geysens S., Goosen C., Groot G.S., de Groot P.W.,
RA   Guillemette T., Henrissat B., Herweijer M., van den Hombergh J.P.,
RA   van den Hondel C.A., van der Heijden R.T., van der Kaaij R.M., Klis F.M.,
RA   Kools H.J., Kubicek C.P., van Kuyk P.A., Lauber J., Lu X.,
RA   van der Maarel M.J., Meulenberg R., Menke H., Mortimer M.A., Nielsen J.,
RA   Oliver S.G., Olsthoorn M., Pal K., van Peij N.N., Ram A.F., Rinas U.,
RA   Roubos J.A., Sagt C.M., Schmoll M., Sun J., Ussery D., Varga J.,
RA   Vervecken W., van de Vondervoort P.J., Wedler H., Wosten H.A., Zeng A.P.,
RA   van Ooyen A.J., Visser J., Stam H.;
RT   "Genome sequencing and analysis of the versatile cell factory Aspergillus
RT   niger CBS 513.88";
RL   Nat. Biotechnol. 25(2):221-231(2007).
XX
DR   MD5; b1e9ceda97fb595f594bcc73fbc4304a.
DR   ENA-CON; AM270980.
DR   BioSample; SAMEA3283178.
DR   EnsemblGenomes-Tr; CADANGAT00001267.
DR   EnsemblGenomes-Tr; CADANGAT00001268.
DR   EnsemblGenomes-Tr; CADANGAT00001269.
DR   EnsemblGenomes-Tr; CADANGAT00001270.
DR   EnsemblGenomes-Tr; CADANGAT00001271.
DR   EnsemblGenomes-Tr; CADANGAT00001272.
DR   EnsemblGenomes-Tr; CADANGAT00001273.
DR   EnsemblGenomes-Tr; CADANGAT00001274.
DR   EnsemblGenomes-Tr; CADANGAT00001275.
DR   EnsemblGenomes-Tr; CADANGAT00001276.
DR   EnsemblGenomes-Tr; CADANGAT00001277.
DR   EnsemblGenomes-Tr; CADANGAT00001278.
DR   EnsemblGenomes-Tr; CADANGAT00001279.
DR   EnsemblGenomes-Tr; CADANGAT00001280.
DR   EnsemblGenomes-Tr; CADANGAT00001281.
DR   EnsemblGenomes-Tr; CADANGAT00001282.
DR   EnsemblGenomes-Tr; CADANGAT00001283.
DR   EnsemblGenomes-Tr; CADANGAT00001284.
DR   EnsemblGenomes-Tr; CADANGAT00001285.
DR   EnsemblGenomes-Tr; CADANGAT00001286.
DR   EnsemblGenomes-Tr; CADANGAT00001287.
DR   EnsemblGenomes-Tr; CADANGAT00001288.
DR   EnsemblGenomes-Tr; CADANGAT00001289.
DR   EnsemblGenomes-Tr; CADANGAT00001290.
DR   EnsemblGenomes-Tr; CADANGAT00001291.
DR   EnsemblGenomes-Tr; CADANGAT00001292.
DR   EnsemblGenomes-Tr; CADANGAT00001293.
DR   EnsemblGenomes-Tr; CADANGAT00001294.
DR   EnsemblGenomes-Tr; CADANGAT00001295.
DR   EnsemblGenomes-Tr; CADANGAT00001296.
DR   EnsemblGenomes-Tr; CADANGAT00001297.
DR   EnsemblGenomes-Tr; CADANGAT00001298.
DR   EnsemblGenomes-Tr; CADANGAT00001299.
DR   EnsemblGenomes-Tr; CADANGAT00001300.
DR   EnsemblGenomes-Tr; CADANGAT00001301.
DR   EnsemblGenomes-Tr; CADANGAT00001302.
DR   EnsemblGenomes-Tr; CADANGAT00001303.
DR   EnsemblGenomes-Tr; CADANGAT00001304.
DR   EnsemblGenomes-Tr; CADANGAT00001305.
DR   EnsemblGenomes-Tr; CADANGAT00001306.
DR   EnsemblGenomes-Tr; CADANGAT00001307.
DR   EnsemblGenomes-Tr; CADANGAT00001308.
DR   EnsemblGenomes-Tr; CADANGAT00001309.
DR   EnsemblGenomes-Tr; CADANGAT00001310.
DR   EnsemblGenomes-Tr; CADANGAT00001311.
DR   EnsemblGenomes-Tr; CADANGAT00001312.
DR   EnsemblGenomes-Tr; CADANGAT00001313.
DR   EnsemblGenomes-Tr; CADANGAT00001314.
DR   RFAM; RF00005; tRNA.
DR   StrainInfo; 791018; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..130160
FT                   /organism="Aspergillus niger"
FT                   /strain="CBS 513.88"
FT                   /mol_type="genomic DNA"
FT                   /clone="An01c0390"
FT                   /db_xref="taxon:5061"
FT   CDS_pept        complement(join(774..845,938..1019,1214..1411,1690..1920,
FT                   2089..2190,2262..2336,2475..2503))
FT                   /locus_tag="An01g12680"
FT                   /note="Title: weak similarity to DNA-binding protein 5E5
FT                   -Rattus norvegicus"
FT                   /note="See PMID 8537300"
FT                   /db_xref="GOA:A2QAT4"
FT                   /db_xref="UniProtKB/TrEMBL:A2QAT4"
FT                   /protein_id="CAK37318.1"
FT                   /translation="MQAAGDIGESGREGVKGLEEGGEWKAGEQKAKDSKHAHPCTRTPT
FT                   VTHGGEEYLQISAEAQGGMRILNRREATKEQPWIGGGRSRVRSIGLDHRIRKGKSDPGS
FT                   ASPFGQRRGGKREGGWNRGQRKEGKKQSNPAFKVVAAAVLTPWHLCCESGCGRVPTWVQ
FT                   DASGMVRNAPGYRSGAFRASLAPSGSRAPPATMVHGFPSTSGQLRGSLRATRPTSVCPL
FT                   SGTDPRVDARCTRHVWMVLPGGAPGPTCYMLYPQGIILDT"
FT   mRNA            complement(join(<774..845,938..1019,1214..1411,1690..1920,
FT                   2089..2190,2262..2336,2475..>2503))
FT                   /locus_tag="An01g12680"
FT   exon            complement(774..845)
FT                   /locus_tag="An01g12680"
FT                   /number=1
FT   intron          complement(846..937)
FT                   /locus_tag="An01g12680"
FT                   /number=1
FT   exon            complement(938..1019)
FT                   /locus_tag="An01g12680"
FT                   /number=2
FT   intron          complement(1020..1213)
FT                   /locus_tag="An01g12680"
FT                   /number=2
FT   exon            complement(1214..1411)
FT                   /locus_tag="An01g12680"
FT                   /number=3
FT   intron          complement(1412..1689)
FT                   /locus_tag="An01g12680"
FT                   /number=3
FT   exon            complement(1690..1920)
FT                   /locus_tag="An01g12680"
FT                   /number=4
FT   intron          complement(1921..2088)
FT                   /locus_tag="An01g12680"
FT                   /number=4
FT   exon            complement(2089..2190)
FT                   /locus_tag="An01g12680"
FT                   /number=5
FT   intron          complement(2191..2261)
FT                   /locus_tag="An01g12680"
FT                   /number=5
FT   exon            complement(2262..2336)
FT                   /locus_tag="An01g12680"
FT                   /number=6
FT   intron          complement(2337..2474)
FT                   /locus_tag="An01g12680"
FT                   /number=6
FT   exon            complement(2475..2503)
FT                   /locus_tag="An01g12680"
FT                   /number=7
FT   CDS_pept        join(2693..2883,3038..3923)
FT                   /locus_tag="An01g12690"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   CAD21381.1 - Neurospora crassa"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A2QAT5"
FT                   /inference="profile:COGS:COG0500"
FT                   /inference="similar to AA sequence:UniProtKB:NC123A4.28"
FT                   /protein_id="CAK37319.1"
FT                   /translation="MASPNRNNYSYQGIESYDSGRSRQNSDAMDIHVITAQEPPREPPD
FT                   NNDPYDGHGGPAGTSHYSKWLFYEENGRTYHGYRRGVYPLPCDEQEQDRLDIFHKLFTV
FT                   ARMSESLIYAPHPPNGRFLDLGCGTGIWAIDVAHKYPNAFVAGVDLAPIQPPNHPDNCE
FT                   FYAPFDFEAPWTLGENSWDLIHLQMGCGSVLGWQNLYKRILRHLQPGAWFEQVEIDFEP
FT                   RCDDRSLNGLALREWYQYLKQATQDTMRPIAHSSRDTIRHLEEAGFTQIDHQMVGLPLN
FT                   PWHRDEHEQKVARWYNLAISESIETLSLAPFSRIFHWDLDRIRQITAEVKSQAFNKEIH
FT                   AYNILHIYQARKPGGPSL"
FT   mRNA            join(<2693..2883,3038..>3923)
FT                   /locus_tag="An01g12690"
FT   exon            2693..2883
FT                   /locus_tag="An01g12690"
FT                   /number=1
FT   intron          2884..3037
FT                   /locus_tag="An01g12690"
FT                   /number=1
FT   exon            3038..3923
FT                   /locus_tag="An01g12690"
FT                   /number=2
FT   CDS_pept        complement(join(4908..5997,6056..6196,6257..6345,
FT                   6405..6466,6519..6588))
FT                   /locus_tag="An01g12700"
FT                   /note="Function: the H. sapiens RBQ-3 preferentially binds
FT                   to underphosphorylated pRB."
FT                   /note="Title: similarity to retinoblastoma protein binding
FT                   protein RBQ-3 - Homo sapiens"
FT                   /note="See PMID 7558034"
FT                   /db_xref="GOA:A2QAT6"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR037850"
FT                   /db_xref="UniProtKB/TrEMBL:A2QAT6"
FT                   /inference="profile:COGS:COG5635"
FT                   /inference="profile:PFAM:PF00400"
FT                   /protein_id="CAK37320.1"
FT                   /translation="MNLSLVDPFVLAQDYPDTLTEKLRSGHATCLRFNRKGDYLASGRV
FT                   DGTVVIFDVETNGVARKLRGHTRQIQSLSWSRDGRYLLSSSQDWKCILWDLKDGSRVRT
FT                   VRFEAPVYIAELHPYNHLLFVASLFEDQPVLVDVSLPKPVKRILPSAPFRPPPPKNEEI
FT                   DPAVAAKQAAQDAKHSTCVTIFTALGNHIIAGTSKGWINIIETQTCTTIHSTRLCNGVV
FT                   ILLRLASNGRDLLVNSSDRVIRTILMPDLSQLGIDLEPTNIKLQVEHKFQDVVNRLSWN
FT                   HVAFSSTGEFVTASTFMNPDIYVWERSHGSLVKILEGPREELGVVEWHPSRPMVVACGL
FT                   ESGCIYTWSIVTPQKWSALAPDFGEVEENVEYVEREDEFDIHPAEEIHQRRLDQEDEVP
FT                   DVLTIELNKDGADEDIVASFRMPVLLDISDSESEDDIIAVGPGTMRRRSPGAARDRTNA
FT                   NGDGEKDSVNGGRNGSTRGQKGRRR"
FT   mRNA            complement(join(<4908..5997,6056..6196,6257..6345,
FT                   6405..6466,6519..>6588))
FT                   /locus_tag="An01g12700"
FT   exon            complement(4908..5997)
FT                   /locus_tag="An01g12700"
FT                   /number=1
FT   intron          complement(5998..6055)
FT                   /locus_tag="An01g12700"
FT                   /number=1
FT   exon            complement(6056..6196)
FT                   /locus_tag="An01g12700"
FT                   /number=2
FT   intron          complement(6197..6256)
FT                   /locus_tag="An01g12700"
FT                   /number=2
FT   exon            complement(6257..6345)
FT                   /locus_tag="An01g12700"
FT                   /number=3
FT   intron          complement(6346..6404)
FT                   /locus_tag="An01g12700"
FT                   /number=3
FT   exon            complement(6405..6466)
FT                   /locus_tag="An01g12700"
FT                   /number=4
FT   intron          complement(6467..6518)
FT                   /locus_tag="An01g12700"
FT                   /number=4
FT   exon            complement(6519..6588)
FT                   /locus_tag="An01g12700"
FT                   /number=5
FT   CDS_pept        join(7399..7527,7601..7757,7826..7896,7957..12827,
FT                   12884..12899)
FT                   /locus_tag="An01g12710"
FT                   /EC_number="2.7.7.6"
FT                   /note="Catalytic activity: n nucleoside triphosphate = n
FT                   pyrophosphate + rna(n)."
FT                   /note="Function: RNA polymerase II catalyzes transcription
FT                   of mRNA and U1-U5 snRNA."
FT                   /note="Remark: RNA polymerase II consists of about 12 to 15
FT                   different subunits."
FT                   /note="Title: strong similarity to largest subunit of
FT                   DNA-directed RNA polymerase II rpb1p - Schizosaccharomyces
FT                   pombe"
FT                   /note="nucleus"
FT                   /db_xref="GOA:A2QAT7"
FT                   /db_xref="InterPro:IPR000684"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007073"
FT                   /db_xref="InterPro:IPR007075"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR038593"
FT                   /db_xref="UniProtKB/TrEMBL:A2QAT7"
FT                   /inference="profile:COGS:COG0086"
FT                   /inference="profile:PFAM:PF00623"
FT                   /inference="profile:PFAM:PF04983"
FT                   /inference="profile:PFAM:PF04990"
FT                   /inference="profile:PFAM:PF04992"
FT                   /inference="profile:PFAM:PF04997"
FT                   /inference="profile:PFAM:PF04998"
FT                   /inference="profile:PFAM:PF05000"
FT                   /inference="similar to AA sequence:PIR:S26849"
FT                   /protein_id="CAK37321.1"
FT                   /translation="MANVYFPYSKAPLRTIKEIQFGLFSPEEIKRMSVVHVEYPETMDD
FT                   QRQRPRTKGLNDPRLGTIDRQWNCETCEEGQKECPGHFGHIELATPVYHIGFLTKIKKL
FT                   LETVCHNCGKIKANTSDPKFLEALRMRDPKRRFDHIWRLSKDVLICEADPPPDDDEPFS
FT                   KENAKPVRMHGGCGNAQPQIRKEGITLVGTWKPNKMMDEMDMQQPEKKVITPQVALNVF
FT                   RNISYEDVRIMGLSNDYARPEWMIITVLPVPPPPVRPSVLVGGSTSGQRGEDDLTYKLA
FT                   EIVRANQNVQRCEQEGAPEHVVREFESLLQYHVATYMDNDIAGQPKAMQKSNRPVKAIR
FT                   SRLKGKEGRLRQNLMGKRVDFSARTVITGDPNLSLEEVGVPKSIARTLTYPEVVTPYNI
FT                   EKLQTLVSNGPNEHPGARYIVRDNGERIDLRHAKRAGGQQLLYGWKVERHIMDGDVILF
FT                   NRQPSLHKESMMGHRVRVMPYSTFRLNLSVTTPYNADFDGDEMNLHVPQSEESRAELSQ
FT                   LALVPMNIVSPQRNGPLMGIVQDTLCGIYKICRRDVFLTKDQVMNIMMWVPDWDGVIPP
FT                   PAILKPRPRWTGKQMISMALPSGLNLLRVDKDNSPLSEKFSPLADGGLLIHNGQLMYGM
FT                   FSKKTVGASGGGVIHTIFNEYGHGTAVAFFNGAQRIVNYWLLHNGFSIGIGDTIPDELT
FT                   IQRIENCVRNRKKEVESITASATDNTLEPLPGMNVRETFESKVSRALNNARDEAGSETE
FT                   KSLKDLNNAIQMARSGSKGSTINISQMTAVVGQQSVEGKRIPFGFKYRTLPHFTKDDYS
FT                   PESRGFVENSYLRGLTPTEFFFHAMAGREGLIDTAVKTAETGYIQRKLVKALEEVMVKY
FT                   DGTVRNSLGDIIQFIYGEDGLDGAHIENQRVDIIKCSDDKFRERFRVDLMDPERTLGPE
FT                   VLEQANEIAGDVEVQRHLDEEWEELLKDRAFLRSVAKEDEEMMQLPINVQRILETARTT
FT                   FRIREGTISDLHPAEVIPQVRSLLDRLLVVRGNDIISREAQENATLLFKAQLRSRLAFR
FT                   RLVTEYSMNKLAFQHVIGAIESRFAKAGANPGEMVGVLAAQSIGEPATQMTLNTFHFAG
FT                   VSSKNVTLGVPRLKEILNVATNIKTPSMTVYQEAARSFDKEGAKQLRSAVEHTSLRSVT
FT                   EATEIYYDPDIQTTVIENDRDMVESYFIIPEDVTDDASRQSKWLLRIILSRPKLLDKGL
FT                   TVQDVASRIKAAYPKDIAVIFSDNNADEQVIRIRQIQDYKEDEEDDDIEYDVTLKKLEQ
FT                   HLLDTLTLRGVPGVERAFINEKSKVRVLEDGSLFASKTDPLCKEWVLETSGSSLGEVLA
FT                   IPGVDATRTYSNQFIEVFEVFGIEAARTAVLRELTQVLAFDGSYVNHRHLALLVDVMTV
FT                   RGYLTPVTRHGINRADNGALMRCSFEETVEILLEAAAFGELDDCRGVSENLILGQMAPA
FT                   GTGEFDIYLDQNLMNTVVSNNARFGVMGAIGAKDAIISDGAATQYDTGSPMQESAYIGT
FT                   PDPESNFSPIRQAGAETPGGFTEYQPTGGFGGGFSPAATSPAGYSPSSPFSANPTSPGY
FT                   SPTSSYSPTSPGMAITSPRFMSTSPGFSPASPSFAPTSPAYSPTSPAYGQASPTSPSYS
FT                   PTSPGFSPTSPNYSPTSPSFSPASPAFSPTSPSYSPTSPAVGGVGRHLSPTSPTSPKYT
FT                   PTSPGWSPTSPQTYSPTSPNFAGSPTSPGGPTSPGYSPTSPAFSPTSPRQ"
FT   mRNA            join(<7399..7527,7601..7757,7826..7896,7957..12827,
FT                   12884..>12899)
FT                   /locus_tag="An01g12710"
FT   exon            7399..7527
FT                   /locus_tag="An01g12710"
FT                   /number=1
FT   intron          7528..7600
FT                   /locus_tag="An01g12710"
FT                   /number=1
FT   exon            7601..7757
FT                   /locus_tag="An01g12710"
FT                   /number=2
FT   intron          7758..7825
FT                   /locus_tag="An01g12710"
FT                   /number=2
FT   exon            7826..7896
FT                   /locus_tag="An01g12710"
FT                   /number=3
FT   intron          7897..7956
FT                   /locus_tag="An01g12710"
FT                   /number=3
FT   exon            7957..12827
FT                   /locus_tag="An01g12710"
FT                   /number=4
FT   intron          12828..12883
FT                   /locus_tag="An01g12710"
FT                   /number=4
FT   exon            12884..12899
FT                   /locus_tag="An01g12710"
FT                   /number=5
FT   CDS_pept        join(13750..13792,13926..14000,14071..16022)
FT                   /locus_tag="An01g12720"
FT                   /note="Similarity: patentmatch against tumour suppressor
FT                   TSA305 protein Y17750 Patentprot."
FT                   /note="Title: similarity to tumour suppressor protein
FT                   TSA305 from patent WO9928457-A1 - Homo sapiens"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A2QAT8"
FT                   /inference="profile:COGS:COG0790"
FT                   /protein_id="CAK37322.1"
FT                   /translation="MKNWWLWRFLPLALHVVPESYAHAESSSGPEGSDVLPGHVHVENA
FT                   LQILRESKIPIVAHEKPSGLLGYTWHYAQEAFRLLFMNGPQPDGTHKQKLDPNVAKAAN
FT                   ELKVAAQEHQNPDAMFLLAEMNFYGNFTHPRDFKQAFHWYQTLASSTGNSTAQYMLGFM
FT                   YATGVGGAVERDQAKALLYHTFAAEAGNTKSEMTLAYRYHAGIGAPRDCDQATYYYKKV
FT                   ADKAIEYFRSGPPGGHNMIRESYRWADEEGGVYGEGASVSTAVRDGTHSSTEASLEDVL
FT                   EYLDLMSRKGELKATFSLGKMHYEGGRGLPRNFRKSMNYFRQVAKRYWNKDGSVNPNHP
FT                   VGVEKLASKAAGHIGMMYLRGEGVEQNFATAQTWFRRGLANGDALCQHELGLMYLHGYG
FT                   VTPDAFRAASQFKAAAEQDFPAAETRLGALFLDQGDVQTATRYFELAARWGWMEAFYYL
FT                   AELSNNGVGRKRHCGMAASYYKMVAERAEVIHSSFEEANTAYENGDKERALIPALMAAE
FT                   QGYEHAQSNVAFLLDEQRSLFAIDTILPGAKKSRPALLRNAALALIYWTRSAKQANIDS
FT                   LLKMGDYYLAGMGIAADAEKASTCYHTAAEVHYSAQAYWNLGWMHENGVAVDQDFHMAK
FT                   RYYDLALETSSEAYLPVKLSLLKLRMRGYWNWLTNGDINPIREEEGKEPQHPFR"
FT   mRNA            join(<13750..13792,13926..14000,14071..>16022)
FT                   /locus_tag="An01g12720"
FT   sig_peptide     join(13750..13792,13926..13954)
FT                   /locus_tag="An01g12720"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            13750..13792
FT                   /locus_tag="An01g12720"
FT                   /number=1
FT   intron          13793..13925
FT                   /locus_tag="An01g12720"
FT                   /number=1
FT   exon            13926..14000
FT                   /locus_tag="An01g12720"
FT                   /number=2
FT   mat_peptide     join(13955..14000,14071..16019)
FT                   /locus_tag="An01g12720"
FT   intron          14001..14070
FT                   /locus_tag="An01g12720"
FT                   /number=2
FT   exon            14071..16022
FT                   /locus_tag="An01g12720"
FT                   /number=3
FT   CDS_pept        join(16768..17361,17451..17561)
FT                   /locus_tag="An01g12730"
FT                   /note="Similarity: similarities correspond to multiple
FT                   T-and P-repeats."
FT                   /note="Title: similarity to hypothetical protein EAA65640.1
FT                   - Aspergillus nidulans"
FT                   /db_xref="InterPro:IPR018468"
FT                   /db_xref="UniProtKB/TrEMBL:A2QAT9"
FT                   /inference="similar to AA sequence:PIR:T40050"
FT                   /protein_id="CAK37323.1"
FT                   /translation="MTPNQTPTPNPKRRRLNTTISSPSSTLTKPFKSPLRRPAPATDTT
FT                   TTNTPSSSSSKDTQPQPPSHPSPSTPKPSPKDPPRGTPKKEEDPTLQSLQTTHRHLQSQ
FT                   LLSLRTELETLTQASRIEESHRDEELEKLIVKWRGVGQRVAEEVFEGARERVSRMGGVR
FT                   GWREREMERSRSGGWWDDNEGKNGGGEGDKGDEEKVEAEEEEEEFTIGMMLKTMGIDFK
FT                   VIGYDGEGQRWV"
FT   mRNA            join(<16768..17361,17451..>17561)
FT                   /locus_tag="An01g12730"
FT   exon            16768..17361
FT                   /locus_tag="An01g12730"
FT                   /number=1
FT   intron          17362..17450
FT                   /locus_tag="An01g12730"
FT                   /number=1
FT   exon            17451..17561
FT                   /locus_tag="An01g12730"
FT                   /number=2
FT   CDS_pept        complement(join(17963..19791,19874..19960,20031..20358))
FT                   /locus_tag="An01g12740"
FT                   /note="Function: p40 and Rab9 presumably act together to
FT                   drive the process of transport vesicle docking."
FT                   /note="Remark: the H. sapiens p40 gene product binds to
FT                   Rab9 GTP, required for the transport of mannose 6-phosphate
FT                   receptors from endosomes to the trans-Golgi network."
FT                   /note="Title: similarity to Rab9 effector p40 - Homo
FT                   sapiens"
FT                   /note="See PMID 9230071"
FT                   /db_xref="GOA:A2QAU0"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniProtKB/TrEMBL:A2QAU0"
FT                   /inference="profile:PFAM:PF01344"
FT                   /protein_id="CAK37324.1"
FT                   /translation="MARLSSSTTARNSNASSPFTPFHADPPRWTGSSRTPNPMNPSSST
FT                   PQRPPTTFLMPPSLSGGRRSSADYRPSIRKAQGHVPACLVNASVTYCNNDQIYAFGGFD
FT                   QYTDEVYNHVLRLNLNTLRWELVDNYGDIPGVRMGHTATLYQGDKLIVFGGENEHRDHL
FT                   SDVVILDISTSTWTQPEIHGPIPRGRARHAAVIHDEKLFIMGGVTGENNVILDDLSYLD
FT                   LKTWTWSRSWRFTARFDHIAWVWGGRLWIFGGLDPDMERTTDIWWLDLKGIPSLGAATS
FT                   QGTVDSPAPISRITYSPDAIFSSPPQQLSGRSSSYAANSGSVQIRNGNRRKPIAPGAIS
FT                   CLRFKSGPHVPALFSGTHFQAYASGVLLDLITPSETVRTYECNLSSLDLDSLRWQRLAD
FT                   GQEIFKPGFRWHYCTVNASGTKAWLLGSSLDTGATPGTSDENHMSEVLCIDLEKYGLLG
FT                   NELSAFSPSQSRTSLPEPTGMGSLSGLGADLSAAFDQPPESGSGADFIITANPDDQVDT
FT                   DDEPDTPTSRSEPAFLSPNTPTSPPIHVHRIILQLRWPHFKRLYSAQMAEYHANRMHIP
FT                   EPYSVVRAFIYYLYTDSIAGHLEFCSDIIDVAGMLVMANLYDMPKLRLLCVNRLSRELD
FT                   VENAAIIWERAGRTNEQWLMRRAAQFCLANWGRVVRTDGFKSLSRQSLIELCEVVDTEG
FT                   RIIAGPELEMVGAFGEGYGSNKDPKPSQIALSGAMADNMEDIDGDDIDGMDII"
FT   mRNA            complement(join(<17963..19791,19874..19960,20031..>20358))
FT                   /locus_tag="An01g12740"
FT   exon            complement(17963..19791)
FT                   /locus_tag="An01g12740"
FT                   /number=1
FT   intron          complement(19792..19873)
FT                   /locus_tag="An01g12740"
FT                   /number=1
FT   exon            complement(19874..19960)
FT                   /locus_tag="An01g12740"
FT                   /number=2
FT   intron          complement(19961..20030)
FT                   /locus_tag="An01g12740"
FT                   /number=2
FT   exon            complement(20031..20358)
FT                   /locus_tag="An01g12740"
FT                   /number=3
FT   exon            20950..22926
FT                   /locus_tag="An01g12750"
FT                   /number=1
FT   CDS_pept        20950..22926
FT                   /locus_tag="An01g12750"
FT                   /note="Function: the H. sapiens CDC20 protein directly
FT                   binds to anaphase-promoting complex during mitosis and
FT                   G1,and activate its cyclin ubiquitination activity."
FT                   /note="Title: strong similarity to cell cycle protein CDC20
FT                   - Homo sapiens"
FT                   /note="nucleus"
FT                   /note="See PMID 9811605"
FT                   /note="See PMID 10793135"
FT                   /note="See PMID 9734353"
FT                   /db_xref="GOA:A2QAU1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR024977"
FT                   /db_xref="InterPro:IPR033010"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:A2QAU1"
FT                   /inference="profile:COGS:COG2319"
FT                   /inference="profile:COGS:COG5635"
FT                   /inference="profile:PFAM:PF00400"
FT                   /inference="similar to AA sequence:UniProtKB:BC000624.1"
FT                   /protein_id="CAK37325.1"
FT                   /translation="MATPTVSTPVKTHHGIFSTKTAGGRMPLTPSPRTRAGSVTSNHSS
FT                   PFTPPCGAQESGKEHGKSVYGGNLSSYFAKSVSRTARNYRESPKSNIARARTRKSPRHL
FT                   ELGVSEWALTGTGPSSRTPTKERLRKEVVGKEVAKEVTRKEPPKKEVVKKEAVKKEVSR
FT                   KEAPRKEITTRTTRSGKTTVRIPHNAGDRFIPNRTASEGLVTAGTAKPEESQRPKTSSS
FT                   DGSSVLANAASAFDIGGRGTDEDITAALESLGLEDNEPTTSYTKPAPDAVAYESSLADA
FT                   CGVNLNTRILAFKPPPPESSKPIDLRAQYNRPLKPAKSQSAQFRRRVQTAPERVLDAPG
FT                   LLDDYYLNLLDWSSGNQVAIGLERNVYVWSADSGSVSCLLETAPDTYVSSVKWSGDGAY
FT                   VGVGLGTGEVQIWDVEEGTKLRSMFGHDSRVGVMGWSKHTLSTGARSGLVFNHDVRIAQ
FT                   HKVAELVSHTSEVCGLEWRPDGAQLATGGNDNLVNIWDARSLSAPKFTKTNHRAAVKAL
FT                   SWCPWQLNLLATGGGSYDRHIHFWNTTTGARTNSIDTGSQVTSLRWSNHYREIVSSSGF
FT                   PDNSLSIWSYPTLVRNVEIPAHETRVLHSCLSPDGQLLATAAADESLKFWKIFERKPGT
FT                   TAAASREGGVGSKAQMTKSMTIR"
FT   mRNA            <20950..>22926
FT                   /locus_tag="An01g12750"
FT   CDS_pept        complement(join(23259..24378,24436..25103,25156..25223,
FT                   25345..25418,25479..25614,25677..25758))
FT                   /locus_tag="An01g12760"
FT                   /note="Title: similarity to acetate regulatory DNA binding
FT                   protein facB - Aspergillus niger"
FT                   /note="See PMID 9197408"
FT                   /db_xref="GOA:A2QAU2"
FT                   /db_xref="UniProtKB/TrEMBL:A2QAU2"
FT                   /protein_id="CAK37326.1"
FT                   /translation="MTPSRRPWCNDGLARPSHAAFVERRSCGQGPSDTSDELRGAHLSG
FT                   NQPTAATVSTQQPAPTIPSTYSQTTIALHPNDISSRVTRLEEAVFDRIHVPRDPPSIAT
FT                   ATQGSNNTNQSLITRGAQGSSNGCVTPLTLLPLASAQRRIADLHDYMRNTNSLSRCLPP
FT                   WTQARQLLDHFNVVIQPTFGVFHIPSTRDLLEETYRGILEGEEPSPTVLVLFFSIFAGA
FT                   VLVATPELLQLLNATQAEAKAAFTAYVRLAICILDNPIQSVPPSTIALEAISALARVLF
FT                   HADWYSHKAQALRVDAICMARSMQIHRLDTVQRREERKRSGYNAIEVEVQRRAWWHLVS
FT                   SDWISAFSQSPQEGTYLIHPKHMKVNHPSNIDDEFLTPTGPEHSFPLSVPTSMSVFIFR
FT                   IHYAELCREIIDTLGTTLLESDQPDYETLLEIDGKFHTFIQSLPLFLRNDPASIQKSQD
FT                   ITQQRPYLAWQRTVAHLSFHVRLCRLHRPYHREGLTNPKFAYSRLTCIRSAQTVLDLRH
FT                   SLEDTGVLSGFNPSDYSLVMNHVFFAAMVLATDVSMNPTAPGADTRKQEVLDVIHVLEK
FT                   SQNVSASLMEAIRKNTQTLLSILQDAQRELQQQGRSPKENDIGSVPSGSGGTKSSAAPS
FT                   QPRSVGVDENMTNVASGHLPFTASMHGSSHEDEDPMWSGARRNSWGQLWSDLFNVAPEM
FT                   DALQWDLLLNDSDLPLQSNFY"
FT   mRNA            complement(join(<23259..24378,24436..25103,25156..25223,
FT                   25345..25418,25479..25614,25677..>25758))
FT                   /locus_tag="An01g12760"
FT   exon            complement(23259..24378)
FT                   /locus_tag="An01g12760"
FT                   /number=1
FT   intron          complement(24379..24435)
FT                   /locus_tag="An01g12760"
FT                   /number=1
FT   exon            complement(24436..25103)
FT                   /locus_tag="An01g12760"
FT                   /number=2
FT   intron          complement(25104..25155)
FT                   /locus_tag="An01g12760"
FT                   /number=2
FT   exon            complement(25156..25223)
FT                   /locus_tag="An01g12760"
FT                   /number=3
FT   intron          complement(25224..25344)
FT                   /locus_tag="An01g12760"
FT                   /number=3
FT   exon            complement(25345..25418)
FT                   /locus_tag="An01g12760"
FT                   /number=4
FT   intron          complement(25419..25478)
FT                   /locus_tag="An01g12760"
FT                   /number=4
FT   exon            complement(25479..25614)
FT                   /locus_tag="An01g12760"
FT                   /number=5
FT   intron          complement(25615..25676)
FT                   /locus_tag="An01g12760"
FT                   /number=5
FT   exon            complement(25677..25758)
FT                   /locus_tag="An01g12760"
FT                   /number=6
FT   CDS_pept        join(27615..27632,27787..27888,28251..28993,29156..29341,
FT                   29398..29437)
FT                   /locus_tag="An01g12770"
FT                   /note="Remark: Functional assays establish that H. sapiens
FT                   TFIIA has no apparent role in basal transcription but plays
FT                   an important role in activation of transcription."
FT                   /note="Remark: H. sapiens TFIIA can be an integral
FT                   component of the preinitiation complex."
FT                   /note="Remark: the gene for human protein TFIIA alpha
FT                   encodes a fusion protein of the two subunits p35 and p19."
FT                   /note="Title: strong similarity to large subunit of
FT                   transcription initation factor TFIIA p35/p19 - Homo
FT                   sapiens"
FT                   /note="nucleus"
FT                   /db_xref="GOA:A2QAU3"
FT                   /db_xref="InterPro:IPR004855"
FT                   /db_xref="InterPro:IPR009088"
FT                   /db_xref="UniProtKB/TrEMBL:A2QAU3"
FT                   /inference="profile:COGS:COG5149"
FT                   /inference="profile:PFAM:PF03153"
FT                   /protein_id="CAK37327.1"
FT                   /translation="MSNQQVGTVFDRVIQEVCDGSQVDFEESGVDQQTLLDLRKSWQKK
FT                   LSSLGVAHFPWDPPPPQPAPPQTQNILPPTATVPSNAPRPGPPPQPQHHVPPPPLQQPI
FT                   PQSAPATAPPLQAPTPVGAGPNAMGQQQPHIKTEPGVNGQPGMIPMNNMMMPNSSNPQS
FT                   AQERAANMLRQRYGAAAANSVSQLQAQSQAQAAMAMPGQQRPQPMQHVPNGQAPQIKQE
FT                   PGYPPVSQPPVGNTQTDGAGDDALSAWKAEVARRREAAERQGGEGDRLLREHLRQRMLQ
FT                   LEGGGLMDEDDEDAINSDLDDPDDLVAEDHDAEDAVGQVMLCTYDKVQRVKNKWKCTLK
FT                   DGILTTGGKEYVFHKGQGEFEW"
FT   mRNA            join(<27615..27632,27787..27888,28251..28993,29156..29341,
FT                   29398..>29437)
FT                   /locus_tag="An01g12770"
FT   exon            27615..27632
FT                   /locus_tag="An01g12770"
FT                   /number=1
FT   intron          27633..27786
FT                   /locus_tag="An01g12770"
FT                   /number=1
FT   exon            27787..27888
FT                   /locus_tag="An01g12770"
FT                   /number=2
FT   intron          27889..28250
FT                   /locus_tag="An01g12770"
FT                   /number=2
FT   exon            28251..28993
FT                   /locus_tag="An01g12770"
FT                   /number=3
FT   intron          28994..29155
FT                   /locus_tag="An01g12770"
FT                   /number=3
FT   exon            29156..29341
FT                   /locus_tag="An01g12770"
FT                   /number=4
FT   intron          29342..29397
FT                   /locus_tag="An01g12770"
FT                   /number=4
FT   exon            29398..29437
FT                   /locus_tag="An01g12770"
FT                   /number=5
FT   CDS_pept        complement(join(31310..31624,31672..32734,32826..33475))
FT                   /locus_tag="An01g12780"
FT                   /note="Function: S. cerevisiae Sfp1p regulates the
FT                   expression of gene products involved in the G2/M transition
FT                   during the mitotic cell cycle and the DNA-damage
FT                   response,for example does overexpression of Sfp1p induce
FT                   the expression of Pds1p, which is known to regulate the G2
FT                   checkpoint."
FT                   /note="Function: the S. cerevisiae homolog Sfp1p acts as a
FT                   repressor of the G2/M transition, both in the normal cell
FT                   cycle and in the G2 checkpoint pathway."
FT                   /note="Localization: S. cerevisiae Sfp1p is a nuclear
FT                   protein with two Cys2His2 zinc-finger domains commonly
FT                   found in transcription factors."
FT                   /note="Title: strong similarity to split zinc finger
FT                   protein 1 Sfp1 - Saccharomyces cerevisiae"
FT                   /note="nucleus"
FT                   /db_xref="GOA:A2QAU4"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:A2QAU4"
FT                   /inference="profile:COGS:COG5048"
FT                   /inference="profile:COGS:COG5189"
FT                   /inference="similar to AA sequence:UniProtKB:SCSFP1AA.1"
FT                   /protein_id="CAK37328.1"
FT                   /translation="MLGSSEATHSPPPPSLHYSPSIGDLDCASTRDSTPVTTPLGFGVP
FT                   LRRPDREKLSDSSFTRNSLDIGGDTSSPYFYSQQLHSHSDSDLDFPLFPSSPIQTNTMT
FT                   GAAAPIDIATRQSSVSPPGQQASNLTSALQRAGNGERTGSLSHANGVGLSVFKAPPPRK
FT                   DSIGAATAQWGNGTKPISMSGSNRDKGRRESLAGSLVGGMSWGGVSVGSWIRDDIIMTG
FT                   TSPFTFQSPSFHSSSYLPKLEANFMRDFNCCGVTLPTLHDLLQHYEEAHATKSPQQGHR
FT                   PSQGDSRAALAAVAMAQQQQGQQNNNQGRGLQPDRTLDLQRKLSQVPHTQQHSDMDTID
FT                   DMELDEPMGDHDAATAQLFAPQSRDGGQGGFGSANQRVPHLNLSMLPGHQGFKGSQPGT
FT                   PVASGRPLSLQNNPTVSSVNTPTLMANPLQNSQFRTTPDSSAPGTPAELDDSMLGGFGD
FT                   LAMQNPMMQGQSQFGRFAGNNNDMVDLCIDEPAKRLFSPTGGINTPNAHFKLSGAQYGP
FT                   NSEIARRIREQQLLAGVPDTTALLPNEEPKPFRCPVIGCEKAYKNQNGLKYHKAHGHNN
FT                   QQLHDNADGTFSIVNPETSTPYPGTLGMEKEKPYRCEVCGKRYKNLNGLKYHKSHSPPC
FT                   NPDFQLAAGRNLAFGGGVMQGQNINVAGAGLPGIGEEGLL"
FT   mRNA            complement(join(<31310..31624,31672..32734,32826..>33475))
FT                   /locus_tag="An01g12780"
FT   exon            complement(31310..31624)
FT                   /locus_tag="An01g12780"
FT                   /number=1
FT   intron          complement(31625..31671)
FT                   /locus_tag="An01g12780"
FT                   /number=1
FT   exon            complement(31672..32734)
FT                   /locus_tag="An01g12780"
FT                   /number=2
FT   intron          complement(32735..32825)
FT                   /locus_tag="An01g12780"
FT                   /number=2
FT   exon            complement(32826..33475)
FT                   /locus_tag="An01g12780"
FT                   /number=3
FT   CDS_pept        complement(join(35420..35586,35918..35933))
FT                   /locus_tag="An01g12790"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2QAU5"
FT                   /db_xref="UniProtKB/TrEMBL:A2QAU5"
FT                   /protein_id="CAK37329.1"
FT                   /translation="MALDRELILPEFRGDRHPEEKGLGPIPAISHLPTNTRRSGLSADH
FT                   AERENGVYVNTARPF"
FT   mRNA            complement(join(<35420..35586,35918..>35933))
FT                   /locus_tag="An01g12790"
FT   exon            complement(35420..35586)
FT                   /locus_tag="An01g12790"
FT                   /number=1
FT   intron          complement(35587..35917)
FT                   /locus_tag="An01g12790"
FT                   /number=1
FT   exon            complement(35918..35933)
FT                   /locus_tag="An01g12790"
FT                   /number=2
FT   CDS_pept        join(37896..38122,38183..40117,40175..40259)
FT                   /locus_tag="An01g12800"
FT                   /note="Title: strong similarity to hypothetical conserved
FT                   protein SPAC16.04 - Schizosaccharomyces pombe"
FT                   /db_xref="GOA:A2QAU6"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2QAU6"
FT                   /inference="profile:COGS:COG0042"
FT                   /inference="profile:PFAM:PF01207"
FT                   /inference="similar to AA sequence:PIR:T37732"
FT                   /protein_id="CAK37330.1"
FT                   /translation="MEPTTAQEQLPAPEQLPAPEANAPKRDPENGDAAADHQAQEPPSK
FT                   KARLDDSADSNGQTADAPAPRMKGVAPIKPEFIIDQQPTRGQTASDANADDAAEAAHHD
FT                   GRADEQNGKKKKKKTGQNTNRTFGRSEDAKGLCSSVNFRPEFSPAECTFGEKCRYEHDL
FT                   RTYLKEHKREDLTTFNGMCPVWDVHGKCFVGWKCRFVGSHSEERETADGRKELVLIEDE
FT                   ERKKKVQRLVPFAGEDGAVNVASMEDKIALARRKMDFPRAGPYSAWLENTSRTIEKELH
FT                   KRHRAAPVGAETKDGESKDAESKDADSKDEKEENRAMYVEPPFMPSEKRRLYFGPETPA
FT                   LAPLTTQGNMPFRRLCVELGAQFTYSEMAMSLPLIQGNKSEWALMRAHESEMLPPTMLP
FT                   GADIVQGYDNSKDMKFGAQIAANKPWQAFKATEALAKVTPNLRVIDLNCGCPIDLVFKD
FT                   GAGSALLEHPSKLEKIIRGMNTVSDQIPITVKIRMGTKDNNPNALKLTERLLLGGYETS
FT                   LLHHDGAAGAAAITLHGRSRQQRYTRQADWEYISECAALIKRLNEKTDAVTDTIREPDA
FT                   RTQPNGGKVYFLGNGDCYSHVDYDNHINNAGVDAVMLGRGPLIKPWLFEEIQAGQYLDK
FT                   SATERLAMIEKFCKYGLEAWGSDEHGVGTTRRFLMEWLSFTRRYVPIGLLEHLPPYIND
FT                   RPPAFRGRNELETLLASANYKDWLKISEMFLGPAHKDFKFEPKHKSNSYDEAEG"
FT   mRNA            join(<37896..38122,38183..40117,40175..>40259)
FT                   /locus_tag="An01g12800"
FT   exon            37896..38122
FT                   /locus_tag="An01g12800"
FT                   /number=1
FT   intron          38123..38182
FT                   /locus_tag="An01g12800"
FT                   /number=1
FT   exon            38183..40117
FT                   /locus_tag="An01g12800"
FT                   /number=2
FT   intron          40118..40174
FT                   /locus_tag="An01g12800"
FT                   /number=2
FT   exon            40175..40259
FT                   /locus_tag="An01g12800"
FT                   /number=3
FT   CDS_pept        join(40727..40751,40824..40873,40919..41029,41080..41183,
FT                   41255..41633)
FT                   /locus_tag="An01g12810"
FT                   /note="Remark: the systematic name of the matching S.
FT                   cerevisia protein is YKL065c."
FT                   /note="Similarity: the ORF shows strong similarity to EST
FT                   SEQ ID NO:6241 of patent WO200056762-A2 from Aspergillus
FT                   oryzae."
FT                   /note="Title: similarity to BAX-associated protein fragment
FT                   SEQ ID NO:242 from patent WO200264766-A2 - Saccharomyces
FT                   cerevisiae"
FT                   /db_xref="GOA:A2QAU7"
FT                   /db_xref="InterPro:IPR008417"
FT                   /db_xref="InterPro:IPR040463"
FT                   /db_xref="UniProtKB/TrEMBL:A2QAU7"
FT                   /inference="profile:COGS:COG5374"
FT                   /protein_id="CAK37331.1"
FT                   /translation="MTLYYSLVPPDPRTPGSSDNMSHQHMAVFMGLIIPLPFTVKRKLF
FT                   AFISESPIVAKLQYGLKITFIFILILFIDSVNRVYRVQLELASFGKEGGTMGAAALGTD
FT                   RMEVQARKFYSQRNMYLCGFTLFLSLILNRTYTMILDVLRLEDRVRLLEGDKKAGGKDS
FT                   ARLAQAGEIGEIGRLKEELAAKDRDIETLKKQCEGLTREYHKLGDQVSGEKDEAPKKDQ
FT                   "
FT   mRNA            join(<40727..40751,40824..40873,40919..41029,41080..41183,
FT                   41255..>41633)
FT                   /locus_tag="An01g12810"
FT   exon            40727..40751
FT                   /locus_tag="An01g12810"
FT                   /number=1
FT   intron          40752..40823
FT                   /locus_tag="An01g12810"
FT                   /number=1
FT   exon            40824..40873
FT                   /locus_tag="An01g12810"
FT                   /number=2
FT   intron          40874..40918
FT                   /locus_tag="An01g12810"
FT                   /number=2
FT   exon            40919..41029
FT                   /locus_tag="An01g12810"
FT                   /number=3
FT   intron          41030..41079
FT                   /locus_tag="An01g12810"
FT                   /number=3
FT   exon            41080..41183
FT                   /locus_tag="An01g12810"
FT                   /number=4
FT   intron          41184..41254
FT                   /locus_tag="An01g12810"
FT                   /number=4
FT   exon            41255..41633
FT                   /locus_tag="An01g12810"
FT                   /number=5
FT   exon            complement(43345..44652)
FT                   /locus_tag="An01g12820"
FT                   /number=1
FT   CDS_pept        complement(43345..44652)
FT                   /locus_tag="An01g12820"
FT                   /note="Function: mdm12 from S. pombe is required for
FT                   mitochondrial inheritance."
FT                   /note="Localization: mdm12 is an integral component of the
FT                   outer mitochondrial membrane."
FT                   /note="Similarity: the ORF shows strong similarity to
FT                   expressed sequence tag seq id no:6793 of patent
FT                   WO200056762-A2 from Aspergillus oryzae."
FT                   /note="Title: strong similarity to mitochondrial
FT                   inheritance component mdm12p - Schizosaccharomyces pombe"
FT                   /note="localisation:mitochondrion"
FT                   /db_xref="GOA:A2QAU8"
FT                   /db_xref="InterPro:IPR019411"
FT                   /db_xref="InterPro:IPR027532"
FT                   /db_xref="InterPro:IPR031468"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2QAU8"
FT                   /inference="similar to AA sequence:PIR:T48693"
FT                   /protein_id="CAK37332.1"
FT                   /translation="MSIEVDWGAATSGPDGEALAERIRSFIHDKFQQVALPRFIRSVQV
FT                   HSFDFGTIPPELEIKDLCEPFADFYEEDEDDEASDVSEGLVSRHGSPWHGTHPELNESS
FT                   FRDDNAINHSLRDPFTEGFQPSALRSPIALSDHLNPHFRSGTPGIPGGTSTLGYHLMSL
FT                   GGLSGTQTPLAAVAGGSPFAGGWNDSGMMGPGNRGRPPPPIFTAHQSRPEADIDSSNPT
FT                   SRPSTSSTLPSHPSGSNKNNGDGAGGPDHGSHPEEHGHLDDPTSEEPLRFPRMRERRPE
FT                   DFQVLCHAKYAGDVRLSLTAEILLDYPMPSFVGLPLKLNVTGITFDGVAVVAYIRKRVH
FT                   FCFLSSEDADALIGSDQPDVGAQTEYSRSGGDATVSAKRQGGLLQEIRVESEIGRKEDG
FT                   KQVLKNVGKVERFVLAQVRRIFEEELVYPSFWTFLV"
FT   mRNA            complement(<43345..>44652)
FT                   /locus_tag="An01g12820"
FT   CDS_pept        join(47971..48025,48106..48337,48492..48542,48809..48892,
FT                   48993..49079,49167..49248)
FT                   /locus_tag="An01g12830"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2QAU9"
FT                   /db_xref="UniProtKB/TrEMBL:A2QAU9"
FT                   /protein_id="CAK37333.1"
FT                   /translation="MDLGLEVRREWIFGNSLTSLSAADLLSDASAGGPSLGAVDDITLS
FT                   DGAAAVVLEEVLGAHSGGGRRLEKGPETGGVEEDSRREEHLESAGARVDRKMQSPGLLA
FT                   GSGGGNNRCGGKSWGVVVITSQRKESKMNGWMTVRRSPPSTRTNRAAEPENQLVIRSTS
FT                   HSNHPSNGLAAMRIRKPEITPIWDQPGKASFPR"
FT   mRNA            join(<47971..48025,48106..48337,48492..48542,48809..48892,
FT                   48993..49079,49167..>49248)
FT                   /locus_tag="An01g12830"
FT   exon            47971..48025
FT                   /locus_tag="An01g12830"
FT                   /number=1
FT   intron          48026..48105
FT                   /locus_tag="An01g12830"
FT                   /number=1
FT   exon            48106..48337
FT                   /locus_tag="An01g12830"
FT                   /number=2
FT   intron          48338..48491
FT                   /locus_tag="An01g12830"
FT                   /number=2
FT   exon            48492..48542
FT                   /locus_tag="An01g12830"
FT                   /number=3
FT   intron          48543..48808
FT                   /locus_tag="An01g12830"
FT                   /number=3
FT   exon            48809..48892
FT                   /locus_tag="An01g12830"
FT                   /number=4
FT   intron          48893..48992
FT                   /locus_tag="An01g12830"
FT                   /number=4
FT   exon            48993..49079
FT                   /locus_tag="An01g12830"
FT                   /number=5
FT   intron          49080..49166
FT                   /locus_tag="An01g12830"
FT                   /number=5
FT   exon            49167..49248
FT                   /locus_tag="An01g12830"
FT                   /number=6
FT   CDS_pept        join(50319..50605,50765..51392)
FT                   /locus_tag="An01g12840"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2QAV0"
FT                   /db_xref="UniProtKB/TrEMBL:A2QAV0"
FT                   /protein_id="CAK37334.1"
FT                   /translation="MGNIGLRQRGHGVQKVGTALAALFPWASACFTEPFQPLGGRATQG
FT                   DTAQGPKALKRRRSTGFNQRARPSFSRRWLPGGGTAPVMGPTRDGSWPEPGTPFVSFSH
FT                   LVINPERGPASLIKLSTSKSIQLNPLPWNLPPDHHLRPSGVPSFPFPEASDFTQWSSPF
FT                   PEQCCFLAASFASIKQGGEEGFGSFQLESRCGCPSQDLPRKGMLKGDLRGEAEVAAAGN
FT                   NHEIPGGSCGLGNITRNPQERTEKECSNDLAGPLLLPPKNGQKLTLFLTSPLIASFPST
FT                   FLQSSSRDGSVSINSALATALGC"
FT   mRNA            join(<50319..50605,50765..>51392)
FT                   /locus_tag="An01g12840"
FT   exon            50319..50605
FT                   /locus_tag="An01g12840"
FT                   /number=1
FT   sig_peptide     50319..50414
FT                   /locus_tag="An01g12840"
FT                   /inference="protein motif:SignalP:2.0"
FT   mat_peptide     join(50415..50605,50765..51389)
FT                   /locus_tag="An01g12840"
FT                   /product="hypothetical protein"
FT   intron          50606..50764
FT                   /locus_tag="An01g12840"
FT                   /number=1
FT   exon            50765..51392
FT                   /locus_tag="An01g12840"
FT                   /number=2
FT   exon            51935..52144
FT                   /locus_tag="An01g12850"
FT                   /number=1
FT   CDS_pept        51935..52144
FT                   /locus_tag="An01g12850"
FT                   /note="Title: strong similarity to EST an_3045 -Aspergillus
FT                   niger"
FT                   /db_xref="GOA:A2QAV1"
FT                   /db_xref="UniProtKB/TrEMBL:A2QAV1"
FT                   /protein_id="CAK37335.1"
FT                   /translation="MYTYTPTSKFLVLAPTESAPLSTSTQVRERSSSQSSTTSETAQRP
FT                   GFSRLPSGFLYLGVDTRDAASPSN"
FT   mRNA            <51935..>52144
FT                   /locus_tag="An01g12850"
FT   CDS_pept        complement(join(53072..53089,53154..53185,53301..53368,
FT                   53410..53540))
FT                   /locus_tag="An01g12860"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2QAV2"
FT                   /db_xref="UniProtKB/TrEMBL:A2QAV2"
FT                   /protein_id="CAK37336.1"
FT                   /translation="MTRKSEGKEVARIKGLFTPFYCKHKLFQSWSTNPQDSILEYPSIR
FT                   TRTCISGCICFCICLSECMPVSDGYYAYKGTCIDEQT"
FT   mRNA            complement(join(<53072..53089,53154..53185,53301..53368,
FT                   53410..>53540))
FT                   /locus_tag="An01g12860"
FT   exon            complement(53072..53089)
FT                   /locus_tag="An01g12860"
FT                   /number=1
FT   intron          complement(53090..53153)
FT                   /locus_tag="An01g12860"
FT                   /number=1
FT   exon            complement(53154..53185)
FT                   /locus_tag="An01g12860"
FT                   /number=2
FT   intron          complement(53186..53300)
FT                   /locus_tag="An01g12860"
FT                   /number=2
FT   exon            complement(53301..53368)
FT                   /locus_tag="An01g12860"
FT                   /number=3
FT   intron          complement(53369..53409)
FT                   /locus_tag="An01g12860"
FT                   /number=3
FT   exon            complement(53410..53540)
FT                   /locus_tag="An01g12860"
FT                   /number=4
FT   tRNA            complement(54014..54125)
FT                   /gene="tRNA-Leu (AAG)"
FT                   /locus_tag="An01e12870"
FT                   /product="transfer RNA-Leu (AAG)"
FT                   /inference="profile:tRNAscan:1.4"
FT   CDS_pept        complement(join(55902..56105,56155..56249,56329..56434))
FT                   /locus_tag="An01g12880"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2QAV3"
FT                   /db_xref="UniProtKB/TrEMBL:A2QAV3"
FT                   /protein_id="CAK37337.1"
FT                   /translation="MDFCRSQQQSANAAHMWVFLVVLVWPITVGNLLPAEYFYISGSLS
FT                   SPLTSEDRYVCHMRKSFTLCSGSANPAGMFLQEQCNNVFLRKIEPIPVVSRNWWRRSSS
FT                   SLPPAIYGVVLTISWQEDYENHAYQSIANA"
FT   mRNA            complement(join(<55902..56105,56155..56249,56329..>56434))
FT                   /locus_tag="An01g12880"
FT   exon            complement(55902..56105)
FT                   /locus_tag="An01g12880"
FT                   /number=1
FT   mat_peptide     complement(join(55905..56105,56155..56249,56329..56344))
FT                   /locus_tag="An01g12880"
FT                   /product="hypothetical protein"
FT   intron          complement(56106..56154)
FT                   /locus_tag="An01g12880"
FT                   /number=1
FT   exon            complement(56155..56249)
FT                   /locus_tag="An01g12880"
FT                   /number=2
FT   intron          complement(56250..56328)
FT                   /locus_tag="An01g12880"
FT                   /number=2
FT   exon            complement(56329..56434)
FT                   /locus_tag="An01g12880"
FT                   /number=3
FT   sig_peptide     complement(56345..56434)
FT                   /locus_tag="An01g12880"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        join(56663..56724,57074..57202,57256..57748)
FT                   /locus_tag="An01g12890"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2QAV4"
FT                   /db_xref="UniProtKB/TrEMBL:A2QAV4"
FT                   /protein_id="CAK37338.1"
FT                   /translation="MPDSRSKKSLLKQRMSDAFKVDTFDKVPIGIHEPTSSTAQVLNSC
FT                   TNLARYGSTRQTSLWPGWRSVVLYKGFSQTDLPGRVDDRDFVDNGRSHSLLSNKLWYRS
FT                   FYTTRSPKRMLRRLKHRGNLDNGRSHSLLWVDDNDAGVLLRLLGMPLTSILWPYINRKA
FT                   SWNTRFPRHEPFLDTPQFDLDVLYHHCSNEHISSLRPYYPSPNLPSHTRPSIPPSQSPS
FT                   PTHTQ"
FT   mRNA            join(<56663..56724,57074..57202,57256..>57748)
FT                   /locus_tag="An01g12890"
FT   exon            56663..56724
FT                   /locus_tag="An01g12890"
FT                   /number=1
FT   intron          56725..57073
FT                   /locus_tag="An01g12890"
FT                   /number=1
FT   exon            57074..57202
FT                   /locus_tag="An01g12890"
FT                   /number=2
FT   intron          57203..57255
FT                   /locus_tag="An01g12890"
FT                   /number=2
FT   exon            57256..57748
FT                   /locus_tag="An01g12890"
FT                   /number=3
FT   tRNA            57834..57945
FT                   /gene="tRNA-Leu (AAG)"
FT                   /locus_tag="An01e12900"
FT                   /product="transfer RNA-Leu (AAG)"
FT                   /inference="profile:tRNAscan:1.4"
FT   CDS_pept        complement(join(59820..61802,61857..61998,62083..63170))
FT                   /locus_tag="An01g12910"
FT                   /EC_number="2.7.1.-"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   kinase Kin3 - Saccharomyces cerevisiae"
FT                   /db_xref="GOA:A2QAV5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A2QAV5"
FT                   /inference="profile:COGS:COG0515"
FT                   /inference="profile:PFAM:PF00069"
FT                   /inference="similar to AA sequence:PIR:S29344"
FT                   /protein_id="CAK37339.1"
FT                   /translation="MNDSQPQSLPLTTHASPALTPAAPSEQDNNRSPVYPDLLGAPPVP
FT                   PPRTSSTHRSHHGSSAKPSSSSAEKSSSSRHGKNRADDRSASHRERKGEDSQFRPVNVP
FT                   EEYPQSTSSHAPAAPSSEENMEGYAGQGELQKESSAVINQVLVSDPSVDIEREQVRQAG
FT                   SSVSPSTESAPASGLGLVGSDGVDDGGRGGLRSRHDYSEHAVKRKETTFGQYILGQTLG
FT                   EGEFGKVKLGWKRDGTIQVAIKLIRRESLGSNPSRLPKIYREISILRDLAHPNIVRLHE
FT                   MVETDRHIGIIMEYASGGELFDHILNNRYLKDNSARRLFAQLVSGVGYLHKKGIVHRDL
FT                   KLENLLLDRNRNIIITDFGFANTPNAKGLRRGDLMQTSCGSPCYAAPELVVSDSLYTGR
FT                   KVDVWSCGVILYAMLAGYLPFDDDPANPDGDNINLLYKYIVTTPLTFPEYVTPHARDLL
FT                   RRILVPDPRKRADLFEVARHSWLSEYSHIVSHITSSTTKVADIATTTVSQGMDLAMNPA
FT                   GSATNPVSRAEPHKEVPSLARSASVREPPKTYNNSPVPSVGGLIHHAGDISQEQAVERS
FT                   KTPRDTKRRTVQVEYVAPQSQTARGEVPAGMDAGVAEPAGPSEPRPTRARSNSRPIVPN
FT                   MPSGTLARDLSGASNVRTGEPKAAAGPAPAPVPGHLPRSTSDASALTGTAPTSATHATR
FT                   PTTGGSMASFNAGRLPSRGSYGQPVAPTVAATNAQGRLAQPKSKQYVISSPLQQQDASS
FT                   QQSIGQPSTQQLPAKFNTTPRQEPPKGHKRSNTVSSIGEKLFGRSGSIFGGRGGQGSGP
FT                   RQKNGKRYPPTSMKEPYGGDDTRMSMDSRRSMQYGYNRKTSESGVEGRPRRFSFLPPSF
FT                   SLKGFSSSRSQTPDEESQTDRSTENRVEPRPSTSAMQARSRAASYGTQDAIGAAPEGAP
FT                   GDEILTQDEPINYQARIDQQFAVLHSNQSGIYQPTSYSATSAEQVYQNDNDHYYRNQYA
FT                   NHSAPNHYEEYSAPYDKAPRPSMQAGRPGRGTGVLPKNHRKFADAYEYERDLAHRPGSS
FT                   GAARKVMDFFRRRAKSRAGDDR"
FT   mRNA            complement(join(<59820..61802,61857..61998,62083..>63170))
FT                   /locus_tag="An01g12910"
FT   exon            complement(59820..61802)
FT                   /locus_tag="An01g12910"
FT                   /number=1
FT   intron          complement(61803..61856)
FT                   /locus_tag="An01g12910"
FT                   /number=1
FT   exon            complement(61857..61998)
FT                   /locus_tag="An01g12910"
FT                   /number=2
FT   intron          complement(61999..62082)
FT                   /locus_tag="An01g12910"
FT                   /number=2
FT   exon            complement(62083..63170)
FT                   /locus_tag="An01g12910"
FT                   /number=3
FT   CDS_pept        join(63757..63763,64023..64097,64381..64469,64567..64671,
FT                   64776..64841,65086..65258,65563..65697,66086..66191)
FT                   /locus_tag="An01g12920"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2QAV6"
FT                   /db_xref="UniProtKB/TrEMBL:A2QAV6"
FT                   /protein_id="CAK37340.1"
FT                   /translation="MDARRGNICTAELTLGPSPLPTSNRYPGKGKLERGGEKGKGMGRG
FT                   EDAATRSSQQPAGGARREGSRKTGGIKTQGGRKKEEDPERRQEAEKQMMMGVKKREGIE
FT                   RRRGSDGGGSESVANVKYRIEVPTLIWEQRNSRTSNSKASRERNGQQARHQHLLCVALL
FT                   CWLGKAKSGDVTGPWTLDTDGGVDLGKPDSRTLVGMTDFPGYLMYPLWTDVLTSQSVSQ
FT                   ALREPDQPTLPLLLPASSTTAQTDRPETE"
FT   mRNA            join(<63757..63763,64023..64097,64381..64469,64567..64671,
FT                   64776..64841,65086..65258,65563..65697,66086..>66191)
FT                   /locus_tag="An01g12920"
FT   exon            63757..63763
FT                   /locus_tag="An01g12920"
FT                   /number=1
FT   intron          63764..64022
FT                   /locus_tag="An01g12920"
FT                   /number=1
FT   exon            64023..64097
FT                   /locus_tag="An01g12920"
FT                   /number=2
FT   intron          64098..64380
FT                   /locus_tag="An01g12920"
FT                   /number=2
FT   exon            64381..64469
FT                   /locus_tag="An01g12920"
FT                   /number=3
FT   intron          64470..64566
FT                   /locus_tag="An01g12920"
FT                   /number=3
FT   exon            64567..64671
FT                   /locus_tag="An01g12920"
FT                   /number=4
FT   intron          64672..64775
FT                   /locus_tag="An01g12920"
FT                   /number=4
FT   exon            64776..64841
FT                   /locus_tag="An01g12920"
FT                   /number=5
FT   intron          64842..65085
FT                   /locus_tag="An01g12920"
FT                   /number=5
FT   exon            65086..65258
FT                   /locus_tag="An01g12920"
FT                   /number=6
FT   intron          65259..65562
FT                   /locus_tag="An01g12920"
FT                   /number=6
FT   exon            65563..65697
FT                   /locus_tag="An01g12920"
FT                   /number=7
FT   intron          65698..66085
FT                   /locus_tag="An01g12920"
FT                   /number=7
FT   exon            66086..66191
FT                   /locus_tag="An01g12920"
FT                   /number=8
FT   tRNA            complement(68769..68850)
FT                   /gene="tRNA-Ser (AGA)"
FT                   /locus_tag="An01e12930"
FT                   /product="transfer RNA-Ser (AGA)"
FT                   /inference="profile:tRNAscan:1.4"
FT   CDS_pept        complement(join(69479..69519,69702..70568,70622..71255))
FT                   /locus_tag="An01g12940"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   CAC17479.1 - Homo sapiens"
FT                   /db_xref="GOA:A2QAV7"
FT                   /db_xref="InterPro:IPR009686"
FT                   /db_xref="UniProtKB/TrEMBL:A2QAV7"
FT                   /protein_id="CAK37341.1"
FT                   /translation="MASTVHDPRLLYSISNIRAFHIQNGEETELTPSGPQTLSLLMVPT
FT                   RTTVPGTSPSTPPPDTSAEEDFYLHLHLPPELDLALPATTQIFHQSPDSYLIPRWDVGP
FT                   DAGAFIRIQFPGIGSGPGKVTQDDIDTFETILAQCTAFLERAPPPSNHAPYNPATYAPG
FT                   EGYVAPSGFAQDDAHGRIVLVDEEDGSVVGEMEGYDVVEEPGVKPGSKRPVEIELPTEA
FT                   EGNQVNVSNVSEEYLRMARHPVYKDSTIVQTSATASRLIVTGSSYLANAITSGAEAFTK
FT                   KTKPNPKPMTFSDTTHSRIRKVGTFSQGAAELSAKTVGQVGKYAQNIGASLSRRKDNGT
FT                   QRGVDRSGSDYKPGILNKSMIAFSTLTDGIEQGARNVLITGSNAASTMIGHRYGEQAGS
FT                   VASDLTGGVKNVGLVYIDAAGVSRKAVLKSVARGMVVGRMRNGQQVLVGTGDGGDVPAA
FT                   AGPSQAYGGREPVVRRQSPSSTPPPAYGAPGTTSLSGMSMSGEIWSNLIYAGTSM"
FT   mRNA            complement(join(<69479..69519,69702..70568,70622..>71255))
FT                   /locus_tag="An01g12940"
FT   exon            complement(69479..69519)
FT                   /locus_tag="An01g12940"
FT                   /number=1
FT   intron          complement(69520..69701)
FT                   /locus_tag="An01g12940"
FT                   /number=1
FT   exon            complement(69702..70568)
FT                   /locus_tag="An01g12940"
FT                   /number=2
FT   intron          complement(70569..70621)
FT                   /locus_tag="An01g12940"
FT                   /number=2
FT   exon            complement(70622..71255)
FT                   /locus_tag="An01g12940"
FT                   /number=3
FT   exon            71908..72729
FT                   /locus_tag="An01g12950"
FT                   /number=1
FT   CDS_pept        71908..72729
FT                   /locus_tag="An01g12950"
FT                   /note="Title: similarity to hypothetical protein PA0544
FT                   -Pseudomonas aeruginosa"
FT                   /db_xref="GOA:A2QAV8"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A2QAV8"
FT                   /inference="similar to AA sequence:PIR:C83579"
FT                   /protein_id="CAK37342.1"
FT                   /translation="MARFQIVSDLHLENPKAYDLFEIAPKAPYLALLGDIGNVRDDGFL
FT                   LFIEDQLRKFEIVFLVMGNHEPFHSSWLDVREKLKRFSDDITRKRAQVQFTKPGSHKLG
FT                   KFVLLDQTRYDLAPDLTVLGCTFHSKVSEMQEERVSFSLNDFYYIKNWSVEDHCAAHEA
FT                   DRAWLNDQVTGIARSNPHHKIVIFTHHSPTVASKAVDPAHAKSPISSAFATDLAGEACW
FT                   EKPQVRLWGFGHTHYNCDFTDSRTGKRIVANQRGYYFSQAKVFDPEKVISI"
FT   mRNA            <71908..>72729
FT                   /locus_tag="An01g12950"
FT   CDS_pept        join(73131..73228,73338..74186,74300..74666)
FT                   /locus_tag="An01g12960"
FT                   /EC_number="1.3.99.-"
FT                   /note="Catalytic activity: H. sapiens homolog ACADSB
FT                   activity goes toward the short branched chain acyl-CoA
FT                   derivatives ((S)-2-methylbutyryl-CoA, isobutyryl-CoA, and
FT                   2-methylhexanoyl-CoA), as well as toward the short straight
FT                   chain acyl-CoAs (butyryl-CoA and hexanoyl-CoA)."
FT                   /note="Function: The acyl-CoA dehydrogenases (ACDs) are a
FT                   family of mitochondrial enzymes that oxidize straight chain
FT                   or branched chain acyl-CoAs in the metabolism of fatty
FT                   acids or branched chain amino acids."
FT                   /note="Title: strong similarity to short/branched chain
FT                   specific acyl-CoA dehydrogenase precursor ACADSB - Homo
FT                   sapiens"
FT                   /note="localisation:mitochondrion"
FT                   /db_xref="GOA:A2QAV9"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A2QAV9"
FT                   /inference="profile:COGS:COG1960"
FT                   /inference="profile:PFAM:PF00441"
FT                   /inference="profile:PFAM:PF02770"
FT                   /inference="profile:PFAM:PF02771"
FT                   /inference="similar to AA sequence:PIR:A55680"
FT                   /protein_id="CAK37343.1"
FT                   /translation="MASITRALRPLSRTATSARLITRPPLSTRLAVSTHAFSTTSRRRD
FT                   VDLSGLTPTPITFLSETEALMSESVSKFAQEQISPKVRDMDEAETMDPAVVEQLFEQGL
FT                   MGVEIPEEYGGAGMNFTAAIVAIEELARVDPSVSVLVDVHNTLVNTSIMKYGDAQAKRT
FT                   WLPKLATGTVGSFCLSEPASGSDAFALKTKAEKTADGYKINGSKMWITNAMESGVFLVF
FT                   ANLDPSKGYKGITAFIVEKDTPGFSIAKKEKKLGIRASSTCVLNFDDVLIPKSNLLGEE
FT                   GQGYKYAISILNEGRIGIAAQMTGLALGAWENAAQYIWNDRRQFGQLIGEFQGMQHQVA
FT                   QAYTEIAAARALVYNAARKKEAGQDFVQDAAMAKLYASQVAGRVAGSAVEWMGGMGFVR
FT                   EGIAEKMFRDSKIGAIYEGTSNIQLQTIAKLLQKQYTR"
FT   mRNA            join(<73131..73228,73338..74186,74300..>74666)
FT                   /locus_tag="An01g12960"
FT   exon            73131..73228
FT                   /locus_tag="An01g12960"
FT                   /number=1
FT   intron          73229..73337
FT                   /locus_tag="An01g12960"
FT                   /number=1
FT   exon            73338..74186
FT                   /locus_tag="An01g12960"
FT                   /number=2
FT   intron          74187..74299
FT                   /locus_tag="An01g12960"
FT                   /number=2
FT   exon            74300..74666
FT                   /locus_tag="An01g12960"
FT                   /number=3
FT   CDS_pept        complement(join(77083..77639,77723..78026))
FT                   /locus_tag="An01g12970"
FT                   /note="Similarity: the ORF shows strong similarity to
FT                   expressed sequence tag seq id no:6160 of patent
FT                   WO200056762-A2 from Aspergillus oryzae."
FT                   /note="Title: similarity to hypothetical protein T24H10.2
FT                   -Caenorhabditis elegans"
FT                   /db_xref="UniProtKB/TrEMBL:A2QAW0"
FT                   /inference="similar to AA sequence:PIR:T25255"
FT                   /protein_id="CAK37344.1"
FT                   /translation="MSPTPEPPTTKKRESRAGARKVTSLSAEQLERKRANDREAQRTIR
FT                   QRTKEHIERLEHQVAELKAKGEQFDDVVRRNVALEHEIRALKHQLALASRQGYPGMEGT
FT                   YSNAPGSMVPATQFAEPLGMNPASRAPSVLSTSSRVSVGSEWPPYGTNRSPSTCESSET
FT                   NYGNRAESYLFESQLQPTSAMSVAPPQVSYSAPVGAQPDPTFQSYAQAYHTGNAPRGPV
FT                   DDLASHPPQPVPYVPGQRPMSVPTIPTERPAGYPLVHAPQPYHQHTLPPQTRNDYGYAW
FT                   NPHQS"
FT   mRNA            complement(join(<77083..77639,77723..>78026))
FT                   /locus_tag="An01g12970"
FT   exon            complement(77083..77639)
FT                   /locus_tag="An01g12970"
FT                   /number=1
FT   intron          complement(77640..77722)
FT                   /locus_tag="An01g12970"
FT                   /number=1
FT   exon            complement(77723..78026)
FT                   /locus_tag="An01g12970"
FT                   /number=2
FT   CDS_pept        join(79271..79414,79526..79708,79800..79847,79895..80299)
FT                   /locus_tag="An01g12980"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2QAW1"
FT                   /db_xref="UniProtKB/TrEMBL:A2QAW1"
FT                   /protein_id="CAK37345.1"
FT                   /translation="MPPWGTYRSSMGFVQPQEKVILGTMPGHKPKAVFRLRGSRLTDSQ
FT                   KLATTDKVRRWLTTIFSAICGLCFGMHDPQRFQVPESQISGSARLSDVNTEQNRTVTPD
FT                   PISVSVVEMEVPIGLLKGGALNHGSTGVVLATRRSRSGPHFRSSIKTNYDLLRQAEVWS
FT                   RKALLSNQNQWNPGGNSCLETPGDRSPVEHRNRRFPNSLIRVNHHGRDGVGNMPESKRQ
FT                   KPMGGEGKGSNHHERRLWKRRLAERGCMTHIVPAFSG"
FT   mRNA            join(<79271..79414,79526..79708,79800..79847,79895..>80299)
FT                   /locus_tag="An01g12980"
FT   exon            79271..79414
FT                   /locus_tag="An01g12980"
FT                   /number=1
FT   intron          79415..79525
FT                   /locus_tag="An01g12980"
FT                   /number=1
FT   exon            79526..79708
FT                   /locus_tag="An01g12980"
FT                   /number=2
FT   intron          79709..79799
FT                   /locus_tag="An01g12980"
FT                   /number=2
FT   exon            79800..79847
FT                   /locus_tag="An01g12980"
FT                   /number=3
FT   intron          79848..79894
FT                   /locus_tag="An01g12980"
FT                   /number=3
FT   exon            79895..80299
FT                   /locus_tag="An01g12980"
FT                   /number=4
FT   CDS_pept        join(81763..81818,82149..82233,82363..83757)
FT                   /locus_tag="An01g12990"
FT                   /note="Title: strong similarity to hypothetical membrane
FT                   protein YJL091c - Saccharomyces cerevisiae"
FT                   /db_xref="GOA:A2QAW2"
FT                   /db_xref="InterPro:IPR009447"
FT                   /db_xref="UniProtKB/TrEMBL:A2QAW2"
FT                   /inference="profile:COGS:COG5062"
FT                   /inference="similar to AA sequence:PIR:S56868"
FT                   /protein_id="CAK37346.1"
FT                   /translation="MCNRITILGIPLSRHTATPYKARKEAFVSDLAGGSILEINAVTLV
FT                   APAAALLWSALQSRLSFFTPYSAAALVTDFLLNVLAILFATTVYSSAPWTLNVLLIAPA
FT                   LLLFLNSKPPRSQQKAKPPPKPTQSDRNAADMPESLPIHPFLTTYRAAMMIITCVAILA
FT                   VDFQAFPRRFAKVENWGTSLMDLGVGSFVFSGGVVSARSVLKGRSNGARKTPVGQRLIA
FT                   STRHSVPLLVLGLVRLYSVKGLDYAEHVTEYGVHWNFFFTLGLLPPFVELFDSLAAIIP
FT                   SYEALSLAVAVLYQAALESTELKSYILVSPRGPSLLSKNREGVFSFLGYFAIFLAGRAT
FT                   GIRIIPRGTTTQRSPQQARRGVLVTLGVQALAWSTIFILNSTYALGYGANIPVSRRLAN
FT                   MPYVVWVSAFNNAQLFLFCLLETAFFPSVHRASGKDGEADRVSFATSRILKAFNRGGLA
FT                   IFLVANLLTGAVNLSVPTLDVSTAQAMAILIGYAAALTGIALGLDRANIKLAI"
FT   mRNA            join(<81763..81818,82149..82233,82363..>83757)
FT                   /locus_tag="An01g12990"
FT   exon            81763..81818
FT                   /locus_tag="An01g12990"
FT                   /number=1
FT   intron          81819..82148
FT                   /locus_tag="An01g12990"
FT                   /number=1
FT   exon            82149..82233
FT                   /locus_tag="An01g12990"
FT                   /number=2
FT   intron          82234..82362
FT                   /locus_tag="An01g12990"
FT                   /number=2
FT   exon            82363..83757
FT                   /locus_tag="An01g12990"
FT                   /number=3
FT   CDS_pept        join(84031..84155,84235..84806,84871..85991)
FT                   /locus_tag="An01g13000"
FT                   /note="Function: the heterotrimeric Thermus thermophilus
FT                   asp-tRNAasn amidotransferase also generates gln-tRNAgln."
FT                   /note="Similarity: bears strong sequence similarity to
FT                   amidase superfamily."
FT                   /note="Similarity: the ORF shows strong similarity to
FT                   expressed sequence tag seq id no:4067 of patent
FT                   WO200056762-A2 from Aspergillus niger."
FT                   /note="Title: strong similarity to glu/asp-tRNA
FT                   amidotransferase subunit A gatA - Thermus thermophilus"
FT                   /note="See PMID 10913601"
FT                   /db_xref="GOA:A2QAW3"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A2QAW3"
FT                   /inference="profile:COGS:COG0154"
FT                   /inference="profile:PFAM:PF01425"
FT                   /protein_id="CAK37347.1"
FT                   /translation="MDEKPQFFQYPEARPGPAVPYKNEEQVIPVIRGFPLALGATLVQN
FT                   IGFIQSHLWGTTGFDVIRNLPLDQYSARYDPTVIPVARPDASAADLPVPTQKRQSNAGY
FT                   YTSADYVARYTSGELTPLAVVETLLPLIRRDAKPPGKHSIAFLESQVDKIRAAAEASTQ
FT                   RYKDGKPLGPMDGIPVAIKDEVHMEGYRRTLGSKLDFTGEFRGTSWCVKQWEEAGAIVI
FT                   GKTIMHELGLDTTNNNPNFGTPRNPHNPDYYCGGSSGGSGYAVGAGLVPIALGADGGGS
FT                   IRIPASFCGVWGLKPSHGRVSGSPTVSLASTTGVYGPLASSIDDLALAYRIMATPAPES
FT                   SDPLSAAFPSPLRTLPSPTNNTPRTIGIVRDWIDRASPPVRAVFNATLDHYRTLKNYTI
FT                   IDITIPYLPEGQKAHALTILSEVTSSLTPSQISQLTPANKIMASMGMWQIKGQDFLAAQ
FT                   RLRNCLMMHLAHLFQKHPGLMIVTPTTPIPGWKIEGGEADLKRGVSDGNTTVRNMEYVW
FT                   LANFTGCPAISCPAGYDVLDGGSRVPVGVMAMGEWGSEEELIAFARDGEGVLDGTAAAD
FT                   GMEQSSGLTVPRGERAAWEDVIAKAGERR"
FT   mRNA            join(<84031..84155,84235..84806,84871..>85991)
FT                   /locus_tag="An01g13000"
FT   exon            84031..84155
FT                   /locus_tag="An01g13000"
FT                   /number=1
FT   intron          84156..84234
FT                   /locus_tag="An01g13000"
FT                   /number=1
FT   exon            84235..84806
FT                   /locus_tag="An01g13000"
FT                   /number=2
FT   intron          84807..84870
FT                   /locus_tag="An01g13000"
FT                   /number=2
FT   exon            84871..85991
FT                   /locus_tag="An01g13000"
FT                   /number=3
FT   CDS_pept        complement(join(86428..87909,88146..88244))
FT                   /locus_tag="An01g13010"
FT                   /EC_number="3.1.4.17"
FT                   /note="Catalytic activity: nucleoside 3',5'-cyclic
FT                   phosphate + H(2)O = nucleoside 5'-phosphate."
FT                   /note="Function: the C. albicans homolog PDE1 complements a
FT                   S. cerevisiae PDEase-deficient mutant. It belongs to the
FT                   cAMP phosphodiesterases class-II and hydrolyses both cAMP
FT                   and cGMP."
FT                   /note="Remark: C. albicans PDE1 shares a putative protein
FT                   kinase A (PKA) phosphorylation site with S. cerevisiae PDE1
FT                   , suggesting a possible regulation by PKA-dependend
FT                   phosphorylation."
FT                   /note="Repression: C. albicans PDE1 is only moderately
FT                   inhibited by millimolar concentrations of standard PDEase
FT                   inhibitors."
FT                   /note="Title: strong similarity to cyclic nucleotide
FT                   phosphodiesterase PDE1 - Candida albicans"
FT                   /db_xref="GOA:A2QAW4"
FT                   /db_xref="InterPro:IPR000396"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A2QAW4"
FT                   /inference="profile:COGS:COG5212"
FT                   /inference="profile:PFAM:PF02112"
FT                   /inference="similar to AA sequence:SWISSPROT:CNA1.CANAL"
FT                   /protein_id="CAK37348.1"
FT                   /translation="MQASELPFVGANPPEAASRGEGPGSPSLQIIVLGPTGGPREDRVT
FT                   GLLVRSTSTKWSANSIVAVDAGTLLCGIIDTLEPCDNNKKLSDQGPFAGLELPHNNVPA
FT                   NAAHVFRHIIGAVCITHPHLDHLSAFAINTPVLEAGSGAKTLAALPSVVAAIKTHVFND
FT                   VIWPNLSDEDGGAGLVTYQRLMEGGNPMMGRGDEKGYTRVCEGLLAKCLAISHGCCRQR
FT                   SSVDNDVQRRMSSAPFGVDPMRLNPRAFSISFDEPETGYFSGARSPGYRVPGKDSWATV
FT                   ESSAFFIREPTTKREVIIFGDVEPDSISLNPRNRRVWEAAAPKIVASQLRAVFIECSYN
FT                   DDVDDASLYGHLCPRHLIDELIVLAQKVTELKYPDSFSVRKRKRASAPEAAGDPALSPK
FT                   SKKAALAGEKGGGSRRGSARTSRRHTRARVAVEDIDENMEGSPAVSHAPSEVGMDVSLA
FT                   ESSDPLTVLQWPEPPLAGLLIYIIHIKDDMNDGPPPQERILQELTAQGQAAGLGCEFRV
FT                   PTRGESVLI"
FT   mRNA            complement(join(<86428..87909,88146..>88244))
FT                   /locus_tag="An01g13010"
FT   exon            complement(86428..87909)
FT                   /locus_tag="An01g13010"
FT                   /number=1
FT   intron          complement(87910..88145)
FT                   /locus_tag="An01g13010"
FT                   /number=1
FT   exon            complement(88146..88244)
FT                   /locus_tag="An01g13010"
FT                   /number=2
FT   CDS_pept        join(88532..88609,88727..88988,89054..89061,89106..89393)
FT                   /locus_tag="An01g13020"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2QAW5"
FT                   /db_xref="UniProtKB/TrEMBL:A2QAW5"
FT                   /protein_id="CAK37349.1"
FT                   /translation="MHILHLERLSADIKCTPPSLDGADVAIAVRLAARPMRPKLSKPAA
FT                   RLLLGAALPRKSGAKLRRTRQVSAPVVGGHSLATGHLQHANDRAEQMIQWLEGDSEITV
FT                   GGKSKIERALTRIDGRREDKVSGRKSPTEQRSSEDEPLQYGDQPRDKGGTETLSCAYVP
FT                   EDDQNSVESVYGMPKDKYNRAMKNRWTSSSGYLKTHILRANAEMQCGG"
FT   mRNA            join(<88532..88609,88727..88988,89054..89061,89106..>89393)
FT                   /locus_tag="An01g13020"
FT   exon            88532..88609
FT                   /locus_tag="An01g13020"
FT                   /number=1
FT   intron          88610..88726
FT                   /locus_tag="An01g13020"
FT                   /number=1
FT   exon            88727..88988
FT                   /locus_tag="An01g13020"
FT                   /number=2
FT   intron          88989..89053
FT                   /locus_tag="An01g13020"
FT                   /number=2
FT   exon            89054..89061
FT                   /locus_tag="An01g13020"
FT                   /number=3
FT   intron          89062..89105
FT                   /locus_tag="An01g13020"
FT                   /number=3
FT   exon            89106..89393
FT                   /locus_tag="An01g13020"
FT                   /number=4
FT   CDS_pept        complement(join(90360..91123,91200..91505,91605..92043))
FT                   /locus_tag="An01g13030"
FT                   /note="Similarity: the ORF shows strong similarity to
FT                   expressed sequence tag seq id no:5871 of patent
FT                   WO200056762-A2 from Aspergillus oryzae."
FT                   /note="Title: strong similarity to hypothetical protein
FT                   68B2.90 - Neurospora crassa"
FT                   /db_xref="GOA:A2QAW6"
FT                   /db_xref="InterPro:IPR001870"
FT                   /db_xref="InterPro:IPR003877"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR035780"
FT                   /db_xref="UniProtKB/TrEMBL:A2QAW6"
FT                   /inference="profile:PFAM:PF00622"
FT                   /inference="similar to AA sequence:PIR:T48825"
FT                   /protein_id="CAK37350.1"
FT                   /translation="MRGSEASGPGALFDAPSTLATSLGINPTAASEPPPTDPKLVASNI
FT                   EHVLLSMSEGNGGLVSVSGNSSGSTGKGILIGVLSAFGSAAVAVLVLAVFFFFKYTQRG
FT                   RIILDRIGRPGEFDDEQAFAREEAEALETMDDLTRSEYMRAKAFIEANPPESVQTDISL
FT                   SQFLAIQEKGVSAWEFQPELEIANCFVEGRTEIEFYDSECSVQTNLPVPKQNDVYYWEA
FT                   KIYDKPDNTLISIGMTTKPYPLFKLPGFHKTSVAYQSTGHRRHNQPFAPTPYGPHLLQG
FT                   DVIGVGYRPRSGTIFFTRNGKKLEDVVHGHKAQNFFPTVGANGPCSVHVNFGQMGFVFI
FT                   EANVKKWGLAPMTGSLAPPPPYGSEQGSILLESGRESAAQISQRVYQDANNARTSSTVR
FT                   VAPSASPGPVRSPTDISLAQLAHIPSNEDVGEGSSRTNVVDGEQVPLLHTNDLDQVPPP
FT                   EYSSPDGSRRGSEDLPFDEQPPIPSYDAAVGNRDGHSAHANENR"
FT   mRNA            complement(join(<90360..91123,91200..91505,91605..>92043))
FT                   /locus_tag="An01g13030"
FT   exon            complement(90360..91123)
FT                   /locus_tag="An01g13030"
FT                   /number=1
FT   mat_peptide     complement(join(90363..91123,91200..91505,91605..91953))
FT                   /locus_tag="An01g13030"
FT   intron          complement(91124..91199)
FT                   /locus_tag="An01g13030"
FT                   /number=1
FT   exon            complement(91200..91505)
FT                   /locus_tag="An01g13030"
FT                   /number=2
FT   intron          complement(91506..91604)
FT                   /locus_tag="An01g13030"
FT                   /number=2
FT   exon            complement(91605..92043)
FT                   /locus_tag="An01g13030"
FT                   /number=3
FT   sig_peptide     complement(91954..92043)
FT                   /locus_tag="An01g13030"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        join(92951..93044,93144..94525)
FT                   /locus_tag="An01g13040"
FT                   /EC_number="3.4.13.9"
FT                   /note="Catalytic activity: H. sapiens PEPD hydrolyses
FT                   Xaa-|-Pro dipeptides, also acts on aminoacyl-hydroxyproline
FT                   analogs, but shows no action on Pro-|-Pro."
FT                   /note="Function: the human homolog PEPD is a proline
FT                   specific metallo-peptidases."
FT                   /note="Remark: prolidase (peptidase D) deficiency upsets
FT                   skin healing and facilitates the occurrence of chronic
FT                   cutaneous ulcerations."
FT                   /note="Title: strong similarity to prolidase PEPD from
FT                   patent JP02104286-A - Homo sapiens"
FT                   /note="cytoplasm"
FT                   /db_xref="GOA:A2QAW7"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2QAW7"
FT                   /inference="profile:COGS:COG0006"
FT                   /inference="profile:PFAM:PF00557"
FT                   /protein_id="CAK37351.1"
FT                   /translation="MRVSIPPELVSSLGACDLRVTVRGEGIDKYPGGPGAAKQHARKVA
FT                   MKLGVSSGLIYLVGKPTINWGDSDQPQPFRQRRYFYYLSGADEPDCYLTYDINNDLLVL
FT                   YVPDFDLHRAIWMGPTLTTDEAERRFDVDKVRYYASLQSDIQSWVGKYNDAAPVYILHS
FT                   SQQPQFSVQQLHIDDQRLLPAMDAARVVKDDYELRMIRHANKISGLAHRKVLEQIHKMS
FT                   NEAQIEGLFLDTCVSHGAKNQAYEIIAGSGPNAATLHYVKNNEPLKGRQLVCLDAGAEW
FT                   ECYASDVTRTFPLAADWPSSHARDVYQIVEEMQEQCIKRIKPGVRFRDLQVLAHDIAIR
FT                   GLQKLGVLKPGTVEEIRVSGASAIFFPHGLGHHVGLEVHDVSEKPITGMGLPNRPCRPD
FT                   FIPAMSQSVPLLEEGMVVTIEPGVYFSKLALANSRKLPQARYINFDEAEKYIPIGGVRI
FT                   EDDILVTRTGYENLTTAPKGDEMLEIIRRGIDN"
FT   mRNA            join(<92951..93044,93144..>94525)
FT                   /locus_tag="An01g13040"
FT   exon            92951..93044
FT                   /locus_tag="An01g13040"
FT                   /number=1
FT   intron          93045..93143
FT                   /locus_tag="An01g13040"
FT                   /number=1
FT   exon            93144..94525
FT                   /locus_tag="An01g13040"
FT                   /number=2
FT   CDS_pept        complement(join(96556..96574,96633..96878,97009..97085))
FT                   /locus_tag="An01g13050"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2QAW8"
FT                   /db_xref="UniProtKB/TrEMBL:A2QAW8"
FT                   /protein_id="CAK37352.1"
FT                   /translation="MQWSDAMQRKFSAPNEPNFLCDEQTRPTTETNEDSGYNHAPIQAV
FT                   SAWPSGEGWMPYGPSGYYDAPKLPCISRQSQSNSVSQSGDDNNILPRLLRQHLSLRRKS
FT                   GIFCGMADR"
FT   mRNA            complement(join(<96556..96574,96633..96878,97009..>97085))
FT                   /locus_tag="An01g13050"
FT   exon            complement(96556..96574)
FT                   /locus_tag="An01g13050"
FT                   /number=1
FT   intron          complement(96575..96632)
FT                   /locus_tag="An01g13050"
FT                   /number=1
FT   exon            complement(96633..96878)
FT                   /locus_tag="An01g13050"
FT                   /number=2
FT   intron          complement(96879..97008)
FT                   /locus_tag="An01g13050"
FT                   /number=2
FT   exon            complement(97009..97085)
FT                   /locus_tag="An01g13050"
FT                   /number=3
FT   CDS_pept        join(98073..98398,98527..98761)
FT                   /locus_tag="An01g13060"
FT                   /note="Title: strong similarity to EST an_2136 -Aspergillus
FT                   niger"
FT                   /db_xref="GOA:A2QAW9"
FT                   /db_xref="UniProtKB/TrEMBL:A2QAW9"
FT                   /protein_id="CAK37353.1"
FT                   /translation="MGQRHNRRRTRPRSRNRSANPLLLPSQPFPRPVNLCAPAVSSAFD
FT                   CPEIPAPTWHYGHLLGQKRDRALRMEASTLEAEQYRLFGGVPGDDVGLCYRMLEYFGGL
FT                   DYIDCNFIIVVQAVEKIIFSTKPKKGNEGIPKRHANLNRSPAGPIPTLSKIKIRHQRNQ
FT                   NNTSPRNKSARTSFQWRTQVSDL"
FT   mRNA            join(<98073..98398,98527..>98761)
FT                   /locus_tag="An01g13060"
FT   exon            98073..98398
FT                   /locus_tag="An01g13060"
FT                   /number=1
FT   intron          98399..98526
FT                   /locus_tag="An01g13060"
FT                   /number=1
FT   exon            98527..98761
FT                   /locus_tag="An01g13060"
FT                   /number=2
FT   CDS_pept        join(99805..99834,99892..99976,100064..100290,
FT                   100374..100941,101141..102031,102115..102275)
FT                   /locus_tag="An01g13070"
FT                   /note="Complex: S. cerevisiae Sec63p is subunit of the ER
FT                   translocon."
FT                   /note="Function: S. cerevisiae Sec63p is the functional
FT                   signal recognition particle receptor of the ER protein
FT                   translocation machinery (translocon) which is responsible
FT                   for translocation of nascent secretory proteins across the
FT                   ER membrane and also patricipates in the retrograde
FT                   proteasome/ubiquitin dependent ER degradation."
FT                   /note="Remark: former name Npl1p of S. cerevisiae homolog
FT                   Sec63p is obsolete."
FT                   /note="Title: strong similarity to signal recognition
FT                   particle receptor Sec63 - Saccharomyces cerevisiae"
FT                   /db_xref="GOA:A2QAX0"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR004179"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR027137"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A2QAX0"
FT                   /inference="profile:COGS:COG5407"
FT                   /inference="profile:PFAM:PF00226"
FT                   /inference="similar to AA sequence:PIR:A33618"
FT                   /protein_id="CAK37354.1"
FT                   /translation="MSTDYNYDDKGQFFPFFVLTLTSLVTLPLTYNLLRPSKGLENTAP
FT                   RIKSEFKPEHAELIEAQKRKRLRKERRIKRIITVVVGYAVMAWMAYLIVVTARTVPKVW
FT                   DPYDILGVSRSADEKAISRHYKRLSLIYHPDKIRPDPAKNETIEMLNERFVELTKAYKA
FT                   LTDEEIRNNYIQYGHPDGKQSMSIGIALPTFIVSEGNSKYTLLVYGALLGVLLPYIVGK
FT                   WWYGSQRYTKERVLVASAGNIFREYKEDITDGGIVNALSSGAEFREMLEGPKMDAGLAK
FT                   LEKKVLAEDSTFLSPEDREVIKAIALAFGNVRPILGSFRTSQHLIQAVAPGSSPLLQLP
FT                   HFTEEVVKSVEGADAKEHFTVQKFMSIPEDKRRSLTVGAGLMSEEQYTSAVTVAKQLPV
FT                   LEVSRAFFKVMGEKVITPSSLVQLVVKARFIPPGYSADVPPVNPTDLEDIDPDEDDLDA
FT                   IMGRKPAKNKTTKLVNGVKVEEKVETIQPPLAHAPYLARDHSPRWHIFLADAKQGKMAV
FT                   PPFTFTTFDKPLFDTDGKPTFNVQTLKMQFQAPPQVGDFTFVLNMLCDSYLGLDTKMEI
FT                   TLHIDDPAKAAALDEEDDISEPDEDSIAGQMQALKTGQPPKKKTKKPSDDSSDDDESDT
FT                   DGDAGDTSDTNTETDIDD"
FT   mRNA            join(<99805..99834,99892..99976,100064..100290,
FT                   100374..100941,101141..102031,102115..>102275)
FT                   /locus_tag="An01g13070"
FT   exon            99805..99834
FT                   /locus_tag="An01g13070"
FT                   /number=1
FT   intron          99835..99891
FT                   /locus_tag="An01g13070"
FT                   /number=1
FT   exon            99892..99976
FT                   /locus_tag="An01g13070"
FT                   /number=2
FT   intron          99977..100063
FT                   /locus_tag="An01g13070"
FT                   /number=2
FT   exon            100064..100290
FT                   /locus_tag="An01g13070"
FT                   /number=3
FT   intron          100291..100373
FT                   /locus_tag="An01g13070"
FT                   /number=3
FT   exon            100374..100941
FT                   /locus_tag="An01g13070"
FT                   /number=4
FT   intron          100942..101140
FT                   /locus_tag="An01g13070"
FT                   /number=4
FT   exon            101141..102031
FT                   /locus_tag="An01g13070"
FT                   /number=5
FT   intron          102032..102114
FT                   /locus_tag="An01g13070"
FT                   /number=5
FT   exon            102115..102275
FT                   /locus_tag="An01g13070"
FT                   /number=6
FT   CDS_pept        complement(join(103786..104518,104608..104705,
FT                   104800..105003))
FT                   /locus_tag="An01g13080"
FT                   /note="Function: the S. pombe homolog ntf1 is a
FT                   transcription factor involved in regulating nmt1+
FT                   expression."
FT                   /note="Similarity: S. pombe ntf1 shares substantial
FT                   homology with a family of Cys6 zinc finger-containing
FT                   transcription factors typified by GAL4 from S. cerevisiae."
FT                   /note="Similarity: the ORF is shorter than nft1 of S. pombe
FT                   (344 compared to 706 amino acids). The two proteins show a
FT                   local N-terminal similarity over a stretch of about 100
FT                   amino acids."
FT                   /note="Title: similarity to thiamin repressible genes
FT                   regulatory protein ntf1p - Schizosaccharomyces pombe"
FT                   /db_xref="GOA:A2QAX1"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:A2QAX1"
FT                   /inference="profile:PFAM:PF00172"
FT                   /inference="similar to AA sequence:UniProtKB:SPAC1486.10"
FT                   /protein_id="CAK37355.1"
FT                   /translation="MSRQPKLRPKSHIPGFPDAIYNLAAVSSLSQLESRAGLGDDKHDQ
FT                   RVFRVKRKHVLKACDRCRVKKTKCDGKQPCNRCSAYNHPCLFRERKATQTKVYSRGFVE
FT                   MLESHHSLVVKALQRLYKLCIDKEGFPGEPLVELSDGQPLTHAILDRLGLIKQAEENPE
FT                   EPEEDTEDLRYLRFLSTSTDCSATTDPSPEPATPPDPTPSSCSPITPTSSKGPEPWKWE
FT                   LQPVQPLHSGQYHSYSHPGYHQMTLPRTNLEPHGLSSEDKCPEVVPSMADHGHPLYYYM
FT                   AASCDEGPTKARLETGVAARPGSHQPTSASGFPVVMMNDFNLHVPAEQPVYPSLPSGWT
FT                   YTCG"
FT   mRNA            complement(join(<103786..104518,104608..104705,
FT                   104800..>105003))
FT                   /locus_tag="An01g13080"
FT   exon            complement(103786..104518)
FT                   /locus_tag="An01g13080"
FT                   /number=1
FT   intron          complement(104519..104607)
FT                   /locus_tag="An01g13080"
FT                   /number=1
FT   exon            complement(104608..104705)
FT                   /locus_tag="An01g13080"
FT                   /number=2
FT   intron          complement(104706..104799)
FT                   /locus_tag="An01g13080"
FT                   /number=2
FT   exon            complement(104800..105003)
FT                   /locus_tag="An01g13080"
FT                   /number=3
FT   CDS_pept        complement(join(106607..106706,107206..107313,
FT                   107387..107480,107596..107641,107744..107848,
FT                   107925..108102,108211..108269,108389..108519,
FT                   108602..108842))
FT                   /locus_tag="An01g13090"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2QAX2"
FT                   /db_xref="UniProtKB/TrEMBL:A2QAX2"
FT                   /protein_id="CAK37356.1"
FT                   /translation="MHLLGFVASRLAKLFRGGAEAALREKSGSQSWPEYYITGIATETS
FT                   RWERNDESKEKKGKGNSPGFRGSHEWENKRVRAFTRLPVPNHRYPSISTTVLRCRPTTI
FT                   ARASLTLCHMGRAESLPLIQDAWARGRDLGCIDLMRSSHRHEEDRHGTMTLCIGMGDDF
FT                   WRRTKAIAQRYHGHNNNNNDNNQGRRRRNEAQQANESHWKAGHQSVSLSSSNPSTSGSA
FT                   ALVVLRSIRTPRLPIPADRRDARKLRLTFSRVGQIGGDEVKQTERIQSTPPPPLNYQPT
FT                   PPFRILGPLSSKRVKEGKSQQSCPALSGPAKDLRVLSDPLAHYRAAIIFDMTATPHTMN
FT                   GVADMTGVDLSDT"
FT   mRNA            complement(join(<106607..106706,107206..107313,
FT                   107387..107480,107596..107641,107744..107848,
FT                   107925..108102,108211..108269,108389..108519,
FT                   108602..>108842))
FT                   /locus_tag="An01g13090"
FT   exon            complement(106607..106706)
FT                   /locus_tag="An01g13090"
FT                   /number=1
FT   intron          complement(106707..107205)
FT                   /locus_tag="An01g13090"
FT                   /number=1
FT   exon            complement(107206..107313)
FT                   /locus_tag="An01g13090"
FT                   /number=2
FT   intron          complement(107314..107386)
FT                   /locus_tag="An01g13090"
FT                   /number=2
FT   exon            complement(107387..107480)
FT                   /locus_tag="An01g13090"
FT                   /number=3
FT   intron          complement(107481..107595)
FT                   /locus_tag="An01g13090"
FT                   /number=3
FT   exon            complement(107596..107641)
FT                   /locus_tag="An01g13090"
FT                   /number=4
FT   intron          complement(107642..107743)
FT                   /locus_tag="An01g13090"
FT                   /number=4
FT   exon            complement(107744..107848)
FT                   /locus_tag="An01g13090"
FT                   /number=5
FT   intron          complement(107849..107924)
FT                   /locus_tag="An01g13090"
FT                   /number=5
FT   exon            complement(107925..108102)
FT                   /locus_tag="An01g13090"
FT                   /number=6
FT   intron          complement(108103..108210)
FT                   /locus_tag="An01g13090"
FT                   /number=6
FT   exon            complement(108211..108269)
FT                   /locus_tag="An01g13090"
FT                   /number=7
FT   intron          complement(108270..108388)
FT                   /locus_tag="An01g13090"
FT                   /number=7
FT   exon            complement(108389..108519)
FT                   /locus_tag="An01g13090"
FT                   /number=8
FT   intron          complement(108520..108601)
FT                   /locus_tag="An01g13090"
FT                   /number=8
FT   exon            complement(108602..108842)
FT                   /locus_tag="An01g13090"
FT                   /number=9
FT   CDS_pept        complement(join(109884..110133,110195..116585,
FT                   116711..116873))
FT                   /locus_tag="An01g13100"
FT                   /note="Similarity: the ORF shows strong similarity to
FT                   expressed sequence tag an_3084 from Aspergillus niger."
FT                   /note="Title: strong similarity to hypothetical protein
FT                   AAN61518.1 - Caenorhabditis elegans"
FT                   /db_xref="GOA:A2QAX3"
FT                   /db_xref="InterPro:IPR007122"
FT                   /db_xref="InterPro:IPR025118"
FT                   /db_xref="InterPro:IPR029006"
FT                   /db_xref="InterPro:IPR029919"
FT                   /db_xref="UniProtKB/TrEMBL:A2QAX3"
FT                   /inference="similar to AA sequence:UniProtKB:AY130758.2"
FT                   /protein_id="CAK37357.1"
FT                   /translation="MSSTTDADGTEDVNDFLLRIRELGEKRDKEDEERTKKLEEEILQG
FT                   RKERQARRAGMLTVSVFLGSNTERARSISPTKDSPILDPARLSMSSFSQRAIDPPEHLE
FT                   PTPHTPGHDTGNGADSVRDDASISTDNGRRGSTLTANDGETASRPISPFRSRAGTLSWQ
FT                   QRPTSRDSNRAFFSASPSRESRFRAMSTTSNDDHGVSRSPFASSPSFKDVPWSRHTEGG
FT                   SPSPTRAKQVEEDSLHPLHPDTGAKELEANQEHTTESAKEAENHEIVEERSRSPSRASS
FT                   TFAESSLGNRYSSISSVSTATGLGSPLPLTSAQKLEPRKTEDGADDQITSPPSPRRLSP
FT                   ERSTSPTKGLGGFVQSAMMKRSDSVSKRWSAQLPSGLSRGNSVSSNRNSFAAPSGNDVF
FT                   STAPSYRMSRDGPSLSPSRPTSSHRPGSSHRPGSSHRPGSSHRPGSSHSEATVVHPVKD
FT                   GERPATPPVPGSNGARLDEGDRRPSLSLHTRSTSSVEKSTDSSSLPPSSPSVSRTMDPK
FT                   RWSPTKASWLESALNRDESPRHKRQPSQQASWVKDRQSKGSVDLGRTASFKEVTPVGLM
FT                   RTTAPGGHSKTSSITGIPDIFSNHDAGKTKEAEPETTTQSADTQDSYLPPAEKTEETSP
FT                   SKEESPTKTEAEPEKTEDEATKHKRTPSNLSPITKTTIDAPLASPRDPLLNRPKPLSPV
FT                   IDFRANLRRREVVKDESPREEPEFKNVFGRLKKAESSKHVPPDELKENILKGKAALNSS
FT                   GGPKKSQKVDELKDSILKQKEAIKASGGSLRRNTAGEKDAPGKFVPEAIAMRNNLTKSS
FT                   SIKSNLSAADSSSPLSPLSPREPGTPRSTHGFQVASPLSPAGGESLEKFQDSPIAPEPP
FT                   KPGADDNAEEAAEPKLPEKERGCEQEKTDGAEVNAEEVKEEGINPVRSLPPGDLMQATS
FT                   APAETEGPAAKSKLAGRLNPALAGLLSRGPPAPINGSMKGPSFNSAGESSSRVESSQAA
FT                   ALTHLTKGRARGPKRRLPQGTTPEGTNSLFDESNHVPESPPTPLDAQRPESMYSETEEE
FT                   SDAPDMPAHVDVEEAEDMPLHTKTADALEPLTYMEEKNPEPASPVQEAITHAPELPETV
FT                   GQPEHEPLSPLHKENTNTPEPSAPMIEEPEPASPVKEGMNYATEVSAPIHNDESEPMSQ
FT                   FQEEVHDAPVLSAPMIEGPEPASPAKEEVNDAPVVSAPMDKDEFEPASPLGTEAHDALV
FT                   LSAPTDKMETEPASPIRVKINDIPVVSAPIDKDELEPASPFREVVHDAPVDKNETEPAT
FT                   PIQEGTNDVPVVSTSVEKDLSEPTTPLQKEVHDAPEPVSPIHEISVAPKLSEPLVKEEA
FT                   TPAFPIHEESDDVLVPPALMSRKAPEPASPILEDINGAPVASALSGKDEPELVGPVQNE
FT                   VHVAPVLSAPAGMTAPGPTSPIQEKANGAPDFSTLLEDEEAKPLIPVREGSIPKPEPLA
FT                   SADGEKSETTNLALESPNAPGLSEQAEETTLEATSPILERKTYVPPPPVHMDIEETEAT
FT                   SPVHYETTEALEMPASEDEDRPSSSIFEVDEHPSASLNAHVPEPMFSDPREKNGVLSPS
FT                   APKAEEPKTKSPAPEAGDAVPNSPSELSDAHEPAPARPTSVDNIGTVKSPSLDAEFEPP
FT                   NATSEVNEAIPKSPASTLDAQRSEAHISPIGSPAGVSSGWPLPNTEVKSHDEPQESPSQ
FT                   HDTPATSKPTEFKRSIPRLIERETPQKPDDASPKPSTVLDQTATNIRENASAYFKSIRS
FT                   SLSAKPPLPPKTAPLPATPVSNQTRGSPTHFSSPSPSPLRGSFRDNQSYTHPAQQRSAS
FT                   SLFSSIGSRNSSPRDKALPSPPVPPKGSRASVDRFSSRSSTSLVPQADESWEAISDFFK
FT                   TFPKSSDRVNIDTQLMLADKSDNAKIRTLKRQLWEITGDGKKQDLPVNQEYILYEGSMY
FT                   LCVHLFEADGTVRSEVHLWCGDDVPDSAVDDAQAFSRKVAKDNGSKLEIIKQGKEPARF
FT                   IQALGGILITRRGLSSRSSSSAIFMLCGRKHLGQMVFDEVSFSPSNLSSGYPFVISAMF
FT                   GKLFLWKGKGSSAEEIGAARLIGMDLGLTGEFEEVAEGEEPESFFEVFPHWERDTGDTS
FT                   TDYWRAKPNHERYRSRLFRIDHELGQRSGFWLRRSGSPSPVIRPNDTVQEIEPFCLRDI
FT                   TAKGVYVLDTFFEIYVIVGDQASNRPAEFASAVVLAHEYGILTASLQDRPFIPKSFVAL
FT                   GGVPESCSTAFRKWIPGYPSQRLPQVFPLNAAIEAIRSA"
FT   mRNA            complement(join(<109884..110133,110195..116585,
FT                   116711..>116873))
FT                   /locus_tag="An01g13100"
FT   exon            complement(109884..110133)
FT                   /locus_tag="An01g13100"
FT                   /number=1
FT   intron          complement(110134..110194)
FT                   /locus_tag="An01g13100"
FT                   /number=1
FT   exon            complement(110195..116585)
FT                   /locus_tag="An01g13100"
FT                   /number=2
FT   intron          complement(116586..116710)
FT                   /locus_tag="An01g13100"
FT                   /number=2
FT   exon            complement(116711..116873)
FT                   /locus_tag="An01g13100"
FT                   /number=3
FT   CDS_pept        complement(join(117318..117678,117753..117795,
FT                   117842..118051,118165..118204))
FT                   /locus_tag="An01g13110"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2QAX4"
FT                   /db_xref="UniProtKB/TrEMBL:A2QAX4"
FT                   /protein_id="CAK37358.1"
FT                   /translation="MALVEHGKGNGVPRDLMSSDPTKCCVVDGKLPVIFVSPPSSPFPS
FT                   RPSVDSTPVNQALCAEFDPTEVPKDRNAARVGGNWKAGQKVEIDSTAKAGPGKEETPLC
FT                   SGFATRSTHSGLGLISPSSAGWEKLKGISSQPQSERDAQCQSGRAPHPNFLWASGSGAA
FT                   ADVRAFAGFYLTMEEHYYSCLHGAQLAIDTDPPLETRKTLPGSRCHSFTLDRPG"
FT   mRNA            complement(join(<117318..117678,117753..117795,
FT                   117842..118051,118165..>118204))
FT                   /locus_tag="An01g13110"
FT   exon            complement(117318..117678)
FT                   /locus_tag="An01g13110"
FT                   /number=1
FT   intron          complement(117679..117752)
FT                   /locus_tag="An01g13110"
FT                   /number=1
FT   exon            complement(117753..117795)
FT                   /locus_tag="An01g13110"
FT                   /number=2
FT   intron          complement(117796..117841)
FT                   /locus_tag="An01g13110"
FT                   /number=2
FT   exon            complement(117842..118051)
FT                   /locus_tag="An01g13110"
FT                   /number=3
FT   intron          complement(118052..118164)
FT                   /locus_tag="An01g13110"
FT                   /number=3
FT   exon            complement(118165..118204)
FT                   /locus_tag="An01g13110"
FT                   /number=4
FT   CDS_pept        complement(join(118754..118885,118987..119067,
FT                   119145..119290,119345..119361,119417..119527,
FT                   119590..119648))
FT                   /locus_tag="An01g13120"
FT                   /note="Function: Arl2 interacts with the tubulin-specific
FT                   chaperone protein known as cofactor D by downregulating the
FT                   tubulin GAP activity of C, D, and E, and inhibits the
FT                   binding of D to native tubulin in vitro."
FT                   /note="Function: Cofactors C, D, and E assemble the
FT                   alpha/beta- tubulin heterodimer and also interact with
FT                   native tubulin, stimulating it to hydrolyze GTP and thus
FT                   acting together as a beta-tubulin GTPase activating protein
FT                   (GAP)."
FT                   /note="Remark: the ADP ribosylation factor-like proteins
FT                   (Arls) are a family of small monomeric G proteins."
FT                   /note="Title: strong similarity to ADP-ribosylation
FT                   factor-like 2 protein ARL2 - Mus musculus"
FT                   /note="See PMID 10831612"
FT                   /db_xref="GOA:A2QAX5"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2QAX5"
FT                   /inference="profile:COGS:COG0532"
FT                   /inference="profile:PFAM:PF00025"
FT                   /inference="similar to AA sequence:UniProtKB:AF143680.1"
FT                   /protein_id="CAK37359.1"
FT                   /translation="MLSNLRKARLKDKEMRILMLGLDNAGKTTIVKQIMNEDVTTVSPT
FT                   LGFIIKTIDFQGYRLNIWDVGGQKTLRSYWKNYFEKTDTLIWVVDATDRLRVDDCRDEL
FT                   AGLLLEERLMGASLLIFLNKSEVEGCMNENEVRERLGLDSIKTHKWTILPCSAMTGKNL
FT                   HEGLEWVVQDAKDRLFLY"
FT   mRNA            complement(join(<118754..118885,118987..119067,
FT                   119145..119290,119345..119361,119417..119527,
FT                   119590..>119648))
FT                   /locus_tag="An01g13120"
FT   exon            complement(118754..118885)
FT                   /locus_tag="An01g13120"
FT                   /number=1
FT   intron          complement(118886..118986)
FT                   /locus_tag="An01g13120"
FT                   /number=1
FT   exon            complement(118987..119067)
FT                   /locus_tag="An01g13120"
FT                   /number=2
FT   intron          complement(119068..119144)
FT                   /locus_tag="An01g13120"
FT                   /number=2
FT   exon            complement(119145..119290)
FT                   /locus_tag="An01g13120"
FT                   /number=3
FT   intron          complement(119291..119344)
FT                   /locus_tag="An01g13120"
FT                   /number=3
FT   exon            complement(119345..119361)
FT                   /locus_tag="An01g13120"
FT                   /number=4
FT   intron          complement(119362..119416)
FT                   /locus_tag="An01g13120"
FT                   /number=4
FT   exon            complement(119417..119527)
FT                   /locus_tag="An01g13120"
FT                   /number=5
FT   intron          complement(119528..119589)
FT                   /locus_tag="An01g13120"
FT                   /number=5
FT   exon            complement(119590..119648)
FT                   /locus_tag="An01g13120"
FT                   /number=6
FT   CDS_pept        join(120335..120956,121079..122738,122811..122865)
FT                   /locus_tag="An01g13130"
FT                   /note="Function: PTC is a glutamine synthase inhibitor, a
FT                   herbicide and a component of the antibiotic
FT                   phosphinotricyl-alanyl-alanine (PTT)."
FT                   /note="Similarity: shows only partial similarity to
FT                   patented protein because it is much larger."
FT                   /note="Title: weak similarity to
FT                   phosphinothricin-resistance protein from patent EP0290986
FT                   -Alcaligenes faecalis"
FT                   /db_xref="GOA:A2QAX6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A2QAX6"
FT                   /inference="profile:COGS:COG1247"
FT                   /protein_id="CAK37360.1"
FT                   /translation="MSQENNYDYDSPDLWARIKGTRDSVSSASISNKYRSPGYRPSPRR
FT                   CAENNNTASPQRNLVSPSQVNKMQATVVRATNISTVTCKPHKAIATAIPKCFKAPEPVV
FT                   ATSRLPLNESKPPSHPSSSSKITVKLPVPLSGLRDTSHISVSRSSPSPYIPPHIRNHQY
FT                   QNPDQRILPRNKGGLGTEQRNRRGTAHTFHTPLISHVSKAPERPVNKGKMSSGSDSDYV
FT                   VLRNPRAETLQPKVQDAPGQTGLEAGGDTPPGGSIQQPAGEPPGEKQPTTRAELRAEIR
FT                   RLQKEELAKIYQNLCKEEVETADDEVVAKCRDGPGVDPKSEVYQEIEKNRCVRPMEEVD
FT                   LNVEALSMVNDSDKEPEDDRLDNLEELKFSFDSLLKAPQWDAYEKQSLNYPQVINNQVT
FT                   LSPEPSEAQATLRAKTQKFGVHPYASRGAPPTFPPSAYQKWRKYDHLCDWWWAPPMLPF
FT                   YDSWLQKFRSWLDETIENACYADIYHKGFFDGTAHPDGVRTFLIPDLPKATTILNPNDE
FT                   LGHRHRHETAAGLSYNLVMHKKVEAELEEQKLALSRRMQLECMATMPPNPNTPRANIYL
FT                   RPAHVGDANQLLPIYNWYAQNSFVSVDIRTVQPDDVRERIQAARDARLPFIVAVERGSG
FT                   HQRETIFGYATAKDYTGWETSGRYTAELELFVIPEQQRKGIGNCLMDKLLQVCDGNHRT
FT                   KGGYDFNHTGLSGYGLGGHREFARLIFKFTYIPEERQSKSWVRDWLAKNNFELQGRLCG
FT                   VRAKNERLLDVAYFVHNNIFALPYR"
FT   mRNA            join(<120335..120956,121079..122738,122811..>122865)
FT                   /locus_tag="An01g13130"
FT   exon            120335..120956
FT                   /locus_tag="An01g13130"
FT                   /number=1
FT   intron          120957..121078
FT                   /locus_tag="An01g13130"
FT                   /number=1
FT   exon            121079..122738
FT                   /locus_tag="An01g13130"
FT                   /number=2
FT   intron          122739..122810
FT                   /locus_tag="An01g13130"
FT                   /number=2
FT   exon            122811..122865
FT                   /locus_tag="An01g13130"
FT                   /number=3
FT   CDS_pept        join(123753..125528,125614..126312)
FT                   /locus_tag="An01g13150"
FT                   /note="Function: enzyme of S. cerevisiae is involved in
FT                   ribosom assembly."
FT                   /note="Similarity: belongs to the 'DEAD' box family
FT                   helicase."
FT                   /note="Similarity: shows also strong similarity to
FT                   hypothetical protein from S. pombe."
FT                   /note="Title: strong similarity to ATP dependent RNA
FT                   helicase Drs1 - Saccharomyces cerevisiae"
FT                   /note="nucleus"
FT                   /note="See PMID 1454790"
FT                   /note="See PMID 8247005"
FT                   /db_xref="GOA:A2QAX7"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2QAX7"
FT                   /inference="profile:COGS:COG0513"
FT                   /inference="profile:PFAM:PF00270"
FT                   /inference="profile:PFAM:PF00271"
FT                   /inference="similar to AA sequence:PIR:S64750"
FT                   /protein_id="CAK37361.1"
FT                   /translation="MAGTKKRANADDDFVLTLSDDENDTLNQLEEEGEGDDGALATGSK
FT                   TKKRKRDDAAAAQQEKGKNKKVKKQEQQQQQAQQKKKKGKNAPVQEEEDEDEEEEEDQG
FT                   EDDGALNSDFEFDVGGAANEVRDFDGWEVNGNEEGKGGDKKAVDIDDIISRRQAKKEAE
FT                   LIRKQKKKKQKQEEEFSELEDDDEEDGGMEVDFGDDELLAEDGFGMGVDGEEESEKSDA
FT                   EDEEKEEGSDEEAEGSDEDEQMDEDDDDAASDDDSVATPVMHPDDIASDRDSDEESQVD
FT                   AEEEEKRKAFFAPEEEKTSESAMADAKRSFQEFNLSRPILRGLAGVNFSNPTPIQRKTI
FT                   PVALLGKDIVGSAVTGSGKTAAFVVPILERLLFRPRKVPTSRVAILMPTRELAVQCYNV
FT                   ATKLATYTDITFCQLVGGFSLREQENILKKRPDVIIATPGRFIDHMRNSASFTVDTLEI
FT                   LVLDEADRMLEDGFADELNEILTTIPKSRQTMLFSATMTDTVDKLIRVGLNRPVRLMVD
FT                   AKKNTAVTLVQEFVRLRPGREDKRLGYLLYLCKEIYTGRVIVFFRQKKEAHRVRIIFGL
FT                   LGLKAAELHGSMSQEQSVENFREGKAAFLLATDLASRGLDIKGVETVINYEAPQSHEIY
FT                   LHRVGRTARAGRSGRACTIAAEPDRKVVKAAVKAGKSQGAKIASRVIEPAVADSWAAKA
FT                   EELADEVEEVLSEEKLEKQLAQAEMQVTKGENLIKHEAEIKSRPKRTWFETERDKKAAR
FT                   KLGAAELNGPDAGMSKKEKQKLSNKDKKRLDDSRQRQEAGAGWKKGRATRESMKNGQLP
FT                   KAKKDNKKKGKK"
FT   mRNA            join(<123753..125528,125614..>126312)
FT                   /locus_tag="An01g13150"
FT   exon            123753..125528
FT                   /locus_tag="An01g13150"
FT                   /number=1
FT   intron          125529..125613
FT                   /locus_tag="An01g13150"
FT                   /number=1
FT   exon            125614..126312
FT                   /locus_tag="An01g13150"
FT                   /number=2
FT   CDS_pept        join(127192..127199,127324..127468,127548..129119,
FT                   129187..129342)
FT                   /locus_tag="An01g13160"
FT                   /EC_number="2.3.3.13"
FT                   /note="Catalytic activity:
FT                   3-carboxy-3-hydroxy-4-methylpentanoate + CoA = acetyl-CoA +
FT                   3-methyl-2-oxobutanoate + H2O."
FT                   /note="Function: catalyzes the condensation of acetyl-CoA
FT                   and 2-oxoisovalerate to form 2-isopropylmalate."
FT                   /note="Localization: mitochondrial and cytoplasmic."
FT                   /note="Pathway: first step in leucine biosynthesis."
FT                   /note="Remark: a single nuclear gene produces two forms by
FT                   use of alternative initiation codons in the same reading
FT                   frame."
FT                   /note="Similarity: belongs to the alpha-ipm
FT                   synthetase/homocitrate synthase family."
FT                   /note="Title: strong similarity to alpha-isopropylmalate
FT                   synthase Leu4 - Saccharomyces cerevisiae"
FT                   /db_xref="GOA:A2QAX8"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="InterPro:IPR039371"
FT                   /db_xref="UniProtKB/TrEMBL:A2QAX8"
FT                   /inference="profile:COGS:COG0119"
FT                   /inference="profile:PFAM:PF00682"
FT                   /inference="similar to AA sequence:UniProtKB:SCLEU4.2"
FT                   /protein_id="CAK37362.1"
FT                   /translation="MPMLKDPSQKYKRFQPLHLPDRQWPNKTIDNPPRWLATDLRDGNQ
FT                   SLPDPMDGQQKLRFFKMLVDIGYKEIEVSFPSASQTDFDFTRSLVETPGLCPDDVWLQV
FT                   LSPCREDLIRRTVDSLKGAKKAILHIYLATSPCFRRIVFNMDKQKSLEMAVRCTKYARS
FT                   ITKDDPSTAGTEWHFEFSPETFSDTEPEFAAQVCEAVKAAWEPTEKDPIIFNLPATVEM
FT                   STPNVFADQVEYFCRNVSEREKYVVSIHPHNDRGCAIAAAELAQMAGAQRVEGTLFGNG
FT                   ERTGNVDLVTLALNLYTQGISPKVDFSDINAVIKVVEESNKIPVNERWPYGGQLVVCAF
FT                   SGSHQDAIKKGFKLRETASPDAKWEIPYLPLDPEDIGRNYEAVIRVNSQSGKGGAAWVI
FT                   LRSLELDLPRALQVEFSKIVQRRTEEVSRELRPSEVVELFQEAYHLKSNPRFNLVDYNI
FT                   TTDRSQSPAPPEPGKALNTKNLKRRFTGVIEIDGIQHAITGVGPGAISSLAHALATLGI
FT                   DLDVVDYKEHSIGLGRDVKAATYIQCTAAGSKEQVWGVGIHQDVVQASLIALLSAASSF
FT                   LTSRSGSPAPFRPIRSNTLTDDDLQALEMLNGPSKPKVDIDALTKQAESQ"
FT   mRNA            join(<127192..127199,127324..127468,127548..129119,
FT                   129187..>129342)
FT                   /locus_tag="An01g13160"
FT   exon            127192..127199
FT                   /locus_tag="An01g13160"
FT                   /number=1
FT   intron          127200..127323
FT                   /locus_tag="An01g13160"
FT                   /number=1
FT   exon            127324..127468
FT                   /locus_tag="An01g13160"
FT                   /number=2
FT   intron          127469..127547
FT                   /locus_tag="An01g13160"
FT                   /number=2
FT   exon            127548..129119
FT                   /locus_tag="An01g13160"
FT                   /number=3
FT   intron          129120..129186
FT                   /locus_tag="An01g13160"
FT                   /number=3
FT   exon            129187..129342
FT                   /locus_tag="An01g13160"
FT                   /number=4
XX
SQ   Sequence 130160 BP; 32528 A; 33083 C; 33199 G; 31350 T; 0 other;
     cccccccccc ccccattttc tccgtgattt tttcttcccc cttggtacgc actcgcgctc        60
     acttgtatat ccggttgatc cctcattatt gtgatcaccg ttattttccc attgctcgtc       120
     ttgttactgg taagacggat acatacaagc cgcgaaccga ggcaatggga actcgtatca       180
     gagcctcagg caggaagatg aatggctgac tcctctttag tactggttgg gaggacaggt       240
     gcgtactaga aggacggaat atcaacgaca tcttcaacac caatcattta ccgccagcct       300
     cgaactggtc ccaagttatc gatttgtgtg agaactggac tttggcgacc cgagattagg       360
     tatccatgct gtgtttcttg gctttttgga agcgaaagga aagaaaggga aatgctgagg       420
     atagagaaga agtggtagac tagagaagga taccgatata aagaaataca atactgccta       480
     aaatggaaaa agcaattgga aaagaaaaac cgggaaaggg tgataaaagg gaaaaaaaaa       540
     taagggaaaa taaaaaaata agaataaaaa agttggaatt actaagaaaa ggcaatgaag       600
     ggagaccaaa agagaccaga aaaagaaaaa aaaatgggac agacgaagag aaaagaaaaa       660
     taaaaagaat tgagagacaa agactaaatg gggagacgct aagctactta cctgcttcga       720
     actcgtggtg gatacaagct gtatgtattt tatgcgtatg atataccgac tacctatgta       780
     tccaggatta tcccctgtgg atatagcatg tagcatgtag gtccgggtgc accacctggt       840
     aacacctggg agccactagc cagactatct agttagtgcg cttgtgtgtg atggtagtaa       900
     gttagttagc taggttagcc agttagttag tatgtaccat ccatacatgc ctagtacatc       960
     gtgcatccac cctgggatcg gtaccagaca gcgggcacac agacgttgga cgtgtcgccc      1020
     tgaggaggca ctggagcgct atctggccgt tattttattc gctaaggggg gtaaaacata      1080
     gtttgatgga ttgattgata ggacacgagg gactgtaatc gcggcagcaa aggatcaata      1140
     ccggattatt gatccaggat ccggatgtca gttagaaaag accctccctc atagcagcga      1200
     gcgaggtcag gaccttagtg atccgcgtag ctgcccagag gtgctaggga agccatgtac      1260
     catggttgcc ggaggggctc tacttccgga gggagccaat gaagctcgga aggcgccaga      1320
     tcgatagcca ggcgcatttc tcaccatccc cgacgcatcc tgaacccatg tcggtactcg      1380
     accacatcct gactcgcagc agagatgcca tctacaacaa accactaaac tctggaacct      1440
     ccacgtctca actggcagta gtcaaaacac aaatccaagc cagtctagcc gccagatcat      1500
     ctccattcag ctgcttgccc tggttttctc tctctctccc aaactctcgg tctcttagtc      1560
     tcttagtctc ttagtctctc agtcgtctct tgagtccttt tccctctctc tctcccctgc      1620
     gtttcccacc attccagccc tttttcccag gccctctaac cgccccgcct tcgcgcccgt      1680
     gggcccaacg gggtcaagac agcggctgca acaaccttaa aggcagggtt gctttgcttt      1740
     ttgccttctt tcctctgccc tctattccac cccccctctc tcttcccccc tctccgctgt      1800
     ccgaatggac ttgcacttcc gggatcggat tttccctttc tgatccgatg atccagtcca      1860
     attgacctaa ctctcgatcg tcctcccccg atccatggtt gttctttagt cgcctctctc      1920
     ctcgtaacgc ctgacacctg ctgctgttat cgatacccta tttattattt attatttatt      1980
     tttttcccta ttttcctatg ccgctgccgt gaccgctact tttctctttt gttctctccc      2040
     ccccgacggg ttcctgtcct tgcggggagg agactttttt ccccctacct atttagtatc      2100
     ctcattcctc cttgtgcctc ggccgagatt tggagatact cttctccacc gtgtgtgact      2160
     gtgggtgtgc gcgtgcacgg gtgtgcgtgc ctctttgctc tcatacaact ctcctgggtt      2220
     ggggcaaatt tacaccattg tggactttgg atcattctta cttactatcc ttggcttttt      2280
     gctctccggc tttccactct cctccttctt ccaatccttt taccccttct cggccactga      2340
     ttcattccgc ggaggatacc cccagttagt agttttgttg ttgccgtctt ttcgtctgat      2400
     cagcttttca atccaatcat tggctcaatt tgcggcgccg aactccaact tcctctatgt      2460
     gccacctgac ttacgattcc ccgatatcac ctgcagcctg catacaccct gttggctaac      2520
     attggcgttt tacgttaccg tcacgaagaa cgccggtctc tttgattgaa cgaacccctg      2580
     tatctctacc ataccttgag caggaaaagt cgaatctctt cccagcgaac cgatccttgg      2640
     acttcagggt tccatgtttg aaatcagccg acttttgcat cagccaatta ctatggcttc      2700
     gccgaatcgc aataactaca gctaccaagg gatagaatcc tatgattccg gccgttccag      2760
     gcaaaactcg gatgctatgg acattcacgt cattacggcc caagaacctc ctcgagaacc      2820
     cccggacaac aacgatcctt atgatggcca tgggggtcca gctgggacta gccattatag      2880
     caagtacttc tcccttctca tactctgcac cccacgtacc ccgcaaaatc cctttttctc      2940
     atgccgtgca aatatcacac ttatttctac aactaccggg cgactaattc agggaacttt      3000
     cttttccgtt gttcgtttaa tctaggcctc caaacagatg gctcttctat gaagaaaatg      3060
     ggcgaacata tcatggatat cgcagaggag tttacccgct gccatgcgat gaacaggaac      3120
     aggaccgtct cgatatcttc cataaactgt tcacagtagc acggatgtcc gagagcttaa      3180
     tctacgcacc tcacccccca aatggtcgat tcctagatct ggggtgcggc actgggatct      3240
     gggccattga tgtagcccac aagtatccca atgctttcgt tgctggagta gatctagcac      3300
     ctatacagcc tcccaaccac cccgataact gcgagttcta tgcacctttc gactttgagg      3360
     cgccatggac gcttggggaa aattcttggg atctcattca tctacagatg ggttgcggca      3420
     gtgttctggg ctggcagaat ctctacaagc gaatcttaag gcatcttcag cctggggcat      3480
     ggtttgaaca agtggaaata gatttcgaac cccgctgcga tgatcgctcc ctgaatggac      3540
     tggcactccg ggagtggtac cagtacctga agcaggcgac acaagataca atgcgaccca      3600
     tagcgcacag ctcgcgggat accatcagac accttgagga ggcaggcttt acccagatcg      3660
     accatcagat ggtggggctg cctctcaacc cttggcaccg tgatgaacat gagcagaagg      3720
     tagcccgttg gtataacctc gcaatctctg agagtatcga gacgctcagc ctcgcccctt      3780
     tcagtcgcat ctttcactgg gatctggata ggatcagaca gatcacagcg gaggtcaagt      3840
     cacaagcctt caacaaggaa atccacgctt acaatatctt acatatatac caggcacgga      3900
     agccgggcgg cccatcactt tgaaagtaca gagaaaatta cggcagtgcc ggctgtaatg      3960
     cagatttcat tccggatacc catatgcagc cttttgtggg agggccatcc tacctgttct      4020
     cttctttttg ttcattccat ttttttctcg atgaggatta gtgacgacca attccatctc      4080
     cttgacggga tcatactgaa atgcttatac accaaagcga gcaaagccca caaaaccatc      4140
     actggacttg aactcgtacc aacactgcta gtttgacgca agaacgccag gaacgcagac      4200
     aggcttatct tcattgtgtt attgcctact ttagtgcaga cagctgaacg gcacaaaggg      4260
     acgcgaagta tattatcaat cacaccatgt ggattgttac cgtcgcaaaa gatactgctc      4320
     gaggttttaa ataatagaag cacttcaaga agatgaggtg ccgttgtcgg gactcgaaga      4380
     agtggccgac gactataaag taccagattt gccaggatcc aaaagaagct accaatctca      4440
     tgttgcattt ttggaaagcc ctgtaattca ggccggctga actgcggaga tcccagaatc      4500
     atggcagttg actgagtact tgtcgtgacg ggccctaaac atcagccatt ccatccgaac      4560
     tcaaaactct ctgatgaccg tggcggctct gtggcacagc caccgataat tttttttgtt      4620
     ggcacttatt aatgaattag atgagaaaga agcgaagaac cgagggcttg aacaaacgca      4680
     aagccctcca aatggttact attgaacttt ttgctctccc accgaaactc ccactgatca      4740
     tgtaccgtaa gtatatcgaa aaatatgcca tgtcccttga gacagcctac cagacgccaa      4800
     gaaccctcta actgacatat aaccctatag atgactcgca aagtaagaca gaagcaacac      4860
     gaaggacagt gagagaacgc attttgttag cccacagata gtacaaatca acgccgccgg      4920
     cccttttgac ctcgtgtgct gccgttccta ccgccattta cactgtcctt ctccccatcc      4980
     ccattggcat tcgttcggtc acgagctgcg cctggactac gcctcctcat cgtcccgggc      5040
     ccaacagcga tgatatcatc ctcgctttca ctgtccgaaa tatcaagaag gacaggcatg      5100
     cggaatgagg caacgatatc ctcatccgca ccgtctttgt tcagttcgat tgtgagaacg      5160
     tcggggactt cgtcttcctg gtctagacgg cgctggtgga tttcctctgc cgggtggata      5220
     tcgaattcat cttcgcgctc gacatactcg acgttctctt caacttcgcc gaagtcaggg      5280
     gctagggctg accatttctg cggcgttacg atcgaccacg tatagatgca cccagattct      5340
     aggccgcagg caaccaccat cgggcggctg gggtgccact cgaccactcc tagttcttcg      5400
     cgcgggcctt ccaaaatctt gaccagggag ccgtggcttc gctcccagac ataaatgtca      5460
     gggttcatga acgtggacgc agtaacaaat tccccagtgg aagaaaatgc tacatggttc      5520
     cagcttaaac ggttcaccac atcttggaac ttatgttcca cttggagttt gatgttggta      5580
     ggctccagat cgatacccag ttgtgagaga tctggcatga ggatcgtgcg tatgacacga      5640
     tcagagctgt tgactagtag atcccgaccg ttactcgcta agcggagtaa gatcaccaca      5700
     ccattgcaga gccgagtgga atgtattgtg gtacaggttt gtgtctcaat aatattgatc      5760
     caacccttag atgtacctgc tatgatatgg tttcctagag cagtgaagat cgtaacgcac      5820
     gtggaatgtt tcgcatcttg agctgcttgt tttgcagcta cggcggggtc gatttcttcg      5880
     ttcttcggag gcggaggacg gaacggagcg gatggaagga ttcgcttgac gggcttgggt      5940
     agagaaacat caacgaggac aggctgatct tcgaagagag acgctacaaa gagcaagctg      6000
     caggagcgaa gcgtcagcaa tgtgctagcc gctgagcgat agggggctgt catactggtt      6060
     ataagggtgt agttctgcga tataaacagg tgcttcgaag cggacggtgc ggactcggga      6120
     gccatctttc aaatcccata gaatacattt ccagtcctga gaagaactca gaagataacg      6180
     accgtctctt gaccaactgt gaacggcttg tagttagcat cactgagtgt acggcggatt      6240
     gcgccaaggg gcgtacctca gtgactgaat ctgcctggta tgacctcgta gctttcgcgc      6300
     aaccccgttg gtttccacat caaagatgac tactgttcca tcaacctggg acatggttat      6360
     tgatttgact tcgaagcaat gcccgtgtat tgtgagcaac caacccgtcc agacgcaaga      6420
     tagtctccct tgcgattaaa ccgtagacaa gtcgcatgtc cacttcctgg tatagggtca      6480
     gtgatcacac cgcgaactaa cggcaatgcg cgacatactc agcttctccg ttaatgtgtc      6540
     tggataatcc tgagcgagga caaagggatc gacaagagac aaattcatgg tgttagattc      6600
     aaacagaatg tttttggcaa gcgtcaagtc aaagccagaa agttaaacaa tagaagaggc      6660
     ggtaatttcc cagcctgcga agaaggccgg gaggttcgct cgggagcaaa catccagtgc      6720
     agtcaataac cacagagtta atgaactaca gccgggcggg ggatgggaaa taccggctgg      6780
     catggtgaat tgaagccgaa gggcaaataa agcgacgagc gggcggtgaa gcggccaaat      6840
     aaatctgtca attgcctctc cagtgagtag tcagtgactg cattctgagt ggcggagagt      6900
     ttactgccac ctcacatatg ctccacttcg ggtttagcgt tgcagacttt tagagggcag      6960
     ggtggtcgcg ctagcttgcg gctcagaaaa ctcgttgccc catcgccgac tgacctgacg      7020
     tccaaccgtc tccctttcat cacctcaaca cgcctcctgt ccatcgccca acacccccga      7080
     ccatcgcgct ttgcatcgcg atatcacttt ccgagctgga gatatcgcca agattgaccg      7140
     tgaccctctt tttttccgcc cttttcgagc ttcgcgcagt cggtggataa ggtcgcaggc      7200
     gccctcgtgg caagggctgc cagaggccta ggccggccag tttgctcgca aacatttgca      7260
     tcgtcgcttc agcccattta gactgttgat agatcagtgc tttcgacacg tcagttttcg      7320
     tcttactcgg ccttatttcg actccttcgt catcgcatac ccccggagaa cgatcagctg      7380
     acgacaccaa ccaccatcat ggcgaacgtg tactttccct actccaaggc gcctctgcgc      7440
     accatcaagg agatccagtt tggtttgttc tcacccgagg agatcaagcg gatgagtgtg      7500
     gtccatgttg aatatccgga gacgatggtt tgtttttcct ggagtgccgc ccacaccgac      7560
     tgaacgtggc aaaacgctaa cgcggaaaca caacaaacag gacgaccaac ggcaacggcc      7620
     gcgcacaaag ggtttgaacg atccacgctt gggaacgatt gatcggcaat ggaactgcga      7680
     aacttgtgag gaaggccaga aggagtgtcc tggtcatttt ggacatattg agcttgccac      7740
     accggtttat catattggta cgttgctggc cggccagcca ggggagatcg atctcatgtt      7800
     gcacgcctgc taacgtctgc tccaggtttc ttgactaaga tcaagaagct tcttgagacg      7860
     gtctgccaca actgtggcaa gatcaaagcc aatacggtta gtcatccctt atgggatggc      7920
     aaatctatca cggcatattt gctgacgtag aaccagtccg accccaagtt tctagaagcc      7980
     ctgcgcatgc gagaccccaa aagacgattc gaccacatct ggcgactgtc caaagacgtt      8040
     cttatctgcg aagccgaccc tcccccggac gatgacgagc ctttctcgaa agagaacgcc      8100
     aaacccgttc ggatgcacgg tggttgcggt aatgcccagc ctcagattcg taaggaaggt      8160
     attactcttg ttggaacgtg gaagccgaac aagatgatgg acgagatgga catgcagcag      8220
     cccgaaaaga aggttattac cccgcaggtt gccttgaacg tttttcgtaa catttcttac      8280
     gaagatgttc gcatcatggg tctgagcaat gattatgccc gtcctgagtg gatgattatc      8340
     accgtcttgc cggttccccc tcctcctgtt cgtcccagtg tgcttgtcgg cggcagcacc      8400
     agtggccagc gtggtgagga tgatctgaca tataagctgg ctgaaattgt cagagccaac      8460
     cagaatgttc aacgctgtga gcaggaaggc gccccagagc acgtcgtgcg cgagttcgag      8520
     tccctcttgc agtaccatgt cgccacttat atggacaacg atattgctgg tcagccgaag      8580
     gctatgcaga agtcgaatcg cccagtcaag gctattcgga gccgtttgaa gggtaaggag      8640
     ggtcgtttac gacagaactt gatgggtaag cgtgtggatt tctctgcacg tactgtcatt      8700
     actggtgacc ccaacttgtc tcttgaggag gtcggtgttc caaagagtat cgcgagaacc      8760
     ttgacttatc ccgaggttgt cacaccctac aacatcgaga agttgcagac actggtttcg      8820
     aacggtccga atgaacaccc gggtgctcgg tatattgtcc gagacaacgg cgagcgcatt      8880
     gatcttcgtc atgccaagag agccggtggt caacagttgt tgtatggatg gaaggttgag      8940
     cgtcacatca tggatggcga tgtcatcctg ttcaatcgac agccctctct tcacaaggag      9000
     tccatgatgg gtcaccgtgt tcgcgtcatg ccctattcca ccttccggtt gaatttgtct      9060
     gtcactactc cttacaacgc cgatttcgat ggtgatgaga tgaacttgca cgtccctcag      9120
     agcgaggaat cgcgcgcgga gttgagtcaa ctggcattgg tccccatgaa catcgtttct      9180
     ccccagcgaa acggcccgct catgggtatc gtgcaggata cgctctgcgg tatctacaag      9240
     atttgccggc gtgatgtctt cttgaccaag gatcaagtga tgaacatcat gatgtgggtt      9300
     cctgattggg atggggtgat tcctcccccg gcaattctga agcctagacc tcgctggaca      9360
     ggaaagcaga tgatcagtat ggcgctccct tctggtctta atcttctgcg tgttgataag      9420
     gataactcgc cgctttctga gaagttctcg cctctggctg acggtggtct tcttatccat      9480
     aacggacaac tgatgtatgg tatgttctct aagaagacgg ttggtgctag cggtggtggt      9540
     gtcatccata ctatcttcaa cgagtatggt catggtacgg ctgttgcttt cttcaacggt      9600
     gctcagagaa ttgtcaacta ctggcttctg cataacggtt tcagtattgg tatcggtgac      9660
     actatccccg atgagcttac cattcagcgg attgagaact gtgtgcgcaa caggaagaag      9720
     gaggtcgagt cgattactgc aagtgctact gacaacactc tcgagcctct acccggtatg      9780
     aacgtccgtg agacctttga gagtaaggtg tctcgtgctc tgaacaacgc tcgtgatgag      9840
     gctggtagtg agaccgaaaa gagtttgaag gatctgaaca atgccattca gatggcgcgg      9900
     tctggttcaa agggttcaac tatcaacatt tcccagatga ctgctgtggt cggacaacag      9960
     tccgtcgaag gaaagcgtat tcctttcgga ttcaagtatc gtaccttgcc tcacttcacc     10020
     aaggacgatt actcgcccga gtcgcgtgga ttcgtcgaga actcttacct gcgtggtttg     10080
     acacccactg agttcttctt ccacgccatg gctggtagag aaggtttgat tgataccgct     10140
     gtcaagaccg ctgaaaccgg ttacatccaa cgtaagctgg tcaaggctct tgaagaagtc     10200
     atggtcaagt atgatggcac tgttcggaac tctttgggtg atatcatcca gttcatctac     10260
     ggagaggatg gtcttgatgg tgctcacatt gagaaccagc gggtggacat catcaagtgc     10320
     tcggatgata agttccgtga gcgtttccgc gtcgatttga tggatcctga gcgtacgctg     10380
     ggaccagagg tcctcgagca ggccaacgaa atcgcaggtg acgtcgaggt ccagagacat     10440
     ctggatgaag aatgggagga gctccttaag gatcgcgcgt ttcttcgctc ggtggccaag     10500
     gaagacgagg agatgatgca gcttccgatc aacgtgcagc gtattttgga aaccgccagg     10560
     actactttca gaattcgtga gggtaccatc agcgatctcc atcccgcgga ggtcatccct     10620
     caagtgcgct ctctgctgga ccgtttgctt gttgtccgcg gtaatgatat catttcgcgt     10680
     gaagctcagg aaaatgcgac attgctcttc aaggcccagc ttcgcagccg actcgcattc     10740
     cgcagattgg ttacggagta ttccatgaac aagcttgcat tccaacatgt tattggagcc     10800
     attgagagcc gattcgccaa ggctggtgcc aaccctggtg aaatggttgg tgtgcttgct     10860
     gctcagtcta ttggtgagcc tgccacgcag atgacactca acactttcca ctttgctggt     10920
     gtctcgtcca agaacgtcac tttgggtgtt cctcgtctaa aggagatttt gaacgttgct     10980
     accaacatca agaccccctc tatgacggtc tatcaggaag ctgctcggtc gtttgacaag     11040
     gagggtgcca aacaattgcg aagcgctgtc gaacacacca gcctgcgttc cgttacggaa     11100
     gctactgaga tctactacga tcccgatatc caaaccacgg tcatcgaaaa tgatcgggat     11160
     atggtcgagt catacttcat cattcccgaa gatgtcacgg atgatgcgtc gcgccagtcc     11220
     aagtggttgc tccgtattat ccttagtcgg ccgaagcttc tggataaggg tctgaccgtg     11280
     caggatgttg cttccaggat caaggcggcc tacccgaagg atattgctgt tatcttcagt     11340
     gataacaacg ccgatgagca ggttatccgt atccgtcaaa tccaggacta caaggaggac     11400
     gaagaggatg atgatattga atacgatgtt acgctcaaga agttggagca gcatcttctc     11460
     gacactctta ccctgcgtgg tgttcctggc gtcgagcggg cgttcatcaa cgaaaagagc     11520
     aaggttagag ttttggaaga tggctcattg ttcgcaagca agaccgaccc gctttgcaag     11580
     gagtgggtcc tcgaaacaag cggctcgtcc ctgggtgagg ttctggcaat ccccggtgtt     11640
     gatgctactc gcacgtactc caaccagttt atcgaggtct tcgaagtttt cggtattgaa     11700
     gctgcacgga cggctgttct tcgcgagttg acccaggtgc ttgcgttcga cggttcgtac     11760
     gtcaaccacc gccatttggc gctgctggtc gatgttatga ccgtacgagg ttacctgaca     11820
     cccgtcactc gacacggtat caaccgtgct gataacggtg cactcatgcg ttgttcgttc     11880
     gaagagactg tcgagattct gttggaagcg gccgctttcg gagagctgga cgactgccgt     11940
     ggtgtttctg agaaccttat tctgggccag atggcccctg ctggtactgg agagttcgat     12000
     atttaccttg accagaacct catgaacact gtcgtgtcga acaatgctcg cttcggtgtt     12060
     atgggagcca tcggcgccaa ggatgcaatc atctccgatg gtgctgctac tcaatatgac     12120
     acaggctcgc ctatgcagga gagcgcttac attggcactc ccgaccccga atcgaacttc     12180
     tctcccattc gccaagctgg tgccgagact cctggtggct ttaccgaata ccagcctact     12240
     ggcggctttg gtggcggatt cagtccggcg gctacaagcc ctgcaggcta ttcccccagc     12300
     agtccgttca gcgcgaaccc cacgtcgcct ggttattccc cgacctcgag ttattctccc     12360
     acgtcaccgg gtatggctat caccagtcct cgttttatgt cgacgtctcc cgggttctca     12420
     cccgccagtc cgtcatttgc tccgacatca ccggcctact ctcccacctc tcctgcgtac     12480
     ggccaggcat ctcctacgtc gccatcgtac tcgccaactt caccagggtt ctcgccgacg     12540
     tcgccgaact acagtcctac ttcacctagt ttcagcccgg cttcaccggc ctttagccca     12600
     acctcgccta gctacagtcc gacaagccct gctgttggtg gtgttggccg gcatctgtca     12660
     cccacttccc ccacctcacc taagtacacg cctacttcgc ctgggtggtc tcctacgagc     12720
     ccccagacgt attctcctac atctcccaac tttgccggct cgccgacgtc acctggagga     12780
     ccaacatctc ctggctacag cccgacgtcg ccggctttta gccctacgta agtcactcgt     12840
     gagcagcaat tgagtgtcat ttggttgcta atcaaacatg cagatctcca cgccagtgaa     12900
     atcctaagat ggttgctctg cttctttctg accttcgctg tatcattgta ctatcaccta     12960
     cctcccagac gacctctaag aggaacaaaa gaaaaaaaca tcttgcattg tatgttgcgg     13020
     aattggttgg ttatctcatg cagaatttgg ggcgcctgta gcctttccct ttcacccatc     13080
     cgtttttaac tgtatgtttt tctcttcttg cctcagcctg caggtcgatc cccttctatc     13140
     ccgtattagt cttctttcct actttttttt ttccgagcca gcctgctgaa attgcgaacg     13200
     gttttgtggg ttggtgatat tatgtgtttt gtttgctttt ctttccccct tttttttgca     13260
     cattgaacta ccaagcgttt agacttgagg gtgcttgtgg accatgactc ggttatgaga     13320
     atacgatggt cctctccgga gatggtgttg ttttctctga gttagcatcg aggacgagtt     13380
     attgcgtgta ttgctgcgat cgataagtat ccctatgcgt tgtacacaga cgactgcaga     13440
     tgggttatgg acgagaccgg aggtcaataa taatgaaaat ggttgccaac acatgtgcct     13500
     tgtagtcata aatagtagat gcacttgtag atagtatctt ggtgaaagag ccaagaacgt     13560
     cggcgaaatg aagctccgca acgccaggtg gcccgttccg catcggggcc gagcaagcaa     13620
     ctccccccga gtctcaagtg ctcatcttca ctatcagctc ctctcccctc tcttacttta     13680
     tcggaagctc gagcacagag tcgccatgcg cctctcactg ttcacttcta ttcaactttc     13740
     tcacacaaca tgaagaactg gtggctgtgg cgtttcctgc cgttggcgct tcgtgagtcc     13800
     tcttactgtg gagcttagcc gcatcacgcg atagcaactg acctccaagc atcactttcc     13860
     agtgcttctg caggcgcttg cggatgaata caatggacag cacgacacac aaaaaccctt     13920
     aacagatgtt gttcctgaat catatgcaca tgctgagtcc tcgagcgggc ccgagggctc     13980
     tgacgttcta ccgggacacg gtaagcggcc ctgtgcatga cgccagcgca cccatccttg     14040
     ctaacaacta gtgatttgat gtgccaatag tacacgtcga aaatgccctt caaatcctcc     14100
     gagagagcaa gatccccatt gtcgctcacg agaaaccgtc cggccttctg gggtacacct     14160
     ggcattacgc ccaagaagcc ttccgactcc tatttatgaa tggaccacag ccggatggaa     14220
     cacacaagca aaagctcgat ccaaatgttg caaaggctgc gaatgaactt aaggttgcgg     14280
     cgcaagaaca ccaaaacccc gatgcaatgt tcctcttagc ggaaatgaac ttctacggca     14340
     acttcaccca cccgagagat ttcaagcagg cgtttcattg gtaccaaact ctggcgtcat     14400
     cgactggaaa cagtacggcg caatatatgc ttgggtttat gtatgcaacg ggtgtcgggg     14460
     gtgcggtgga gcgcgaccag gctaaggccc tgttatacca cacctttgcg gctgaagcgg     14520
     gcaatacgaa gtcggaaatg accctcgcgt atcgctacca cgctggaatt ggggctccta     14580
     gagattgcga tcaagcgact tactactata agaaggtggc tgataaggct attgaatact     14640
     tccgatcggg accgcccggt ggccataaca tgatccgcga gtcctaccgt tgggcggacg     14700
     aagagggtgg tgtttatggt gaaggcgcta gtgtatcgac tgccgtacgc gatggaacgc     14760
     attcgagcac ggaagccagc ttggaagacg tcttggagta cctggatttg atgtcgagaa     14820
     agggcgaact gaaggctact ttcagcttgg gcaagatgca ttacgaaggg ggccgcggct     14880
     tgcctcggaa tttccgaaag tcgatgaatt acttccgaca ggtcgccaag cggtattgga     14940
     ataaagatgg atcggtgaac cccaaccatc ctgttggtgt tgaaaagctc gcttcgaaag     15000
     cagcaggcca tattggcatg atgtacctgc gtggcgaggg ggtggaacag aactttgcaa     15060
     ccgctcagac ttggtttagg cgtggactcg cgaatggtga tgctctctgt cagcatgagc     15120
     taggactgat gtacctgcat ggctatggtg tgacaccaga tgcgttcaga gctgcatcac     15180
     aatttaaggc tgcggctgag caggacttcc cggcggctga aacgagactg ggtgccctgt     15240
     ttctagacca gggtgatgtc cagaccgcca cccgttattt cgaactggct gcgcgctggg     15300
     gatggatgga ggccttctac tacctggcag aattgtccaa caatggggtt ggtcggaaac     15360
     gacactgcgg gatggccgcg tcttactaca agatggtcgc agagcgggcg gaagtcatcc     15420
     attcatcttt tgaggaagca aatacggcgt atgagaacgg agacaaggaa cgggctctca     15480
     ttccggcgct gatggctgcg gagcagggtt acgagcatgc acagtccaat gttgcgttcc     15540
     tgctggacga gcagcggtcc ttattcgcca ttgacactat cctcccagga gctaagaaga     15600
     gcagaccggc tttgctgcgg aatgcagcgc tggctcttat ctattggaca cgttccgcca     15660
     aacaggcgaa catcgactcc ttgctcaaga tgggcgatta ctacctggcg ggcatgggaa     15720
     ttgctgcgga tgcggagaag gcctcgacct gctaccacac agcagccgaa gtgcactata     15780
     gcgcacaggc gtactggaat ctgggatgga tgcatgagaa tggcgttgcg gtggaccaag     15840
     acttccacat ggccaagcga tactacgatc tagcgctgga gactagctcc gaggcatatc     15900
     tgcccgtgaa gctcagtctg cttaaactgc ggatgcgggg atactggaac tggctcacga     15960
     acggagacat caaccctatc cgagaggaag aaggtaagga accccaacat ccttttcgct     16020
     gagaaacccg aacaatcaca cttacacact aatgcagaag tgaggtcgca tcgcaccttg     16080
     aaggaattca tcgccacttt tatccagaac aacgaggaag aagaggccgc cttccgcgcc     16140
     cagatgtaca aacaggacga ggaggacgaa ctcatgtcga ataatcgcct tgacgaccac     16200
     cgcgaagacg gctactatga tgagctggag ctcgatattg atgatagcat cctggaggga     16260
     ttgctcattc tcagtcttgc cgcgacgctg cttgttctcg tgtatatgag acagcagcgg     16320
     aatcgccagc gtcagaacga caatggcggc gcgaatccgg cggcaggagg caatgccaat     16380
     aatgaccggg gaatgtttcc tcggccaggc gagccgggtt ttaatgattg gcttgctggg     16440
     gcggtaggtc attaatgata tagaattgtc cttttcgcag taatgtatat gcgttttatc     16500
     tatctcctaa gtacacgaat gataccttcc tggttgttag ttaccatcta tggagtgtgt     16560
     agagagcaga gtatatctat cttatcagct gactttcctt atcgataagc atctttactt     16620
     tccacttcta ctatactacg gaatacttca ctctcttcaa gttcatactt tacaacatcc     16680
     cccacaatcc attcccattg catatcaaga cctcacccaa acatcggatc tactcaacca     16740
     agaaaacaca taaacaggat aaacaccatg acccccaacc aaacaccaac tcccaacccc     16800
     aaacgccgcc gtctaaacac caccatatca tcaccctcat ccacgctcac caaaccattc     16860
     aaatcgcctc tccgcagacc agccccagcc actgatacca ccaccacgaa cacaccttct     16920
     tcttcttctt ctaaagacac acaaccacaa ccaccatccc acccatcacc atcaaccccc     16980
     aaaccctccc ctaaagatcc cccaagaggt acccccaaaa aggaagaaga ccccaccctc     17040
     caatccctcc aaaccacgca ccgacacctc caatcgcaac tcctctctct ccgcacagaa     17100
     ctagaaacac tcacgcaggc ttcccgcatc gaggaatctc accgagatga agaactagag     17160
     aaattgatcg tgaagtggag gggcgtgggg cagagagttg ccgaggaggt gtttgagggg     17220
     gcgagagaga gggttagtcg gatggggggt gtgaggggct ggagggagag ggagatggag     17280
     aggagtagga gtggtgggtg gtgggatgat aacgagggga agaatggggg tggggagggg     17340
     gataaaggcg atgaggagaa ggtttgtcta ttcttttttt ctattttgat tgtgttgttt     17400
     gtgcgtggtt gatgcgttgt ggatgtatgc tgatttagtt gtgataggag gtagaggcag     17460
     aggaagagga agaggaattc acgataggga tgatgttgaa gacgatgggg attgatttca     17520
     aggttattgg gtatgatggg gaggggcaga gatgggtgtg attaattcta ttaggaggat     17580
     gaggtgtgga tggagatact attgatgtgc tttacttgct gtatgtctgt gtatctcaag     17640
     ggaagaaatc ttattgctag gcgtacgatg aattgacagc tacactatca agaaaacaag     17700
     catgtgatca ttctatgcta acgctatact gcaaatactc cctatcgtga ccgcaatttg     17760
     caaaactcct atctcataac cccattttga cccatactta catgctctca gcctgtttca     17820
     cgccatccca tatcatagat gctctgtaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa     17880
     aaaaaaaaaa aaaaaaagaa tccagaacac aaaataaaca aagaaaagaa aggaagctct     17940
     acccagacac tcttcctcaa catcagatga tgtccatgcc atcaatatca tcaccatcaa     18000
     tatcctccat attgtcagcc atagcaccgc ttagtgctat ctgagaaggc ttgggatcct     18060
     tattagatcc atatccttct ccaaaggccc caaccatctc cagctcaggc ccggcgataa     18120
     tacgaccctc agtgtcgact acctcgcaca gctcgatcaa actctgccgg cttagagact     18180
     tgaagccatc ggtccggaca acacgtcccc aattggcaag acagaactga gcggcacgac     18240
     gcatcagcca ctgttcgttg gtgcgccctg cacgttccca aatgattgcg gcgttctcta     18300
     catccagttc gcggctaagg cggttgacac aaagtagacg caacttgggc atgtcgtaaa     18360
     gattcgccat gacgagcatt cccgcaacgt cgatgatatc ggaacaaaat tccaggtggc     18420
     cggcgatgct atctgtatac agatagtaga tgaacgcacg cactaccgag tatggctcgg     18480
     gaatgtgcat cctgtttgca tgatattcag ccatctgagc cgaatagagc ctcttgaagt     18540
     ggggccatcg cagctgcaga atgatccggt gcacatgaat cggaggcgaa gtaggtgtgt     18600
     tgggggagag gaaggctggc tctgatcggg aagtgggggt gtccggctca tcgtccgtgt     18660
     caacctgatc atctggatta gcggtaatta taaagtctgc accgctacca gactccggtg     18720
     gttgatcgaa cgctgccgag aggtctgctc ccaaaccgga caaagatccc atccctgttg     18780
     gttcgggtaa cgacgtccgg ctttgactgg gcgaaaacgc ggacaactcg tttcccagta     18840
     agccgtattt ttcaaggtca atgcaaagca cctcgctcat atgattctca tcactagttc     18900
     ccggggtagc accggtgtcg aggctactac caagaagcca cgctttggtg ccgctggcat     18960
     tcacggtgca ataatgccat cgaaagccgg gtttgaagat ttcttgcccg tcagctagcc     19020
     gctgccagcg caaagagtcc agatccagtg atgatagatt gcactcatag gtacgcactg     19080
     tctcggaagg agtaatcaga tccaggagca ctccggatgc ataagcctgg aaatgagtgc     19140
     cagagaacag tgcaggcacg tgagggccag acttgaaccg aagacaggaa atggcgcccg     19200
     gagcgatcgg cttccgacga ttgccattgc gaatttgaac actcccggaa ttcgcagcat     19260
     agctactgga ccggcccgag agctgctgcg ggggactact aaagatagcg tctggactat     19320
     aagtaatcct gctgattggc gctggggaat ccacggtacc ttgcgaagtc gccgctccaa     19380
     gagacggaat gcctttgaga tccagccacc aaatatccgt tgtacgctcc atgtcgggat     19440
     cgaggcctcc aaagatccag aggcggccgc cccaaaccca ggcgatgtgg tcgaaacgag     19500
     ccgtgaatct ccaagagcga gaccaggtcc aggttttaag gtccagatac gacaaatcgt     19560
     cgaggatcac attgttctct ccagttactc ctcccatgat gaaaagcttc tcatcgtgga     19620
     tgacggcggc atgacgagcc cttcctcggg gaatcggtcc atggatttcc ggctgagtcc     19680
     aggtagaggt cgagatgtcc aggatgacaa cgtcagatag atggtcgcgg tgttcatttt     19740
     ctccaccaaa tacaatcaac ttatcacctt ggtagagggt agccgtatga cctacgacaa     19800
     tcgagaggat aaattagtat ggtttgcgta tttcttatcg agaaaagtat tcaaaaaatg     19860
     cggggaagct aacccatgcg gacaccggga atgtctccat agttatcgac tagttcccac     19920
     cgaagagtgt tgagattcaa acgcaagacg tggttgtaaa ctatttcaac gagtagaaag     19980
     cattagtatc agacatagac gatgaacagc atgagaacta agcatatcac cttcatccgt     20040
     gtactgatcg aagccgccga aagcgtagat ctggtcatta ttgcaatacg tcaccgaagc     20100
     attgaccagg caggctggca catggccttg cgccttgcgg atgctcgggc ggtaatccgc     20160
     gctgctacgg cgaccaccac tgagactagg gggcatgagg aatgtggtcg gcggtctctg     20220
     aggggtagag gaggagggat tcatcggatt aggagtcctg gacgacccgg tccaacgcgg     20280
     tgggtcagcg tggaacggtg taaagggcga cgaagcgtta ctattcctgg cggtagtgga     20340
     ggacgatagc cgcgccatta gggtccgaca gtaaagacgg gcccagagga tcaaaaaagt     20400
     agtataacca aaggacaaag atgctgaaaa tgtagataaa acagtagtaa cactcacttc     20460
     tctcacatac tgatgctgat cgcagcgacc ccacgtctct tctcagcggc aagagaacaa     20520
     aaaggaaaat gagaaaagaa aggggcaagt gccaagccga tcgtcgccga aaagggaaga     20580
     gccgcatgtc aggtggcggg ctagccggaa agggactagg gcagccgtac ctccagtaac     20640
     cggcgttgcc atgggtgagc agaactatat cctttattta ctcccttttc ctcctccacc     20700
     cccgtcccct cctcttcctc ctcttcatca tctttcttgt tctttgccgt ttatctgcta     20760
     ctaattgcat accatattgt gtgggattgg tattccctgc ttgcattcaa tactattgta     20820
     tcgcagttag gtcttcttcg tcctgtgtcc aagccagcgt gtgactggga ttggccctgc     20880
     aaacggatct tggaggcatt tctctctcga taccctcccc tatctctcga aaagtaaata     20940
     tatatcagca tggctacacc tacagtatcg actcccgtga agacccacca tgggatcttc     21000
     tccaccaaga cggctggtgg ccgcatgccc cttacacctt caccacgcac tcgcgcagga     21060
     agtgtgacgt caaaccactc ttccccattc acacctccct gtggtgctca agaatcaggc     21120
     aaggagcatg gaaagtccgt ctacggtggt aacctctctt catacttcgc caagtctgtc     21180
     tcgaggacag cccgcaacta ccgcgaatcc cccaagtcca acatcgcccg tgctcgcaca     21240
     cgcaagtctc ccagacacct tgagctgggt gtatcagaat gggccctgac aggcaccggt     21300
     ccatcatcac ggactcctac caaggagcgc ctacgaaaag aggtcgtggg gaaggaagtg     21360
     gccaaggagg tgaccagaaa agaaccgccg aagaaggagg tagtcaagaa ggaggcagtc     21420
     aagaaggagg tgtcgaggaa agaagcgcca agaaaggaga tcaccactcg gaccacgagg     21480
     tcaggaaaga cgaccgtccg cattccccac aacgcgggtg acagattcat tccgaaccgt     21540
     actgccagtg agggtcttgt aactgccggc acagccaagc cagaggaaag ccaacggcca     21600
     aagaccagca gcagtgatgg atcctctgtc cttgccaatg ccgcgagtgc ctttgacatt     21660
     ggtggccgcg gaactgatga agacatcacc gcagctcttg aaagccttgg gctcgaggat     21720
     aacgagccaa cgacctcata caccaagcca gcaccggatg ctgtcgcgta cgagtcatcg     21780
     ttggcagatg cctgtggtgt gaatctgaac actcgcatcc tggccttcaa accgccaccc     21840
     ccagagtcat ccaagcccat tgatctgcgc gctcagtaca accgccctct caagcctgcc     21900
     aaatcccagt cagctcagtt ccgccgacgg gtccaaacgg ctcctgagcg tgttctggac     21960
     gcccctggac ttcttgacga ttactatctc aatttgctgg attggagctc tggcaaccag     22020
     gttgcaattg gcttggagcg caatgtttac gtatggtccg ccgattcagg atcggtcagc     22080
     tgcctactgg agactgcacc cgacacctac gtgagcagtg tgaagtggag tggtgatggc     22140
     gcctacgtcg gtgtcggcct tggaactggt gaagtccaaa tttgggatgt tgaggaagga     22200
     accaagcttc gcagtatgtt tggccatgac tctcgtgtag gtgtcatggg ctggtctaag     22260
     cacacactgt ctaccggtgc ccgcagtggt ctggtattca accatgatgt tcgtattgca     22320
     cagcacaagg ttgctgagct ggtctcgcat acctctgaag tctgtggtct ggaatggaga     22380
     cccgatggtg ctcagctcgc caccggtggt aacgacaatc tggttaacat ctgggatgct     22440
     cgctctctca gcgcgcccaa gttcaccaag accaaccacc gcgctgccgt taaggccctc     22500
     agttggtgcc cctggcagtt gaacctgctt gccactggtg gaggttccta tgaccgccac     22560
     atccacttct ggaacactac cactggtgct cgcaccaaca gcatcgacac cggctcccag     22620
     gtcaccagct tgagatggag caaccactac cgcgagattg ttagctcgag tggattcccc     22680
     gacaactcgt tgagcatctg gagctatccc actctggttc ggaacgttga gattccggcc     22740
     cacgagactc gtgtactgca cagctgtctt agcccagatg ggcaactcct ggccaccgca     22800
     gccgctgacg agagtttgaa gttctggaag atcttcgagc gcaagcctgg aaccaccgct     22860
     gctgcctctc gggagggtgg tgttggcagc aaggctcaga tgaccaaatc catgaccatc     22920
     cggtaaatgg gttggttgtc tttcaactct tctcatcttg ttaattattt tccttcttcg     22980
     atgactatat ttcgggttcg gtatcgtaga ccggttctgt ctagatatca ttggttctat     23040
     cggtgttcat tacattgggg gcacatattc ggatccatgg gatggaaggg gtgttattgg     23100
     taactggcgt ttgtatctag gtttgaccgt ataatagctg tcaggattct tgtatagaaa     23160
     gttgcatact catcactgct cgtcttttcc cgcttgcgtc ttagagggga tagaagctgg     23220
     ccaacccatg acctagtcaa ggctttgcgg ctagcccttc aatagaagtt cgactgaagt     23280
     ggcaagtcag aatcattcaa caacagatcc cattgcagcg catccatttc cggcgccaca     23340
     ttgaagagat cagaccacag ctgaccccag ctattccttc ttgctccgct ccacattggg     23400
     tcctcatctt catgactcga gccatgcatg ctagccgtga aaggaagatg cccgctggcc     23460
     acatttgtca tgttctcatc taccccaaca gaccgtggct gtgatggagc agcgcttgac     23520
     ttcgtcccac ccgatccaga cggcacagaa ccaatatcat tttctttagg tgaccttccc     23580
     tgttgttgca attccctctg agcgtcctga agaatggaca acaacgtctg cgtattcttc     23640
     cgaatcgctt ccatgagcga cgccgacaca ttctgcgatt tctccagcac atggataaca     23700
     tctaacactt cctgcttgcg ggtatctgcg cccggagcag ttgggttcat ggagacgtcc     23760
     gtggctagga ccatggcggc gaagaaaaca tggttcatga caaggctata atctgaggga     23820
     ttgaagccgg agagaacgcc tgtgtcttct agggagtggc ggaggtcgag gacagtttgg     23880
     gcggagcgaa tgcaggttag tcgagagtag gcgaatttgg ggttcgttag gccttctcgg     23940
     tggtaggggc ggtggaggcg gcagaggcgg acgtgaaagc ttagatgggc gacagttcgt     24000
     tgccaggcta ggtagggtcg ctgttgggtt atgtcttggc ttttttggat gctggcgggg     24060
     tcgtttcgga ggaataatgg tagggattgg atgaaggtgt ggaatttgcc gtcgatttcg     24120
     agtagggtct cgtagtcagg ttggtcggat tcgaggagtg tggtgcccag ggtgtcgatg     24180
     atttcgcggc atagttctgc gtagtggatt ctgaagatga atactgacat ggaggtgggg     24240
     actgataggg gaaagctgtg ctctggtcct gtgggcgtta agaactcgtc gtcgatgttg     24300
     cttggatggt ttactttcat gtgttttggg tggatgaggt atgtgccttc ttgtgggctt     24360
     tgcgaaaatg cgctgatcct gtggttgtta gtggttgaga gggatatgaa ggtgaaggag     24420
     gtaaatatta gttaccagtc cgaggagact aggtgccacc atgctcgtcg ctgtacttcg     24480
     acctcgatgg cattgtatcc tgaacgtttc ctttcctctc gcctttgaac tgtgtctagc     24540
     cgatggattt gcatcgatcg agccatgcat atcgcgtcga ctctgagtgc ttgggctttg     24600
     tgggaatacc aatccgcatg gaagagaacg cgggccaagg cactgatggc ttcgagagca     24660
     attgttgatg gcggcactga ttgaattgga ttgtctaata tgcagatagc taaacgcaca     24720
     tatgcagtga aggctgcttt ggcttccgct tgtgttgcgt tgagcaattg cagaagttcg     24780
     ggagttgcaa ccagcacagc cccagcgaag atactgaaaa acagtaccaa gaccgtgggg     24840
     cttggctcct cgccctcgag tatacccctg tatgtttctt ccagtaaatc tcttgtggat     24900
     gggatgtgga agactccgaa tgtcggctgg atgactacgt tgaagtgatc taatagttgg     24960
     cgagcctgag tccaaggggg aagacacctg gataaactgt tcgtatttcg catgtagtca     25020
     tgaagatcag caatgcgtct ttgtgctgaa gctaggggta ataatgtaag cggagtgaca     25080
     catccattgc tcgagccctg tgcctaagga acgctttaga tcttgcaaat gcgaatgttg     25140
     gtagtgaaca catacgccac gtgtgatcaa gctctggttc gtgttgttgc tgccttgggt     25200
     agcagtagca atactaggcg gatctagatc tgcattagaa tgaggtttac gaatccccag     25260
     ccaggccgag tatcatttct gatggttgaa cgggaagatc acaggccccg taacaatggt     25320
     tctaattcgc taggtataac tcaccccggg gcacatggat tcggtcaaaa acagcctctt     25380
     ctagcctggt gacccggctt gatatgtcat tcggatgtct tttcaattgg gtcagtttct     25440
     aattataatg acacacccaa accatggagc ccgcttacaa agcgattgtg gtctggctat     25500
     aagtggatgg tatagttggt gctggctgtt gtgtggagac cgtcgcagca gtgggctgat     25560
     tgccagatag atgagctccc cgcagttcgt ccgaagtatc cgatggaccc tggcctgtat     25620
     actcgcaagg tacctttctc agaacgcaat tcgcacaggg ttgggtacga tcacaccgca     25680
     gcttcttcgc tcgacaaaag cggcatgaga ggggcgggcg agaccatcgt tgcaccatgg     25740
     cctccgggac ggcgtcattt ttccgtttca tatcttatcg ccggcaacat taggttaatg     25800
     ctatagcaac ctagatggct ggagaacaat atgaagtgga gaagacgaac ggtcaaggtt     25860
     cggctgtcaa actccacccg cgccttgccg agattgggta agctccgcag gttggggaga     25920
     accctaagta attgcctgat agggactcac aatctacctt ttttccaatg aggaaagatc     25980
     aaaaggatag agagcttaca tgttttgtgg ccatagttgg tttcgtcact cactgattcg     26040
     ccttttgatt gtctacattt taatctttgg caatccttct ctttagggac ctaaagatga     26100
     aatttctact aaaatgaaat atgaaatctg tacaatcaaa caaataggga ctatagtact     26160
     acactatatg gtaattgtgt tgaattaagg gttgacaagg gttcatgctt tcgaactagt     26220
     agattatcac accccatcca attcgagcat cttcaaagga tgtataacgg tttggagagc     26280
     acgatgttga tctgccattt actgcttctg tatgcgtgcc gataatcatt gaaatagttt     26340
     gcatcaatat tctattcgtc ccatagtgtg cctatgtctg tttggtgact gccacctcct     26400
     ttggcgagtg aatcaagatt attcaggcat ttattatcag ttcttgagca gcagagacat     26460
     agaagtgtga tgttcgaatc tcgataagct gtgtccgaac gtaatcgtga attgataact     26520
     tgcaattaga gggatccttg gtgtgagaac acaaggtact ctatattttc ctattactgg     26580
     gttatatgaa gtctcaagct tcacaaagtc agacggtaac acccgagtcc cttacacaga     26640
     ggaagaaaga ggaatgggat tcttgcgcag aattatttac tttgcttcct ggcaaagtcc     26700
     gttcttatag ggaacttttc tgctttctct taacgcttcc cgtagccttt catagaaatt     26760
     caaaacttat ttattcactt gccagccacc ggcttgtgag cgtgacagat cttatttcgg     26820
     taccttacgt gagtcgaaga agctctgagt gaggttctct ctttgtgtag tactctacag     26880
     taaggaagtc ggataagacg agattagatt gtcatgaggc ttgcatgagc tgggcggaaa     26940
     accaagaacg tgatttgtcg cacaaccacg cggctgagcg gctgacagat ggtggatgat     27000
     tctggggtct aaaccacgat aactggcaaa ccaagggata agttgaagtg gcgaggagat     27060
     actggagatc tgaaagtcaa aaagtcaaag agcagctctt gcgtcgcgcc ggggcagatc     27120
     ccccggacct cccactaggg actagcggtg gtggtgacta agcaggcggg aggaaggcgg     27180
     atttcgcccg gagagagcga ctttcacctc aaccacatcc ctccggcacg cctgccttgc     27240
     tttcactctc ccttccggca ttcacccggc attctacggc tcgtcacgcg ctgagacctt     27300
     taatattgag ttcttgaagt aagaaagacc atctacagaa gcagtgcaag ttcgagggtg     27360
     gtcggaagta gtggttgtgg agactcaact gtcgcattcg cccgtggcaa gcgaccgctg     27420
     cgacggcgag gctttacctg tgataagccc gacaacacca ttcacgtcga gctctcgcgt     27480
     gttaataggc ccctgttctt ttttctactt ccttagaaga cagagcaaat ttatttgacc     27540
     ccaacttcat taaaattccc ttcacctggc ttgacaaagc gtcttctcgt ccttgtctga     27600
     tcccagcagc gatcatgtcg aaccagcagg tggtgagtgc atctttaaaa acacaaacct     27660
     tgccagagct agagacttcg atgggcctgg actgtggctc aatactccct gcgaagttct     27720
     ctatttcccc gctctaaccc catcatgata ccatgtgaga tgttggctta taccagttat     27780
     ccctagggca cggtgttcga tcgtgtcatc caggaggtct gtgatggctc ccaggtggac     27840
     ttcgaggaaa gtggtgtgga ccagcaaaca ctgttagatt tgcgcaaggt tagtgctcca     27900
     tcaacatcca tcttcctttg ttggagagat ctctttgagg tcaaaagaag tcgatatgct     27960
     tggggggtga gagccccagg gggagacgcc ccaagcgggg tccgagaggt gcgggaaggg     28020
     cggccgcctg ggggcatcgc ctgcttttga gtctcttttt ataccgcgcc gcttttaccc     28080
     gccctagtcg gcctgccaag ccgcttcagc atcgtcattc gctgcccgtt tccccttcac     28140
     ctctcggtct cagatttcct tatacttatc gcttgaccct ttggctcctt gctccattca     28200
     tatatttctt ttaattaaaa cctttcagtc tgctaatatt tcccctccag agctggcaga     28260
     agaagctctc ctcattgggt gtcgctcact tcccttggga tccgccgccg ccgcaaccgg     28320
     ctccccctca gacgcaaaat atcctccctc ctacagcaac tgtaccatca aatgctcccc     28380
     ggcctggtcc gccccctcag ccacagcatc atgttcctcc tccacctctg cagcaaccca     28440
     ttcctcagtc cgcccccgct acggcacctc cgctccaagc tcctactcca gttggggccg     28500
     gccccaatgc catgggtcaa caacaacctc acatcaagac cgaacctggc gtcaacggtc     28560
     aaccggggat gattccgatg aataatatga tgatgccaaa ctcctccaac cctcagtctg     28620
     ctcaagaacg ggctgccaat atgcttcgtc agcgttacgg cgcagcagcc gctaactcgg     28680
     tcagtcagct gcaagcacag tcacaggcac aagcagccat ggccatgccg ggccagcagc     28740
     gcccccaacc catgcagcat gtgcccaacg gacaggctcc acagatcaag caagaaccgg     28800
     gttacccccc tgtgtctcaa ccccccgtcg gcaatactca aacggacggt gccggtgatg     28860
     atgccttgtc tgcatggaag gctgaggttg cacggaggcg ggaagctgct gaacgccagg     28920
     gaggagaagg cgatcgtctc cttcgtgaac atctcagaca acggatgctc caattagaag     28980
     gcggtggtct gatgttgcct ctcgacgagc atgactactc atcaaagaca ttgactcgtg     29040
     ggctggtggc tacccaagca gagccagctg aggtatcaga agttgctggc tcctcgttgc     29100
     atccgcccaa ggttctcgga gctcagtttg acggtcccgg tggtgatgat gaaagggatg     29160
     aggatgatga agatgctatc aactcggacc ttgacgaccc tgatgacctt gttgctgagg     29220
     atcatgatgc tgaagatgcc gtaggccagg tcatgctttg cacttacgac aaggtacaac     29280
     gcgtgaagaa caagtggaag tgcacactta aagatggtat tttgaccacc ggtggcaagg     29340
     agtaagtgcc ctcttttcat taaccccata tccaatctcc cgctaacgag ttgacaggta     29400
     cgtcttccac aaaggtcaag gagagttcga gtggtaaatg ggcgtaagcg tcacccattt     29460
     gctccggata atcccagatc gtgtattttc ttctccatac ctcttcttca tctgttctac     29520
     tggcctcgtt ttcgatcccc cattatactc agcatgtaaa aatcccagat ttgactcagg     29580
     attctatgag caacgaaacc catatctggc tcctttttct tcttccaact atgtctggat     29640
     ggtcggtgca agcggaaatt tgcctcaaat gacgatttga ttttcacgaa gtaaacaaac     29700
     aacaccggga ctcctgtttt cttatttttt tttgtcattg attaagattc ttttccctca     29760
     tactctttgc ttcttcccca cattggatgt atgtggcgct tatgaggtgg acggcggttc     29820
     cttttcagtc taagctgtac tagagtaaca tatctgaatt gaatgaaaca gattgttttc     29880
     tagtttctgg atcacacact cgtctagaat aacgagcagc cgaataatgt aaccaaagat     29940
     catcttgtac cattaatgag ccagattaat cgatcacgtg tggcccttgc tactccaaat     30000
     cccatgctac ttactggtga cgtggctagc ctaagttcag caatgagata ctactagtcc     30060
     cattaactgt ccatacatca gtcaattagt atgacaaccc aaggaactca atctcccagg     30120
     tatcactaaa ttttaccaga atactgcagc ccaaacctac tatcatcttt ttagcttaaa     30180
     aatcaattac agtatattaa taatcaaatc agctacccaa tctagtcgac tatcaagcga     30240
     gcatatccga gagctaatga ttgatatgga gtgaaattgg ttcatgttca gacttttttg     30300
     gtatgaagaa aggagccctt tttccgcaag caaacaacat taaatcaatc cttcaatcga     30360
     aacgggaatc tcaaaagagc aggcaggcaa aacaagcaac aagaacatag cgagtaaaaa     30420
     gctctatcag caactcagcc agtcagttcg aaagtcccat gtttctccaa caacaccaac     30480
     aacacaccac aggcaaataa gaacaagaga cgcaaaaacg aaggaagtaa tgatagcaaa     30540
     gaaaaggaaa gggaagaaaa tgacacaaga cacgcagtgt aagaaccaga agccggtctg     30600
     aaaaaggaga aaacattatc tacagaacta agtgacgcca gagtaccacc agtagttact     30660
     tttttttcct ggtctttcct tgtctccaag ctgcgaaacc tcattgtgcc agagaaaggc     30720
     aaagaacaac aaccaccgcg ttgctccaac tttgcatatc cagtagaaac ccttgcgcta     30780
     aaaaattgct tttcgttctt tttttcaaat ccaaagtcgt cctatcatcc catcgcaacc     30840
     gtactccaga ttctgtttct gcagggcatg acaagccttt gagaaagttc tgattagatg     30900
     actcggtatc gtggatcgcg aaggagccta gcaatggaga cgtgacaatg gaagacgaca     30960
     taagcaaccc ccaactctct gttttgatcc cgaatacaca tgaccgtgaa agctaagcaa     31020
     atgccagggg caagcaaaag aaaccagaga atccaccgcc gatacgtcta tcggctaatg     31080
     agtcgtggaa gatcttcttc aaagtcttga aaggactgat ttattaccag accaaagcac     31140
     ggtcgtccca aaccgcgatt gacatgacgt tcataccatt aactccaagc caccaaacct     31200
     atcattaaat cgtattccgc gcgacgaagc cgtcaaaaat cgtcgtcgaa ttagtgtggg     31260
     aataatgatg cgtaaaattg aattgcatgt cgttcgtgat atggggacct tataaaagac     31320
     cctcttcacc gatgccaggt aggccagccc cagcaacgtt gatgttctgc ccttgcatga     31380
     cgcctccacc aaaagccaag ttcctgcctg cagcaagctg gaagtcagga ttgcatggcg     31440
     gcgagtgcga cttgtgatat ttaagaccat tcaggttctt ataacgcttg ccacagacct     31500
     cgcagcggta gggcttctcc ttctccatac caagtgttcc aggatatgga gttgaggtct     31560
     cgggattgac gatggaaaag gtgccgtctg cgttgtcatg aagctgctgg ttattgtggc     31620
     cgtgctagga aacagttaga aaagctaagt ggtttggttc gaaagactta cagctttgtg     31680
     gtatttcaga ccattctggt tcttatacgc cttctcgcag ccaatgactg ggcaccggaa     31740
     aggcttaggt tcctcgttgg gaaggagagc agtggtatca ggaacacctg ccaacaactg     31800
     ttgctctcgg atgcgtcgag cgatctcact gttgggacca tactgtgctc cacttagctt     31860
     gaagtgagcg ttgggagtgt taattccgcc ggtggggcta aacaaccgtt tggctggttc     31920
     gtcgatacac aagtctacca tatcgttgtt gttcccagcg aaccttccaa actgagactg     31980
     gccctgcatc attgggtttt gcatagccag atctccgaag ccaccaagca tgctgtcatc     32040
     gagttctgcc ggcgtcccag gtgcagacga gtctggtgtg gtccggaact gtgagttctg     32100
     tagagggttc gccatcaaag taggagtatt gacggaagaa actgttgggt tgttctgcag     32160
     cgatagaggg cgcccagaag caacgggagt accgggctga gagcctttga acccttggtg     32220
     tcctggaagc atagatagat tcagatgcgg aaccctttgg ttggcactgc caaaacctcc     32280
     ttggcctcca tcacgcgact gaggcgcgaa cagctgtgca gtggcggcat cgtggtcacc     32340
     catcggctca tcgagttcca tgtcatcaat ggtatccata tccgaatgct gctgagtgtg     32400
     agggacctga ctcagtttcc gctgcaagtc cagagtccta tctggttgca atccacggcc     32460
     ttgattattg ttttgctgac cctgttgctg ctgcgccatc gccaccgcag ccagggccgc     32520
     tctactgtcg ccttgactgg gacggtggcc ctgctgaggt gacttggtgg cgtgagcttc     32580
     ttcatagtgc tgcaaaagat cgtgaagcgt cggaagggtc accccacaac aattgaagtc     32640
     gcgcatgaag tttgcctcca gcttgggtaa atatgaggat gaatgaaatg acggtgactg     32700
     gaaagtgaac ggagatgtgc cggtcatgat tatgctagat gattcatcgt cagcttccag     32760
     tggccaaagc acttgcgcga tcaggggaaa ccgaaatgat tcccataagg acaaaggaca     32820
     ctcactcatc gcgaatccaa ctgccaacag acacaccacc ccagctcatt ccaccaacta     32880
     aacttcctgc caaagactca cggcggcctt tatcgcggtt ggagccggac attgagatgg     32940
     gcttcgttcc gttgccccat tgtgcagtag ctgcaccgat cgagtccttg cgaggaggcg     33000
     gggccttgaa gacgctgaga ccaacaccat ttgcatggga tagactgcct gtccgttctc     33060
     cattaccagc tctctgcaga gcagacgtca gattcgacgc ctgctgtccg ggaggagaaa     33120
     cggaactctg gcgggtggca atgtcgatcg gagcggctgc accggtcatg gtgttggttt     33180
     gtatggggga ggaaggaaag agagggaagt cgagatctga atcagagtga gagtgtagtt     33240
     gctggctgta aaagtacggt gaggacgtgt cgccgccgat gtcgagtgaa tttcgagtga     33300
     acgaggaatc cgagagcttt tccctatccg gtctgcgcaa cggtacgcca aacccgaggg     33360
     gagtggtgac gggggtcgag tccctagtag aggcgcaatc gaggtccccg atagagggag     33420
     agtaatgaag agagggagga ggaggactat gcgtcgcttc tgacgacccg agcattaagg     33480
     aacgattcca cgacggcggt tttgggcggg atcacacaag gagtgtccac caccctcgga     33540
     tgttgtcccg ctttggctgc ggaactgtga cggattcggg aaaggtggcg ggacgtaacg     33600
     ataatacttc gtcgatgcag tcacgaaagg caagaaaaca aattcaaaga tgcagagaaa     33660
     gaaggtagtc acaacagtag tagatggcga tgatgagaag ttgatgatgg tgtaaaagag     33720
     tatgatgaat atgggcgatg gttaatgggg gagggtgtgg gcaacacgca cacacacacg     33780
     aggaacaaca cccaatttca ccgacagcag cgaagtcagg aagcccagca actggcggca     33840
     agcagcaacg accggaaagg tccaggtaat aatgactaga ggagtgactg gacctggggg     33900
     ggcaattcac ggcaccacct tcactaccag gatgactctc aaacattacc gttttattac     33960
     gccccaatct ggtcaagtcc gtccatgacc taaattacgg tacatcccgg acgaggcccg     34020
     cacttgtctg gattgggtaa gaaagacact tagtcatggt atggctgggg ccacccataa     34080
     ctatttccag gcaatcagag ctgcccagca tctgcccagt gcccaacgac gaatcttctt     34140
     gcgacttact attacgtatg aggagggcgg aggatccatg ggaggtttcg accactgact     34200
     ccagtggcca gcacagcttc tggttcccta cggcttctag caggtgggcc ccctttagta     34260
     gcaatgaact tgacaccgct tgcagtctag tcgagtcact agcgcttctt cgaaaagtcg     34320
     atgatgatga cggcggtgga ctggtgtgta gctactgctg caggagatcc agaggggcgt     34380
     cacccttgta tcgtgcgtta tgtatgaaat cgtattaccg gggagtggtc cccgctccag     34440
     ttcccggtct ctgtattatt acggatctgg acctactttt ggtggtgcta ctcgctagta     34500
     gtcactacta tactagcaag tcaaccagct cattcacctg cgtcgtcctt gcaacgtcca     34560
     catatcccac tatcgttttg tctgtccgtg cggatatgct ttctcaattt cgggctcatc     34620
     cgctcttcag aatatttaga cgactcgacc cttccagaaa acaatatgct tgtgcaacat     34680
     tgtaactctt ctcggagcct tgaatgtctc gtactaccct cagtgagcac gctacctacc     34740
     catggttcac atgcgcacta tatcctggct gagatccctc cggggacttg cagcctatga     34800
     aagtactctc acactctgaa gttatccgat ggaccggtcc tagaacctgg atccttcaat     34860
     ccggcggtgt caataagggt ccaaagcttg tcatgccaca ccaagccagg tgcgtcggct     34920
     aggcagtcca accaacgcaa cccccacaga atctgaaatt cagtactcaa cacgggatct     34980
     tgatattcag gaacttctgc ggtggaggta gaccggaaaa tggaggttca ggcgcaatcg     35040
     ctgcaaagtt caacgtgcgt ttactatcag gggctacaat gctttctatt gtgctattgg     35100
     agggcctggc tggtgtttaa cattggctac cttcttatcg ttcgcatcgg acattccacg     35160
     acatccgtct atgctccgcg ataccctctt cagtaagccc cgatctctag tatgcccgag     35220
     tcagtaccga tatgacgata agcacgaagc acggccactt atcgctcctt ttcagcactg     35280
     gccatatatc aatgacatca atagtatagc agcctcactt gtaaacgaac gaggcaaatg     35340
     ggcggtctgt atgaacgttt cttatacaaa agtactgata gatcggtgta tcaaagagca     35400
     aaccctccct acttggacgc taaaatggcc tagcagtatt aacatacaca ccgttctccc     35460
     gctcagcatg gtctgctgat agaccagatc gcctggtatt ggttgggagg tgagagatcg     35520
     caggaatggg accaagcccc ttttcctccg ggtgccgatc gccgcgaaat tcggggagga     35580
     tgagttctca ttcattctga tcatgcaatt agtctagggc atattctggg ggttagttct     35640
     tggctccaac actagaagca ctgaagaagc atttctaatg gttagcggca attttgcgtc     35700
     tttcaccgca ttatcggtcg agtgactttc cttttcgggt gcaagtgctg accatgcaac     35760
     gatgatgaac agactctcct gctggattga tataactaaa caagccaata tcaactaccc     35820
     agtttaggtt acagacaaca gggattgttg tgtgttctct aatctcatac tcatctgggc     35880
     aagctgaacc gatgctccgg ctctactggt cccctacccc tgtcaagcgc catccgtttg     35940
     tttcatccat gtctcaaccc tcgaatacct cggctgcgtt ttaccgaacc taatttgagt     36000
     caagtgaggc gcctgtatcc accaggtatt atcccgaaga ctccgcgtgt acgctacaac     36060
     gtatataccg cttttcggag tattgctgcc atccgcactc tgatcaataa gcattcctac     36120
     agtagtagtc accttacagc cgctactcta atcaggcacc tgcattctgg gatgactggg     36180
     agacacaagt gacggatccc atacatggtc gattatgtac atgaattagt agtactcccc     36240
     ttacatacac ggtactactc acagcacatg atgcctaatg aactatcccg aagcaccaat     36300
     atcttcaaat aatctacgca tctatgtcgt acagttgcgt aagcttacaa gagccataac     36360
     ttcccagaaa taccaatata tatacgtact gctcagcaat aaatagaacc aatttgccac     36420
     ccttacattt ccaagtccac ggttcctgga atgccacatg tgcttttgtc ccttgatgtg     36480
     gataccatga tccatccact ttacaacgaa ccgcaatgca accccttcaa cctgtacctg     36540
     cctcatgcag attatactgc agcaacccat acgcataata tccacccatc caaatgcaaa     36600
     aaaaaggggg gaagccagta tgcagcatac gtaaatagca ctgagaaatc gctcaaggcc     36660
     ataaacaacc aaccccatag ttatgcactg gactatcact gcagtggaag tagacgcatc     36720
     acgacgttcc tctccccccg gacttcatcc cgtaaggtca ggcttacaca acagacgatt     36780
     ttaatgtaca tgtaacatga tgcatggggg agggtagtta atcctcatca ggacataaca     36840
     gatcagcagg tacaagcgct aagcagagtg actaaaagta agaggcgcag gagatcttcg     36900
     catcgtttcg agattgccca atgctagagg cgtattcgta gtcctgtgac cttcttgcca     36960
     aggtggaatt gactttccgg gttgttactg aagtttaagg agatgattag tactgtagta     37020
     gtggtgaacg tgatggaggt gttgaatggt cgccagtcgg atatatctcc gatgtagtat     37080
     ttgtcttgaa tacttttgta ggaagttctt gtcttccaga tgtattaatg atccttgcca     37140
     ctgtggtgga ggcatatccc acagtcgtcg taacattcga caagtacgat cgatcacagt     37200
     gatgggcgga gcgacagcat acggagacta tgccttgatt ggaatcctga tggtgggtag     37260
     gctcgatgcg agaccgacgg cgtttgctaa gctagtcaac gacaggtggt tgactttctc     37320
     agcattgatc tacccccccc catcaaacgg gtcgtttaag ttcttctaga aacccagaaa     37380
     atgtgagcat tgcaagacta ggttcaactt cggtggggct cttgttcagt atgtaaagta     37440
     agattacgct agtgtgttcg acatttgtaa tggatggggg agaaggaggt tgcccggtaa     37500
     ggcgacggca aaggatcgct tccgttttac cgcgtgtacc gcccatcgta acagcacctc     37560
     agggattggc tgtcaaaaca acagttgccc gcgggtccgc accgccacga agtactggta     37620
     agcaacgccc tgaccgcctc cgtaccgcca cgctggaact gccgtgaacg ccactgccag     37680
     tgcaaacctt acaaactgca cccctcgaaa tttttgcccg cattagattg attgcggaga     37740
     ttcttgagga ccgaccggca tctttttgga ttcgaaaagg gtctggatca caagacgcgc     37800
     tgattctagc ccaattgtcg cattgcgcag tccagttcct ttggtaattc ggtagtcatt     37860
     tccttccttt ctctcgagga aagcgactgt tcacaatgga gccgacaacc gctcaggaac     37920
     agctgcccgc tccagaacag ctgcccgctc cagaggctaa tgcgcccaag cgtgatccgg     37980
     agaatggcga tgccgctgca gaccaccagg cccaggagcc accctcgaag aaagccagac     38040
     tcgatgattc ggcggattct aacggacaga cggctgatgc gcccgccccg cgtatgaagg     38100
     gcgttgctcc tatcaagccc gagtatgtga ttgatctaaa tctgtttgcg atgcgcccgc     38160
     tctaaccgac ttcctctgct aggtttatta tcgaccaaca acccacgaga ggccagaccg     38220
     cttccgatgc caatgctgac gatgctgcgg aagctgcaca ccacgacggg cgcgccgatg     38280
     agcagaatgg aaagaagaaa aagaagaaga ctggtcagaa tacgaaccgc acgtttggtc     38340
     gatccgagga tgcgaaagga ttgtgctcta gtgtcaactt caggcctgaa ttctctcctg     38400
     ccgagtgcac tttcggtgaa aagtgtcggt acgagcatga cctgcgcaca tacttgaagg     38460
     agcataagcg ggaagatctt acgacgttca atggcatgtg tcctgtctgg gatgtccacg     38520
     gaaagtgctt cgtgggctgg aaatgtcgtt ttgtcggttc acactcggag gagcgagaga     38580
     ctgccgatgg aaggaaagag ttggttctta ttgaggatga ggagcgcaag aagaaggttc     38640
     agcggcttgt tccctttgct ggagaggatg gggctgtgaa tgttgcttcg atggaggata     38700
     agattgcctt ggcgaggagg aagatggact tcccaagagc tgggccgtat agtgcttggc     38760
     tggaaaacac atccaggacc attgagaagg agctccacaa acggcatcgt gctgcgcccg     38820
     taggagctga aaccaaggat ggagagtcta aggatgcaga atctaaggat gcagatagca     38880
     aggacgaaaa ggaggagaac cgggctatgt acgttgagcc gccattcatg ccatcagaga     38940
     agcgccgact gtactttgga cccgaaacac cggcactggc gcctttgact acccaaggca     39000
     atatgccttt ccgaagactt tgtgtcgagc ttggcgcaca atttacctat tctgagatgg     39060
     ccatgagctt gcccttgatc cagggtaaca agtcggagtg ggccttaatg cgagcccatg     39120
     agtcggagat gctccctccc acgatgctgc ccggggcaga catcgtgcag ggctatgaca     39180
     actccaagga catgaagttt ggtgctcaga ttgcagcaaa caagccctgg caggcgttca     39240
     aggctacaga ggcgctggct aaagttactc caaacctgcg tgtcatcgat ctgaactgtg     39300
     gctgcccgat tgacctcgtc ttcaaggatg gtgctggctc tgctcttctg gagcacccgt     39360
     cgaagctcga gaagatcatt cgtggcatga acactgtttc ggatcagatt cctatcacgg     39420
     tcaagatccg tatgggaacg aaggacaaca atccgaacgc cttgaaactg acggagcgtt     39480
     tgctgcttgg gggctacgaa accagtctgc ttcatcacga cggcgccgca ggtgcagcgg     39540
     ctatcactct tcacggccgt agcagacagc agcgttacac cagacaagct gattgggaat     39600
     acatctccga atgtgccgcc ttgatcaagc gcctgaacga gaagactgac gcggtgacgg     39660
     ataccatccg ggagcctgac gcccgtacgc agccaaacgg cgggaaggtt tacttcctgg     39720
     gtaacggtga ctgctactct catgttgact acgataacca catcaacaat gctggcgttg     39780
     atgctgttat gcttggtcgc ggtcctctga tcaagccttg gctgttcgag gaaattcagg     39840
     cgggccagta ccttgacaag tctgctacgg aacgtttggc aatgattgag aagttctgta     39900
     agtatggtct ggaggcatgg ggatccgatg agcacggtgt tggtacgact agacgcttct     39960
     tgatggaatg gctgagcttc actcgtcgct atgtacctat cgggttgctc gagcatcttc     40020
     ccccctacat caacgaccgg cccccggctt tcagaggccg gaatgagctt gagacactgc     40080
     tggccagtgc caactacaag gattggctca agatctcgta agtaccttct cctgaccggc     40140
     tcactctttc gaactcattc taacagcctt ctagggagat gttcctcgga ccggctcata     40200
     aggacttcaa gttcgagccc aagcacaagt ccaactcgta tgacgaagcg gagggttaaa     40260
     cacacgctgt ctagattagg attaacgcat agagacgatg tacataccac agctagcaat     40320
     catatgcaat gagaactaca cactttagat aaaccctgtt gctatgacgt agacggtagg     40380
     ctgagccgcg gtcgatagag tcacgtgcac gatcacagct ccgggcggta atgacgtctt     40440
     cctctcacca gaaactgcaa aaagaccacc tcatctcctg aactgcccaa ccgctgctct     40500
     gttctggcac tgttcatgcc agtatattag ctaggagtac ttctttgata aacattgtcc     40560
     gccttacgcc tgatcgatcc ttcaggtttt tcaactcctc ttgcgtgtta cctcgcacct     40620
     ttgtttatct ttgcaaaaca aaccccacaa ccactgctgg atatccagcc agacttgcat     40680
     tttgaagcat ctgccggaag tttattgaac tacaacatta gacaatatga cgctttacta     40740
     cagcctcgta cgtaccgcca tttgttgttg actctcctcg caatggcatg gagttcggga     40800
     ttgttgcagc ctgccgcctg cagcccctga cccgcgcact cccggatcat cagataatat     40860
     gtcgcatcag catgtgctta caatatggta ataggttttc tgcctcttgg tgtttgagat     40920
     ggcggtcttc atgggcctca tcatccctct tccattcacc gtgaagagga agctcttcgc     40980
     tttcatttcg gaaagtccga tagtagctaa attacaatat ggattaaagg tatgctatta     41040
     aacattgtct aacatttgca atcactcatc aagctataga tcacattcat ctttatcctc     41100
     atcctcttca tcgatagtgt caaccgcgta taccgtgtgc agctggagct ggcttccttc     41160
     ggcaaagagg gaggcaccat ggggtatgct tccgacgatc caggcccttt ttagcattgc     41220
     actgaaacag ttactgacct agctttcgcc acagagccgc cgctctcggt accgatcgca     41280
     tggaagtcca agcccggaag ttctactcgc agcgcaacat gtacctctgt ggattcaccc     41340
     tcttcctgtc tcttatcctc aatcgcactt acaccatgat ccttgacgtc ctccgtcttg     41400
     aggacagagt cagactcctt gagggtgaca agaaggctgg cggtaaggac tccgctcgtc     41460
     ttgcgcaggc cggtgaaatc ggtgaaatcg gccgtctgaa ggaggagctt gcagccaagg     41520
     accgtgacat tgagaccctg aagaagcagt gtgagggtct cacccgcgaa tatcacaagc     41580
     ttggtgatca ggtgtctggt gagaaggatg aggctcccaa gaaggaccag tagacgtctc     41640
     ttgggtgtgc cgcgagaaat acaatcgtga gcttgttagg ccagtcggga ctgtgaattg     41700
     atcgctcttt ggggctgatt gattgtacat cacgccgtct gcaagctact ctcttatgtg     41760
     catttcggtt accatatcta tcgggtctgg atgaggcgga atgttgacaa caaccgcctg     41820
     ttggtcggat gaaccagctg ttatcttgaa gcgcattggt ggagtggatc atactggtgc     41880
     agttttcggg aaagaagttg tcattgcaaa acttaggatt atctgggtca tctgggttat     41940
     cacttacaat ggagcaaaaa taccatcgtc taaatcaaaa tgtaggcatt cggtaaacac     42000
     aagagcgata catccacaga tacaaacata cgccattgcc aacatttgaa aaatacagta     42060
     gtcaataact ctcagatcaa aacccaatgt agaaagaggg acaacgatca cagtcgaagc     42120
     acctgcttgc ggttccatcg ttcctctttg accaacaccg cagtttactc acaacaacaa     42180
     caaccaccac caccaaagtt aggattctca cactcaatac gactcccaag tacaaggtcc     42240
     aagaaccgaa atcttcttct actcacttca acatttcttg aatctccatc cttcttaccc     42300
     tgaagagcaa taacagctgc tactataccc gaaaaccatt tacaacctct caccctgact     42360
     cctcatggcg atcagacaag tcccacctta gcaaagaatt acgagtgctt tgtctacatc     42420
     gtacaatagc taccagctaa gccattaatc cctcattgtt ttcatcaatt ttcgtcagct     42480
     aacctgctca taatgctaga gacagtcagg taaacaccag ctgacaggcg cccccaccca     42540
     ccaacttaaa gggatcaacc gctgacgaga gacgaagaga acgagaatga aaggaatgag     42600
     caagcgaggg agtgaagaaa atccactggt tcccgcccta ctcttcccgc ctggggccgt     42660
     tccgaggggt gtgggcctgt cacaaggatc atgaggtttg gtttgcagag ttcggttggc     42720
     ttcatgtcag ctaacttggc atgaccagat aactatgtgt cttagactag gaaatggact     42780
     aatggaactg tagccaatgc cggctgtctg tttcattcaa ttcatggtga gatggatagc     42840
     tatggatttg ttgtacttgt ggaggggtgg tcatcagatc tttcctgtgt ggaacttgga     42900
     attcgcttgg ctggcctgct actaccaagt ataaggtagt agtgaggaat tacttacatt     42960
     gacagctacg tcacgaggaa caagggggtg gcgacaagag cagtcagttg ttaagataat     43020
     tggcaggtat gacagagatg cgcgtggggt ctgacaggaa ggatttgtgc caggaacgct     43080
     ttcccgcaag cgatgaggtt tgtggctaca ttgcccctga aggaagttta ggcatgattc     43140
     ttcaatcgct agggaggaga gatgcatgcg ctaaattgga tattaaacac tgcagtctta     43200
     gtgcctgttt ctgacaaatc ggtgggttcg aggcggtctg gagcacacgg taggactcaa     43260
     atagtcgatc aaaccctaaa tcctcacggg tttagaccaa tgcgagttga caatgttctt     43320
     ccgcggccca tatctacagc acaactagac caggaatgtc cagaaactag gatagacgag     43380
     ctcctcctcg aatatccgcc gcacctgtgc gagcacaaac cgttccactt tgccgacgtt     43440
     cttgaggact tgtttgccat cttctttccg accaatctca ctctcaactc ggatttcttg     43500
     cagcagtcca ccctgtcgct ttgcagagac ggtcgcatcc ccgccagagc gtgaatactc     43560
     ggtttgagca ccgacgtccg gctgatcaga cccaatcagc gcgtccgcat cttcggatga     43620
     caggaagcag aagtggaccc gcttgcggat gtacgcgacc actgcaacac catcaaacgt     43680
     gatccctgtg acatttagtt tcaagggtag tcccacgaaa ctgggcatag gatagtccag     43740
     aagaatttcc gctgtcaatg acagccgcac atcacccgcg tatttggcgt gacacagtac     43800
     ttgaaaatcc tcgggccggc gctctctcat tcgaggaaat cgcagtggct cttccgaagt     43860
     agggtcatct aaatgtccat gctcttcggg gtgtgatcca tggtcaggac cgcctgctcc     43920
     atcaccatta tttttattgg acccggatgg atgagaaggt aacgtgcttg atgttgatgg     43980
     gcgcgaagtc ggattactgc tgtcaatgtc ggcttccgga cgcgattggt gggcagtaaa     44040
     aattggaggc ggtggacgcc ccctattacc agggcccatc atcccagaat cattccatcc     44100
     gcctgcgaac ggagatccgc ctgcaactgc agcaaggggt gtctgcgtcc ctgaaagccc     44160
     accaagtgac atcagatggt agcctagggt cgatgtacct ccgggtatac caggagtgcc     44220
     ggagcggaaa tgcggattga gatggtcgct aagagctatg ggagatcgca aggccgaggg     44280
     ctggaagcct tcggtaaaag gatcacgcag cgaatgattt attgcattat cgtcgcggaa     44340
     agatgattca ttgagctctg gatgagtccc atgccacggt gaaccatgcc tggagacaag     44400
     tccctcagat acatcggacg cttcatcgtc ttcatcttct tcatagaagt cggcgaacgg     44460
     ttcgcaaagg tccttgatct cgagctcagg cgggatcgtc ccgaagtcga aagagtggac     44520
     ttgtactgat cggataaagc gtggcagagc aacctgctgg aacttgtcat gaataaaaga     44580
     gcggatgcgc tcggccagag cctctccgtc gggaccggaa gttgcggcgc cccagtcaac     44640
     ttctatggac attacatgtg caaaacggcc ttctatccgt gggtgatgac agagaaagga     44700
     aaggaaagga ttcgagaatt gattctagaa gcctgggaaa agaacctgaa acaaagtgaa     44760
     caccaggccg attagctttt cagaccattc ttgtcggtga cgtcgagaat cggagagtcg     44820
     gagttggcgc ttgtttttgt cgcgcttcgg cggttcttgc agctggtgcg cgtcacgtga     44880
     gatcgcgaca acgtgaccgc catcaatgcc ccaacgacaa tccaatgcta ccacaatgcc     44940
     ttctttcggc ctccaacggt cacaatggag tctgacagtg accagagtta aaagctggct     45000
     tccctaggac tttcaaatga ccctggtata agttttggtt ggcctgagcg gcgcagtcgg     45060
     tgcccacacc gctttaggtt tactgtccca gcattctggt tccccaggtc cctcccgccc     45120
     atcgccggtc taagggtgat ggcacagctc tgcggcgctg ttctgagcat tactcaagcg     45180
     gtgtacactg gcagcgcacg cctgctgctc caggggtcgc tctgggaccg ccgtacaaca     45240
     atactgtgac caacaagtgc tattcatcgg cgcggctcaa tcacgactga gctaggctat     45300
     ctgggaccca acactggcga gtctagtacc agctactatt ggcctgctag ggggtttccc     45360
     ctctatagaa gggatgaaca ggtaaacctg gcttgctaat aacccctctc ttgtaacttt     45420
     ttaaactttt acccccggta tctgcctcga ggcctgaccg ggtttaacaa cctgttaatt     45480
     caccccccaa agccgatcca aagtgccgta tggcccgcgt ttctcagaaa cagagcagcc     45540
     gataacacat gaagacgcga aggggggtac gccacacaac actgatttct catgtggtcg     45600
     gaacattgct ccagaaaccg tacaaccccg tcactttgac gctgtgttct tcctttccac     45660
     gccagcgaag ccggagaaaa agaggggcac agctacactg cattcaaatt ttcaagcatt     45720
     gtcgttggac acagcaaccc cgacctagcg cctggcaggc cccagttgca ctgggttttc     45780
     acttttcaga atccccgata tacgcgcgga gttcctaccc ttactggctc cgggaacccc     45840
     catccatcgg cgagactcgt tggcaccagt cagcatctct tgccaccaga caactcgcgt     45900
     ctgtgccccg tttactgcac ctgatttgcc cgttggacat caggtgataa aaagcgtatg     45960
     cggtgctaat gcagccggtg atgtgcggtg ctaatcaggg tcgaagagaa ttttctcgtt     46020
     agttggtccc ccctctcgtg tagggtagga ggacccattg gagcctatct gcattccgcg     46080
     tacgcacaca cacaaatttg cggccgacct ttttttttcc cctagacccc taacgatgaa     46140
     aagcgtagtt gaaaactgta atgcgaaatg gaagaggagg aagaactaac accatttgca     46200
     cctagtatct ccgagagtac tccgggattc ttcctcaccc actgttgatg gtttgcgcgg     46260
     caaaggtaac catcgatgtg gaggatttcc ccatccatcc tgttgactcg cgccacgagg     46320
     aagtagggcg acaaaggcag cagtggtgga ggatttgtca cacctaagcg ccgtcaacca     46380
     tggttccatg ggccggatgg gtcttgtcat aatctactag tagtctagtc ggcccctccg     46440
     agtcagtagt tggttttggg tccgacagaa ttgccgcgct ggtgtgaatc ttttgtctgt     46500
     gcctctttct ctctgcattg attttcttgt ctttcccatg tgaaactaaa tcatgtagat     46560
     ggaagaaaaa taaattgagt gaggggaaag gagggtcttg caaatcgaac catatgacca     46620
     agttgcacca catactatct actcacgctt taatatagta tgagattagt aaacaagtag     46680
     gtaacttagc tgaaataata cagttgaggg tggcaccagc aaggcatcca catctcgtga     46740
     acatcatcat catcatcatc gttaccatca gagtagtagg aggagctaaa tacatactaa     46800
     aggatatagt agtaatacta tggatagata gaaagtatca gctgatgatg atgatccagt     46860
     cccaactact ctacttacta ggtagctata aatgacatca actactcaaa gacccaatat     46920
     aaaatgaagt aaaatagacg aatgataaat gagcgtcgca taagccaaca agcgaactaa     46980
     ataactactt acatagtagt tacaaacaaa aaggggacaa cgatgacaaa aatccacact     47040
     taacagcaaa gcaaagcaaa gcacacacac caatgcagcg caatgccaag tgagaattag     47100
     cgaaaagaga gacggatgcc gccgagaaat caaaaggaaa caaacaacaa taacatgtgg     47160
     atgggaataa taagcatggg ttagtgttcc tcctgatgat cgacatgtgc ctcccggggg     47220
     aaaaatgaat cgaatcaaat caaatcaaat catggatgaa ggaacggaac ggaagtggta     47280
     tgaaacgcaa ggaagaaatc agaaaactaa cgaagtgact aacatatgca gatgatgcaa     47340
     atctggggtg tgtgcggcga tggcgatgat ggtgaaacaa aaaaaaaata aaataaaata     47400
     agaagccgaa atgatctcaa taacaacgac agacagtaac aatgacaatg atgatgatga     47460
     gaacagatga aaagacaaat aaacagaata atcaggtgcg agcgatgcca atgtgaaacc     47520
     tcaatttgtc ctccctgatg aatttttttt ctgacttttt cttttttttg cgattttcaa     47580
     caggctaatc gcgaacaaag ggaaccagac gataaaatca aaaccgaaac tcaaaactgg     47640
     aaaataagaa aaaagacgaa aaaagaaaca gaagatgcca gataaccgtc cgtccccatc     47700
     tcagatccgg ttgtcacttc tcctaatatc cgcccccatc atgtctgcgc gcgaatatct     47760
     ccagacaaga cacacaagag ggcggatatc gataattgga aaaaatcgtt gtcatcgaaa     47820
     caacccgaac ctggatttct tctccccctc cttctcctca aacaggctca ctaccttact     47880
     atgccgttca atctagctag taaggtagag tagcaatcaa ccctggggcc agaaaccgtt     47940
     agttcacgaa cgtatccctt ccctttatgg atggatctgg ggctggaagt taggcgcgag     48000
     tggatcttcg gcaactcact aacctgtggc acccaccccc cggaggagga gggggaaagg     48060
     gcatagcatg aaactatcta gccaccgtgg ttagggcagt tgtagccctc tcggcggcgg     48120
     atctgctgtc tgacgccagt gcaggaggtc cctcgcttgg cgcagtagac gacatcaccc     48180
     tcagcgacgg tgcagccgca gtcgtacttg aagaagtact gggagcacat agtggcggtg     48240
     ggaggagact ggagaaggga cctgaaactg gtggagttga agaagatagt cgtagagagg     48300
     agcacttaga aagtgcggga gcaagagtag atagaaagta gaagagtgtg agagagagtg     48360
     aagtttgaga agttgtggtc aggctgagct gagctagctg gattgctttt gcttgcttga     48420
     ttgctttgat ggattgatga tggttctgat tgtccgatgg gggagtgcga agggggcttt     48480
     aaataattga ggatgcagtc tcctggacta ctggcaggta gtggtggtgg taacaaccgt     48540
     tggtacgtcc gtagtaggag cagtaagtgt ggttgtggtg gtggtgagtc tcgaatcaga     48600
     atcccaaatg ataaagatga ctgcggttga ctgtgccgca acaacgccag tctacgccca     48660
     caattgttca gttggcgtag ggccagtttg tgactcaacc cggccaatca caattaagag     48720
     aaaataattt ttctatgcaa aaattaaatg gcggttaagt aagaaaaaat aataaaatca     48780
     taaatcattt gttgtgttgt tgtggcagtg gtggtaagtc ttggggggtt gtggtgatca     48840
     catcgcagcg aaaagagtca aaaatgaatg gatggatgac cgtcagaaga aggttaggca     48900
     aggaacggga aactaactac ggcttgcatc ttgctttttc ttcctttctt ttccctgcac     48960
     tcggttctct tttcccattt ttttgggctc agccctccct caacacggac caatagagcc     49020
     gctgaaccgg agaatcagtt ggtgattcga tctacatcac actcgaatca tccttccaag     49080
     taaaaatttt aatataacag tatcccaaca tatgatccag tctgcatatg catctcaatg     49140
     cctttgatgc tccccctccc tcccagcgga ctggcggcta tgcgaatcag aaagcctgag     49200
     atcaccccca tctgggatca gcctgggaag gcatcttttc caagatagga aaatgaacgc     49260
     gtatctgact agcatggtca tgcatcggcc gaaggtgatg tgagcctctc gaggatggtg     49320
     gggggcaaag gaacgcatta gacttccgct gctgcatcat gcgaaggttg acatcatctt     49380
     cacatctaca cgtccttcct gcggcaggga aagacccgtc aggatatgca ggcgcaaacc     49440
     caacaattga attatcaaat cagtccccgc acacgaccaa cagtagttcg actgcgaagg     49500
     gggtcatgct gcagtctaga atgagtcccg gaccagagca tctgacgaat gcaagaccgc     49560
     agacgaccag atccactcat caaggcgcac atctggcgac tgttctctcg ctatcatgtg     49620
     tccttgacac cggattgaac gggagcggag gagcaggatt cgcatggcca ccggcagtcc     49680
     aatatgatcg cgccgatatc agagttcggg gaatcacccc caccagcttg gtctgaccgt     49740
     ctggcacctg gcgctgtttg gctagaaaag gctgcgcagg attagttgat ccatgagcca     49800
     cctgctcctg tcaggggccg ccgcagttcc taagagtgca tcctgtccca cgtcaaacat     49860
     catcctgctg cgggtcgctg ggatcaacaa ggtgtgtcag agtcccggag ccgacatgcg     49920
     gaagctaaag agatgaacat gcaagaactg ctgtgccgtc acaggcacgt tgggtcatag     49980
     ctttgccagt gaccaatgtc tgagacccat aaccttgacg cagttggtga tatcagtgac     50040
     atccacaaag cctgaacaca tgagcctgac tgcctttccc tcctcttggc tccagttgtt     50100
     gggaatagct cgggggccag aagttatccg acatcagcgc gagccagcaa ccgagcgtta     50160
     cttagcgtag tttccccatg ggcctgggat attacggcgt tggtgtgata gtgagccagg     50220
     tctaccacgg ccgaggctaa ctggagtaat tcggcagtgc cagccagacc gtttccgcct     50280
     atcgattttc catgatcaac caccagcagc taggctgaat gggaaacatc gggctaaggc     50340
     agcgaggcca tggagttcag aaagtcggca cagcacttgc ggcgcttttt ccatgggcct     50400
     ctgcatgttt cactgagccc tttcagccgc tgggtggccg cgccactcag ggcgatacgg     50460
     cgcagggccc gaaggcgcta aaacggcgac ggtcgacagg tttcaaccag cgggcacggc     50520
     catcttttag ccgccgttgg ctcccgggag ggggaacggc gccggtgatg ggaccgacgc     50580
     gtgatggttc ctggcctgaa cctgggtttt ggcctgttcc tgaagggggc ttggttttct     50640
     agtcgctgtg gttgattctt gcgcgcatct catgtcagcc acgtgatccc gggctggttt     50700
     gagccgcctg cttgcttggc ttcatacttc ctctggcttt gttgtttttt tttactccct     50760
     ccagaactcc cttcgtctcg ttctcacacc tcgttattaa tccggagagg ggacctgcta     50820
     gtctcattaa attgtccact agtaagtcca ttcaactcaa ccctttacca tggaaccttc     50880
     ccccggacca ccatctccgc ccgtcgggtg ttcccagctt cccgttccct gaagcttccg     50940
     acttcacaca atggtctagt cctttccccg agcaatgctg ttttctagcg gcttctttcg     51000
     cttctatcaa gcaagggggc gaggaaggat tcggatcatt tcaattggaa agcagatgtg     51060
     gctgcccaag tcaagatctc ccgaggaagg gaatgttaaa aggcgatctc cgaggggaag     51120
     cagaagttgc agcagcggga aacaaccatg aaattccggg ggggtcatgt ggcctgggga     51180
     acataaccag aaatccacag gaaagaacag aaaaagaatg cagcaacgac ttggcaggcc     51240
     cgcttctttt gccccccaag aatggacaaa aactcacttt gttcctgacg tcgcctctta     51300
     tcgcctcttt tccttccacg ttcctccaga gctcgtcacg ggacggttcg gtctcaatca     51360
     atagtgcctt ggccacggct cttggttgct gatcatccga ggctaggttc ggagtcgtgg     51420
     cggtcctgat gcttgtgtcg gggaccccca ggcccagctc acccaaccag aatgtccacc     51480
     gcatcctgct cgggtatgac tattgccaga gccaagagat gcatgggaag gggggatttt     51540
     caaggatgac gttctcagcc cctcctttgt gatagtccgt ttcgcaggca tgtgaattac     51600
     agcgtgtccc ggtccaccgt cgggtatgag gaataggcaa gccactgctt gtccctccac     51660
     ttatctgctt tctgcagctg ggctagaatc ggtagctcgc ctgatcgaca ccatctccgg     51720
     tcaacccctc ttccctgctg cgataatggc ttggctgagc tctgccatag ctatataagg     51780
     gtggccgatt ccagccgatg aaattctcat ccatcctctt tcctccaagc aactctgcaa     51840
     gaaaagttct ctctacttga ttccaagtca ctttaagact ttaccaattt acctgctttc     51900
     aagagactcc ttgtcaactc atccatcaat caccatgtac acctacactc ccacctccaa     51960
     gttccttgtc ctggccccta ccgagtcggc tcctctctct acctcgacgc aggttcgtga     52020
     gcgctccagc agccagtctt ccacgaccag cgaaactgcg cagcgccctg gattcagtcg     52080
     tctccctagc ggcttcctct acctgggcgt cgacacccgc gacgccgctt cgcctagcaa     52140
     ctaagcttct ggcaatagaa gcaatttcaa ttcgacgaat cgcgctggac acgatttcct     52200
     tgcctcgcac ctcatcgtct aacggggcct aaagtctcac cccgcagacc gaaggaagac     52260
     actactagtt cttgtcatgg atatctgacg ttattggacc gagcgaccat tcgggggaaa     52320
     cgaagtgcgg ggcccgatgt tttctttttt gggggggttg caagattcat tgcttttgcc     52380
     atttctactc tacgccaagt ctacacctca tgttcatagc ctcttgcaca atcataatga     52440
     taccatactc cttgcctggg ccgcgctgcc cagacaatcc tgaatgactg ccaagggtcc     52500
     attgatatgt gccaagcatt gtgccatcag ataaaccgca gttcctgttg cacagccaag     52560
     caatgataga ttctgccgat caaccctttt cggagttgcc aagccagcgt aaccccttga     52620
     atgtttgccc tgtagtctaa ggtgtagata agaaagagaa aaaagtaaac agagctgaac     52680
     cctgaacctt gtagacctga aattagttaa attaatcatg gctgcacacc gtacggcgta     52740
     ctccgtccat gcgtcggagt aaaagggccc ggcagggttc catagataac tagtgggcca     52800
     tggcagcgat gctatctgaa ccagaccaga ccagaacggc gcgatctcag atctagcccc     52860
     aacccccggt gacaacttgc agtatggatg tgctggtcac ggggtctgca cagagctgca     52920
     acttgcctct ccggatgctg agatatgtac atccgcgggc aacgcaagca tgtcgctgct     52980
     gctgctgctg ctgctgctgc acccaactca gcccaactcc cacaccactt tctgcgaagt     53040
     aggtttactt ttattactga cctttttttt ttcaggtttg ttcatctatc tatacgatgg     53100
     ttccaccaat gttatattcc tattaccaat tttcaccgat tagaataact tacgcacgtt     53160
     cccttgtaag cataatagcc atcagctata gtaatattga taacgagtta tattatcaag     53220
     acaatggtga taccttcaat atccttatca ccccaccgac caccaccagc ccccttcctt     53280
     ctctaaccga gccgacttac atacaggcat acattcactc aaacagatac agaaacaaat     53340
     gcatccggat atgcatgtcc gcgtacgtct gcacaccgga cttggctgtc catgacacat     53400
     actacttaca tacttggata ttccagtata ctatcttggg ggttggtact ccatgattgg     53460
     aagagcttat gtttacaata gaacggtgtg aataaccctt ttatccgagc cacctccttt     53520
     ccctcggatt tccttgtcat gatgcaggat ggacaagcgg atgggatagg taggtggacg     53580
     gacggtgttt caccgagatg atcatcgatt tcttttgctt tcttgttgat tcttcttggt     53640
     tcgcatcctt tctttttata gaaaatttcc ggtcggtgaa gctagctact tattgaggtg     53700
     atgggatgat atgacataag aaataagtag atttttctta ttgtcgttgg gatggtgggg     53760
     gttgatgctt atgcttactt atggttatgc ttacgctcat gttaaagttt attacatatg     53820
     tccgcggctg gctgggagtt aggcaggagg agaaaaggat gaatagcggc gggcttgcaa     53880
     aaacccccaa agaaaatgat ggcgatgata gatgtagaaa aagaactgag ttactatcaa     53940
     cttccatcca cgtcgtctcc cacgtcttga gatcgatcgg ttgggggggg gggaagaaaa     54000
     aagtaaaaat gtatgacaag agtgggattc gaacccacgc catcttacga tgatcaggaa     54060
     gctgtgaagc tgagtattaa ggtggacctt aacctgacgc cttggaccaa ctcggccatc     54120
     ttgccttgtt catgtcatct actctcattt aatgtaatat agctgggcct atctcatgac     54180
     gggagataga cccgttccat tactggctta tcctccggtg tcgatagtct ggactagtct     54240
     gctggatagt atatcccggg ttgcgtgatt cgcgctagtt tcataatagg atccactacg     54300
     attgtatcat cgctttgggt cggaatcgga tgctcattcg acgtttcgga ccaagggata     54360
     tcttagtctc ccgtccgtgt aatatttatg ttggtgtgcg agcgtcatca tagcaaggat     54420
     ggtcagcacc attagctaac aataaatatc aaccatctag tttcatcgct acaatgtaag     54480
     ccgcagttat cattcaatta gcagtggttt caaattagcc gaaaatgcag atccaaaatg     54540
     tgattggtgc aatgagccga gatatcctac cggggtccat atgcattact gtcaggtgag     54600
     cgtgttagca tatcgctagt ttaaggctgt gtagtatagg acattctaaa tatacttcaa     54660
     tagctatata gatactttgt atagcctgat tgtatgcgct aaaaaggcgt gcttaccagg     54720
     gtccttgcaa cggcttcgga tgcggctctg gtagggctca tctcagcttc gtgtatgttg     54780
     aaccgcaatg tgatatctgc ttgactgagt gatattatct ccgccatcac tgcgttccgt     54840
     agtgatgctt tttcccttct cttttctctt gctgcttcac cgggttgaga tgaaaatcat     54900
     ttcacattca tttcctattc acagtattgt atacagattc acacaatatg gtccggattc     54960
     acaactaagc gctgctcggt cccgtagtat ataagcagcc aattttctct cgcctcttgt     55020
     gtttcttcct ctgtaatctc cctagtcttt ttaataaatc attatctgct cgatacagtc     55080
     tatctgctag tatcttctcg attcattggg tcaattgact agaaagagta cagccgatga     55140
     ctggtatctt ctatgaataa tatatgacat tctcatatac agcacattgc tacaatacta     55200
     agctacttcc cctgcttcaa cctcgtgtta ctcccgccat tggatgcctg gagtaaatgg     55260
     tcttccctta atccaagagg gtcgaataca tctacaaagt attcgcacgt ccagaagata     55320
     cattttgaac aaagacaacg aagagatact acgagagagt acccgagatt aacaaagcca     55380
     catcgttgtc ccgagtctta gaacacaaca tcgattatcg ggaataacat cgctatagta     55440
     gtcaagaacc acaatcacgt gaggaattgt gaaatacttt ggcgcggttc agccatcatt     55500
     taataaagat gtttgctgac aacggtcagt ctatgtatgt catctttatg tttggggctg     55560
     gtgagacggc ccgctaagaa tgcataagct gacatctact ccagcaccag gaaagggcgt     55620
     tttatcggtt atcttacttc tccatgcatg cctttgcgat aagacataga aaggttgcta     55680
     gatgagggtt atagctgtta ttccaaagcc aaggctattg ctgcgtcggt gcaaaaccat     55740
     atgatattac ctcaacgata tcgatgcaac ccatctaaaa gcatcatgat ggccgaaaag     55800
     gagtgattgt cagccatatg attgggttct cgacaataag gcgtatgggc ccaactgaca     55860
     cgtgggctgt gtcctacgag acattacgag gagctcatat ctcaggcatt tgcgatggac     55920
     tgatatgcat gattctcata atcttcctgc catgatatgg tgagaacgac accatagatt     55980
     gcaggcggga gcgaagacga agatcttctc caccaatttc gagatactac tgggattggc     56040
     tcaatctttc ggagaaatac attgttgcat tgctcttgga ggaacatgcc agcaggattg     56100
     gccgactgcc gtttatggct ggaaaattta catggaatgc ctggaaatac ttaccccaga     56160
     gcacaaggtg aaggatttcc tcatgtggca aacataccta tcctcactag tcaagggaga     56220
     ggaaagagaa ccagagatat agaaatactc tggacccgat caaatagcag cttcgaacat     56280
     actcagtttc tcgaagcaat gtgcgatggt tgcacttttg gaacacacct gcaggcagca     56340
     aattgccgac tgtgattggc cacaccaaga ctacaagaaa aacccacatg tgggcagcat     56400
     tggctgactg ttgctggctg cggcaaaagt ccatgggccg cggtctacat gcaagccgat     56460
     tagaacgaga ccaagaagct tttgaagtgg cacacacgaa accacattgc ctaagactac     56520
     ggtgagaaca tcgaagtcat tagtagccca aagcaaaaag aatagcaagt ttggctcaat     56580
     acttatccaa gcacttgcaa ttattgttag ctgatggagt attcattttg gcattcgaag     56640
     tcaacacacg cccacagaca ctatgccaga ttcgagatcg aagaaaagtc tcttgaagca     56700
     gagaatgagc gacgccttta aagtgttagt caataaatct ggcatgctac agcaacacca     56760
     caaatgacgt tgttatccca caaatgaaga cggcgataag gaagagggcg cctagtaaag     56820
     aagcttagca gtaaccttac tacacggcaa ccggccacaa ccctccagaa tcttccggct     56880
     ctttctctgc ccgttttctt acttttaacc tagtagcctc gacctccggc tttatctctc     56940
     ctgttccctc tcggtttcaa ggacggccag cgatactaca aatgaagcga tctggcgtgc     57000
     tgtagccgcc acactgacta cctcataaga ctatagggcg tgtcagctgg gtttggtgtg     57060
     acttttcaat tagggatact ttcgacaaag tgccgatcgg tatccacgaa ccaacctcaa     57120
     gtacggcgca ggttctaaac tcgtgcacta atctagctcg atacgggagt acaaggcaga     57180
     cctctttatg gccgggttgg cggttaagtt aagggaggca gggagaagat ttctgggtgt     57240
     ttaattaaac cacaggtcgg tggttctata caaagggttc tcccaaacgg acctgcctgg     57300
     gcgggttgat gatcgagact tcgttgacaa tggacgaagc cactcgcttc tgtcaaataa     57360
     gttatggtat cggtcgtttt acacaacacg ttctccaaaa cggatgctgc ggcggcttaa     57420
     gcatcgaggt aacttggaca atggacgaag ccattcgctt ttgtgggttg atgacaatga     57480
     tgcgggtgtg cttcttcgat tacttggtat gccattgacc tctatactgt ggccttatat     57540
     aaaccgcaag gcttcatgga atacccgctt tccgcgtcat gagccatttc tggacacccc     57600
     tcagtttgat cttgatgtat tataccacca ctgtagtaat gaacacatct cctctctcag     57660
     accctattac ccgagtccta atcttccctc acacacaaga ccatccattc ccccatcgca     57720
     atccccgtcc cccacccaca cccaataaga accaagaatt ccccacaatt atatatctac     57780
     atacactcaa gcagacccat ataccactat ttcttttgca aataatatct caaggcaaga     57840
     tggccgagtt ggtccaaggc gtcaggttaa ggtccacctt aatacccagc ttcacagctt     57900
     cctgatcatc gtaagatggc gtgggttcga atcccactct tgtcatacat ttttgtttct     57960
     gagcatatca acactgacta aatgtgttct ctaatcatgt caattgatcg ttccctttta     58020
     tttttatttt atttttgcag tattgtttga tggtgagtac tccgtaggta gttgtataat     58080
     agctagttag ttgcctatgc cactgtgcca ttgtagacca tacatcatcc gtctactcta     58140
     acacctggga atagtaatat gtcttgtgag cagtatctaa ctaactaact gagtagatac     58200
     agaactacta tcgtgggggt caattagata gttagtaggt agtgagctac tcgcaaggct     58260
     gactgattga cagacatcac agacatcaca gacacacaca ttttacacac cctagttcag     58320
     tagccatcta tctatgcacc catcccaacg aaacaacatc ccccttgggg tccaaaacta     58380
     taattatccc cctcagctaa tgcatatgca acctaaaatc tgatctacta tctagatact     58440
     agatagcggc tgacactcag cccgagcagc acaacaggag gagataaatg ccgcaagtac     58500
     tccgtactat atccaactaa aacacataac ccggtccaaa tgccctacta agcaacacca     58560
     agctaaggta agtaagcaaa cagcgggttg tttcagatat agttcagaga cggcaggtga     58620
     cttattgtac tcacagacca cacgcaaatc agaccactgg ctgcatggtc atcaccacta     58680
     tctttgggtc tagtttggtt agttcgtttc aggtacagcc tcagctgaga gtgtcatctg     58740
     tagatactag atagtgggaa agaaaagagg ggtagacgac aaggataaaa agaggggatc     58800
     acatctaagc cacgactccg tttctttctt tctacgtctt tcgatgggct ggagttagct     58860
     gcagctacgg ctactatcaa tagatggtat atccgctcac gctagacagg gattctgcaa     58920
     agccccaatc actatcaatc aagggttgtg gattgcacta tactatggat tgtggccccc     58980
     aagggcatga agttatggaa atagatgcta gggtaatcga catgcgctca atgcactggt     59040
     aatgctccaa ccaagtcatc ctcactaccg gttcaaaaca agtaccacat caaaatcaac     59100
     agaggccggg ttgtgcgatc acaataaacg tattaaatta accacaaaat aatcctgatc     59160
     aataggaatg taaatagccg tagcacacca aggacaccac gtcctagaag aaggggaaaa     59220
     aagaacaaaa gcacaaataa tcaatggggg agtcagaaaa gaaatcaatt tacaatcagt     59280
     actatagtga cagggaaagg aaaacgagaa tttgaacaaa ggaaataagg ctttatggga     59340
     aacaagggat attcaaatgc aagatgggga tatgtatgcg ggaacaaacg gttgctggta     59400
     caatgcgagg acaaatcgat aggtgcaagc aacagaaggg acgaattttg cgtgggtatc     59460
     acgggggtat ccaattaacc attctgctct ttaatgctga tttccaggag cctggtcgcc     59520
     tcaaatgcca cctccaaacc aagaggctcc agtcgagacc cgtcgttccg tcgaacccat     59580
     cctcgctttc tctcgaggat cgtgggtatg cggtgaatgc cagagcacct gcgtcgcctt     59640
     cctgggcatt gccatacgct ccattcccaa atcgcaagca ggtcatgaga ctgggactgc     59700
     ttgtcattcg tcattgttcg accgcggtaa ccaattctgc actgaccggt tatgtcgagt     59760
     tcggtgagtt gtattgtgac aagatgatat tagatagatt tcaagaccaa gaagccagcc     59820
     tatcggtcat cgccagctct cgacttggcc cgccgacgga agaaatccat cacttttctg     59880
     gctgcgccag agctgccagg ccggtgcgcc aagtcgcgtt cgtactcgta cgcatctgca     59940
     aacttgcggt ggttcttggg taaaacgcca gtcccgcgcc caggtcgacc agcctgcatc     60000
     gacggccgcg gcgccttatc atacggggcg gagtactcct catagtggtt gggtgccgag     60060
     tggttggcgt actggttgcg ataataatgg tcattatcgt tctggtacac ttgctcggcc     60120
     gaggtcgcac tgtaagaggt cggctggtat attccagact ggttggagtg tagtacggcg     60180
     aactgttggt caatccgggc ctggtagttg atgggttcgt cctgggtcag gatctcgtct     60240
     cctggggcac cctcaggcgc tgctccgatg gcatcctggg tcccatagct agcagcgcgc     60300
     gaacgcgcct gcattgcact ggtcgacgga cgcggttcga cccggttttc ggtagagcgg     60360
     tctgtttgcg actcttcatc aggagtttgc gatctgctgg aagaaaatcc tttcagggag     60420
     aatgatggcg gcaggaatga gaaccttcga ggccggcctt ccacgccaga ttcactagtc     60480
     ttgcggttat atccgtattg catggagcgt cgcgaatcca tcgacatccg ggtgtcatcc     60540
     ccaccgtatg gttccttcat actcgtaggc ggataacgct tgccattctt ctgccgagga     60600
     ccgctaccct gtcctcctcg ccctccgaaa atggaaccag agcggccaaa cagcttctcg     60660
     ccaatgctgg aaaccgtgtt ggatcgcttg tggcccttcg ggggctcttg tcggggtgtt     60720
     gtgttgaact tggccggaag ttgctgtgta ctcggttgac cgatggactg ttgggacgac     60780
     gcatcttgct gctggagagg agaggagata acatattgct tgctcttggg ttgtgcgagc     60840
     cgaccctggg cgttcgtggc agccacagtt ggtgcaaccg gctgtccata agagcctcgt     60900
     gatggcaaac gaccggcgtt gaacgaggcc atggagccac cggtagtggg gcgggtggca     60960
     tgagttgcag atgttggtgc cgtcccagtg agcgcagaag catccgacgt cgagcgaggc     61020
     aagtgcccag gaacaggtgc cggcgccggg ccagcggccg ccttgggctc tccagtccgc     61080
     acgttggacg cgccagacaa atcacgggcc agagtgcccg acggcatatt aggcacgatg     61140
     ggtcgactgt ttgacctggc tctcgtcggt cgaggctccg acggcccagc tggctccgcg     61200
     acacctgcat ccatgccggc aggaacctcg ccccgcgcag tttgagactg aggtgcaaca     61260
     tattcgacct gcaccgttcg tcgtttcgtg tctcgagggg tcttggaccg ttcgaccgcc     61320
     tgctcttggg aaatatctcc tgcatggtgg ataagtcctc ccaccgaggg aacagggcta     61380
     ttgttgtatg ttttcggagg ctcccgaacg gacgcgctgc gtgccagcga cggcacttcc     61440
     ttgtgcggtt ctgcccgaga caccgggtta gtggcagagc ctgcaggatt catggcgaga     61500
     tccataccct gtgagacggt ggttgtggca atgtccgcaa ccttggtcgt gctgctcgtg     61560
     atatgggaaa cgatgtgcga gtactcgctt agccagctgt gccgggccac ttcaaacaag     61620
     tctgctcgct tccgcggatc aggcaccaat atccgcctca aaagatcgcg agcgtggggg     61680
     gtcacatatt ccgggaatgt tagaggagtg gtgacaatgt acttgtacaa caagttgata     61740
     ttatcaccgt ccgggttagc cggatcatcg tcaaagggca aatatcccgc aagcatagca     61800
     tactgtgaaa actaattagc gcttttgcaa tggtatgttg cttgagggtc acccaccaaa     61860
     atcacaccac agctccaaac gtcgaccttg cgcccagtgt acagtgagtc gctaaccacg     61920
     agctccggcg cggcataaca aggacttccg cagctggttt gcatcagatc acctcgcctc     61980
     agacccttgg cgttgggcct gtctaagcgc atccgcttca caaactcctt gttagtcagg     62040
     ttgtattcga tctcatcgcc caattcgtcc atggggtcaa acgtattcgc aaagccaaaa     62100
     tcggtgatga taatgttgcg attccggtcc agcaacaggt tctccagctt caagtcacga     62160
     tggacaatac ccttcttgtg aagatatccc acaccagata caagttgcgc aaacaggcgt     62220
     cgagcggaat tgtccttgag ataccgattg ttcagaatat gatcgaagag ctcaccccca     62280
     gaggcgtact ccatgatgat accgatgtga cggtccgtct cgaccatctc gtggagccga     62340
     acgatgttcg ggtgagctag gtcacgcagg attgaaattt cgcggtagat cttgggtaac     62400
     cggctaggat tcgacccaag agactccctg cggatgagct tgatggctac ctgtatggtg     62460
     ccgtctctct tccaccccaa tttcaccttg ccaaactcgc cctcacccag cgtctgcccc     62520
     agaatgtact gaccgaacgt cgtctctttg cgcttgacag catgctccga gtaatcatgc     62580
     cgacttcgta gtccacctcg acctccatca tccacaccat cgcttcccac caaacccagc     62640
     ccggatgccg gagcgctctc cgtcgatggg gacaccgatg agccggcctg ccggacctgc     62700
     tcccgctcga tatccacaga cggatcactc accaggacct gattgatcac tgcgcttgac     62760
     tccttctgca actcgccctg gcctgcataa ccttccatgt tttcctccga agacggtgcc     62820
     gctggcgcgt gggagctcgt gctctgcggg tattcctcgg gcacgttcac cgggcgaaat     62880
     tggctgtcct cccccttcct ctcacggtgg cttgcactcc ggtcatcggc tcgattcttt     62940
     ccgtgacgag aactcgagga cttttcggcg gaggatgagg aaggttttgc actcgaacca     63000
     tggtgactgc ggtgggttga cgatgtcctt ggcggcggga cgggcggagc acccagtagg     63060
     tcgggataaa cgggggagcg attgttgtcc tgctcggacg gcgctgcggg tgtcaaggct     63120
     ggggaggcat gggtggtgag cggcaaagat tgcggttggg agtcgttcat agccgaaaga     63180
     agctgtcagg accgaagagg aggctagctg ctgagcagtt agcactacac ggattgcgcg     63240
     gtgtggcgct ctatcgcggc gactgtcgcg ctgacgctga cagcagtgtt gcggcgcata     63300
     actcggcatg acggagctgg aggggggaag gaatgtggac aggaacagcc acgggggagg     63360
     ggcagaccaa tgtggattct cggcaaacag tgtagagtag cacgtcacat accttcgttt     63420
     attgaagacg cagcagagcc tttgagatga ggactgctgc gtttacggtc cgggacagcc     63480
     tcttcaggca gacgcgagac ggcagatgag cgatcacctc ggttcgctct gatggagcaa     63540
     ttgcgatcgg cgagctgaat tccgacacgt ccaagccctc cagagggaga taaaagagga     63600
     cgttgttatt tttctttttt actatctgtt tgtggggggg gggggaagag agtgaccgat     63660
     caaaccggag ctagagggtt ccggtcgggc agctgagctg ttgtctctcg agtcagtttc     63720
     agtcatcgga ggttccattc gaaccaccga taagggatgg atggttaggg aaataactga     63780
     caggtattgg tcaccgacaa aagcagcaag gtcgttggta taaaggacac caggtcgaat     63840
     agaagcagca gaatattagt gcaaaaagcg acgtcggcga aaataaagaa gaggaagcta     63900
     gtcaacactc gcgtttgtca aagaaacgca taagctgctg cttgttgtgg attttgaatt     63960
     ttctttcttt ttttttcttt ttcttttctt ctgaacccct ggttattttt gatcgatcgc     64020
     agcaagaagg gggaatatct gcactgcaga attgactctt ggaccttcgc ctcttcccac     64080
     gagtaatcgc tacccaggtg ggtaatgggt tgaagagggg gggtgggagg gagtctgcgg     64140
     ctcgagagat tgaggaattg gagatcggag ggacgagacc gacgcgggcg ggaaggggag     64200
     agcagcagcc tcgggagacg cgaaattaac caccacgagc cactttctta ctagcacgat     64260
     ggatactcga cggcgggaaa gctcgctttg gactctttcc cagacacggc accaatttca     64320
     acacttccga gggaattgac aaggcaaagt gtatgctgct ctgaatagca tgatcgacag     64380
     ggaaggggaa attggagaga gggggggaga agggaaaggg aatgggaaga ggtgaagatg     64440
     cagcaacacg cagcagtcag cagccagcag tagttgcttg agcagcggta gcagtagcgt     64500
     cgcgacaaga ggggtgcttg aagcctggtg gagttgtcgt ccgtctctgg atcggggagc     64560
     ggacaggggg gggcgcggcg cgaggggagc aggaagaccg gcgggattaa gacccagggg     64620
     gggcgcaaaa aggaagagga tcccgagcga aggcaagaag cagaaaagca agtgaaggga     64680
     acaagaatag aaggaaacta gaacagtaaa aagggacaaa aggaacaaaa aaaagagaag     64740
     aggaagggga agaagatgga gatggaggga aagagatgat gatgggggtg aagaagagag     64800
     aggggataga gagaaggaga ggaagtgatg gcggtggtag tgtgaagtcg tagcaatacg     64860
     aatagaataa aaaaaataaa taataataat aattataata attttgataa tgctagttag     64920
     tagactacta ctagatacag ctaatgagcc aggtattatt attgccttcc tgcgaacgat     64980
     gaacacccac ccgacactct gacggggcca cccactatct gctaactgct aactacttcc     65040
     tacttcctct ctagtgaacg aattgaccgg gttacctcgt gtcaggagtc cgtagcgaat     65100
     gtcaagtata gaattgaggt tcccacctta atttgggagc agagaaacag caggacgagt     65160
     aattccaagg cgagccgcga aaggaacggg caacaagccc gtcaccagca tttgctttgc     65220
     gttgctttgc tgtgctggct ggggaaagca aaaagcgggt caacgggtcg gatctctttg     65280
     ccaggaataa tcatcgccgc cccaatttaa aatcataagc aacttgccag aagttgaagc     65340
     gcaacatggc agtcgggaaa agaaaagaag acaacagaaa aacaggttaa taatcgatga     65400
     attcaaatca aacaccacct gatctttact ttgaaaacta cttcttttca agaaattcac     65460
     atcttcaacc tcacctacag gttttcatga gaaacctaca taccgaacta catcacagag     65520
     gaacagctgc atttaggcct cggaaatatt ggggggagcg agggatgtga ctggaccatg     65580
     gaccttggat acggacggag gagtggactt gggaaaaccc gactctagaa cgttagtggg     65640
     gatgaccgac ttccctggct acctaatgta tccattatgg acggatgtcc tcacgaggtg     65700
     acgaaatgct cttgtttttg tttttccttt ttctttttct tttccttgtc ctgtattctc     65760
     tttctctttc tgtttccttc ctggatgcaa gatggggcag aaagagggcg cgatggacgc     65820
     ccgatccaga taaccactaa aacaagggcc tgaacgtggg tgttgtccct tgcctggttc     65880
     gaccggccgt tgggaacttc cttctgagtc tggtcattcg tccggatggg cgatcgtgta     65940
     ccttaagtag tacttttcgc tagaactgaa atgactacta ctatccactt gcggtaccgg     66000
     tttatgcatg cttttctggt tcgataccac gataataatc caagcggccc tcgtatagtt     66060
     tatgtcttgc gcagtggtta gtcagtcagt cagtcagtca ggctttgagg gaacctgatc     66120
     agccgacact tcccctcctc ctcccagcat ccagcacaac agcccagacc gacagaccag     66180
     agacagaata gaccagagac cgagtgagca tgagaaggcg ccaagtcatc aggggcatcg     66240
     aaccactgtt tcaagccggc acgaaaaagt cgctactgga gccgctgggg cagccgatcg     66300
     tcattacggc gactaaccgg gcagtcatcg tctgcgccca actgctgatt ggtcgcccgg     66360
     aagattaccg tcctggacac ctcaggtacc accggtcacg ccgcccactg gtacctgcct     66420
     taggtaccac cgcctagcag gggacttaca gtagtctgct ttttttttat tattattttt     66480
     aattgttatt atgtcctctc agaacttgct ggcttcatga actcccgatc gctaccaaat     66540
     ctaattaact caactaaacg aacttaacac ttacacgtca atggttggta tccgtccctg     66600
     accaaaaaag gcccccaacc acagcgctta atgagcctac gtgcttctct tcttcctcgg     66660
     gtttgcccca tccttgaccc ttggatatcc tatccacggt agggataacc gccatccctg     66720
     gagttgtcct tctgaccatg atcggtaacc caattatgtc cccatcaagt ccgagcttat     66780
     ttgatgctgg ggggaattaa aatgaaccat ttatgaacat gcctcattcc ttcttatccc     66840
     ttggatgatg gatcatcgta tttcctgata tcttatctac tttcctttcc ccttctatct     66900
     acatgttcga tgagacttcc attcctgaac cccatcctcc gcaactctac ttactccgcc     66960
     cagtcttgat agctgctgat acgacatgtc caaccgcact aaccggattc accatgagtg     67020
     cagcatttga ccaactagcg ccagctctca tgccattgga ccaacctcct catgctaatg     67080
     ctgtatctat ttcctacgtc tcccgagatg aaaccgacct tgatcagcta gcttccttag     67140
     cctgccagct aggatgcacc tcatccagct atttaattta aaagctgaca gtctagtcgt     67200
     cttacccgag agggagggga gggggccgtc aagccaaccc ctctaaaata gaaactctcg     67260
     acagggatgt tcccaggaaa agagcaaaac aaaccacaaa caggcccatg ctcaatcaag     67320
     gagactctta ttgattactt tcaccggcct gggcaagttt gcagtgtaac cctccgagtg     67380
     tacttactta gtaaccggat ctactccgca tgacgaccga ccagttcgtt accccagcat     67440
     cgcgccgatg atagtagtag gattcggaga tttcccccaa ttacgtatgc gctgtgagcc     67500
     tgtgacaact atctactgca cagtagactc tggctaacca actaaccgat ctaattataa     67560
     aatttgattg catccctttc gatccccttg tttgctgctg gttgtcaggg agatcttgcc     67620
     agccttatcg atgtctgcaa catagacaat gcttgtctga gaaatcaatt tcagtttgcg     67680
     ccatgtttac tttcccaaat tgggtctgat aggcgtaatc cggacatgga tgtctgaaat     67740
     aatcaaacac acacaaaaca ccacactatg atctttccct ttctcaggct agtcgcatgg     67800
     aacatgttct gcatgactga aaactagttg tctctatgac agggacctgc gacatactaa     67860
     tttcctctgg tcaaatctcc ccgggaacga ggcccctggt aaatatatcg gtccttctcg     67920
     gaggcacaca cagcgcgcga tcatttagta gttaatgagg tgcattatag agggtcttgc     67980
     tgggaggcca ttggtcatca gatcaattac tcgtgcattt caaggcgcat ctccgaatat     68040
     accaataaca actactgatt aaatagacga agctgtccta ctcaataatt tgatgcggcg     68100
     ttagcgtcac atattcccgg ttactatata tacgttcttg tgcacaagta gaagcagcca     68160
     ttgatacgcc atttactacg catcggtggc tcaccctctc atttagactg agtacataca     68220
     tacaccactg cacagtgtat acaatatttc tctgcacata gccatgcaca cagtgcccac     68280
     gacatacctg cacatggatg ccatcaatcg agctactgcg ctctatacta cttactactt     68340
     atataccctc ctctccaagg catggagata cacccccaat agctagagat atagtacata     68400
     cccatacacc ccaacataac ccaaacaaaa cacacctgaa acccaaccca acccagtagt     68460
     cctatgaaat tatcactccc acatacatac ccagcaacca ctatcaccat cccataccca     68520
     cgtgaacaag ctagatagaa atccctccca taccataata ccgacatcaa caacctctat     68580
     ccatctatct actccgttcc gtacccaaaa agtagattat ccacagagta ctccgtatat     68640
     atttgatatc catccacatc cgccaacaga cccacccacg acccacaaca accacacaat     68700
     aactccagtt cccacaaaaa agaaccccta ggagtaataa aagaggggga aaaaaaacaa     68760
     aaagatatcg acaacagtcg gatttgaacc gacgcctccg aagagaatag atttctagtc     68820
     tatcgcctta gaccgctcgg ccatattgtc ttattgatat ttggaggcta ttccttggct     68880
     atatgagggg ggggacgctc tggggagggg gtgtgggtgg gccattgagg aggtattggg     68940
     atttttattt atgttgtgtg tgggattatg ttggttggtg tagtggggtt tgatttctgt     69000
     ttggtagtaa gtagtagtgg gttggttcgt agcaatacta ctgggtaagt tggtgagatc     69060
     atggcggtgc cagttcatta atatatatac tgttgatgtt agcggggtgt gcatatccct     69120
     gggcaatagt agtacattgt agtctcggca tatgctagta ctggacgtga tgataggcat     69180
     tgatgcgaga acgaggagca ggatgttaac tgggaattgg actggatgca aggtattggc     69240
     gtggacacat tcttactata cacctcacgt ttggttgtgc tggaaccggt gcacatgccc     69300
     tggggtaatg tggcctacag catactacgt attagatagg ataaatccaa cctcggtgat     69360
     gggtattgaa agttaatatt cacaaccggt ccggagatag agttggtcct aagactgcta     69420
     aagagtgcta gctctagcct agtatatgac acaagagcaa atgccaccgc cgttttcttc     69480
     acatagatgt accagcgtat atcaggttgc tccatatctc tatgtatcca tataaacagg     69540
     gtacatatcg taaaaacacg gaaaaagagt gcataaaacg gacgacacgc gggaaatcac     69600
     caacccagtg catcaaggtc ataaatcata cattaaacag agtacagcag accagattga     69660
     aatagaagat caaactgaag agcatccacg tcaacgctta ccccccgaca ttgacatgcc     69720
     gctcaacgag gtagtgcctg gcgcaccgta tgcaggtgga ggggtcgagc tgggagactg     69780
     acgtctcaca actggctcac ggccaccata tgcctggctt gggcccgccg ctgcaggaac     69840
     atctccgccg tcgcccgttc caacgaggac ctgctgccca ttgcgcatac ggccgacgac     69900
     catacccctc gcaacggact tcagcacagc cttgcgacta acacccgcgg cgtcaatata     69960
     caccaagccg acattcttga ctccgccagt gaggtcggag gctacggagc ccgcctgctc     70020
     gccatagcga tgtccaatca tggtgctagc tgcattggag ccggtgatca atacgttgcg     70080
     agcaccctgc tcgatgccgt ccgtcaaagt tgagaacgca atcatcgact tgttcaggat     70140
     gcccggcttg tagtcgctcc cggacctatc gacgcccctc tgcgtaccgt tgtccttgcg     70200
     gcgggacagg gaggcaccga tattctgggc atatttaccc acctgaccaa ccgtctttgc     70260
     ggacagctcg gcagcaccct gcgagaatgt accgactttt cggatccgag aatgtgtggt     70320
     gtcagagaag gtcatcggtt tagggttggg cttggtcttc ttggtgaaag cttctgcgcc     70380
     gctcgtgata gcgttggcaa gataggaaga tccggtgacg atcaagcgag aggcagtcgc     70440
     agaggtttga acgattgtcg aatccttata aactggatgg cgtgccatcc gcaggtattc     70500
     ttcggagaca ttactgacgt tgacttggtt accctcggcc tcggtaggaa gttcgatttc     70560
     cacaggtcct atcaaggcaa atgttagcag attcgtggat tagcaatgac agaaaacgta     70620
     cgtttcgagc caggtttgac accaggttcc tcaaccacat catacccttc catttcacca     70680
     accacgctgc catcttcctc atctaccaga acaatccggc catgggcgtc atcctgggcg     70740
     aatcctgacg gggcaacata cccttcgcct ggagcgtaag ttgcgggatt atacggtgca     70800
     tgattgctcg gcgggggagc gcgttcgagg aacgcggtgc attgagctag gatggtctcg     70860
     aaggtatcga tatcatcctg tgtgacttta cccggacctg agccaatgcc cgggaactgg     70920
     atacgaatga atgcgccggc gtcagggccc acatcccagc gagggatcaa gtagctgtct     70980
     ggagactggt ggaagatctg agtggtagca ggaagcgcca ggtctagttc cggtggtaag     71040
     tgcaggtgaa ggtaaaagtc ttcctctgca gacgtatcag ggggaggagt cgagggggag     71100
     gtgccaggca cggtcgttct agtggggacc atcagaagag aaagggtctg aggcccagac     71160
     ggggtcaact ctgtctcttc gccattttga atgtgaaaag cacggatgtt gctgatgcta     71220
     taaagtagcc ttggatcatg aacggtggaa gccatgactg aattgcctcg aagatagaca     71280
     gtaaacagtt gcagctcgaa gaccctgtag gtaccaagtg gaggactttg cgggggggag     71340
     ctgataacac ggcacagccg cttggcgggg gggtgattgc aagatgagag acggtgtgct     71400
     gtccacagca accaagtgaa ttatgagagt aagtaaaagg agaagagaag gggaagagat     71460
     gcgacagcag caccggggaa caggcaataa atacttgccc gaaccccggg caggccgacg     71520
     agcgtcgaaa caaccatgaa tgaatggatg gcggccaaga ggggagtgac ataatcgccc     71580
     ccgtccgctc ttggcagtgc tgcgccacac ctcatcacat cacacctgca ccgccacata     71640
     tatgcacggc ggtgcgtgag tggtccgtcc tgtctcaata atagaacagc ctcgcagcca     71700
     gcggcaaaat tcaacccccc cattccctcc tggaaaggcc ctggctgagt ggaggtggct     71760
     atctttcccc tcttttgaca agccagtcag tgcacaccct ggcattttcc agtggctgca     71820
     gggttcttgt tggagccaag ggcgcttaaa gtgctgaaca atcgggatcg agggatagac     71880
     taggggaggt caagcccctc actaagaatg gcacggttcc agatcgtctc cgacctgcat     71940
     ctagaaaacc ccaaggcata cgacttgttc gagattgcac caaaagcacc ttatctagcg     72000
     ctcctgggag atatcggcaa tgtcagggac gatggcttcc tcctgttcat agaagatcag     72060
     ctccgcaagt ttgagattgt ttttcttgtg atgggaaacc acgagccctt tcattctagt     72120
     tggttggacg tgagggaaaa gctgaagcgg ttttccgacg atataacacg caaaagagcg     72180
     caagtacaat tcaccaagcc cgggtctcac aagctaggga agtttgtcct tctcgaccaa     72240
     actcgatatg atctggcacc agatcttacg gtcctggggt gtacatttca ctccaaggtc     72300
     agcgagatgc aagaggaacg ggttagcttc agcttaaatg atttttacta catcaagaac     72360
     tggtcggtcg aggatcactg cgctgctcac gaagctgacc gagcttggct caacgatcag     72420
     gtcactggaa tcgccaggtc caacccccat cataaaattg tgattttcac tcatcacagt     72480
     ccgactgttg catctaaggc ggtggatccc gcgcacgcga agagtcctat atcatcggcg     72540
     ttcgcgacgg atctcgccgg ggaggcgtgc tgggagaaac cccaggtgcg actctggggg     72600
     tttggccata cgcattacaa ctgtgacttt acagacagtc gaacgggaaa gcgcattgtg     72660
     gcgaaccagc gaggctatta cttctctcag gcgaaggtct ttgacccgga aaaggtgata     72720
     agcatttgat agagcgggaa tggcatgtga aggaggggtt gggagttcat gtctcgggtt     72780
     atagataggc gcactggaac ctaatctgac agaaacaagc ggatagtgac attgatagaa     72840
     tgacatctaa ttaatctggg atttctttca gtagacagga cctgtagata tgccccagct     72900
     ggtggctaat tgcggagaga tggagctgga gccggagctg gagaaacggg gagacggctg     72960
     atcgacggcc ctcggccgcg tttaaccgag gcccgtctgc gcttctcact cgtgatctct     73020
     ccccgtcacc acctgctttc ctccttctca cttcctcttc cccctgcgcg tctttgccgt     73080
     ggcctcgagt tacacactat ccagctaatc cagttaatta ccatctcgct atggcgtcta     73140
     tcacccgtgc gttgcggcct ttgtcgcgca ctgctacctc cgcccgcctt atcacaagac     73200
     cgccgttgtc gaccaggcta gctgtgaggt gagttccagg ccgtgatccc cccgttcctg     73260
     cgtcaacagg acaagagcca tagcgcaatt attcacaatc atggccgtta cctatcgcta     73320
     acactcccct ccagcagcac ccatgcgttc tccaccacct cccgccggcg ggatgtcgat     73380
     ctgtccggac tgacgcccac cccgatcacc ttcctctccg aaacagaggc cctcatgtcc     73440
     gaatccgttt ccaagtttgc tcaggagcaa atatccccga aagtcagaga catggatgaa     73500
     gcggagacca tggaccctgc cgtggtcgag caactcttcg aacaaggact gatgggcgtc     73560
     gagatcccgg aggaatacgg cggtgcgggg atgaacttca cggcggcgat tgtggcgatt     73620
     gaggagctgg cccgcgtcga ccccagtgtc agtgttctcg tagacgtcca caacaccctc     73680
     gtcaacacct ccatcatgaa gtacggtgac gcgcaggcga aacgcacatg gctgcccaag     73740
     ctggctactg gcaccgtcgg ctcgttctgt ctgtcggagc cggcctccgg atcagacgcg     73800
     ttcgccctga agaccaaagc cgagaagacg gccgatgggt ataagatcaa cggatcgaag     73860
     atgtggatta ccaatgccat ggaatctggc gtgttccttg tctttgccaa ccttgacccc     73920
     agcaagggct acaagggtat caccgccttc attgtggaga aggatacccc gggattctcc     73980
     attgcgaaga aggaaaagaa gctgggcatc cgggccagca gcacctgcgt gctcaacttc     74040
     gacgacgtcc tgatccccaa gagcaacctt cttggcgaag aaggccaggg atacaagtat     74100
     gccattagca ttctcaacga gggacgaatt ggaattgctg cccagatgac cgggttggcc     74160
     ctcggcgcct gggagaatgc tgcacagtaa gcaaccccca acaccacctc tccatatctc     74220
     cgcgggactc agtatctccg cggtgacccc aagcagtcat tccatggccg acgtgtccat     74280
     ttgctaacat gtctcacaga tacatctgga acgaccgacg ccaattcggc caactgatcg     74340
     gcgagttcca gggcatgcag caccaagtgg cacaggcgta cactgagatc gcagccgccc     74400
     gcgcgctggt ctacaacgcg gcccgcaaga aggaagcggg acaagacttc gtccaagatg     74460
     ccgcaatggc gaagctgtat gcctcgcaag ttgctggccg cgtggctggc tccgcagtgg     74520
     agtggatggg aggcatgggc ttcgtgcgtg aaggcatcgc cgagaagatg ttcagggata     74580
     gcaagatcgg cgccatctac gagggaacca gcaacattca gctgcagacg attgccaagt     74640
     tgctacagaa gcagtatact cgctaagtga aacgatacct ttctttcttt cttttttttt     74700
     ctccacttgt tccctgttat catccgttat ccgttctatg gttccgcttc atagattgag     74760
     atccgatcca tcgtagatta catacacatg ccatactata ccatactata ctgaactata     74820
     ctactttatc cttctcttat gccactttat gtatccttat gactcagatc catcacaagc     74880
     cgaagaaggg aacggagcca acgaacctcg tgtcgatcta gccgacaaac tcaaattcat     74940
     aaccatggca ctggaaccga ttacacctct accatacatc ctcccctcac ccttatatcc     75000
     gacctccgaa catgcatctt agatgtggta cgtacccacc actgacaaag cacgtacata     75060
     catacataca taatatcata cccaataaca aagatccgcc tctttaccgc tcctcacatg     75120
     cgccggaaac tacatccatt cgcacattat tggccgggtc ggcacacaat ccaaaaaacc     75180
     aaccttaggc aatactagta ggtaggcatc atctataaac ttccatgagt gggaccccta     75240
     ccagaagtag tagtagtaat agtacattct accggccgag tgatgagccc tgctgtccaa     75300
     ctaacacaaa ccgaacttac tttgtactga gtggtaagta ctatcccgca cagcaaaaca     75360
     aatcgtaact acttactcta tggaattgta ttgcaaccca taagataatg attataaacg     75420
     ccgatatccc cgcgtccttt ccccgacaac ctaccaccta aactaagact aactatctac     75480
     tttatatatt taagattaat aagaagctgc agcctagaca aggctgggct aaactagcag     75540
     gaaacccaaa gttaacaaag tcactaagta cagtactagc agtaaaagaa aaggatagta     75600
     ctgtagaaaa cgttatccga ctgatccgac cgaaagtata accataaaag gtagtagtaa     75660
     tatactctgt accgagatat gcctgcatta gcctttatag aacatatcac taatcacgcc     75720
     aaatgccaag gccaagccaa gccaagacat tgcatcaaag aaaaaaaatt ggaggttcgg     75780
     ttagaagtga ctgagtaaac cttcttgaat gacagaatgg tttgaaaggt aggtaactgg     75840
     gtaactgggg agtggttccg atcggaagct tacataaaaa gaggtaagag ggggaaaagg     75900
     gagagagaga gcgggtttcg tttcgggagt tattctggtt ccgatctccc ctccccggtt     75960
     tgatcctctt tttttttttt ttcttctggg ttctagatag atagtagact agaggtcgca     76020
     tccatcgtct tggattaaac gcttacctct gccgagctcg aatcacgttt gaagggttgg     76080
     tggatgctgg ggttgggctc ttttgtctac ttcgagtaaa gtatgggcct tgtaaagaga     76140
     aagaaatccg gtagacgagc cgatgggcgg gcgggccgac tggggaaaaa aatggaatag     76200
     aaatgggttt gggacggttt gctaatcgga tggaattgtg gtacggagat gtttctggaa     76260
     aaagtgaaaa atttacaaca tagattccag gaaaaggaaa agcgggagta tacactgggt     76320
     cgttctgggg ccctgatgat gttcacgatg atgaagatga tgatattgtg gttttctggt     76380
     tgaatctgaa accgaccatg tggattcgga gcagctcggt tatcgagttt ctttctttct     76440
     ctctctctct ctctctcccc ctctatctac tgttaactaa tccgcctacc aatgattcat     76500
     gtaatccgat tcccttgcat tctattcccc tctctgtatc caagcgaaat catgaagaaa     76560
     acgtggagtt gccgttccat catctcccgc cggcaaatct cgtcgtgttc gcgggccgaa     76620
     aaatcacgga tttgtttgta tggggcgggt cgtcgggaag agctggagct gggactgaac     76680
     gggtcagatc tgccctgttc cacgatacgg tgtggtgacc gccagtgcca ctgagatatc     76740
     cggacccctg ggattttttt ttctttgctg gacgcctggc aaaggcaagc caatttccgg     76800
     atccaatgaa gccccttcat cacaagttat gtagacaatt tggagatagc cctgtgctgt     76860
     atgaccagtc cgtaagtgtg tatgtgtgtt gtttgcgtag ttgcacgcaa cagtgttttg     76920
     catcccagat accaggtcct ccccgtgcgt tgagtcggag aatattgatc gtaaccatca     76980
     tatgatcgct tgctgaacca ttcaggcaac aaccgtgatt gccttggcct catgcaagaa     77040
     tctcttttct ttcgtgagag ccccacgtgc ttgcccatcg tctcacgact gatgcgggtt     77100
     ccaggcatag ccgtagtcat tccgtgtctg aggtggaagc gtatgttgat gatacggttg     77160
     tggcgcatgt acgagaggat atcctgccgg tctctctgtg ggtattgttg gcactgacat     77220
     cggcctctgt ccaggtacgt aaggtactgg ctgtggagga tgggatgcta ggtcatctac     77280
     cggtccacga ggagcgtttc cggtgtgata tgcctgtgca tacgattgaa atgtcgggtc     77340
     tggttgagca ccgacaggcg cgctgtagct gacctgcggc ggcgcgacgg acattgcgct     77400
     cgtaggctga agttgacttt cgaacaagta cgattcggcc cggtttccat agttcgtctc     77460
     gctcgattcg caagttgaag gtgaccggtt ggtgccatag gggggccatt ccgacccaac     77520
     cgagacacga ctggacgtgg agaggaccga cggggcccta gaagctggat tcatccccaa     77580
     aggctctgca aactgcgtgg ccgggaccat agatccaggt gcattgctat acgttccttc     77640
     tgttgatgcg caacaattga tcggtcagcc attccaagtt ctttccgtag ccgtaataaa     77700
     acgaataaga ccggccacct acccataccc ggatatcctt gtctgctagc cagggcgagc     77760
     tgatgcttca gagctcggat ctcatgttct aacgccacat tccgtcggac gacatcgtca     77820
     aattgttccc ccttggcttt caactcagcc acttggtgct ccagccgttc aatatgctcc     77880
     ttggtccgtt gacgaatggt tctttgggct tcccgatcgt tggcgcgctt cctctccagc     77940
     tgttcggcag agagcgacgt cactttacgc gccccagcac gggactcgcg ctttttggtt     78000
     gtcgggggtt caggagtagg gctcatcctg cacatcaaat tgtattcagg tgggtgatga     78060
     tgatgtgagt aggagagtag aagagggttt gttgcaggtg ataggtgtga cccgtatagg     78120
     caacgtgatg catcccagcc aggtgtgtgg accgccagag gtacttgatc ccgcctctca     78180
     agatgcgact atagcggttc caagtgcgtg ggtcgcgcta aaccaggtat atatataccc     78240
     aaggggacgg acagaggccg tctgatagga acaaggtggg cgggtagata cgtaggtaga     78300
     ccgtagttac ttacttttag taggggtcgg tggtggaaga ataataatct ttgttgagcg     78360
     tttgaacgaa aaaagaatca gggaactgcc cgttttgggc atggctgcta ggacccattc     78420
     caggtcagac agactctgac tggtgcaggc aataattagg cacgtatggc ctgggaggat     78480
     ctagtcctgg cttggtctcc agatcgtccc tgtctctccc tcagacagct tggagtctcc     78540
     agctccccaa cttccttagt tatcagcagt acaaaccagt aaggaagtaa tacaccgtac     78600
     accttcgtta ccaaccgttg gcttggggcc cgaggacgca ccaatgagca gatccctcga     78660
     gcagcccaat cccatgaagg aaggggggag ggggagggag gggacacaca cacacacaca     78720
     cacacacggc ttttggtgca gtgcttttct tcaggtagct cttacgatgg gtcagcggcg     78780
     cagcgctatg agcaccttcc gaccctcccg acctacaagt acgctctaat tcgcaacttt     78840
     gggggggtcc ccctcagcac cctagacggg ttggcctggt tgcgtggcgg tagcgtacac     78900
     cagtcaagta ccgaagctgt ttatgccggg taccccgaag aggcagaaac agatggtcaa     78960
     cgttgttgct gtccctctcc tgtcctagag catgtccagc acggtatctg catctgaagg     79020
     agcatctctt gtacggcatt tagtagtagt attgaccatc cggtggatct tagtccttcc     79080
     gggccacatg gcagacccga ttcagtagcg ggttcattat tttattaagc gaacgaacag     79140
     aaaaaaaaaa gaaaggaaaa aaaaaaagcc actagaaaaa gcaaacccca aaaagaaaaa     79200
     gtgggaatag ggagggcaag gaaaaaaaaa aaagacaagg ttaaccgaag acgaaatcca     79260
     tgggcgaccg atgccgccct ggggcacata cagaagctcc atggggttcg ttcaacctca     79320
     ggagaaagta atccttggca ccatgccggg gcataagccc aaagcagtat tcaggttgag     79380
     gggaagccga ctgaccgaca gtcagaaact ggcagttgga gggccgctgc agtgccaggc     79440
     gggacgggag aataccgaga gcgaccaact ttgtccataa gggttagagc ggagctgacc     79500
     agaggagtgg gttttggctg tctagactac cgacaaagta cgacggtggc tgaccaccat     79560
     tttctcagcg atctgcgggc tttgctttgg tatgcacgat ccccagcggt tccaggttcc     79620
     cgaatctcag atttcaggat ctgccaggct atcagatgtg aacactgaac agaacaggac     79680
     agtcactcct gaccccataa gtgtctctgt ttgaatgctc acccatggtt gcgtagatga     79740
     cgtcttgccg tctgttcgta ccagcgattg cagacaacct cctcgattta cccaaatagg     79800
     ttgttgaaat ggaggttcct atcggactcc ttaagggcgg agccttggta agggagtaaa     79860
     taatgggcag tcagccccct ttgggctcag tcagaaccat ggtagcactg gggttgtgct     79920
     cgccacgagg agaagtagat cgggtccaca cttcaggtcc tccatcaaaa ccaactacga     79980
     tttgctgcgc caagcggaag tttggtccag aaaagccctt ctgagtaatc agaaccaatg     80040
     gaatcccgga gggaactcgt gtcttgagac gcccggcgac agaagccccg tagaacatcg     80100
     aaaccgaagg ttcccaaatt ccttaatcag agtcaatcac cacgggaggg atggagtagg     80160
     caatatgccc gaatctaaac ggcaaaaacc gatgggaggg gagggaaaag ggagcaacca     80220
     ccatgagaga aggctttgga agagaaggct ggctgaacgt ggatgcatga cgcacattgt     80280
     gcctgccttc tcaggttagt cggttttctt cctaaaggtt caaatggagt ctggatccca     80340
     cttctttttg ttttgtttta ttttttttta ctccctcgct tttgcaaccc ttcccttttt     80400
     ttgcttttcc tgttgctcag cctcattccc ttgagacttg gctttgcagg gatgagcgac     80460
     ctgaggctca tatattattg gcatcgatac aatgtcccag cttaccccaa taccagggca     80520
     aaagacagga cagaatagtt tatgccctgg agctggttcg tggcgtcaat gtaccccgga     80580
     cacggaagac caacataccg gtcgtcggcc gaatggccct aaaaaataat ctcctaaggt     80640
     aaagccgtgc taaagccggt cggtgggcct gatagctgca tatcattgtc ccaagctgca     80700
     tccgcacggg agacagccgt gtactttact gaaactcact ggtgatcatt cccttccgat     80760
     tgattggttt gcggtgggtg catcccatgg gtggttatta attttttttt cccttccttt     80820
     tttctttgtt ttagtccgct cgtcgttcat gtcaagccaa gcattaactt agcattatgt     80880
     gtaagcggca cagcagatct ggtgagctaa cccaggactg acccaacccg tccttagccc     80940
     gaaacaacga cgcatagcct aaagcagttt cctgcgtagt agatagtcct accaagggga     81000
     cacggagaac ctccgttccc cccggggctc acctttgcat ccctgctcca gtagaagtat     81060
     agtataagca tctagtggca tggtagtagt tagttagtcc ccccattatc tttagcaagc     81120
     tccgtggatg aaacccggta cccccccctt gctagtatct ggttggcccc cagagaatgt     81180
     agatcggaga tattgtggag gctccagcaa tggcagcctg gcaggtggta atcaattgcc     81240
     agtgaaaaac tcgcacgccg cagtcatgat cggtctgtcg cacataagca cgataattca     81300
     atgcagctct tggcagatct ttggtttgtc tgctgttagc tatctttcgt cttattgcat     81360
     tcccagcatg ggattcgtca caacagaccc tacgaatgca ggttaaacgg cggattttct     81420
     ttttctgtct ctgtgtctca gactctcgag tgctaaggaa gttgagcttc tttcaatatg     81480
     gcaccataag caacgtaatt aagatgaaca gtgagatggg gaacggtgga tgcatggtta     81540
     gtcaccactt tgcctgagcc agagacacgg tgattgataa gtcggaaata cagttcccag     81600
     gcaggaaaga tggcagagga tgatttgctg agaaggaggg aaagaagacc atggaaaagg     81660
     tgggaactcg acgagaccga caggccgaaa agcaagacaa gcaagagaga aaacgagatt     81720
     cagattttgg actgtttgaa tcaaaaggcg ggggatgtat ggatgtgtaa ccggattacc     81780
     atactcggta ttcctctttc caggcacaca gccaccccgt atgggtctag tcccaataag     81840
     ggaagttatt ggcctgaggt gcttcagact actccgtaaa tgcggccaga ttgtttttgt     81900
     tcgcgcgtca tcgcagctgt gcttgtttgc cttccttgac ttgactgact tggtgacttg     81960
     ctgcttccta ccttgcgccg gccacgtctc actgtcggtg gatagggctt ctaatgcaag     82020
     attaactcca atctatctgc aacgttgcac acatttgatc gttttccctt tccttcctac     82080
     ccctcctccc ccggtctctt gcctctttgg acttttggtc caaacaggtc gcagctaatg     82140
     gatcccagct acaaggcccg caaagaggcc tttgtgtctg atcttgctgg tggcagcata     82200
     ctggagatca atgctgtcac attagttgcg cctgtacgtt tctcgtcaac ttgacagctg     82260
     ttcaatttca caagtccaga gcccatgggc ctgggatacg tcacacctct cttccccccc     82320
     cctccaggca gtgttatctg actctttacg ggattggtct aggccgctgc tcttttatgg     82380
     tcagcgctac aatcacgcct ttccttcttc actccttaca gcgcagcagc actggtgacc     82440
     gactttctgc tcaatgtact ggccattctc tttgccacga ctgtctactc ctctgcgcct     82500
     tggacgctga acgtcctgct gatcgccccc gccctcctgc tgttcctcaa ctcgaaacct     82560
     ccccgcagcc agcagaaggc taaacctcca ccgaagccga ctcagagcga taggaatgca     82620
     gcggacatgc ccgaatcctt accaattcac ccatttctga cgacatatcg tgcagccatg     82680
     atgatcatta cctgtgtcgc tatcttggcg gtggacttcc aggcgtttcc acggcggttt     82740
     gcaaaggtgg agaattgggg cacctcactc atggatctgg gtgtgggatc cttcgtcttc     82800
     tcaggtgggg tagtatctgc tcgctctgtg cttaagggcc gcagcaatgg cgcccggaag     82860
     actcccgtag gccagcggct gatcgcttcc acgcggcact cggtccctct gcttgtcttg     82920
     ggtttggtca gactgtatag tgtaaagggg ttggactatg cggagcatgt aacggagtat     82980
     ggcgtgcatt ggaacttctt tttcaccctt ggtcttttgc cacccttcgt ggagctcttt     83040
     gatagcctgg ctgccattat tccgtcctac gaagcccttt cgctggcagt tgctgtgttg     83100
     tatcaggccg ctctggaatc gaccgagctg aagagctata tccttgtttc ccctcgcgga     83160
     ccaagtttgc tctccaaaaa ccgggaaggt gttttctcgt tcctgggata ctttgcgatt     83220
     ttcctggcag gccgtgccac tggcatacgg atcattcctc gcggcaccac tacccaacgg     83280
     tccccccagc aggcgagaag aggcgtgctg gtgaccctgg gtgtccaagc gctcgcatgg     83340
     tctacgatct tcatcctaaa ttctacctac gcattaggct acggtgccaa cattccggtc     83400
     tcgcgccgcc ttgctaacat gccgtacgtt gtttgggtat ctgcctttaa caatgctcag     83460
     ctgttccttt tctgtctcct ggagacagcc ttcttcccat cggtgcatcg ggcgtcgggg     83520
     aaagacggcg aggccgaccg ggtgtctttt gcgacaagcc ggattctgaa ggcattcaat     83580
     cgtggtggac tggctatctt cctggtggct aatctgctta cgggggctgt caacctgagc     83640
     gtcccgacac tggatgtcag tacggcccag gcgatggcaa ttcttatcgg atatgccgcg     83700
     gctctcacag gcattgcact gggtttggat cgggcgaaca tcaagttggc aatttgaaga     83760
     agtgcgaaga catcccaccc ctctccaacg agacgtgagg aataatcaaa tataataaag     83820
     aacaattgtg tacatagtca agtggccatc tacttacttt tggtcgagat gcggaccgaa     83880
     atccggggtt ccagtagatt agcagctgtt tgggttaagg agcttagctt gacgggctgg     83940
     ccggcttggc gatgattctt gaggaacaag aaagactgct tgcttctttc tctctctcct     84000
     cgactgtcac cggccactcc tgatcgcaac atggacgaga agcctcagtt cttccagtat     84060
     ccagaggccc gaccgggtcc cgctgtgccg tacaagaacg aggagcaggt gatccccgtc     84120
     atccgtggct ttcccttggc cctcggcgcc actctgtaag tcctcctgtc tgacgtcctg     84180
     cacttcactc ttcttctctc tcggccgcag ctgcctaatc accatcctct atagtgttca     84240
     aaatatcggc tttatccaga gccatctctg ggggaccact ggcttcgatg tcatccgcaa     84300
     cctccctctc gaccaatact ccgcccgcta tgatccgacc gtgatccccg tagccagacc     84360
     tgatgcttcg gctgccgact tgccagttcc cacgcaaaag cgacaaagca atgcaggata     84420
     ctacacttct gccgactatg tagctcgcta tacttcgggc gagttgactc cccttgccgt     84480
     cgtcgagacc ctgctccctc tgatccgccg cgatgccaaa ccacccggca agcactcgat     84540
     cgcctttctt gaatcgcaag tcgacaagat tcgcgccgca gcagaggctt ctacacagag     84600
     atacaaagat ggcaagccac tgggtccaat ggatggcatc cccgtcgcaa ttaaggatga     84660
     agtacatatg gaaggatacc gacggaccct gggcagcaaa ctcgacttca ccggcgagtt     84720
     tagaggcacc tcttggtgtg tgaagcaatg ggaggaagcc ggtgccattg tcattggcaa     84780
     aaccatcatg cacgagttgg gtctaggtga gtagtgcaac tcccaacata ccccatccga     84840
     accaactaac caccactttc acccccccag acaccacaaa caacaaccca aatttcggta     84900
     cccccagaaa cccccataac cccgactatt actgtggcgg ctcctctgga ggctctggct     84960
     acgctgtcgg cgcaggccta gtccctatcg ctctaggcgc cgacggcgga ggctcaatcc     85020
     gcatcccggc ctccttctgc ggcgtctggg gactgaagcc ctcccatggc cgagtgagcg     85080
     gctctcccac cgtctcactg gcatccacca ccggcgtcta cggcccccta gcctccagca     85140
     tcgacgacct agccctcgcc taccgaatca tggccacgcc ggccccagaa tcctcagacc     85200
     ccctatcagc agccttcccc tcacccctcc gcaccctccc ctccccaacc aacaacaccc     85260
     caagaaccat cggcatcgta cgcgactgga tcgaccgcgc ctcgcctcca gtccgcgccg     85320
     tcttcaacgc caccctcgac cactaccgca cgcttaagaa ctacaccata atcgacatca     85380
     cgatccccta cctccccgag gggcaaaaag cgcacgctct aaccatccta tccgaagtga     85440
     cctcgtccct caccccttca cagatctccc agctcacgcc cgccaacaaa atcatggctt     85500
     caatgggcat gtggcaaatc aaaggccagg atttcctcgc cgcgcaacgt ctccgtaatt     85560
     gtctcatgat gcatctggct cacttgttcc agaaacaccc tggcttgatg atcgtcacgc     85620
     cgacgacgcc tatcccgggg tggaagatcg agggcggcga ggcggatctt aagcgcggcg     85680
     tgtcggatgg gaatacgacc gttaggaata tggagtatgt ctggttggcg aatttcacgg     85740
     gttgtccggc gattagttgt cctgctgggt atgatgtttt ggatggtggg tcgagggtgc     85800
     cggtgggggt tatggcgatg ggagagtggg ggagtgagga ggagttgatt gcgttcgcga     85860
     gggatgggga gggtgttttg gatgggactg ctgctgctga tggtatggag cagagctcgg     85920
     ggttgacggt tcctcggggg gaaagggcgg cttgggagga tgttattgct aaagctgggg     85980
     agagaagatg agctcttagg tttcgatgta gtggtttatt tcgggatttg tggtcactct     86040
     aattagtcat accatagtga ccaggagttt ataactctga cgattctaat aataataata     86100
     tgttcgatta cgccgttggt atctgctaaa tcacatgatg caatagcaaa agggtaacga     86160
     tggataaatt tgcttcacga aagccgcgcc aaagatagaa ccaaagaagg tagcacatat     86220
     aaaaatgaaa aacaagggca agaggtacta taaaatgcag acaagccccc ctcacccaga     86280
     cgagaaatgg attcacaaca catggcccac agtattgtat agatatagct cgttgatact     86340
     gcatggtttg gtgtcacaag aagcaaggag cgccgaacat gttcggtgca aggcagacga     86400
     gccatgatga aattgcggta accgacatca gatcaagacg ctctcgccac gtgtgggaac     86460
     tcgaaactcg catcctagcc cggcagcttg tccctgggcc gtaagctctt gcaggatccg     86520
     ctcctgagga ggtgggccat cattcatatc atctttgata tgtatgatat agatcagtag     86580
     gccggccaga ggtggttcag gccattgaag cactgtgaga gggtctgaac tttctgccag     86640
     tgacacatcc ataccgactt cactaggtgc gtgggaaacg gctgggcttc cttccatgtt     86700
     ctcgtcaata tcttcaacag caactctggc acgggtatgg cgccgcgacg tcctggccga     86760
     tcctcgacga gagcctccac ctttctcgcc cgcgagagca gccttcttcg actttggact     86820
     gagagctggg tcgccggctg cctcaggggc actcgcgcgt ttacgttttc tcaccgaaaa     86880
     cgaatctggg tatttcagct ccgtaacttt ttgtgccaat acaatcaatt catcgatcaa     86940
     gtgacgtggg cacaaatggc cgtataagga ggcatcgtca acatcgtcgt tataggagca     87000
     ttcaatgaag accgctcgca gttgagaggc aacgatcttc ggcgctgccg cttcccacac     87060
     gcgtctgttg cgcggattca gtgagattga gtcaggttca acgtcgccaa agatgatcac     87120
     ttctcgcttt gtcgtaggct cacggatgaa gaaagctgac gactccacgg ttgcccagct     87180
     atccttaccg ggtacccgat agcctggcga acgtgctccg gaaaagtagc cggtctctgg     87240
     ttcgtcaaac gagatcgaaa aagcccttgg gttcagcctc attgggtcta caccaaaagg     87300
     ggcgctgctc atccggcgtt gaacatcatt gtcgacgcta gatctctgcc tgcagcaccc     87360
     gtgactgatg gccaggcatt ttgctaacaa gccctcgcag actcgtgtat agcctttctc     87420
     atcaccacgc cccatcatgg ggtttccgcc ctccatcaga cgctggtagg tcacaaggcc     87480
     agcaccgcca tcctcatcag agagatttgg ccaaataaca tcgttaaaca cgtgggtctt     87540
     tatggcagcg actaccgaag gcagggcggc cagcgttttc gcgccacttc cagcctccag     87600
     aactggcgtg ttgatggcga acgctgacag atggtctaga tgaggatgcg tgatgcagac     87660
     agctccgata atatgccgga agacatgggc tgcgtttgcg ggtacattgt tatgtggcag     87720
     ttcgagccca gcaaatgggc cctgatctga caacttcttg ttgttatcac acggttccag     87780
     agtgtcgatg atcccacaaa gaagggtgcc cgcatcaaca gctactatcg agtttgcgga     87840
     ccatttggtg gatgtggatc ggaccagaag tccagtgact ctatcctcac ggggacctcc     87900
     tgtcggaccc tttcaaggga agcgttagtg gccgaccttg aatgcgaaac ttgccagcga     87960
     taagatggta tgaggtgtag cgagagttcg agaacatggc gcggggagga atgtgagaca     88020
     tggcgcatcg atgctagtga tcgggctcgc cagccggcag attttcaggg tttgcagtta     88080
     tgtgcaaaga acaaacgtca tggccaaatt ggactgacaa acgcaggatg tgagacaaaa     88140
     cttaccaaca cgattatctg caaacttgga gagccggggc cttctcctcg gctagccgct     88200
     tctggagggt ttgctccaac aaatggcaat tcagacgctt gcatgtttgg ttgtgaagat     88260
     ggatcaaggc aggagtcgcc tgggcatcaa ttgcaccagc aatcgatggg atttggcttt     88320
     ccagtaaaat aaccctttcg gacgaactct agcccttatt tagagaacca cttggggtag     88380
     cggccggacc ttatgtggat accccaaagg atctggacca ggcgatcctt acgcttttct     88440
     atcaagtgaa gctataaagc agttcccaca agctgagaac tatcgccgtt gttgcactgc     88500
     gtatctgccc ggagaataag caagggccaa aatgcatata ctccacctag agcggctgag     88560
     cgcagatatt aaatgcacac caccctcgct tgatggtgca gatgtggcag tgggcggctg     88620
     taacctcctc ggattagagt tcgtcaagtc gagaggtgtt gtgaagatga agaggtggta     88680
     ctttcttcga tcttcttgaa gaactgcacg atgcttttca atttagatag cggtcaggct     88740
     ggcagccagg cctatgcgac caaagctttc caaaccagca gcgcgcctac tgttgggggc     88800
     ggcacttccc cgtaaatctg gggcaaagct gcgtcgcacc aggcaagtta gcgcaccagt     88860
     tgttggcggt cactcgctcg ccactgggca cctgcagcac gctaacgacc gggctgaaca     88920
     gatgattcag tggctggagg gggattcgga aatcaccgtt ggcggcaaaa gcaaaattga     88980
     gcgggcttgt acgagagcca atgagtaatg agaagtgttg tttaaaccga caagagtgaa     89040
     tatttaatac aagtgactcg cgtgagctca atataatggt ggctgttgtt gtatcaaatg     89100
     tgcagattga tggacgacga gaagataagg ttagtgggag gaaaagtccg accgagcaac     89160
     gcagcagtga agatgagcca ttgcagtacg gggaccagcc aagggacaag ggaggaacag     89220
     aaactctatc atgtgcgtat gtaccagagg atgaccaaaa ctcagtcgaa tcagtttatg     89280
     ggatgcccaa ggacaaatac aatcgtgcga tgaagaaccg gtggacgtcg tccagtgggt     89340
     acttgaagac gcatatctta cgtgcgaacg cagaaatgca atgtggaggt tgagaaacga     89400
     tggaatctga agaagaagaa aatgatgatg atggtggata gaggggagat ggagaggttg     89460
     agccgagtca ttgactggca ctgatcgatg acgcgctggt tgcggaagga gcaccattgc     89520
     aaaagtggct tgttctcaga aataattcca gcactgaaca tcactggata ataatagatg     89580
     aagatagcaa atattgggtc gaacatgtgg ggtggaaatg gggcaattga tggaccggtt     89640
     ctactactac cttgtacgat caactggcta cttagttatt gtacgccgtg ctaccgcagc     89700
     tggtagccaa tattcttgat acaaaaacat ccatttgccg ccggttatcc agcagcgcaa     89760
     gggcagatga ccactcgaat gctacacata cacacaaaat acaggaaagc gcagacaagg     89820
     attgatataa ataaccactg tatgtgttca accatgaaaa aatatactcc cagacaaaca     89880
     ccgcaataaa tccacccagt tcaagagcac ccatttttga cacgaattgc gcaagggaac     89940
     aaggtcatca ttggaacagc attgtccgct cttccggtcg gtcaaggccg agaagacccc     90000
     tgccgaccgc ctctcctcga agaaattgat gtcgaaggga gggtaggcat tacgggattc     90060
     ggccttggaa aggtttccca tggacctaac tcgagacaat tgatccaaat gacgaatgaa     90120
     gacagaaacg atcagaccct atatacgtaa aattcatcat tgccacatct agcggcgtaa     90180
     ccgtgaaacc taacccgtag aatccccgcc tgtggaacgc cgaccgtggc cgctaaaata     90240
     agggaacagt agtagaaata gaaccagtgg ctgaagcatg ccgtatacac atcaaagaga     90300
     cgctgcgcca ataactgatg aatagacgat aacaatagtt gcaggacctc ggtcgccttc     90360
     taacgattct cgttggcatg cgcgctgtga ccgtcccggt tgccaacagc agcgtcgtag     90420
     ctgggtatcg gaggctgttc gtcaaagggc agatcctcgc tgcctctccg actgccatcc     90480
     gggctggaat attcgggagg cgggacttgg tcgagatcgt tcgtatgcaa caaggggact     90540
     tgctctccat cgacgacatt ggtccgactg gatccttcgc ctacgtcctc gttcgacggg     90600
     atgtgggcaa gctgagccag ggatatatcg gtgggtgatc gcacagggcc gggactggca     90660
     gaaggcgcaa cacggacagt cgaactggtg cgcgcattat tggcatcctg atagacccgt     90720
     tgagaaatct gagctgcact ctcccgaccc gactctagca ggatgctgcc ttgctcgctg     90780
     ccgtaaggcg gaggcggagc cagactacca gtcatcgggg ccaggcccca tttcttgacg     90840
     ttggcctcaa tgaacacgaa gcccatctga ccaaagttca catggacgga gcaaggccca     90900
     ttggctccaa cagtggggaa gaaattctgc gctttatgac cgtggacaac gtcctccagc     90960
     ttcttgccat tgcgagtgaa gaaaattgta cccgagcgtg gtcgataccc cacaccgatc     91020
     acatcacctt gcaaaaggtg aggaccgtac ggtgttggtg caaatggctg gttgtgcctc     91080
     ctatgaccgg tggactggta tgcgaccgaa gtcttgtgga agcctgacat cataagaaac     91140
     aaaattagcg accgcggaca acccatatcc tcccccaaac aagttgtcca agaacgcacc     91200
     tggtaatttg aacaaaggat acggtttcgt agtcatccca atactgataa gagtattatc     91260
     aggtttgtcg tagatcttag cctcccagta atagacgtca ttctgtttcg gaacgggcaa     91320
     attggtctgg acactgcatt ccgagtcgta gaactcgatt tccgtacggc cttcgacaaa     91380
     gcaattggcg atttccaact ctggttgaaa ctcccaagcc gatactcctt tttcttgaat     91440
     cgcgaggaac tgagagagtg atatgtcggt ttgtacggac tcgggcggat tggcttcgat     91500
     aaatgctatg tgagagatca gcgacaaatg cacatacgtc atgtcttaca agaccccatg     91560
     gtcgtcgttt gcccaaagga gcggacaaag agccagtgac ttacccttcg ctctcatata     91620
     ctccgatcgc gtgaggtcat ccatcgtctc caaggcttcc gcctcctcgc gcgcaaacgc     91680
     ttgctcatcg tcgaattcac ccggtcggcc gatgcgatcg agaataattc taccacgctg     91740
     agtgtatttg aagaaaaaga aaacagcgag tacaagcact gcaacggcgg cggatccaaa     91800
     ggcagagagg acgcctatca ggataccctt gccggtagaa cccgacgagt tgccactgac     91860
     gctaactaga ccgccattgc cttctgacat ggacaacaag acatgttcaa tgttcgaggc     91920
     gactagtttg ggatcggtcg gagggggttc agaagcagcg gtgggattga ttccaaggga     91980
     cgtggcaaga gtcgagggag catcaaagag agcaccgggc cccgatgcct cagatccccg     92040
     catcgttcat tgactggttg gaggtgttgc gtcgacacgg gactcgctgt aacgctaaac     92100
     tgaatattat tagataagga gggaaagcga cactagggag attggcgggt ggatgaaagg     92160
     tttaggggag gggaaggaat gagagatgga aaagttgaag aggagtgaat gagatgagga     92220
     gcgatgatga gggagttcaa atggggagag ttggaggtcg ggaccagaaa ccaagaagca     92280
     gaagcccagg aagagagaga gagggagaga gaggcgcatg tggggggcga aaggcagcga     92340
     cgcttccggg cgatgcgctc gatgctttcg gatgacaaca ctcaaggcat gttgtgaact     92400
     cctgaaggag atacagacat tagatgggcc acgtttgaga tcagatacac tctacatatg     92460
     cctgcctgcg gactaagttg ctccccaaat aactgtccat gcaaggtccc aagcagtcca     92520
     gggaaaaggg atgagggact cgagagtccc ttggatgcct gatcagggac ttaatcgccc     92580
     gtcactcttc aataataatc atctcacatc agagacgtat ctcttgtctg taagatactg     92640
     tatcaacagt ctggccaggc cattagtcat accaaatatc tcgtatttta gctgttccat     92700
     ggcagtaaga atacaaggcc cggtcaaaca tgatggaact ccgccggaga ccctgtctaa     92760
     acccgataga gagacgcaat cgctggctgt cattcctctc cctctccctc tctctaagcg     92820
     ctgtcttatc tcccccagtc cctctatctc ccttcctata ccttcaatca ggtccctcgc     92880
     ctctgtgaca gtcctgtctc tataggcact tccattccca ctctgcctgt agattgtggt     92940
     aagcaacagg atgcgtgttt caatcccgcc ggagcttgtc tcgagccttg gtgcctgcga     93000
     tctccgcgta acagtgcgcg gcgaagggat cgataagtat ccaggtatgt ctcatgttgt     93060
     gacccccagg atatatactc tttcctccct cacatttatc attcccctcc tgctttaatc     93120
     ctgggacgcc cgaagactaa caggaggtcc tggcgcagcc aaacaacatg cgcgcaaagt     93180
     ggccatgaag ctgggagtgt ccagcggcct tatctacctg gttgggaaac caaccatcaa     93240
     ttggggggat tccgaccaac cacaaccctt tcgacaacga cggtacttct actatcttag     93300
     tggagccgat gagccggact gctatcttac ctacgacatc aacaatgact tactggttct     93360
     ttatgtcccg gacttcgacc tacaccgcgc aatatggatg gggcccacgt tgaccacaga     93420
     tgaggctgaa cggcggtttg acgtagacaa agtgcgctac tatgcttccc tacagagcga     93480
     tatccagtcg tgggtaggga aatacaatga tgccgcccca gtctacatcc tccatagctc     93540
     tcagcagccc caattctctg tccagcagct tcacatagat gatcagcgct tgctacccgc     93600
     aatggatgca gcgcgggtgg ttaaagatga ctatgagctt cgtatgatac gccacgccaa     93660
     caagatatcc gggttggccc atcgcaaagt gctcgagcaa atccacaaga tgtccaatga     93720
     agcccagatc gaaggccttt tcctcgatac ctgcgtatct cacggagcga agaaccaagc     93780
     atacgaaatc attgctggtt cgggacccaa cgcagccacc ctccactatg tgaagaacaa     93840
     cgagcccctc aaaggacgac agctggtctg tctggacgca ggtgcggagt gggagtgcta     93900
     cgcaagtgac gtgacccgca catttccttt ggccgccgat tggcccagtt cacacgcccg     93960
     cgacgtctac caaatcgtgg aagagatgca ggagcagtgt atcaagcgca ttaagccagg     94020
     tgtgcggttt cgcgacttgc aggttcttgc ccacgacata gccattagag gcctgcagaa     94080
     gctaggcgtc ctcaaaccgg gcaccgtgga ggagattcgt gtatcggggg cgtcggccat     94140
     tttcttccct cacggattgg gccatcacgt tggactggaa gtccacgacg tgtccgaaaa     94200
     gccaatcacg ggaatggggc tgcctaacag accttgcaga cctgacttca tcccagccat     94260
     gagccagtcg gtccccctgc tcgaggaggg catggttgtc accatcgagc caggcgttta     94320
     cttctccaag ctggctctgg cgaattctcg gaaattgcct caggcgcggt acatcaactt     94380
     cgacgaggcc gaaaaataca ttcccattgg tggcgtacgc attgaagatg atatcctggt     94440
     cactcggaca gggtatgaga atctgacgac ggcgccgaag ggcgacgaaa tgctggagat     94500
     catccggcgc gggatcgaca attagccgag ccgtcatgtc aacgattcga ttttgccttg     94560
     gcggtaacaa gagcgactct cgtttcacag tttctccatt tcccgtcagt gtatgacgat     94620
     gatgtagcca gtctagaccc tcttcgcatt tctgcttgtg tggagcgttg ctgtaccact     94680
     ttcaattacc gagtcgcacc aaaatggcat gattggtcgc tgaacgggac tgctctctct     94740
     tcagcagtct cgattccgtc agaggcgttt tccacactcc atacctccct tcctcctacg     94800
     tagtgtgtat cccatcttca tctcctttct ccttggatag ccggaaaaag tctataccac     94860
     acctgtactc agtaggctag aagcaaatct catcaccact tacctagata cttaccgccc     94920
     attgtcatct catatcctca accaaggaac caccaaaacc cgaaacacaa catgaacaaa     94980
     gacacacaca cacacacata caccagatga aacaatctct cccgtctcag gcacacatac     95040
     acacacatcc tcatctccaa tattagcaac aacacaaaac aacacaacaa aagtccccat     95100
     cggaccgcaa ataaccgccc ccatccatcc accacccact tcccttccct tctctcccgt     95160
     attgaacttc ttgtctagac ttcactcgca gtctagaaaa cccacgatct ttccacacga     95220
     ctccacatat taattttttc ctttccttta cgcccccatc gtaagccaca aaagggggcg     95280
     gtagtagtag tagtgtggag ggtggagtgg gtttttccgt gccctagggc ttgcaggtac     95340
     acagtaagta ctaagtactt ttggttactc atgcatggac aacaacatca gcagcagcag     95400
     caataataga cggtggtaaa agggggaggg gagggtttgg atgggtcatc agggctagtt     95460
     ggtgagttag ttcgttcatc gtgttctcca tttgcggggt ttagagaaat gggacttcga     95520
     cggtagtgtt ggaaacggag tctcggggaa gacggaagga gatgggatga ggtccagtgt     95580
     gcccacgtag actgttgtct tggggtcggt tagttagtgc aattgggttt cttttggtga     95640
     gagtgaaaga ggtgaaggga gggagggagg gagagaggga ggaagggtaa gttggtttgt     95700
     ttgcgagtga gaacaaagta gatagttggg ccacgttcgt tggaagtacg tggttggagt     95760
     agagtagtta tactatagct acagctgtgc atgtaagtag tgagtggtag gttcgcagtt     95820
     tgcttcctgt tttccctgca gctacgtact acctaaccaa ccaaaccata gtaaacaaac     95880
     aaacgaacag gaaccctact ccgtagatac ttagttcagg catacaactc cctcatgaat     95940
     atgccagtaa aagtttgata tccactactg cagtatattc gggcatgcat cccatctacc     96000
     tactggagac ctgtctgcca gatggcttgc cagccacgcg ctacgtagtc gcatatcgtt     96060
     atggtttgtc cgtgtccgtc cgccaggaac aaacaaaaaa acacgcattc atgcacaaag     96120
     aataactatc gatgccaaag gagtatagtt gggacatgtg tcaaggctgg attagagcca     96180
     cgaaagtcgg tcaaagcaga atttttccct ttgcggcttt ttcatttttg tgccgagatc     96240
     tgcagagatt tttttctctt ttttgcgccc ccaaggtaag tgtaagtttg tggggggggc     96300
     ggaagtcgat gagattgagg gatatacctt gttagttagt taactggttg ggtaggatgt     96360
     tattgatgcg gtttgatcat tgaggcatta tttattctat tgggattatc gaaaaaggtg     96420
     aagagtgtag taagtaagta gttgatccgg cccgtcaaca atggatcgac agaaagggaa     96480
     aattggatct agaattattg atcgattccc gcacaattaa agacagacta ctaccatcta     96540
     agtactacta gtagactatc tatcagccat gccgctatag atcgacgcgc ggagtaaata     96600
     ggaaacaata tgtgacaagt ttgacaactg accaaaagat gcccgatttc ctccgtagtg     96660
     aaagatgctg ccgaagcagc cgtggtagga tgttgttgtc atctcctgac tgactgacgg     96720
     aattggactg gctttgacga ctaatgcaag gtaattttgg cgcgtcataa tacccgctcg     96780
     gcccgtacgg catccacccc tcgccactcg gccaggctga aacggcttgg ataggtgcgt     96840
     ggttataacc agagtcctcg ttggtttcag ttgtaggcct gccaaatggg agagacaagt     96900
     gcgtggttat agatatgact aagagaaagc tttgtcgatc tagatcacat gacatcacaa     96960
     ctggggacag cggcatcgga gacgggtttt gtattgtaaa aggagtacct tgtttgctca     97020
     tcgcagagaa aatttggctc attcggggcc gagaacttcc tttgcatggc gtcagaccac     97080
     tgcattttgg gataatattt tgcaaatttt cgaaaattct tggttcattt ctcttttgag     97140
     cctttgttta acgtctcctg atatctaata attccgttta atccgattca gttgcaccgt     97200
     gggtacagac tgggccgcat taaaattctt ctttgtgttg cttcccttgc caggcgcaca     97260
     gaactcaatc agaggttgtg ttaggcagct aggctgaacc agaattttct cattcattgt     97320
     ggaaggcagc gaatagttct tactggttcc atcacgatgc tgggaaaaag aaaaagggta     97380
     taaccaagaa tagtagtaga ctaagtaacc tagacttggg tcggggagta gtgactcagg     97440
     agaaccctaa ttcgtgaaac ttctttgtac ggagtcgcgc ccttgtgctc cgtagggcca     97500
     ctcgatgatt tggtgcgagc taaatcacta cgcaatcacc gttctccatg agaccacatt     97560
     tcaccatcgg caagcagggt taggtatttc tgcttctaga ctgcatcaga gtggagttcg     97620
     cactcccgaa ggtaggggga tgcttgagtg gatccccccg agccggatgt gaagattttc     97680
     gtcctgcttt ctgtgccttt gtaaccttat tgggttatag tgagtcacac cactgctttc     97740
     cccgtttcgg caatcgttcg ggttgcgcca ttctccatcc gccatccgca tctatatata     97800
     cgcctgctcc ctgttcatga tctcctgatc cccccttggc ttgggttttt tcctcacctc     97860
     atctcatcct tcccaggggt gatggtcact ccttcctttc tatcgactta gtataaaaaa     97920
     gcctcttcgg acaatagatc ccctcttact ggggactatt gtcttgaaaa tacccgctcc     97980
     cctactacac ccttacgacc tacaccccga aaagcaagaa aaaaaaagtt tcaacaagct     98040
     atatcctcct ttttcgccgg attggacgga gaatgggcca gagacataat cgacgtcgca     98100
     cacgaccccg atctcgaaac cgcagcgcca atcctctact tcttccgtcc caacctttcc     98160
     cacgacctgt caacctctgc gctccagctg tttcctccgc tttcgactgt cctgaaatac     98220
     ccgccccgac ctggcactat gggcatttgc taggacagaa gcgtgatcgt gcgctgagga     98280
     tggaggcttc tacgctggag gcggaacagt atcgcctctt tggcggtgtc ccgggcgacg     98340
     atgttggtct ctgttatcgc atgttggagt acttcggtgg actcgattat atcgattggt     98400
     gagttgtctc aaccgagcaa tcagcgttgg acgagcaatg actaacagtt accgcatagt     98460
     ccacaatcct taaacgcact acctgggtga ctttaaccct gcagacgtca ttgggctttt     98520
     ttgcagcaat ttcataattg tcgtccaggc ggtggaaaaa ataatatttt caacaaaacc     98580
     aaaaaaggga aacgaaggca tacccaaacg gcacgcaaac ctcaaccgat cgccagcggg     98640
     ccccatcccg acattatcga aaatcaaaat ccgacatcag cgaaaccaga acaataccag     98700
     ccctcgaaat aaaagcgcga gaaccagttt tcaatggagg acccaagtca gtgacttgta     98760
     gcaatgaaga tcccctctcc ctgtaagaag ggagaggcgc gattggattg gtcttttgaa     98820
     aggcttggcc atgtgaacgc tggcatggag gaaaccggca cgcttgcaac gtcgagatca     98880
     gagggtctgc catgtcgagg gcttattcgc tttcgtgggt cgagttcgtg cccgacccag     98940
     tctccggtca ttttggcgct tgaattccct gcggagcggg taagtgactc acattgtgca     99000
     gattcttttt gcatttccgt ctgtctagcg tgtaggggac tccgttccca cgctaatatc     99060
     cagagctggc tctgatgctc gaaatttatg aggaaacgaa aagtaccaaa aagtttggga     99120
     tggcgttcta aaattgtcca ttcctgggat acacaaaaaa gagggataca gttttatgat     99180
     gaaatgaagc ttggatgtga catgcttgta tactctaaac ccggagattt cctgtatcct     99240
     agtagataga cctgagcgcc gtacagtatc agtatgtacg gcttgacatt agtcaaaaaa     99300
     atgtcaccat gataattcat tcatacaaca gtccagctaa aatgtagtca tcgcaataag     99360
     agtcatcaag gtactagtta gtcacgcctt gcggaggact agttagttaa aagtcaaaag     99420
     tagacccaaa actaagcaca tgaccctgaa agcctgaata attgggacca agccaccagt     99480
     tccattcagg caggcggtgt ggccccccta cggccccgta aaggacacgg tcgatcacaa     99540
     ggtacagccg acgccgatgc ggataatccc atcttgtcga cagttactcc ggcctactct     99600
     ctcgccttcc ctccatcttc cacactcttt tgtcacgcct gacagaggga taatgctcct     99660
     ctattatact acttgaatcc tgtactaatt gccttgatct gctggacata tctgtcacgc     99720
     agcgaactca gtgtccggga gacacttttt tgtaccagtc ctgcccgctg cgggcgaccg     99780
     tgtccattgt gaaattgctt caccatgtct accgactaca attatgatga caaggttagt     99840
     cgcctattgg atcggacgcc aataacgcac cgtaactaac atatccaata gggacaattt     99900
     ttcccgttct ttgtcctgac cctcaccagt cttgtcacac tccctctcac atacaacctt     99960
     ctccgaccga gcaagggttc gtactagcct tatcccctct ggacactcgc gggtatctgg    100020
     cggttagatg tgatctgtac taactgtccc atgtccgctg caggtctcga aaataccgct    100080
     ccccggataa agtccgagtt caagccagaa catgcagagc ttattgaggc gcagaagcgc    100140
     aaacgcttgc gcaaagagcg ccgcatcaag cgcataatca ctgttgtcgt gggttacgct    100200
     gtcatggcat ggatggccta tttgatcgtc gtcaccgcga ggactgtgcc caaagtttgg    100260
     gacccttatg acattctggg tgtttcaagg gtgagcattc aaccagtcca cctggcgttt    100320
     tggtcgcgtc ctccaataac ttatgtagct gtactaactg taataaattt cagagtgccg    100380
     atgagaaagc tatctcgaga cactacaagc gcctctcact tatctatcac cctgacaaga    100440
     tccgcccgga ccccgcaaag aatgagacta ttgagatgct caacgagcgt ttcgttgagc    100500
     ttaccaaggc atacaaggcg ctcaccgacg aggaaatccg caacaactat atccagtatg    100560
     gccatcctga tggcaagcag agcatgagca tcggtatcgc tctgcccacg ttcatcgttt    100620
     cggagggaaa ctccaagtac actctgctgg tctacggtgc actgcttggt gttttgctgc    100680
     catacattgt cgggaaatgg tggtatggct cccagcgcta cactaaggaa cgcgttcttg    100740
     tcgcaagtgc cggaaacatc ttccgcgaat acaaagagga cattaccgat ggcggcatcg    100800
     tcaacgccct gtcctccggc gcagagttca gggagatgct cgagggacct aagatggatg    100860
     ctggactggc caagcttgag aaaaaggttc tggctgagga ttctaccttc ctgtcgcctg    100920
     aggatcgcga ggttattaag ggtctggacg aatcgagcag acgcaaggct ctggcattgc    100980
     tgtgggctta ccttggccgc gttgacctgg aggacactac actcaacgga ggtacgtgat    101040
     tttgcatcca atgcgtctag atgatctgct aacattcgtg tacctacaga gaagtacgaa    101100
     gctgcaccaa tcgctctgtc gctgaacgaa gctttcacag ccattgctct cgcattcggt    101160
     aacgtccgac ccatcctggg ttctttccgg acctcccagc atctcatcca agctgttgcg    101220
     cctggctcgt cgcctctcct gcaactccct cacttcacgg aggaagttgt caagtccgtt    101280
     gagggtgccg acgcaaagga acacttcacc gtccagaagt tcatgagcat ccctgaagac    101340
     aagcgtcgca gcctcactgt cggcgctggc ctcatgtccg aggagcagta cacctccgcc    101400
     gtaaccgtcg ccaagcagct ccctgtcctg gaagtctccc gtgccttctt caaggtcatg    101460
     ggcgaaaagg tcatcacccc cagcagtctc gtccaactgg tcgtcaaggc ccgcttcatc    101520
     cctcctggct acagcgcgga cgtcccgcca gtcaacccca ccgacctcga agacatcgac    101580
     cccgacgaag acgacctcga cgccatcatg ggtcgcaaac ccgccaagaa caagaccacc    101640
     aagctcgtca acggcgtcaa ggtcgaagag aaggtcgaaa ccatccagcc tcccctcgct    101700
     cacgctccct acctggcccg cgaccactcg ccccggtggc acatcttcct ggccgacgcc    101760
     aagcagggca agatggctgt cccacccttc accttcacca ccttcgacaa gcccctcttc    101820
     gacaccgacg gcaagcccac tttcaatgtg cagactctca agatgcagtt ccaggctcct    101880
     ccccaagtcg gtgactttac tttcgtcctg aacatgctct gtgatagcta cttaggtctg    101940
     gacactaaga tggaaatcac ccttcacatt gatgaccccg ccaaggcggc cgctttggat    102000
     gaagaagatg atatcagtga acctgacgag ggtaagccac tttccccctc tcctcccgta    102060
     accctttctc tcacagtact taaacttgat actaaccaac atgatgtgat atagactcaa    102120
     tagccggcca aatgcaagcc ctgaagaccg gccaaccacc caagaagaag accaagaagc    102180
     cctctgacga ctccagcgac gatgatgaaa gtgataccga cggagatgca ggagatacca    102240
     gtgacacgaa cacagagacc gatattgacg actaaagcaa gtaaagtgtg gggattagga    102300
     ttctccaagt agaggaaaga gaaagaaaaa gaaaacaaaa tcaaatcaaa tcaaactcat    102360
     tttatacggg atactactac ttctgctgct actatactac gggagttttt cagctgctac    102420
     atccaaggga tcaatgttgt gattgtgtct catgtggatg gagtattttc agttttgcat    102480
     ttgcattgtt gttgcttgtc atcattatat aacttactta cataccatac cataccattt    102540
     tcgcaatgaa agcagagaaa tttttcatat tttccatatt caatgtcttt tattcttatc    102600
     cattaggatc catttctaat ttatggtgta tatcagtatt ttcgtattga tcttcccctt    102660
     ctgatcgttt cttgatcatg tccattttat tacccgtagg tagtgggtaa gttggaaagt    102720
     aagtaagtac tcttgttctg atgtaataag taatagtttt tattcagtct gatgttatgt    102780
     tttattttta ctggtgtcga tttattacta ttaaatcaac tcttcaactg cacttgtggg    102840
     gcaattgcat aacgtgtttg tgtggcttgc atgctggctt ggcttcttct gggtctacag    102900
     tagtagtgga ctagtcagca cccctcccta gttaactagc taaccaacaa tgatgccctt    102960
     gcttagtagt tgctgactga cattagtagt agtagtagta gtagtagtag tagtagtagt    103020
     tatttgctgt atgggttaga cgagatgggg tgcaaagggg actaattcaa ttgaacgttt    103080
     gttcgattca ttcatggtac gtgcatgtct gcgggaccaa accctctaat ctcgaggggt    103140
     tgttatctgc tcctattgat gcatgataca tggtgtatat gtatgttgta gtaaactgct    103200
     cgcttatcac ttctttgttc tgttctgttc tggggatata tgagaagaga aagaaaagaa    103260
     atgtgaccag aaacttgaaa gaaggaagga gatagggcat gcgagtagag tagaaagagt    103320
     cggtgtatca agtctgagag agactttgat ggtgaagtag gggcctgtat aggggcccag    103380
     atctagtagt aaagaacgca taagtcgagg aaggtcaagg aacctaaccc ctcaacgcct    103440
     gtgaccttgc ttgtacatgt cagtggatcc tgtctcggct ggcttgagcc gagcaaaacg    103500
     ccgtgccggg tatgatatga tatagaataa acattgccga gagtttcaca ggtactccgt    103560
     aaagggctat gatagagaac aataaaccgt acgcagcacg atacagagct aaagaaagca    103620
     gaaaaggcgg ccaagaatgg ctgtcagcct gtataatgtg catgtacaag gaatgagata    103680
     tggacggcga cagtcaggcc tgtccaatga aagaaagtgg gtagaaagaa gagtatgaaa    103740
     aggaccgcag tcacttgata gagatactag gatatgtgac cacccctatc cacatgtata    103800
     tgtccaccca gatggaagag atgggtaaac aggctgctct gctggtacat ggaggttaaa    103860
     gtcattcatc atgacaacag ggaatcccga tgcggatgtg ggctggtgcg agcctggcct    103920
     ggctgccact ccagtttcta gacgggcttt cgtgggccct tcatcacagc tggcagccat    103980
     atagtaatag aggggatgtc catggtcggc catagaaggt acaacttccg ggcatttatc    104040
     ttcactcgag aggccatgtg gctccaggtt tgttcggggc aaagtcatct ggtggtatcc    104100
     aggatgagag taactatgat attgtcccga gtgaaggggc tggacaggtt gcaactccca    104160
     tttccaaggc tctggcccct tggaggaagt aggagtgata ggactgcaac tactgggagt    104220
     aggatccgga ggagtggccg gttctggtga gggatccgtc gtagcactgc agtccgtcga    104280
     ggtagacagg aaccgcaaat accgcaggtc ttcagtatcc tcctcgggct cctctggatt    104340
     ctcttcggcc tgtttgatca atccgagacg gtccaggatg gcatgagtta gaggctgacc    104400
     gtccgagagc tcgacgagag gctcgccggg aaatccttcc ttgtcaatgc acagtttgta    104460
     tagcctttgg agcgccttga caaccagcga atggtgtgat tccagcattt caacgaatct    104520
     attcacactc acagagaccc gtcagttttg tcagtccata aagggagagc acactaagac    104580
     aatgtagaat agaaatcagg accttaccct cgagagtata ctttggtctg tgtggccttc    104640
     cgttcccgga acagacacgg atgattgtag gccgaacaac gattgcacgg ctgtttccca    104700
     tcacactaac atgaatgagc atggctggcc aacgatatag tgcgctgagg ccagggtaga    104760
     ggtgaaagat gacaaagaag agcccagtac ttcaccaacc ttggtcttct taactctgca    104820
     acgatcgcaa gccttcagca catgcttgcg tttgacacga aagacgcgct ggtcatgctt    104880
     gtcatctccc agtcctgcgc gagactcaag ttgcgataaa gatgatactg cagcaagatt    104940
     gtagatggcg tctgggaagc ctgggatatg cgatttgggt cgcagtttag gctgcctcga    105000
     catcttgcag gggattctcg gtgtgcagtc aagataacaa cagagagatg aaagaaagga    105060
     acctttgcgc acacccacag agggaaggaa cagagcagga agagagttgg agggggaaga    105120
     gaaaagaggg cagacgaggg aggaggggga gctctgatag tgatatgaga cctgactaat    105180
     ggctaagtag aggaaaagga gggggagggg taggtagatg aatggcagat gctggagcaa    105240
     agcaagcaag caagcaaagc taagcaagca ggtggggtgc gagataattg caagggggga    105300
     aaggaagagg aggaggatgt ggcagaagag gaggctgaga gaccaagtct tgtcttgtct    105360
     ttgaggactt cagttgatat cattttagtc attttatgcc agcctgtata tcgaatgccc    105420
     cgcacctccc ttggacctcc tgctacccca ctcaaccccc ccgagacgta tagtatcaac    105480
     gcctgagaag aaaacgcgct ggtgacgtgg aaaaaagcgg cctgtcacga tatcgaccgg    105540
     caccggtcgc tcgacgtcct tcaggccgtt gtggctgtgg cagcctagca ggtacaccag    105600
     gggtccccgc atatctggac agatatgctt gacaaaagcc cacactctgt ttgtttgctg    105660
     atacaggtga ccatcccccc tccccccgat tttgctggcg cgagacacgc caggcagtca    105720
     tgcctgtcga cggtccgagc cgtcagaacc agagaatgtc catggcaccg ctcatcggca    105780
     ctagccgggc acaatcctgg tcatttgggc agcgaagcgc agagtgagcc ttcaagctga    105840
     ccttcctgcg ccatgccagt ggtggccttt ccgtatcaag gtagaacagt caggtactcg    105900
     tctcgtcgcg tcataatctt ttgcgacagc ttggtcgctt ctgtattccg tatcttccct    105960
     atccttcgcc cgtcatcctc ttggttttgg ttttgtcagt gctgcttgct gggtgagaca    106020
     tggccatagc acaggagtac cggagctgta gactcaggca gggctcggga ccgatgagga    106080
     aaactttgat accacagtct gtctggcagg cgcgtatcga atgatttgcc agctgccatt    106140
     ggcacacgga tgaccggctc actaacactc tgactaccgc catgcaatcg acgagcgcgt    106200
     gctttacact gagttcagcg ttacgccaag ggcgatgagt cggcgttggc ccaatgggtg    106260
     cggcctgtca cttgcttttt cctttccaaa atccaacctt tttttttttt ctcttcccct    106320
     ttcctttttt ctgtgttgac tattttttcc ctttcccgca gattttcggg caatcacctg    106380
     cacaggcatg ttctgctcaa ctaggcctag tagtaagcaa agaacgtgca gcacacctag    106440
     aaataataat aataatcaaa ggaaatgacc gcggcaaagt cgggtggcct ccatccagtc    106500
     aagaaaagcc gcataatgct ttttgttcat cgacagagct agttaatcat tctgagcttt    106560
     gtaagcgcag tattgtaagt agactgtcta aaacaggatc tggggtctat gtatcgctaa    106620
     ggtccactcc cgtcatatca gcgacaccat tcatggtgtg tggcgttgct gtcatgtcga    106680
     aaatgatagc ggcacgataa tgagccctgt caagagatca cccgaaaaat aataataata    106740
     aagatatggg aagacaggga tgccaatcta tcgaatggat gccccgccaa ggtcactggt    106800
     aggatgcgtg caatggcatt gttggtgaca gaagtgtaat aaacattgag taagcgtcag    106860
     cgcatcaggc tgcagttgac ttgcaaggtg cagaggggtt gcacggcgtg cgcttattgc    106920
     atctctgcac gagccgagtc cgtcaaaaag ggagaaaaaa aaacgagtat ccgtgcatgt    106980
     tgacctgtat cgaaagcgta actggagtcc agccaccgaa aagggagccg ggaaaaaaat    107040
     aaaaacatgg catggacatg gataatcgaa ttacatttga ttaaaaatga tgcctccatc    107100
     ctatttttcc tgcaatatct ctgattgttg tcacattcgg gccacacaat gtgtcatgga    107160
     gtcgactcga gagacttgat acgagatcag gcaagcccgg gccacagggg atccgataac    107220
     accctcaagt ctttagcagg accgctaaga gcagggcagg attgttgtga tttcccctct    107280
     ttcacccgct ttgaactgag gggtccgagg atcctgcgtg agtgcaagtc aaaccgcacg    107340
     ggcgacttgc agggaaaaag gtccgctcac ctgcagggcc ttggacctga acggaggggt    107400
     tggttgatag ttcagtggtg gtggtggtgt tgattgaatt ctctccgtct gcttaacctc    107460
     gtcccctcca atttgcccta ctgaaaataa acttccgtca aaaaaatgtt gaatccttac    107520
     atcaggaacg tactggggag actgtggcgc aggcaaggcg cggggcattc ggaataggtc    107580
     atttatgaca gtcacccctg ctgaaggtta atctcaactt gcgagcatcc cgtcgatcag    107640
     cctgggcatc gctcaggatt taggcagaaa atatcagaca aaaggatagg atattgtaaa    107700
     aagtcatgaa atggaccgaa gacggaagga tagagagaga aaccgggatt ggaagacgag    107760
     gagtgcggat ggaacgaagc acgacaagag cagccgaacc agaagtggat ggattggagg    107820
     aagaaagact gacggattga tgcccggcct gccaaatgga gccaatcacg gcaacgtgac    107880
     ttttcttcct tactactgta tcccttctcc ccgtccacaa tgactttcca gtgcgactcg    107940
     ttcgcttgtt gtgcttcatt ccttctccgc cttccttggt tgttatcgtt attgttgttg    108000
     ttatgaccat ggtatcgttg tgctatcgct tttgtccttc gccagaaatc gtctcccatc    108060
     ccgatgcaca gcgtcatggt cccatgacga tcctcctcat gactgacaca ccgacaacaa    108120
     cagagacact cacacccaaa aaaaagagac tcatagcttt gactgggagg caaaacagag    108180
     agagaaattg atagagcgcg caacacgaac cggtgagaac ttcgcatcaa gtctatacat    108240
     cccaaatctc tgccgcgtgc ccaggcatcc tggtatcacc tgcattgcat gacataacct    108300
     agcatgatct ctgtttacat ttccttacaa cgggaaaacg gccaagccaa tgggcaatca    108360
     aagaaggcaa tccttggttt ctctaaacct gaatgagcgg cagggattca gcccttccca    108420
     tatggcaaag agtgagtgaa gcccgggcga ttgtggttgg tctacaccgc agtacagtag    108480
     tgctgatgct gggatatctg tggttcggga caggcaaccc tctcggcccc gaagagcatc    108540
     gcgcagatgc tgaattgtca gactattcaa tgggtaatgg tacatacgta ttcgcgccga    108600
     cgggtgaatg cgcggacacg cttgttttcc cactcgtggc tgccacgaaa gccagggcta    108660
     tttcctttcc ctttcttttc tttgctttca tcatttcttt cccaccgaga ggtttccgtg    108720
     gcgataccag ttatgtagta ttccggccaa ctctggctac cagatttctc tctgagagcc    108780
     gcttctgcgc ctcctcggaa gagtttggcc aacctagagg caacaaaccc gaggagatgc    108840
     atcgtgtcca catctgcaga tcaagaaaac gaaagcaccc gcggacgtcg accgatgctc    108900
     gatacggagt gccataactc cgagacccgt gaccaaggga caaatatgcg aaaaccggag    108960
     tgatctggag tcaaatcgct actactcgtc agaagccagc tgaagtcccg gaataagcaa    109020
     acagaggcgg ctaatcacaa aaagatctca tacaaaatgt tctcaacgag caagtagaca    109080
     ggtcaggtat ggacacgaag atcgatgtta ctctttctgt gcagtgagac ggaaaggggg    109140
     aagggaataa aacagagacg caaattagag aattgtgact ggggcaataa agtagtatac    109200
     atttactatt taatagttac ttgaaccatg ggtcagccaa tagaaatcct cgaattgctt    109260
     tgttccagct gaccacctgc aaagtagaaa gtgtcggtca agatttattg acggttcatg    109320
     ccaaacctcc ttactatgat tctctttttc cctcatatca agtatgccag taattcataa    109380
     cattaccaat tcacaaggga ggactatgaa agaggaaacg aaaaaaagac gggaggccag    109440
     actgaacgat ggttggcggc gcgttccggc atcggatctc acctcatatc atgggttgtg    109500
     gagtagaagt ctttctatat tgaagtgata tgtatcgtac acagaatcag cgccaatatc    109560
     ttcatcgaag cgaagtacga aaagaaaagt aagtgaacag caaccgtaac tcccagcaca    109620
     gccatgtaga tatgcacaaa atgactgcca catacacacc ctgccatgta ggctcctagg    109680
     aatttaaaag caatgtttcc actttcccat cccatgccat ctcagtcccc aagtctgtac    109740
     agataggccc agccaagcta gtatatgcat gtgtaaaacc ccgcgagatc gctatgcaca    109800
     gctagaaacc agaagaaaaa aaagtatacc acaacgagag aggacacctc ccagaaagaa    109860
     tgaaaagccg agagaaagga agattaagcg gaccgaatcg cttcgatagc cgcattaagg    109920
     gggaacacct gggggagacg ttgcgaagga tagcccggga tccacttccg gaacgcagtg    109980
     ctgcaagact ctggaactcc tccaagagcg acgaaactct tcggaatgaa gggtcggtct    110040
     tgaagtgatg cagtgagaat tccatattcg tgcgcgagga ctacagcaga tgcgaactcg    110100
     gcgggccggt tggaagcttg gtcgcccacg atcctaatca gggaaaagaa tgttagcagt    110160
     tggtcggcaa gcaccaaaaa gaagggacac atacacgtag atctcgaaaa aggtgtcaag    110220
     aacatagaca cccttagcag taatgtccct gaggcagaaa ggctcgattt cctggacagt    110280
     gtcattgggc cggataaccg gagaaggcga gcctgagcga cgcagccaga accctgaacg    110340
     ctggccgagc tcgtggtcga tacggaaaag ccgcgagcga tatcgctcgt ggttgggttt    110400
     tgcacgccag tagtcggtgc tggtatcgcc tgtatctcgc tcccaatggg gaaagacttc    110460
     gaagaagctc tctggttcct caccctcagc cacttcctca aactcgccgg ttagcccaag    110520
     gtccatgcca atcaggcgcg cagcaccaat ctcttcggcg gagctgccct tgcccttcca    110580
     gaggaagagc ttgccaaaca tcgcagagat cacaaagggg tagccggagc tcagattgct    110640
     gggcgagaag ctgacttcat cgaacaccat ctgacccaga tgcttgcgcc cgcagagcat    110700
     gaagatggcg gaggagctgg agcgagaact caagccgcga cgagtaatga gaatgccccc    110760
     aagagcttga atgaaccgag cgggttcctt gccttgcttg atgatctcca gcttggaccc    110820
     attatccttg gcgactttac gagagaaagc ctgggcatca tcgactgccg agtcggggac    110880
     atcatcacca caccagaggt gcacttcgga gcgtacagtg ccatcggcct cgaaaagatg    110940
     tacgcacagg tacatgcttc cttcatacag gatatattcc tgattaacag gaagatcctg    111000
     cttcttccca tctcccgtaa tctcccacaa ctgtctcttc aaagtcctga tcttggcatt    111060
     gtcactctta tcagccagca tcagctgcgt atcaatgttg acacggtcgc tagatttggg    111120
     gaaggtcttg aagaaatcag agatggcttc ccatgattca tcggcctgag gtacaagaga    111180
     tgttgaagat ctcgaggaga agcggtcaac agaggccctg gaccccttag gaggaacagg    111240
     gggagaaggc aaggctttat cccgtggcga cgagttgcgt gagcctatgc tggaaaaaag    111300
     cgaggacgcg gacctctgct gtgctggatg agtatagctc tgattatccc tgaagcttcc    111360
     cctcaaaggc gaaggagaag gtgatgagaa gtgagtcggc gagccccgtg tctggttaga    111420
     gacaggtgtt gctggcagtg gagctgtttt gggtggcaga ggaggcttcg ccgagagtga    111480
     gctccgtatg ctcttaaagt atgcgctggc gttctctcga atattggtag cagtctgatc    111540
     caacaccgtt gaaggtttag ggctcgcgtc gtcgggcttc tgcggtgtct ctctctctat    111600
     taaacgaggg atgctcctct tgaattcagt tggcttgctt gttgctggcg tgtcatgttg    111660
     gctcgggctc tcttgcggtt cgtcatggga tttgacttca gtattaggaa ggggccagcc    111720
     gctggagact cccgcaggac tgccaatggg tgagatgtgt gcttctgacc tctgtgcatc    111780
     caaagtagat gctggagatt tcgggatcgc ctcatttact tctgacgtag catttggagg    111840
     ctcgaactct gcatccaatg atggagactt cacagtacca atattgtcga ccgaggttgg    111900
     acgcgcaggt gctggctcgt gtgcatccga aagctctgat ggagaattcg gtactgcatc    111960
     acctgcctca ggagctggac tcttggtttt cggttcttcc gctttgggcg cagagggact    112020
     cagaacacca ttcttctctc ttgggtcaga aaacatgggc tcgggaacgt gcgcattcaa    112080
     agaggcagat gggtgctcat ccacctcaaa tattgacgat gaaggcctgt cctcgtcctc    112140
     gctggccggc atctccagtg cctcagtagt ctcgtagtga accgggcttg tagcttcagt    112200
     ttcctcaata tccatatgga ccggtggtgg tggtacataa gttttccttt ccaagattgg    112260
     gcttgtggct tcaagtgttg tctcttctgc ctgttctgac agtcctgggg cgttagggct    112320
     ctcgagagct aggtttgtag tctcagattt ctcgccatcc gcagaagcta aaggctcggg    112380
     cttagggatg ctcccttctc ggactgggat cagaggcttg gcctcttcat cttccaaaag    112440
     agtcgagaaa tctggcgccc cattggcttt ttcttggatc gggctcgtag gaccaggagc    112500
     agtcataccc gcaggtgcac tgagcaccgg tgcaacgtga acttcatttt ggactgggcc    112560
     cacaagttca ggttcatctt taccagaaag cgccgaggca accggtgcac cgttgatatc    112620
     ctccagaatt gggcttgcag gttcaggtgc cttcctactc ataagtgctg gaggcactaa    112680
     tacatcatcg gactcctcgt ggattgggaa ggcaggggtg gcttcttcct taaccagggg    112740
     ctccgagagc tttggcgcaa cactgatttc gtggatcggg ctcacgggtt caggtgcatc    112800
     gtggacttct ttttggagtg gggtcgtagg ctcagaaagg tctttttcaa cggatgttga    112860
     aaccaccggt acatcgtttg ttccctcttg gatcggagtc gcgggctcag tttcattctt    112920
     atccaccggt gcatcgtgga ctacttcccg gaatgggctt gcaggctcaa gttcgtcttt    112980
     atcaataggt gctgagacca ccggtatatc gtttattttc actcggatag ggcttgcggg    113040
     ctcagtttcc attttatccg ttggtgctga gagcactaga gcgtcgtggg cttctgtccc    113100
     gagtgggctc gcgggctcaa attcatcctt atccataggc gctgaaacca cgggtgcatc    113160
     gttcacctcc tctttggctg ggctagcagg ttcaggtccc tcaatcatgg gtgctgagag    113220
     cactggtgca tcgtggactt cttcctggaa ttggctcata ggctcagatt catcgttgtg    113280
     aataggcgct gaaacctcgg ttgcatagtt cattccttct ttgactgggc tagcaggttc    113340
     gggttcctca atcatgggtg ccgacggctc tggtgtatta gtattctcct tatgcagtgg    113400
     gctcaggggc tcatgctctg gctgtcccac agtttccgga agctctggtg catgcgtgat    113460
     agcctcctgg actggactcg caggttcggg gttcttttct tccatgtatg tcaatggctc    113520
     tagagcatct gccgtcttcg tgtgcaatgg catgtcttcg gcttcttcta catccacatg    113580
     tgctggcata tccggagcat cactttcctc ctccgtctcc gagtacatcg attctggtct    113640
     ctgtgcatcc aaaggtgttg gcggagactc tggtacatga ttgctttcat caaagagtga    113700
     gttcgtacct tccggtgtag taccctgggg caggcgtctc tttggccctc tagctcgacc    113760
     cttggtcaaa tgagtgagtg cggcagcttg agaactttcc actctcgagc tgctttcccc    113820
     agcactgttg aaagaaggac ctttcatcga cccgttaatc ggtgcgggcg ggccacggga    113880
     taaaaggccc gctaaggcag gatttaatcg gcctgcgagt ttacttttag cagcaggacc    113940
     ctcagtctca gcaggtgcac ttgtagcctg catcaaatcc cccggtggca gagaacgcac    114000
     cggattgatg ccctcctcct ttacctcttc ggcgttcacc tctgccccgt ccgtcttctc    114060
     ctgttcgcat cctctctctt tttccggcag tttcggttca gccgcctcct cggcattatc    114120
     atcagcgccg ggcttgggtg gttctggggc gattggcgaa tcctgaaact tttcaagaga    114180
     ctcgccgccg gcaggggaca gtggcgatgc aacctggaag ccatgcgtgc ttcttggtgt    114240
     gcccggctct ctaggcgaga gcggcgaaag cggcgacgaa gaatcggctg ctgaaagatt    114300
     gcttttgata ctgctggact tggtcaaatt gttccgcatt gcaatcgctt caggtacaaa    114360
     tttgccggga gcatccttct cccccgcagt attacgtctc agcgaacccc cactggcttt    114420
     gattgcttct ttctgcttca aaatgctgtc tttcaattca tccactttct gcgacttttt    114480
     tggtccgccc gaggagttca gagctgcctt gcctttgaga atattttctt tcaactcgtc    114540
     cggcggcacg tgcttcgagg actctgcttt cttcagcctt ccgaagacat tcttgaattc    114600
     tggttcctcc ctgggtgact catccttgac cacttccctc cgtcgaaggt tggctctgaa    114660
     atctattaca ggagacagag gcttgggcct attcaacagc ggatcacgag gggatgccag    114720
     gggcgcatcg atagtggtct tggttatcgg gctcagatta gacggtgtac gcttgtgttt    114780
     cgtagcttca tcttctgttt tctccggttc cgcctctgtt ttggtaggcg actcctcttt    114840
     cgaaggagag gtctcttcgg tcttctctgc aggtggtaaa tagctatcct gagtatccgc    114900
     gctttgtgtg gtggtttcgg gttctgcttc tttcgtcttc cctgcatcgt gattggaaaa    114960
     tatgtcgggg atgccggtga tactggaggt ctttgagtga ccaccaggag cagtagtccg    115020
     cataagaccc acgggtgtga cctccttgaa gcttgcggtt cgacccaagt caacgctacc    115080
     ttttgattgc cggtctttga cccaggaagc ctgttgggag ggctgtcgct tatgcctggg    115140
     tgattcgtcg cggttcaaag cactttcgag ccaggaagct ttggttggac tccatctctt    115200
     ggggtccata gttctcgaaa ctgacgggct tgatggtggt aacgagctgg agtccgtgct    115260
     tttctcaacg gagctagtag accgtgtgtg caggctgagt gagggtctac ggtccccttc    115320
     atctagccgc gcaccattgc tgccaggaac gggaggtgta gccggtcgtt cgccatcttt    115380
     gaccggatgg acgacagtcg cttcgctatg gctagaccca ggtctgtggc tggaaccggg    115440
     tctatggctg gaaccgggtc tatggctgga accgggtcta tggctagagg ttggccgcga    115500
     gggcgagaga cttgggccgt ccctgctcat tctatatgaa ggcgcagtgg agaaaacatc    115560
     attgccggaa ggagcagcga agctattgcg gttgctagaa accgaattgc ctcgactaag    115620
     ccccgacggc agctgagcgc tccagcgttt tgacacgctg tctgatcgct tcatcatagc    115680
     gctttgcaca aatccaccga gccccttggt aggagatgta gaacgctcgg gagacaaacg    115740
     cctaggcgag gggggtgatg tgatttggtc atctgcgccg tcctccgtct ttcgcggctc    115800
     gagtttctgt gcgctcgtca aaggcaaagg agagccaagc ccagtggccg tcgacacaga    115860
     agatatgctc gaataccgat tgcccaaact actttctgca aacgttgaac ttgctcttga    115920
     cggggaccgt gatcgctctt ctacgatctc gtgattttct gcttccttcg ccgactctgt    115980
     agtgtgctct tgatttgctt ccaactcctt ggcgccagta tcagggtgca gagggtgcag    116040
     tgagtcctcc tctacctgct ttgcgcgggt cggagaaggg ctccctccct ctgtgtggcg    116100
     agaccacggt acgtctttga acgaggggga agacgcgaat gggctcctag ataccccatg    116160
     atcgtcatta gacgttgtgg acatggctct gaaacggctc tcacgggagg gcgacgcgga    116220
     gaagaaagcc ctgttgctat cccgagacgt aggcctttgt tgccaggaga gagtgccggc    116280
     tctgctccgg aaaggtgaga taggtctgga agcagtttcc ccatcgtttg ccgtcaatgt    116340
     agaccccctc cgaccattgt ctgtagatat cgatgcgtca tctcgaaccg aatcagcccc    116400
     gttgccagtg tcatgcccgg gcgtatgagg ggtaggttcg aggtgttctg gagggtcaat    116460
     cgctcgctgg ctgaaagaag acatgctcaa ccgagcggga tctaatattg gtgaatcttt    116520
     cgtgggggaa atcgaccgtg cccgctctgt attggatccc aaaaaaacgg acacagtcag    116580
     cattcctgaa gatgacagat ttggaaaagg accagccaac cgccagccaa ccgtgagtca    116640
     tggcgactgg aaattcactt tgaaaggggc tccgccgggg aataaaaaaa aagcaaggga    116700
     aatcaaatac cagctctcct agcctgcctt tccttccgac cctgcaggat ttcctcctcc    116760
     aacttctttg tgcgttcctc gtcctcttta tcgcgcttct ctcctaattc gcggatgcgc    116820
     aaaaggaagt cgttgacatc ctcagtgcca tccgcgtcgg ttgtggacga catggccagc    116880
     ttggcacttt ctcaatgagc ccaaaaattg ggtaaagaag ggaaaaaaag agggaacaaa    116940
     gcagaaatgg caagtcagaa aaagaaatga tgccctttca aaccgaataa acaccgacaa    117000
     aaatccccca ggaacggtgg ggtgtggcaa gaggcaccag actgaagagg ggaggagggg    117060
     gggaagggga agagaggggg aatgatttgg ttgcttgtga accagagatg ttgaagtaat    117120
     caggaagagt ggagggagtg tcacggttag cagtggtggt ggtgattgag cgactctctg    117180
     gctcttgccc gcttgagaga cttttgtgac tgatttgtgc cgggtctgag cctcaggaag    117240
     ggataatcgt gtgcctccag ctcatgtcgt tgctgttgct gttgctgttg ttgtcgttgt    117300
     cgggtttact ccacctttca ccctgggcga tccagtgtga aggaatggca gcgagagccg    117360
     ggcagcgtct ttctcgtttc tagtggtgga tccgtatcga tggccagctg agcgccgtga    117420
     aggcaagaat agtaatgctc ttccatcgtc aaataaaatc cggcgaaggc acgcacatca    117480
     gctgccgccc cactgccgga agcccagagg aaattaggat gaggcgcccg accggattga    117540
     cactgcgcat ctctctcgct ctgcggctgt gagctgatcc ccttgagttt ctcccacccg    117600
     gcactactag gcgagatcaa acccagtcct gaatgggttg atcgcgtcgc aaatcccgaa    117660
     caaagagggg tttcctctct gatttcccaa aagcttcatc atccattgga gaggggatgt    117720
     tttgaagttt ctctacaagg agaactgttt actttccggg tccggctttt gcggtggagt    117780
     caatctcaac cttctctgcc gccccgcgat cggatacgca atcaattttt ttctggctga    117840
     cggcctgctt tccagtttcc tcctactcgg gcagcattac gatccttggg aacctcggtt    117900
     gggtcaaact cggcacacaa agcttggtta actggtgtgg aatccacgga tggccttgaa    117960
     gggaaggggg aagaaggtgg agatacgaag ataaccggga gcttcccatc aaccacacag    118020
     catttagtcg ggtctgacga cattaagtcc ccttcaaccc ggcgcaggac tagtagtacg    118080
     tatcgtgaga cacattggcg gcaatccttg ctgaaacctc gtggttgacg taaattacga    118140
     agcgaggcgc tccctagtgg gaactgggaa caccgttgcc tttaccatgt tcgacaaggg    118200
     ccatcgtagt gtagttcgtg gaccctgaag gcgatttgtc tgatcgccgt tccgataccc    118260
     gaccaggcac tactagtagc aattgagaca ggggctctgc tagtggtgct ttgtagtact    118320
     agtcgacggt caaaatgagt gtagccagca tggatgcttg tcccctgagg tccaactggt    118380
     cttaagttgt agagagtaga tcagagttac atgtttttca atgatcacta ctactagtat    118440
     atagtaagta taaatccatt gctgacgagc tgaaatccac aattgtaaaa tgcactgtta    118500
     ttacgtggtt gaattttccg tgaagaatat ataaatagtg ccgaagagct ggtgcaaaat    118560
     ccatcaccat tgatttcgtt ccaccaacga acttcatcgt aagatcgcat catgccataa    118620
     gagccaaaca atatggcatc tgctatcatt gaaagaccat aagtacgaaa atatgaatag    118680
     aaaaagggaa acaaatagca tatcgtggtc attaaagggt gtcaaaagca agccatagac    118740
     acttccacag cactcaataa aggaaaagcc tatctttggc gtcttgtaca acccattcta    118800
     gcccttcatg caggttcttt cctgtcatcg cactgcaggg taatatggtc catttatgtg    118860
     ttttgataga atccaagcca agccgctgtg gacaagaaca tcagtcaata tccgctgaaa    118920
     gacaaggcat gaggagccaa aagcgagaac ctatagttca aagtaagatg aagggcatgg    118980
     gcttacttct cgaacttcat tctcattcat acatccctca acttcgctct tattcaagaa    119040
     aattaaaaga cttgctccca ttaaacgctg cgtgacggtt agcccgtggc tggcaaaact    119100
     cttcctgggc gggcgcagcg gtgccggcgg ggatggcaac aaacctcttc cagaaggaga    119160
     ccggcgagct catctctaca atcatccact ctgagacgat cggtcgcatc gacgacccaa    119220
     atcaatgtat cagtcttctc aaagtagttt ttccaataag atctgagggt cttttggcct    119280
     ccaacgtccc ctgatggcaa gtggtcagtg gagtctgggc ggtatcactg gtcgacctcc    119340
     ttacatatat tgagtctata tctgcataga agtcagtgag tgattcttgc agattatcaa    119400
     attcaaataa taataccctt gaaaatctat tgtcttgatg ataaaaccca atgtcgggct    119460
     gacagtagtg acatcttcgt tcataatctg cttaacgatg gtggtcttcc cggcattgtc    119520
     cagacctctg tcgccatggc tattagtgaa tcacttcgta aattgtatgt atcacggggt    119580
     aaaacttaca gcatcaggat tcgcatctcc ttatccttca gccgggcttt tctcaaattg    119640
     gataacatct tcactggtct cttagtgatg ttgcagtttg tagttggggt aattgaaggg    119700
     gagagaaaga ttggacagac gaggagctcg atatagatcc cgctcactgt caaatctact    119760
     acacctcctt cacatcacag tgggacatca taggccatgt gtcccatgaa caaccaataa    119820
     caaccctaat gtagtcctgc aattctctgc aatagtattt ccagtcctga ctctttcact    119880
     tcctcacttt cacaacaaga acaacaaatg tgagtatagc ccttacgaaa tatcaagtaa    119940
     ttggaatagc aatgtatttt cttcacgcag acataacagg cagccactta attccagctc    120000
     tatcagaatt caccatatgc gcatagcgtg acattagaga ggtatcaagt cgttaaatag    120060
     tgcgcacatc ccatgctctc cagtatgtcc ctgtctacag cggggcaaga acctcctcat    120120
     tctcatgcgt gttgtcacat aacgacagaa gccatatgaa agattaggaa acagaatatc    120180
     ttgttcgatt agatagaatt ctgtgattca gtcttttcag aggcctctat cagcagtgag    120240
     tacaatcaat gtcaagtaag accctccttg cctaacatga atacccttgg gagagatgat    120300
     gtgagtgata ctaacctacc tcacactgtt agaaatgtca caagagaata actatgacta    120360
     tgacagccca gacttatggg cacgtatcaa agggacacgt gatagtgtat caagcgcctc    120420
     gatttccaac aaataccggt ctcctggata ccggccttcg ccacgacgat gtgccgagaa    120480
     taacaacacc gcttcacctc agcgcaatct agtgagtccg agtcaggtta ataagatgca    120540
     agcaactgtt gtgagagcga caaatatcag tacagtcacc tgtaagccgc acaaggcaat    120600
     cgctacggcg attcccaagt gctttaaagc accggagccg gtcgtggcca ccagccgatt    120660
     gcctttaaat gaaagcaaac ccccctcaca cccctcaagc tcttccaaaa tcaccgtcaa    120720
     gttacccgtg ccactgagcg gattgcgtga cacttctcac atttcagttt cccgatcttc    120780
     accatctccc tacatccctc cacacataag aaaccatcag tatcagaatc ccgaccagcg    120840
     catcctccct agaaacaaag gaggtctagg gactgagcag agaaaccggc gaggtaccgc    120900
     acatactttc cacactcctc tcatctcaca cgtctccaaa gcacctgaga ggccaggtca    120960
     gttaagattc actcgaaata cttcgtctgg cttgccgcat aagcttgctc tactcggtaa    121020
     acgataaata tcgctccctc tgtcttgcca tggaatgtgc tgactgacac ctgagaagtt    121080
     aataagggaa aaatgtcatc cggcagtgac tcagactacg tcgtcctgcg caatcccaga    121140
     gctgaaacac tgcagcccaa ggtgcaggat gctccaggcc agactggact agaggccggt    121200
     ggtgataccc ctcctggagg cagtattcaa cagccagcgg gcgaacctcc cggggagaag    121260
     cagcctacta cccgtgctga gctgcgagca gagattagaa gattacaaaa ggaggaactt    121320
     gccaagatct atcagaatct atgcaaggag gaggtcgaaa ccgcagatga tgaagtagta    121380
     gcaaaatgtc gggacggccc aggggtggat ccaaagtcgg aagtctatca ggagatcgag    121440
     aaaaatcgat gcgtgcgtcc tatggaagaa gtcgacttga acgtcgaggc tctctctatg    121500
     gtcaatgact cggataagga accagaggat gaccgcctcg ataacctcga ggagcttaaa    121560
     ttcagcttcg acagccttct taaggcccca cagtgggacg catacgaaaa acagtctctc    121620
     aattaccctc aagtgattaa taaccaagtg accctctcac ctgagccgtc cgaggcgcag    121680
     gccacccttc gagctaagac ccagaagttc ggagttcatc cttatgcctc tcgaggtgca    121740
     cctcccactt tcccgcccag cgcatatcag aaatggcgga agtacgacca cttgtgtgat    121800
     tggtggtggg ctcctcctat gcttcccttt tacgactcat ggcttcaaaa gttccgttct    121860
     tggctcgacg agacgattga gaatgcctgc tatgcagata tataccacaa gggcttcttt    121920
     gatggcactg cccatccgga tggtgttaga acctttctca tcccggatct accgaaggcc    121980
     accacgatcc tcaatccaaa tgatgagcta ggtcatcgac acagacacga gacggcggca    122040
     ggtctcagct acaacctggt catgcacaaa aaagtcgaag cagagctcga agagcaaaaa    122100
     ctcgccttat cgcgccgcat gcaactggaa tgcatggcca ccatgccgcc aaaccccaac    122160
     acgcctaggg cgaacatcta tctcagacct gcacatgtgg gagacgccaa tcagcttctc    122220
     cccatctaca actggtacgc ccaaaactcc ttcgtgagcg ttgatattag aaccgtgcag    122280
     ccagacgacg tcagggagcg tatccaagcc gccagagacg cccgtcttcc cttcattgtt    122340
     gccgtggagc gcggttctgg ccaccagaga gagactatct tcggctacgc cactgccaaa    122400
     gactacaccg gctgggaaac cagtggaagg tataccgcag aattggaatt gttcgtcatc    122460
     ccagagcagc agcgcaaagg cattggaaat tgtcttatgg acaagctctt gcaggtatgt    122520
     gatgggaacc acagaactaa gggtggttac gatttcaacc acactggtct cagtggctac    122580
     ggcttgggag gacatcgcga gtttgctcga ctgatcttta aattcaccta catcccggaa    122640
     gaacgtcagt caaagagctg ggtccgagat tggttggcga agaacaactt cgagttgcag    122700
     ggacgtttgt gcggagtccg cgctaagaat gagagactgt aagtgctaat cctgcttcac    122760
     tataatgatg atgatatcaa acattcaaac ctgactaaca actattctag tctcgacgtt    122820
     gcttactttg tccacaacaa catattcgct ctcccatatc ggtagtttaa tccggactag    122880
     cttgcatgga gtatctcgcc cccagtcttg aaaatgatcc aatctcatgg acagcgacaa    122940
     ccgagaaact ccaagcaagg cttttctctc tgtctttctc ggcaggcttc taatacagca    123000
     agaacctggc tgactgacag aagacagtga tgagactatt ggacattgga gtagtagtcc    123060
     gtcccttatt ttcttttgtg atcttttcct ttgttagttc ttcaacgcac caatgattcc    123120
     tgcaaaacct taatcaacct tatccggcct atgcagacga atccatgtgc tccagcatca    123180
     atcaaatcaa caataacacc aaaaacaagt gaaaagggca aaaaaaaagg gaagccgacg    123240
     caccataagc ggcggcggac gtcagtttac agtgtatcaa atatctacga gcatgcagat    123300
     aaaaagcttc cttactcgag ttgataaaat tgaaaattga aattgaaacg gaaatttgac    123360
     ttccaactca gaagatgcac ccaatgctat gttataagta gaattatctt actatccaga    123420
     aatctaggta catacagtaa gtagcaagta gtgctagagt ggatcccata tcgataaaca    123480
     acgcaaccaa tcaccacctc cccgacgaca gtaagcacaa gattctgcca tcgcaaacgc    123540
     cctccaccgc cttcgaaatt tgaacttttt tctccatctt tatcccgata ccaacataca    123600
     taacataccc attgaattgg aacataggga ggagagtgtt ctttcctttt tataacccat    123660
     taacttgttt tgctacattt tatttcacgc aacccaattc acaagaaagg aagaaatctc    123720
     ttgttccttc cctttccccc cacacgccaa ccatggccgg aacgaaaaag cgcgcgaacg    123780
     ccgacgacga cttcgtgctc acattgtcgg acgatgagaa tgacacgtta aatcagctcg    123840
     aagaggaggg cgagggcgac gatggtgcgc tagccacggg atcgaaaacg aagaagcgca    123900
     agagagatga tgctgcggcg gcgcagcagg agaaggggaa gaacaagaag gtgaagaagc    123960
     aggaacaaca gcaacaacaa gcacaacaga agaaaaagaa gggaaagaat gcccctgttc    124020
     aggaggaaga ggatgaggat gaagaggagg aagaggatca gggtgaagat gatggcgcgc    124080
     ttaattcgga tttcgagttc gatgtcggcg gtgctgcgaa tgaggttagg gatttcgatg    124140
     ggtgggaggt taatggtaat gaggagggta agggtgggga taagaaggct gtggatatcg    124200
     atgatattat ttcgaggagg caggcgaaga aggaggctga gttgattcgc aagcagaaga    124260
     agaagaagca gaagcaagag gaggagttta gtgaattgga ggatgatgat gaggaggatg    124320
     gtggtatgga ggtcgacttt ggggatgatg agctgcttgc ggaggatggg ttcggtatgg    124380
     gtgtcgatgg ggaggaggag agcgagaagt ccgatgcgga ggatgaggag aaggaagaag    124440
     ggtctgatga ggaggctgag ggcagtgatg aagacgagca gatggatgag gatgatgacg    124500
     atgctgcttc ggatgacgac tcggttgcta ctcctgtcat gcacccggat gatattgcct    124560
     ctgatcggga ctcggacgag gagagtcagg tcgacgccga ggaagaggag aagcgcaagg    124620
     ctttcttcgc gcccgaggag gaaaagactt ccgagtctgc tatggcagat gcgaagcggt    124680
     cgttccagga attcaacctc tctcgtccca tccttcgtgg tctcgccgga gtcaacttct    124740
     cgaaccctac acccattcag cgcaagacga tccccgtggc tctcctgggc aaggatattg    124800
     tcggtagtgc cgttactggt tccggaaaga ctgccgcctt cgttgtcccg attctcgaac    124860
     gtctgctgtt ccggccgcgc aaggtcccga cgagtcgtgt tgccattctc atgcccaccc    124920
     gtgaattggc ggtgcagtgc tacaatgtcg ctacaaagct ggccacatac acggacatca    124980
     ccttctgtca gctggtcggt ggtttcagtc ttcgcgagca ggagaacatc ttgaagaagc    125040
     gtcccgatgt gatcatcgcc acccccggtc gtttcattga tcacatgcgc aactcggcca    125100
     gcttcaccgt tgatactctg gaaatcctgg ttctggatga agccgaccgc atgctcgagg    125160
     acggtttcgc cgacgagttg aacgagattc tcactacgat ccccaagtcg cgccagacta    125220
     tgcttttctc ggctacgatg acggacactg tcgacaagct cattcgcgtc ggtctcaacc    125280
     gccccgtgcg cttgatggtc gacgccaaga agaacacggc cgtgacactg gtgcaggaat    125340
     tcgtgcgtct gcgccccgga cgtgaggaca agcgactagg ctaccttctc tacctctgca    125400
     aagagatcta caccggtcgg gtgattgtct tcttccgaca gaagaaggag gcgcaccggg    125460
     tgcgtatcat cttcggactg ctgggcttga aggctgccga gctccacggt agcatgagcc    125520
     aagaacaggt atgttatttt acatcgactt tcattttctt caatacgatc gatgatacta    125580
     atcgtggggt tttccaaact acagcgtatc aagagtgtcg agaatttccg tgagggcaag    125640
     gcggcgttcc tgctggctac ggatctggcg tcgcgtggtc tggatatcaa gggcgttgag    125700
     acggtcatca actacgaagc gccgcagagc catgagatct acctgcatcg tgttggtcgt    125760
     actgcgcgtg cgggccgctc cggtcgggcc tgcaccattg ccgccgagcc tgaccgcaag    125820
     gtggtcaagg cggcggtgaa ggcgggcaag tcgcaaggag ccaagattgc cagccgtgtg    125880
     attgaaccgg cggtggcgga ttcctgggcg gccaaggcgg aggagttggc ggacgaggtg    125940
     gaagaggtgt tgtcggagga gaagctcgag aagcagctgg cacaggcgga gatgcaagtg    126000
     accaagggag agaacctgat caagcacgag gcggagatca agtcgcggcc gaagcgtact    126060
     tggttcgaga cggagcgcga caagaaggcg gcgcggaagc tgggcgcggc ggagctcaac    126120
     gggcccgatg ccggcatgtc caagaaggag aagcagaagc tcagcaacaa ggacaagaag    126180
     cgtctggatg attcccgtca gcgccaggaa gcgggtgctg gttggaagaa gggccgggca    126240
     acacgggaga gcatgaagaa tgggcaattg cccaaagcta agaaggacaa caagaagaag    126300
     ggcaagaaat gagtcacaag ggtgaggtga cgggacggac tcagaaggat tttctaaaaa    126360
     aaattatcat tattcgcatt agcatattgt ggatatactg tatagatata tttttcattt    126420
     tctgctcaga ccattcacga tcttcttatt agttacaaag tatatccctc ctttttccta    126480
     ttcagtatga ttctagtcct tctatcaaga ccatgggggg atcagggtag cggctgtcga    126540
     cggctatcga cggggacagc ggggtgctgc aagggcggcg agggactccg gtgtcggcga    126600
     gccgagatgg aggagagagc ggagaagccg agtgctcttg cagttcatcc aaccagccag    126660
     ctaaattgat cacgggtgga gtgggatttc gtaccaaatt gctaattctc ggccggtgat    126720
     tgattcggaa agacccatcg agttgccagg gggagggtgc aatactagta gtactaactt    126780
     tgagtatgta acatgatggt tggaggtgac ttttcatcag gcctggctgg taccaaatca    126840
     gaaggcgatc cgccatccgc tgtcggcgca aatttcgagg gccaaaggcg gcgagcgtca    126900
     ttccaattga ctcatggcgg ccactcgccc gtcgccttta aatcctacca ttttcctctg    126960
     cgtcaccgtt tgtctgtccc cgttcctggt ttctttttaa gcttcatacc ttttttttct    127020
     tccctttctc cctttctctc ttcaagaatc actgatttgt cctccctctc tccttgcgtg    127080
     aggtgaataa ctactgatct atcttcaacc actttcctcc cccctcatct tccacccgca    127140
     tttcctctcc tctcatttcc ccgctgcgga tcctcccgct tctcctccat catgcccatg    127200
     tacgtgtctc ccactaatgc tcaatttcct caattctggt cgtgtctgca atagaagcat    127260
     gttttccgca gtcatacttg accgttgcat cagttgactc acatccactg actctgtatc    127320
     caggctcaag gacccctccc agaaatacaa gcgctttcag cccctccacc ttcccgaccg    127380
     ccaatggccc aacaagacca tcgacaaccc gccccggtgg ctggccaccg atctgcgtga    127440
     tggcaaccag agtctgcccg accctatggt aagttcatta cagtgtctag ttaggggcga    127500
     gaagaatagc gggacccagc tgaccacttc tctcgtgaaa cacacaggat gggcaacaaa    127560
     aactccgttt cttcaagatg ctcgtcgaca ttggctacaa ggaaatcgaa gtctctttcc    127620
     cctccgcctc gcaaaccgac ttcgacttca cccgtagcct ggttgagact cccggtctgt    127680
     gccccgatga tgtctggctc caggtcctct ccccctgcag agaagatctg atccgtcgta    127740
     cggtcgattc cctgaagggt gccaagaagg ctattctgca catctacctg gctaccagcc    127800
     cctgcttccg tcgcatcgtg ttcaacatgg acaagcagaa gagtctggag atggccgtgc    127860
     gctgcaccaa gtatgctcgc tcaatcacca aggatgaccc gtcgacagcc ggaaccgaat    127920
     ggcactttga gttctccccc gagaccttct ccgacaccga gcccgagttc gctgctcaag    127980
     tctgtgaagc cgtcaaggcg gcgtgggagc ccacggagaa ggaccccatc atcttcaacc    128040
     tgccggctac ggtagagatg tctaccccca acgtcttcgc cgaccaggtc gagtacttct    128100
     gccgtaatgt ctccgagcgc gagaagtacg tcgtgtccat ccacccccac aatgaccgtg    128160
     gctgcgccat tgccgccgcc gaactcgctc agatggccgg tgcccagcga gtagaaggaa    128220
     ccctgttcgg aaacggcgag cgcacgggta acgtggactt ggtcaccttg gctctcaact    128280
     tgtacaccca gggaatctcc cccaaggtgg acttctccga tatcaatgcg gtcatcaagg    128340
     tggtcgagga aagcaacaag atccccgtca acgagagatg gccctatggt ggtcagctgg    128400
     tcgtctgcgc cttcagtggc agtcaccagg atgccatcaa gaagggattc aagctgcgcg    128460
     agaccgccag ccccgatgcc aagtgggaaa ttccctacct ccccttggac cccgaggaca    128520
     ttggccggaa ctacgaggcc gtcatccgtg tcaactccca gagtggcaag ggtggtgccg    128580
     cctgggttat cctgcgcagt ctggagctgg atctcccgcg cgccctgcag gtcgagttca    128640
     gcaagatcgt gcagcgcaga accgaagaag tcagccgcga gctgcgcccc tccgaagtcg    128700
     tcgagctttt ccaggaagcc taccacctca agtccaaccc ccgcttcaac ctggtcgact    128760
     acaacatcac cacggatcgt tcgcagtcgc ctgcgcctcc tgagcccggc aaggccctca    128820
     acaccaagaa cctcaagcgt cgcttcaccg gtgtcatcga aatcgacggc atccagcacg    128880
     ccatcactgg tgtcggtccc ggtgccatct cctccctggc ccacgccctg gccactctgg    128940
     gcatcgatct cgacgtcgtc gactacaagg agcactccat cggtctgggt cgtgatgtca    129000
     aggccgcgac gtatatccag tgcactgcgg caggcagcaa ggaacaagtc tggggtgttg    129060
     gtatccacca ggatgtggtc caggctagtt tgatcgccct gctcagcgcc gccagctccg    129120
     tatgttcccc cggaacctat tcatctatga agaattacat ccactaacat gtactctctt    129180
     gattagttcc tgaccagccg ctccggctcc cccgctccct tccgccccat ccgctccaac    129240
     accctcaccg acgacgacct ccaagctctg gaaatgctga acggtcccag caagcccaag    129300
     gttgacattg acgctctgac caagcaggct gagagccagt aaatcgttca tcccaactta    129360
     gctagcatat ttcggttttg ctgtcatcgt cttctacttg cattatatct cgggtccgtt    129420
     ttggtttctt gctccaaaca ttttttcttc tcggggtttt tgggaagaga aaagtacgaa    129480
     aattgtgttt tcaaggaaag acatatatga agagaggata agagcgtggt gaaagaaaag    129540
     agtttgcttc gatttgtaca gatttaggaa tgacgtgata tgaaatttca aattaattat    129600
     tctaattcag ttttatggtc cacttctcgt atgtttcaat taatcaggaa actaccaagt    129660
     aagtactaga tggaggaaag agtgattata ttcatgacct caggatcaac gtctacccgg    129720
     atactagtag aaagatagta tcacggacag attgaacgct actgaagtac tgggaatgtt    129780
     actataatgt ggtaatgtcc agaggaacag tataaactta gtgatagtct ctattgataa    129840
     tctactcctt gcgggcaact gaaaactagc atgaacatat ctatatagga tgacattgta    129900
     aacagagcta agctactact gcatgcctat atgataaatg tagaatgcga atggggatgc    129960
     gggggtatgt atgtacaaaa taaacaaaac acattttgca tatcggtcat catagataga    130020
     agggggaatg gggggtgaca agtagacagg tataaagctg tttttctacc ttttatagag    130080
     ttgggatgac atgcatgggc cacaggagaa aacagaaagg tagggactgt gtataaaggg    130140
     gaggaaggtg gggggtgttg                                                130160
//

If you have problems or comments...

PBIL Back to PBIL home page