(data stored in ACNUC14238 zone)

EMBL: AM270312

ID   AM270312; SV 1; linear; genomic DNA; STD; FUN; 53423 BP.
XX
AC   AM270312;
XX
DT   28-JAN-2007 (Rel. 90, Created)
DT   14-MAR-2015 (Rel. 124, Last updated, Version 5)
XX
DE   Aspergillus niger contig An14c0040, genomic contig
XX
KW   .
XX
OS   Aspergillus niger
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
XX
RN   [1]
RP   1-53423
RA   Pel H.J.;
RT   ;
RL   Submitted (01-MAY-2006) to the INSDC.
RL   Pel H.J., DSM, 624-0295, P.O. Box 1, 2600 MA Delft, THE NETHERLANDS.
XX
RN   [2]
RX   DOI; 10.1038/nbt1282.
RX   PUBMED; 17259976.
RA   Pel H.J., de Winde J.H., Archer D.B., Dyer P.S., Hofmann G., Schaap P.J.,
RA   Turner G., de Vries R.P., Albang R., Albermann K., Andersen M.R.,
RA   Bendtsen J.D., Benen J.A., van den Berg M., Breestraat S., Caddick M.X.,
RA   Contreras R., Cornell M., Coutinho P.M., Danchin E.G., Debets A.J.,
RA   Dekker P., van Dijck P.W., van Dijk A., Dijkhuizen L., Driessen A.J.,
RA   d'Enfert C., Geysens S., Goosen C., Groot G.S., de Groot P.W.,
RA   Guillemette T., Henrissat B., Herweijer M., van den Hombergh J.P.,
RA   van den Hondel C.A., van der Heijden R.T., van der Kaaij R.M., Klis F.M.,
RA   Kools H.J., Kubicek C.P., van Kuyk P.A., Lauber J., Lu X.,
RA   van der Maarel M.J., Meulenberg R., Menke H., Mortimer M.A., Nielsen J.,
RA   Oliver S.G., Olsthoorn M., Pal K., van Peij N.N., Ram A.F., Rinas U.,
RA   Roubos J.A., Sagt C.M., Schmoll M., Sun J., Ussery D., Varga J.,
RA   Vervecken W., van de Vondervoort P.J., Wedler H., Wosten H.A., Zeng A.P.,
RA   van Ooyen A.J., Visser J., Stam H.;
RT   "Genome sequencing and analysis of the versatile cell factory Aspergillus
RT   niger CBS 513.88";
RL   Nat. Biotechnol. 25(2):221-231(2007).
XX
DR   MD5; c05c22914ccff6258eace17b998a9bd8.
DR   ENA-CON; AM270993.
DR   BioSample; SAMEA3283178.
DR   EnsemblGenomes-Tr; CADANGAT00011040.
DR   EnsemblGenomes-Tr; CADANGAT00011041.
DR   EnsemblGenomes-Tr; CADANGAT00011042.
DR   EnsemblGenomes-Tr; CADANGAT00011043.
DR   EnsemblGenomes-Tr; CADANGAT00011044.
DR   EnsemblGenomes-Tr; CADANGAT00011045.
DR   EnsemblGenomes-Tr; CADANGAT00011046.
DR   EnsemblGenomes-Tr; CADANGAT00011047.
DR   EnsemblGenomes-Tr; CADANGAT00011048.
DR   EnsemblGenomes-Tr; CADANGAT00011049.
DR   EnsemblGenomes-Tr; CADANGAT00011050.
DR   EnsemblGenomes-Tr; CADANGAT00011051.
DR   EnsemblGenomes-Tr; CADANGAT00011052.
DR   EnsemblGenomes-Tr; CADANGAT00011053.
DR   EnsemblGenomes-Tr; CADANGAT00011054.
DR   EnsemblGenomes-Tr; CADANGAT00011055.
DR   EnsemblGenomes-Tr; CADANGAT00011056.
DR   EnsemblGenomes-Tr; CADANGAT00011057.
DR   RFAM; RF00005; tRNA.
DR   StrainInfo; 791018; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..53423
FT                   /organism="Aspergillus niger"
FT                   /strain="CBS 513.88"
FT                   /mol_type="genomic DNA"
FT                   /clone="An14c0040"
FT                   /db_xref="taxon:5061"
FT   CDS_pept        complement(join(<1..402,492..831))
FT                   /locus_tag="An14g01040"
FT                   /note="Function: Nip1p has a primary role in translation
FT                   initiation. Nip1p is a subunit of eukaryotic initiation
FT                   factor 3 required for efficient translation initiation."
FT                   /note="Localization: mainly cytoplasmic."
FT                   /note="Remark: C-terminus truncated due to end of contig."
FT                   /note="Title: similarity to nuclear transport protein Nip1
FT                   - Saccharomyces cerevisiae [truncated ORF]"
FT                   /note="See PMID 9722586"
FT                   /note="See PMID 1332047"
FT                   /db_xref="GOA:A2R2K3"
FT                   /db_xref="InterPro:IPR008905"
FT                   /db_xref="InterPro:IPR027516"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2K3"
FT                   /protein_id="CAK46444.1"
FT                   /translation="MSRFFYGGGSDSESSSSEEEELYSDREEEEQSEEESSEEESEEEE
FT                   ESSSEDEDAGKTGANRFMKNVSESEESEDEERVTIVKSAKDKRLEELENTVKLIENAEK
FT                   ISDWAVISTEFDKLNRQIVKIVQSGPTPKIYVKTVADLEDFVNGTISKQKSSNKKMNAS
FT                   NAKGFNAVKQRIKKNNKDYAVQIDKYRKDKDGFMEAKEEVARPVAAAPRLTKIERIEAP
FT                   ALSTAGDDEVLRPLAVAARPSSTPP"
FT   mRNA            complement(join(<1..402,492..>831))
FT                   /locus_tag="An14g01040"
FT   exon            complement(<1..402)
FT                   /locus_tag="An14g01040"
FT                   /number=1
FT   intron          complement(403..491)
FT                   /locus_tag="An14g01040"
FT                   /number=1
FT   exon            complement(492..831)
FT                   /locus_tag="An14g01040"
FT                   /number=2
FT   CDS_pept        complement(join(2111..2874,2926..3284,3345..3464,
FT                   3522..3781,3841..4000,4065..4264,4321..4592,4662..5214))
FT                   /locus_tag="An14g01050"
FT                   /EC_number="2.7.1.-"
FT                   /note="Catalytic activity: ATP + a Protein = ADP + a
FT                   Phosphoprotein"
FT                   /note="Function: Yak1p functions as a negative regulator of
FT                   the cell cycle in S. cerevisiae."
FT                   /note="Remark: Yak1 acts downstream of the cAMP-dependent
FT                   protein kinase in yeast."
FT                   /note="Remark: the database proteins are all shorter in
FT                   length."
FT                   /note="Title: similarity to serine/threonine protein kinase
FT                   Yak1 - Saccharomyces cerevisiae"
FT                   /note="See PMID 8150276"
FT                   /note="See PMID 10816418"
FT                   /note="See PMID 2558053"
FT                   /db_xref="GOA:A2R2K4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2K4"
FT                   /inference="profile:COGS:COG0515"
FT                   /inference="profile:PFAM:PF00069"
FT                   /inference="similar to AA sequence:PIR:A32582"
FT                   /protein_id="CAK46445.1"
FT                   /translation="MDSQWQAYQDPLMGHPAQFNNGLTSNPQQLASKYGAQPQHSQPPV
FT                   GYTYEPFQSPGTTAKPPSIGANSRTVSMASSPAATPRSRDYVTDADTTMEDADPYNRAK
FT                   YSTRPSHHSRPSSQYFPSEESSAARRYSPMNVLSPSMSFNASPGKSHNSYAFPPGPNQP
FT                   RRSPTRGSTYASPPQAFQSPPSASRPPRLPPLQPTDMSPDQYYPPSAGSQLNAAFAQDG
FT                   RSPRSASISGGSQQPGRGPVPKFQKIKSIQELQPRMNAQPPYRRANPDGGFISPLQALT
FT                   THLPATYRICNPGFNYESSRNPRRVLTKPSKGVKNDGYDNEDSDYILYVNDILGSEEAG
FT                   HKNRYLILDVLGQGTFGQVVKCQNLKTGEVVAVKVIKNKTAYFNQSMMEVSVLDLLNSR
FT                   YDKNDDHHLLRLKDTFIHRQHLCLVFELLSVNLYELIKQNQFRGLSTTLVRVFAQQLLN
FT                   ALSLLNKAHLIHCDLKPENILLKNLESPIIKVIDFGSACDERQTVYTYIQSRFYRSPEV
FT                   LLGLPYSSAIDMWSLGCIVVELFLGLPLFPGSSEYNQVCRIVEMLGLPPTWMLEMGKQS
FT                   GEFFEKTQDEFGRKTYRLKSLEQYSREHNTKEQPSKKYFQASTLEEIIRSYPMPRKNMK
FT                   QAEIERELNNRVAFIDFVRGLLAINPLERWSPQQAKLHPFITQQKFTGPFMPPMNLKYS
FT                   SLNKTVPPGIQQQQQAEAASKQRAAQAAHAQSAAQNAYAMQLNQFHTPTHAQPPPMYNG
FT                   IFTGHQQGAPPPYPTQPPAYGHQMNLIPGQVPQAQYAPSQSLYAQATTRAGRQRASTMD
FT                   PQGGGIPPTIQRVASHLDPNAPIRLQPSPAYYPPPPDGYVDPNSAGQRRRGSRTGGTRN
FT                   RDFIRTLEDGVLGGEGFMGQNQWH"
FT   mRNA            complement(join(<2111..2874,2926..3284,3345..3464,
FT                   3522..3781,3841..4000,4065..4264,4321..4592,4662..>5214))
FT                   /locus_tag="An14g01050"
FT   exon            complement(2111..2874)
FT                   /locus_tag="An14g01050"
FT                   /number=1
FT   intron          complement(2875..2925)
FT                   /locus_tag="An14g01050"
FT                   /number=1
FT   exon            complement(2926..3284)
FT                   /locus_tag="An14g01050"
FT                   /number=2
FT   intron          complement(3285..3344)
FT                   /locus_tag="An14g01050"
FT                   /number=2
FT   exon            complement(3345..3464)
FT                   /locus_tag="An14g01050"
FT                   /number=3
FT   intron          complement(3465..3521)
FT                   /locus_tag="An14g01050"
FT                   /number=3
FT   exon            complement(3522..3781)
FT                   /locus_tag="An14g01050"
FT                   /number=4
FT   intron          complement(3782..3840)
FT                   /locus_tag="An14g01050"
FT                   /number=4
FT   exon            complement(3841..4000)
FT                   /locus_tag="An14g01050"
FT                   /number=5
FT   intron          complement(4001..4064)
FT                   /locus_tag="An14g01050"
FT                   /number=5
FT   exon            complement(4065..4264)
FT                   /locus_tag="An14g01050"
FT                   /number=6
FT   intron          complement(4265..4320)
FT                   /locus_tag="An14g01050"
FT                   /number=6
FT   exon            complement(4321..4592)
FT                   /locus_tag="An14g01050"
FT                   /number=7
FT   intron          complement(4593..4661)
FT                   /locus_tag="An14g01050"
FT                   /number=7
FT   exon            complement(4662..5214)
FT                   /locus_tag="An14g01050"
FT                   /number=8
FT   CDS_pept        join(7444..7680,7736..7809,7867..11227)
FT                   /locus_tag="An14g01060"
FT                   /note="Complex: protein may interact with TFIIH, which is
FT                   involved in transcription-coupled repair."
FT                   /note="Function: putative helicase, DNA repair and
FT                   recombination protein."
FT                   /note="Similarity: also similarity to human DNA repair
FT                   helicase ERCC6."
FT                   /note="Title: strong similarity to DNA repair and
FT                   recombination protein Rad26 - Saccharomyces cerevisiae"
FT                   /note="nucleus"
FT                   /note="See PMID 9566886"
FT                   /note="See PMID 9880486"
FT                   /note="See PMID 10666451"
FT                   /db_xref="GOA:A2R2K5"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2K5"
FT                   /inference="profile:COGS:COG0553"
FT                   /inference="profile:PFAM:PF00176"
FT                   /inference="profile:PFAM:PF00271"
FT                   /inference="similar to AA sequence:UniProtKB:SCRAD26.2"
FT                   /protein_id="CAK46446.1"
FT                   /translation="MDGAKLNDVDVAASRSGFDEDMKKEEEPEQQAKSTLDPAESEASL
FT                   NQGHSANADEASRLRELQADVRDQDDLERDISRQADRLLMEQADERDSKRLEKTTLEKQ
FT                   KLESQILKLHQRLSQPVGTSARVRISNEIEKLESRNTALATDLKEIQQRMDERHQGDEA
FT                   GSQTTGTGRMPNESRRDYLIRTGKITPFSNMSSGPNHGPLASLQDALIDAEDERDEKEA
FT                   LEQVKNRSAVSHRNLVRPGFGFDETPASSLVDEAPTSRASKRRKIDRESHEEEEEALEQ
FT                   ETKVSLEDNFEDQDESASYVESERQSSVSEDEEEFLPEERPKRTAKPVKAPKSSDEVED
FT                   FSGMDDGNEELYQTRLQYWVSRRAAARKRALESRVAGHGPEVDAAGDNVDVLDQDEQEE
FT                   WFMPHPTVSDMPYDNGYRIPGDIHPLLFDYQKTGVQWLWELQQQQVGGIIGDEMGLGKT
FT                   IQVISFLAGLHYSKKLTRPVIVVCPATVMKQWVNEFHRWWPPFRVSILHTSGSGMVNIR
FT                   NESSREDALLSQAWNASSTRGMPSGLKAARKVVKRVVEEGHVLVTTYSGLQTYASLVIP
FT                   IEWGCAVLDEGHKIRNPNTSITIHCKELRTPHRIILSGTPMQNNLTELWSLFDFVFPMR
FT                   LGTLVNFRNQFEFPIRQGGYANASNLQVQTAAKCAETLKDAISPYLLQRFKIDVAADLP
FT                   KKSEQVLFCKLTKPQRQAYEAFLGSEEMKSILNGRRQVLFGVDILRKICNHPDLQNHKL
FT                   MSSTTGYGSGSKSGKMQVVKSLLELWKDTGHKTLLFTQHRIMLDILEKFVNSLSGFSYR
FT                   RMDGTTPIQHRQAMVDEFNNDPSLHVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDV
FT                   QARERAWRLGQKRDVTVYRLMTAGTIEEKIYHRQIFKQFLTNKILRDPKQRQTFQLSDL
FT                   HDLFSLGDEGQGPTETSKIFKDADVTYEDSDGTSRKSNAAIKSSASSHSAQEEKKDISK
FT                   VVGVAAVEQFQGDQEQQSEQEKGTSGANSESRIMEGIFARSGVHSALEHDQIVNGKRVV
FT                   RADPKIIEAEAKRVAAEAAEELRRAGEAARSVPIGTPTWTGQFGLAGKPEEQLPSRPAF
FT                   GGSSSAARRAVAGPSSASILANLSARTPSPRSSSNSPAPSRTPSGIDFITMIRDFITAQ
FT                   GGSVYTQMLIDHFNRYCTTPQRSAEFKEMLKTIAVLDKGGRNGRGKWALKPEYAKRR"
FT   mRNA            join(<7444..7680,7736..7809,7867..>11227)
FT                   /locus_tag="An14g01060"
FT   exon            7444..7680
FT                   /locus_tag="An14g01060"
FT                   /number=1
FT   intron          7681..7735
FT                   /locus_tag="An14g01060"
FT                   /number=1
FT   exon            7736..7809
FT                   /locus_tag="An14g01060"
FT                   /number=2
FT   intron          7810..7866
FT                   /locus_tag="An14g01060"
FT                   /number=2
FT   exon            7867..11227
FT                   /locus_tag="An14g01060"
FT                   /number=3
FT   CDS_pept        join(13334..13742,13809..13900)
FT                   /locus_tag="An14g01068"
FT                   /note="Title: strong similarity to EST an_2307 -Aspergillus
FT                   niger"
FT                   /db_xref="GOA:A2R2K6"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2K6"
FT                   /protein_id="CAK46447.1"
FT                   /translation="MKFLASLALLASTVAASPMLYPRQSSNSTQSFYLKTSGASNDNHN
FT                   NLYVYAYHTGAGFNDAVLTSDVGTASPAFLNGTHTQFDLGTSFPWGFKMGVQNNYAAWE
FT                   SVQINVGYGDDDFAIGTTGLEWSAQDGFGGWLVCDWYPTHPSSSTSTATKSPLFLPPAA
FT                   LST"
FT   mRNA            join(<13334..13742,13809..>13900)
FT                   /locus_tag="An14g01068"
FT   exon            13334..13742
FT                   /locus_tag="An14g01068"
FT                   /number=1
FT   sig_peptide     13334..13381
FT                   /locus_tag="An14g01068"
FT                   /inference="protein motif:SignalP:2.0"
FT   mat_peptide     join(13382..13742,13809..13897)
FT                   /locus_tag="An14g01068"
FT   intron          13743..13808
FT                   /locus_tag="An14g01068"
FT                   /number=1
FT   exon            13809..13900
FT                   /locus_tag="An14g01068"
FT                   /number=2
FT   CDS_pept        join(15233..15338,15424..16029,16079..16215)
FT                   /locus_tag="An14g01070"
FT                   /note="Remark: similarity corresponds only to multiple A
FT                   and T-repeats."
FT                   /note="Title: strong similarity to hypothetical protein
FT                   EAA61306.1 - Aspergillus nidulans"
FT                   /db_xref="GOA:A2R2K7"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2K7"
FT                   /protein_id="CAK46448.1"
FT                   /translation="MRSMSRLFILCLLLLLGTVTSAWPWRPHGELLRRADTTAAESATT
FT                   GAAATTESASKTEAATKTAAATGTDTTATATGTNTKSATKTGTASGKSSGSSSNSTTSV
FT                   SINPAAGAGGISMLIPTEGATSYYKIGDFVTLEWNYTSLTISPTAVNVVASCSLNSATY
FT                   TISSNMTMSPTGKVVWDTKKYQANATVPLLTASYTLIVWDASKAITETASAGYLSAASS
FT                   YIFGMYSSQPYTPLNGFVCATCSGAFSELERLGMKFTFGMFAITVLSFTWFAGGFGLFS
FT                   T"
FT   mRNA            join(<15233..15338,15424..16029,16079..>16215)
FT                   /locus_tag="An14g01070"
FT   exon            15233..15338
FT                   /locus_tag="An14g01070"
FT                   /number=1
FT   sig_peptide     15233..15298
FT                   /locus_tag="An14g01070"
FT                   /inference="protein motif:SignalP:2.0"
FT   mat_peptide     join(15299..15338,15424..16029,16079..16212)
FT                   /locus_tag="An14g01070"
FT   intron          15339..15423
FT                   /locus_tag="An14g01070"
FT                   /number=1
FT   exon            15424..16029
FT                   /locus_tag="An14g01070"
FT                   /number=2
FT   intron          16030..16078
FT                   /locus_tag="An14g01070"
FT                   /number=2
FT   exon            16079..16215
FT                   /locus_tag="An14g01070"
FT                   /number=3
FT   CDS_pept        complement(join(18159..18323,18395..19051,19107..19298))
FT                   /locus_tag="An14g01080"
FT                   /product="hypothetical protein"
FT                   /note="Remark: similarities correspond to different short
FT                   domains."
FT                   /db_xref="GOA:A2R2K8"
FT                   /db_xref="InterPro:IPR021627"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2K8"
FT                   /protein_id="CAK46449.1"
FT                   /translation="MASAPNPGQTLPRMPVVVPAMVPPSNGAEASTGGASNTDPSPDAW
FT                   DSEMQLVSSLAKLQKMEAMIHQLRTLLPERLLEPLAPIVNPKAAAGRPVPKSPQMLYEQ
FT                   LAQAARAGVSELQEFQSMWRSPEMKAVWDRIDAQIKENGGVMLQPTGKWERDYDTILAD
FT                   LREEEQTQNEQQQKANEEMERSKIQATEGGWRAIVEGFAQKNVPGVRVLASQSEAAVTV
FT                   VLVKAGMVFRVEAIAGQDGNGVPDWRVFTRTPGGQTPSKVETAVAQCLNSRPRQWDLLY
FT                   LLDMISSYSTIKQTPCAKCTKMTDSTATLPTIRKPSSTPQEQGSQTWEAYHQGCTE"
FT   mRNA            complement(join(<18159..18323,18395..19051,19107..>19298))
FT                   /locus_tag="An14g01080"
FT   exon            complement(18159..18323)
FT                   /locus_tag="An14g01080"
FT                   /number=1
FT   intron          complement(18324..18394)
FT                   /locus_tag="An14g01080"
FT                   /number=1
FT   exon            complement(18395..19051)
FT                   /locus_tag="An14g01080"
FT                   /number=2
FT   intron          complement(19052..19106)
FT                   /locus_tag="An14g01080"
FT                   /number=2
FT   exon            complement(19107..19298)
FT                   /locus_tag="An14g01080"
FT                   /number=3
FT   tRNA            19763..19835
FT                   /gene="tRNA-Lys (CTT)"
FT                   /locus_tag="An14e01090"
FT                   /product="transfer RNA-Lys (CTT)"
FT                   /inference="profile:tRNAscan:1.4"
FT   mobile_element  20115..20263
FT                   /mobile_element_type="transposon:Tndm1"
FT                   /locus_tag="An14e01100"
FT                   /note="Title: probable transposon 160bp LTR (Tndm1-LTR)
FT                   -Aspergillus niger"
FT   CDS_pept        complement(join(20750..20910,20963..21229,21286..21946,
FT                   22007..22456))
FT                   /locus_tag="An14g01110"
FT                   /EC_number="1.14.14.-"
FT                   /note="Function: YlALK1 functions to assimilate n-decane
FT                   and longer molecules in Yarrowia lipolytica."
FT                   /note="Induction: the expression of the P450 gene YlALK1
FT                   was induced by n-tetradecane and repressed by glycerol in
FT                   Yarrowia lipolytica."
FT                   /note="Remark: disruption of Yarrowia lipolytica gene ALK1
FT                   results in decreased n-decane assimilation."
FT                   /note="Title: strong similarity to alkane-inducible
FT                   cytochrome P450 gene ALK1 - Yarrowia lipolytica"
FT                   /note="See PMID 3892551"
FT                   /note="See PMID 9848230"
FT                   /note="See PMID 10953079"
FT                   /db_xref="GOA:A2R2K9"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002402"
FT                   /db_xref="InterPro:IPR002974"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2K9"
FT                   /inference="profile:COGS:COG2124"
FT                   /inference="profile:PFAM:PF00067"
FT                   /inference="similar to AA sequence:UniProtKB:AB010388.1"
FT                   /protein_id="CAK46450.1"
FT                   /translation="MLAAAIVFLGAIYLTFRILSSLHQAYHHRKKAKALGCQPPNSVDT
FT                   GFLGITGFYRIAKAAREKRWVEYIAEHYQTSGPTFRQQALGGLMVTNTVEPENIKALLA
FT                   TQFQDFGLGTRHREFYPLLGNGIFTLDGAGWSHARGMLRPQFTRDQVADLDLMDGHVTK
FT                   MMDLIPKDGSTFDIQRLFFLLTIDSATHFLFGESVGSMRTSAESSLLEKSTVGNAQGFA
FT                   EAFNRAQEYLAARSRAMAFYWLVNPKEFREANQLVHEVVDHYVRLALEAKRHPEKKEPG
FT                   RYIFAEALAGDTDDPRVIRDNMLNILLAGRDTTASLLSSAFFYLARHPNVWTRLRQTIV
FT                   DEFGDAQHPNGKITHARLKDTPYLRYFLNEVLRLLPPVPLNFRVAAKDTSLPLGGGPDG
FT                   KAPIYVRKGELVSYSVYAMHRRTDLYGPDAHAFRPERWEENSKRGWEYLPFNGGPRICL
FT                   GQQYALTEASYTMVKLLQRYNRIENADPDMMEPIINSSLTLSHDRGVHIRLFSA"
FT   mRNA            complement(join(<20750..20910,20963..21229,21286..21946,
FT                   22007..>22456))
FT                   /locus_tag="An14g01110"
FT   exon            complement(20750..20910)
FT                   /locus_tag="An14g01110"
FT                   /number=1
FT   mat_peptide     complement(join(20753..20910,20963..21229,21286..21946,
FT                   22007..22396))
FT                   /locus_tag="An14g01110"
FT   intron          complement(20911..20962)
FT                   /locus_tag="An14g01110"
FT                   /number=1
FT   exon            complement(20963..21229)
FT                   /locus_tag="An14g01110"
FT                   /number=2
FT   intron          complement(21230..21285)
FT                   /locus_tag="An14g01110"
FT                   /number=2
FT   exon            complement(21286..21946)
FT                   /locus_tag="An14g01110"
FT                   /number=3
FT   intron          complement(21947..22006)
FT                   /locus_tag="An14g01110"
FT                   /number=3
FT   exon            complement(22007..22456)
FT                   /locus_tag="An14g01110"
FT                   /number=4
FT   sig_peptide     complement(22397..22456)
FT                   /locus_tag="An14g01110"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(join(23201..24670,24725..24883))
FT                   /locus_tag="An14g01120"
FT                   /EC_number="3.4.16.-"
FT                   /note="Similarity: the human gene has sequence homology
FT                   with lysosomal prolylcarboxypeptidase."
FT                   /note="Title: strong similarity to thymus specific serine
FT                   peptidase TSSP - Homo sapiens"
FT                   /note="See PMID 10527559"
FT                   /note="See PMID 10630289"
FT                   /db_xref="GOA:A2R2L0"
FT                   /db_xref="InterPro:IPR008758"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2L0"
FT                   /protein_id="CAK46451.1"
FT                   /translation="MGSRQGKAPFGWGTQSLAHFGINPDLGLHNQQNLNSLISHSAMAT
FT                   ALETEYATIPIDHNNASAGTYQNRFWVSDEFYQPGNPIFVYDTGESDGGSIAQSYLTST
FT                   LSFFREFLIEFNAMGIAWEHRYYGNSTPAPVSYETPPEAWQYLTTKQALADLPYFASNF
FT                   SREKYPDMDLTPQGTPWIMVGGSYAGIRAALTRKEYPETIFAAFSSSSPVEAQVNMSAY
FT                   YDQVYRGMVASGWTNCSADIHAALEYIDDQLSDEDTATSVKQLFFGSGAETNSNGDFTA
FT                   ALTAIYGYFQSYGMAGGIGGLGAFCEYLEIDPKTNGTTGPDGLAPTYGGQYVAERWAAW
FT                   PTFLELVNLNMGTNCGPQDASQPIDCDFSKPYGDPSAITWTWQYCSEWGFFQANNDGPH
FT                   SLASRYQSVEYQQEVCNRQFPDAVDKGLLPPSPRADDVNQEFGGWTIRPSNVYFSGGEF
FT                   DPWRSLSILSTEDFAPQGVEFTSAIPACGVQTNEDTVFGYVMQNSEHCFDFQATPTVGK
FT                   LSRGIFTSALLQWLECFGQNSSQSR"
FT   mRNA            complement(join(<23201..24670,24725..>24883))
FT                   /locus_tag="An14g01120"
FT   exon            complement(23201..24670)
FT                   /locus_tag="An14g01120"
FT                   /number=1
FT   intron          complement(24671..24724)
FT                   /locus_tag="An14g01120"
FT                   /number=1
FT   exon            complement(24725..24883)
FT                   /locus_tag="An14g01120"
FT                   /number=2
FT   CDS_pept        join(27717..27972,28015..28122,28171..28292,28339..28408,
FT                   28455..28530,28576..28627,28675..28886,28935..29156,
FT                   29219..29465,29523..29663,29727..29783,29912..29950)
FT                   /locus_tag="An14g01130"
FT                   /EC_number="4.2.2.-"
FT                   /note="Expression: expression of rhamnogalacturonan
FT                   degrading enzymes by A. acculeatus is regulated at the
FT                   level of transcription and is subjected to carbon
FT                   catabolite repression by glucose."
FT                   /note="Function: the enzyme is found to be a
FT                   rhamnogalacturonan
FT                   alpha-L-rhamnopyranosyl-(1-->4)-alpha-D-galactopyranosylur
FT                   onide lyase."
FT                   /note="Remark: rhamnogalacturonan is a pectic
FT                   polysaccharide."
FT                   /note="Title: strong similarity to rhamnogalacturonase B
FT                   precursor rhgB - Aspergillus aculeatus"
FT                   /note="See PMID 7576553"
FT                   /note="See PMID 7592973"
FT                   /note="See PMID 7961884"
FT                   /note="See PMID 8587995"
FT                   /db_xref="GOA:A2R2L1"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR015364"
FT                   /db_xref="InterPro:IPR016590"
FT                   /db_xref="InterPro:IPR029411"
FT                   /db_xref="InterPro:IPR029413"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2R2L1"
FT                   /inference="similar to AA sequence:PIR:B55415"
FT                   /protein_id="CAK46452.1"
FT                   /translation="MLSKTSLLSLLSLAAGVVNADFGITTNDDSYVINANSPNSLVFTV
FT                   DRGSCDITSIVHYGTELQYSGKGSHIGSGLGTATVSATKSGAGDYIKVTCETDTLTQYM
FT                   VVHDGDPIIHMATYITEEPSIGELRFIARLNSDVLPNEEPFGDVSNTADGEAIEGSDVF
FT                   LVDGETRSKFYSSQRFIDDQRHCIAGDEHRVCMILNQYETSSGGPFHRDINSNNGGDYN
FT                   SLYWYMNSGHVQLESYRMGLHGPYSMYFSRSGTPSTDIDTSFFADLDIEGYVAESGRGT
FT                   VSGTASGADSSFDWVVHWYNDDAQYWTYTSSSGSFTSPAMKPGTYTMVYYQGEYVVATS
FT                   EVTVSAGSSTSKDISGSVETGTTIFKIGDWDGQPTGFRNAENQLRMHPSDSRMSDWGPL
FT                   TYTVGSSSLTDFPMAIFKSVNSPVTIKFTATSDQTGAATLRIGTTLSFAGGRPQATIND
FT                   YEGSAPSAPTNLDSRGVTRGAYRGYGDVYDVSVPEGTIVEGENTITISVISGSSGDDFL
FT                   SPNFLDAVFIIALVDN"
FT   mRNA            join(<27717..27972,28015..28122,28171..28292,28339..28408,
FT                   28455..28530,28576..28627,28675..28886,28935..29156,
FT                   29219..29465,29523..29663,29727..29783,29912..>29950)
FT                   /locus_tag="An14g01130"
FT   exon            27717..27972
FT                   /locus_tag="An14g01130"
FT                   /number=1
FT   sig_peptide     27717..27776
FT                   /locus_tag="An14g01130"
FT                   /inference="protein motif:SignalP:2.0"
FT   mat_peptide     join(27777..27972,28015..28122,28171..28292,28339..28408,
FT                   28455..28530,28576..28627,28675..28886,28935..29156,
FT                   29219..29465,29523..29663,29727..29783,29912..29947)
FT                   /locus_tag="An14g01130"
FT   intron          27973..28014
FT                   /locus_tag="An14g01130"
FT                   /number=1
FT   exon            28015..28122
FT                   /locus_tag="An14g01130"
FT                   /number=2
FT   intron          28123..28170
FT                   /locus_tag="An14g01130"
FT                   /number=2
FT   exon            28171..28292
FT                   /locus_tag="An14g01130"
FT                   /number=3
FT   intron          28293..28338
FT                   /locus_tag="An14g01130"
FT                   /number=3
FT   exon            28339..28408
FT                   /locus_tag="An14g01130"
FT                   /number=4
FT   intron          28409..28454
FT                   /locus_tag="An14g01130"
FT                   /number=4
FT   exon            28455..28530
FT                   /locus_tag="An14g01130"
FT                   /number=5
FT   intron          28531..28575
FT                   /locus_tag="An14g01130"
FT                   /number=5
FT   exon            28576..28627
FT                   /locus_tag="An14g01130"
FT                   /number=6
FT   intron          28628..28674
FT                   /locus_tag="An14g01130"
FT                   /number=6
FT   exon            28675..28886
FT                   /locus_tag="An14g01130"
FT                   /number=7
FT   intron          28887..28934
FT                   /locus_tag="An14g01130"
FT                   /number=7
FT   exon            28935..29156
FT                   /locus_tag="An14g01130"
FT                   /number=8
FT   intron          29157..29218
FT                   /locus_tag="An14g01130"
FT                   /number=8
FT   exon            29219..29465
FT                   /locus_tag="An14g01130"
FT                   /number=9
FT   intron          29466..29522
FT                   /locus_tag="An14g01130"
FT                   /number=9
FT   exon            29523..29663
FT                   /locus_tag="An14g01130"
FT                   /number=10
FT   intron          29664..29726
FT                   /locus_tag="An14g01130"
FT                   /number=10
FT   exon            29727..29783
FT                   /locus_tag="An14g01130"
FT                   /number=11
FT   intron          29784..29911
FT                   /locus_tag="An14g01130"
FT                   /number=11
FT   exon            29912..29950
FT                   /locus_tag="An14g01130"
FT                   /number=12
FT   CDS_pept        complement(join(30056..31419,31545..31781))
FT                   /exception="reasons given in citation"
FT                   /locus_tag="An14g01140"
FT                   /EC_number="3.5.4.3"
FT                   /note="Catalytic activity: guanine + H2O = xanthine + NH3."
FT                   /note="Remark: a putative sequencing error results in an
FT                   frameshift."
FT                   /note="Similarity: shows also similarity to
FT                   chlorohydrolases from different bacteria."
FT                   /note="Title: strong similarity to guanine deaminase Gda
FT                   -Mus musculus [putative frameshift]"
FT                   /note="putative frameshift"
FT                   /note="See PMID 6098039"
FT                   /note="See PMID 8226898"
FT                   /note="See PMID 10075721"
FT                   /db_xref="GOA:A2R2L2"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2L2"
FT                   /inference="profile:COGS:COG0402"
FT                   /inference="profile:PFAM:PF01979"
FT                   /protein_id="CAK46453.1"
FT                   /translation="MSPKYTLFVGTFIQLPRFKSEEGHQLAITRGALWVSTADGTIEGF
FT                   DWSIANDRDLKRFLRHKGWTVVNDKDGHNKNKHGKHPIDTHIHAPQYPNAGLFGDAGLL
FT                   HWLKNYTFPIEASSAAPNSPPSLYAYRVYNQVVARTLANGTTCASYFATIHVPATNLLA
FT                   SLCHARGQRALIGRVCMDRPEQCPDDLRDESPDIAIDKTQASIDHIHTIDPEGALIQPI
FT                   VTPRFAPSCTPRSLGKLSKLAASYSPPLHIQTHLAENLDELDLVKKLYPESRDYTSVYN
FT                   YFKLLTPRTILAHCVHLSDDERAMIAENDAKLSHCPASNSALGSGICEVRKAIDSGITV
FT                   GLGTDVSGGYNPSILETVRQACLVSRLLPHMSRAQPEEREGTPDDNDDKVPREVLSIEE
FT                   ALYLATRGGAAVVDMADQIGGFDQGMVWDAQMVKLGKFNPAGRWGKTGGVESAVDVFDE
FT                   GQSWKEKVHKWVWNGDSRNVRMVWVGGRLVHRVWEEGEDRDGRGKGGWVRWVMGAVGVG
FT                   AVGWVIVRRLGGGR"
FT   mRNA            complement(join(<30056..31419,31545..>31781))
FT                   /locus_tag="An14g01140"
FT   exon            complement(30056..31419)
FT                   /locus_tag="An14g01140"
FT                   /number=1
FT   intron          complement(31420..31544)
FT                   /locus_tag="An14g01140"
FT                   /number=1
FT   exon            complement(31545..31781)
FT                   /locus_tag="An14g01140"
FT                   /number=2
FT   CDS_pept        complement(join(32377..32432,32484..35610))
FT                   /locus_tag="An14g01150"
FT                   /EC_number="1.4.4.2"
FT                   /EC_number="2.1.2.10"
FT                   /note="Catalytic activity: glycine + lipoylprotein =
FT                   S-aminomethyldihydrolipoylprotein + CO2."
FT                   /note="Remark: protein is a component, with EC 2. 1. 2.
FT                   10,of the glycine cleavage system, previously known as
FT                   glycine synthase."
FT                   /note="Similarity: the protein shows also similarities to
FT                   aminomethyltransferases from different organisms."
FT                   /note="Title: strong similarity to glycine dehydrogenase
FT                   component P - Pisum sativum"
FT                   /note="localisation:mitochondrion"
FT                   /note="See PMID 8206222"
FT                   /note="See PMID 9479445"
FT                   /db_xref="GOA:A2R2L3"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2L3"
FT                   /inference="profile:COGS:COG0403"
FT                   /inference="profile:COGS:COG1003"
FT                   /inference="profile:PFAM:PF02347"
FT                   /inference="similar to AA sequence:PIR:A42109"
FT                   /protein_id="CAK46454.1"
FT                   /translation="MAASLCALRGTRQLALRSRLRAAPSPIAVRRVSPLIRSLHTTTQQ
FT                   SPSARRPVYTSSVADHGVPHPPDLFQPLDTFPRRHIGPSPDAAKEMLATLDPPVASLDE
FT                   FVKQVLPADILSEKDLKVSAPHSTANLPHSSVHGGLGETDMLKLLDTYRKQIDVSGKTY
FT                   LGTGYYPTIVPPVILRNVLENPAWYTSYTPYQPEISQGRLESLLNFQTLTADLTGLPFA
FT                   NASVLDEGTAAAEAMTMSLATLPMSKQKKAGKSYVVSHLCHPQTIAVMRSRAEGFGINL
FT                   VVGDILADDFKLVKEQGDKLIGVLAQYPDTEGGIYDFQSLSDTIHGSGGTFSVATDLLA
FT                   LTLLKAPGEFGADIAFGSAQRLGVPMGYGGPHAAFFACADKYKRKVPGRVVGVSKDRLG
FT                   NRALRLALQTREQHIRREKATSNICTAQALLANMTAMYAVYHGPAGLKAIAQRIMSMTT
FT                   TLQAKLAGLGYNVPIKSNSADGGALFDTVVVELSGAQETDAIIAAAREQSIFLRRLNDT
FT                   KVGISLDETVGREEVKSILRVFAAHASKAEVGLEEDLAVAPVPASLERTSAYLTHPVFN
FT                   THHSETEMLRYIRHLESKDLSLAHSMIPLGSCTMKLNATTEMIPISWPEFSQMHPFLPA
FT                   DVAKGYTQMIDDLEQQLADITGMAEVTVQPNSGAQGEFAGLRVIKKYQEAHEGDKRNIC
FT                   LIPVSAHGTNPASAAMAGMRVVTIKCDTKTGNLDLEDLKAKCEKHKDELAAVMITYPST
FT                   FGVYEPGIKQACEIVHQHGGQVYMDGANMNAQIGLCSPGEIGADVCHLNLHKTFCIPHG
FT                   GGGPGVGPIGVAEHLRPYLPSHPGSEYLQSKRTESSSPPISAAPWGSASILPITFNYIN
FT                   MMGSKGLTHATKITLLNANYILARLKDHYPILYTNENGRCAHEFILDVRKFKDTCGVEA
FT                   IDIAKRLQDYGFHAPTMSWPVANTLMIEPTESENKAELDRFCDALISIREEIAAVESGA
FT                   QPQEGNVLKMAPHTQRDLLSSEWNRPYTRETAAYPLPYLVEKKFWPSVTRVDDAYGDQN
FT                   LFCTCGPVEDSE"
FT   mRNA            complement(join(<32377..32432,32484..>35610))
FT                   /locus_tag="An14g01150"
FT   exon            complement(32377..32432)
FT                   /locus_tag="An14g01150"
FT                   /number=1
FT   intron          complement(32433..32483)
FT                   /locus_tag="An14g01150"
FT                   /number=1
FT   exon            complement(32484..35610)
FT                   /locus_tag="An14g01150"
FT                   /number=2
FT   CDS_pept        complement(join(36680..36803,36859..37320,37377..37594,
FT                   37641..37786,37833..37880,37939..38008,38070..38244,
FT                   38362..38579))
FT                   /locus_tag="An14g01160"
FT                   /note="Expression: DAL5 is a constitutively expressed
FT                   allantoin system gene whose product is required for
FT                   allantoate transport in yeast."
FT                   /note="Remark: dal5 mutants of S. cerevisiae lack
FT                   allantoate transport; these mutant strains also exhibit a
FT                   60% loss of allantoin transport capability."
FT                   /note="Title: strong similarity to allantoate permease Dal5
FT                   - Saccharomyces cerevisiae"
FT                   /note="See PMID 3549700"
FT                   /note="See PMID 2651902"
FT                   /note="See PMID 3275614"
FT                   /db_xref="GOA:A2R2L4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2L4"
FT                   /inference="profile:COGS:COG0477"
FT                   /protein_id="CAK46455.1"
FT                   /translation="MSSTDIEKPPSVERIEDIDKPEIHDVDYDEEFTPAEQRKIIHRVD
FT                   RRLVTMAGLAYCISLMDRTNLSMAAVAGSTLSVLLDVTADKGQSVVILVFFIPYVVFQP
FT                   PMTVIIRKVGPTLFLGTLVISWGAILVGMGFVKNWKQMVAIRVLLGALEAGYFPGCVYL
FT                   LSSWYARYDIQKRYSVFYLIGCVASALAGVLAFGLMQMGGIQGISGWRWIFIMEGVITG
FT                   AIGLLTFVFMVDFPEKAHKSWKFLNERESAFIVRRINRDRADGNEEPFTFKRFFSPAFD
FT                   LKIWGFALICLCSTTVAYAIAYFLPIILQEGMGFSTGASQCLVAPPYGFAGIVMYTTAW
FT                   ISDRYRMRGPIVAFNAVVGIIGLPLMGFAKGNAARYVGVFLVVAGANSNIPAVMAYQAN
FT                   NIRGQWTRAFCSATLIGVGAIGGIISSLVFQSKDAPEYRPGIWTTIACNLVTMITVAAL
FT                   SVWFRYANKQADRGERVIEGSSDFRYTI"
FT   mRNA            complement(join(<36680..36803,36859..37320,37377..37594,
FT                   37641..37786,37833..37880,37939..38008,38070..38244,
FT                   38362..>38579))
FT                   /locus_tag="An14g01160"
FT   exon            complement(36680..36803)
FT                   /locus_tag="An14g01160"
FT                   /number=1
FT   intron          complement(36804..36858)
FT                   /locus_tag="An14g01160"
FT                   /number=1
FT   exon            complement(36859..37320)
FT                   /locus_tag="An14g01160"
FT                   /number=2
FT   intron          complement(37321..37376)
FT                   /locus_tag="An14g01160"
FT                   /number=2
FT   exon            complement(37377..37594)
FT                   /locus_tag="An14g01160"
FT                   /number=3
FT   intron          complement(37595..37640)
FT                   /locus_tag="An14g01160"
FT                   /number=3
FT   exon            complement(37641..37786)
FT                   /locus_tag="An14g01160"
FT                   /number=4
FT   intron          complement(37787..37832)
FT                   /locus_tag="An14g01160"
FT                   /number=4
FT   exon            complement(37833..37880)
FT                   /locus_tag="An14g01160"
FT                   /number=5
FT   intron          complement(37881..37938)
FT                   /locus_tag="An14g01160"
FT                   /number=5
FT   exon            complement(37939..38008)
FT                   /locus_tag="An14g01160"
FT                   /number=6
FT   intron          complement(38009..38069)
FT                   /locus_tag="An14g01160"
FT                   /number=6
FT   exon            complement(38070..38244)
FT                   /locus_tag="An14g01160"
FT                   /number=7
FT   intron          complement(38245..38361)
FT                   /locus_tag="An14g01160"
FT                   /number=7
FT   exon            complement(38362..38579)
FT                   /locus_tag="An14g01160"
FT                   /number=8
FT   CDS_pept        complement(join(40432..40871,40961..41786))
FT                   /locus_tag="An14g01170"
FT                   /note="Title: similarity to hypothetical protein B7F18.110
FT                   - Neurospora crassa"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2L5"
FT                   /inference="similar to AA sequence:PIR:T50992"
FT                   /protein_id="CAK46456.1"
FT                   /translation="MPAKRSTTQAKPFRYVDECQTRSSASLGDLKLGRIRVDCCFLISK
FT                   TQWGKLRGQDAGLMYLDLTFHQPTDCKLSQATITMNFHEAEHRRRRINTGLEVTEFFGP
FT                   KILTGEKRERQVSKSFEATPKVGTANASVEGIGISRKTQASYASRWKFTGSRFTDDSDD
FT                   ESYTPNNRYRQLVWHLEENELERQAVHHSIVHTALTFHHDSSPFYLDLQIEVKMQRWHH
FT                   RVRQRLVCPPRNKKALTRAKIKPVVSATDDPYFSKLVRNIDQVMVEENLHPVADDTLGK
FT                   DPDTEFSEICLPNEALLELARQLTGNKSPSTLAPPRSSSAASTQTVNSSDSTLVESETI
FT                   SQSDEQAEIKCTSSEAGNPITVDPPKEIIKTTTIPEHASRVALSGARHTSQVLAALIAW
FT                   LILGLNGLHAGLTRAGRGLEKS"
FT   mRNA            complement(join(<40432..40871,40961..>41786))
FT                   /locus_tag="An14g01170"
FT   exon            complement(40432..40871)
FT                   /locus_tag="An14g01170"
FT                   /number=1
FT   intron          complement(40872..40960)
FT                   /locus_tag="An14g01170"
FT                   /number=1
FT   exon            complement(40961..41786)
FT                   /locus_tag="An14g01170"
FT                   /number=2
FT   CDS_pept        join(42074..42763,42825..44561,44630..44968)
FT                   /locus_tag="An14g01180"
FT                   /note="Remark: similarity corresponds to a distinct
FT                   region."
FT                   /note="Title: similarity to hypothetical protein encoded by
FT                   An02g08790 - Aspergillus niger"
FT                   /db_xref="GOA:A2R2L6"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2L6"
FT                   /protein_id="CAK46457.1"
FT                   /translation="MTLNITIGSDRASDEEDSSESGVEIAPPSITGSHASHDSHAEWAD
FT                   VPLPDELKPGKKAYKPPPRVQSRYWAAAPSPFRVSKQDDWLISSGDNDKDITAHLNLDV
FT                   ALDLEHELGYLARLNRLGHFKKGIRYFERRLAPYVDFFPVVAEYADLLLEQGNFGNLHQ
FT                   FISSRLKDHLVEYSKEEYILLKILKAFAEIYTKGAIVPALNMAKETLSHLSVRKHVSKV
FT                   PSLSTGVKIQLLEMCVRIITNAAAYSNLLETESFNPLLYWSASSNGTVKLDDKGDSGEI
FT                   HARGYRTPRQSPPRIGSWYRFLLQEGFSWDAHRILRSILPMLGSPDGHYIFNGRFEEFF
FT                   ELKNISEAEKVLLQPAEMSFQDEQVLLAEFANACLLADFLSAERFSEIVQVAGCQFLQR
FT                   SRSLASAILLEYPHLISTRPYLDWLLSESIRILPFSRHVQPLVKNTRLVPDSWTWKSFD
FT                   NMQFLHQRKLSMTRGTELPKTPNDPPSFQSLESISECVRGLGDYRLERSVLHQMFWHSL
FT                   DWDQSLQALRDLTRLNRDLMSDTCGYLQSLIDECIALDYSNAPDCERLREDLYSRFSAF
FT                   DHSFPFRFDYDTAVHESSAIVFFDNALLKYIERNMLFDFLVETGRGTEAELVGMKLSRT
FT                   GHYLPGEIRSSLISTGRYFGRTDSLAAKQIPKSAEIKGHIPDSTLAGYRVPDLVPGPSD
FT                   VRRDGPGGIPRAILQVPYRSDAAADDTALSLERLIRQGRDAERAKQTGDLVEREKKAMK
FT                   QERVRFTQEVARFRRHFQIEEEKKRVAQTDSTSLVTLKDPVGRAFLFPFNQCRPFAAMK
FT                   GLMQQVFRSDNILAPHIAKGNYRFTSLDGNPITRDSWDSDIQPGGTIMVHITSDLGQDL
FT                   SQEPEKANTEHDQPVEGERLTAQLESVNIVDPEDKQDQGPRVDDVSDSST"
FT   mRNA            join(<42074..42763,42825..44561,44630..>44968)
FT                   /locus_tag="An14g01180"
FT   exon            42074..42763
FT                   /locus_tag="An14g01180"
FT                   /number=1
FT   intron          42764..42824
FT                   /locus_tag="An14g01180"
FT                   /number=1
FT   exon            42825..44561
FT                   /locus_tag="An14g01180"
FT                   /number=2
FT   intron          44562..44629
FT                   /locus_tag="An14g01180"
FT                   /number=2
FT   exon            44630..44968
FT                   /locus_tag="An14g01180"
FT                   /number=3
FT   exon            45822..46712
FT                   /locus_tag="An14g01190"
FT                   /number=1
FT   CDS_pept        45822..46712
FT                   /locus_tag="An14g01190"
FT                   /EC_number="3.5.3.1"
FT                   /note="Catalytic activity: L-arginine + H(2)O = L-ornithine
FT                   + urea."
FT                   /note="Regulation: arginase activity is regulated by
FT                   various small molecules, including the product
FT                   L-ornithine."
FT                   /note="Remark: enzyme is a hexamer in B. caldovelox."
FT                   /note="Title: similarity to arginase - Bacillus caldovelox"
FT                   /note="See PMID 8647285"
FT                   /note="See PMID 2029528"
FT                   /db_xref="GOA:A2R2L7"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2L7"
FT                   /inference="profile:COGS:COG0010"
FT                   /inference="similar to AA sequence:PIR:S68863"
FT                   /protein_id="CAK46458.1"
FT                   /translation="MPANAITIIFSPYHVGIRDHRVGNGPHRIRQHGIIQALEDLGVKV
FT                   NFIELDRVDEFEGEIGRSFELLRRTSTAVTQAVKNNTFPIILSGNCMASAAVACGLNTD
FT                   DLKFIYFDAHDDLDSPDVNENGYLDAMGLSMLRGESWKTLTRTVPGYKPFTYDGNFLYC
FT                   GLRDQSDVQRQRVFDAGMVAIWGETERKVDFVGELSKQLEAKSYDPALVHLDLDVLDES
FT                   YGKVNDYPSPGGLFESELLGCMDLVPRRSTPRSLTVCSFDPDAGDGDRIAVIAVRAVTS
FT                   FVQSLLDTGALINDA"
FT   mRNA            <45822..>46712
FT                   /locus_tag="An14g01190"
FT   CDS_pept        complement(join(47069..47572,47639..47816,47872..48027,
FT                   48098..48307,48355..48487,48557..49260,49315..49397,
FT                   49485..49556))
FT                   /locus_tag="An14g01200"
FT                   /note="Function: nirA of A. nidulans is a zinc finger
FT                   transcription factor mediating nitrate induction of genes
FT                   involved in nitrate assimilation (nitrate reductase,nitrite
FT                   reductases and a nitrate permease, niaD, niiA and crnA,
FT                   respectively)."
FT                   /note="Remark: the nitrate assimilation genes are induced
FT                   by nitrate and repressed by ammonium at the transcriptional
FT                   level."
FT                   /note="Title: strong similarity to nitrate assimilation
FT                   regulatory protein nirA - Aspergillus nidulans"
FT                   /note="nucleus"
FT                   /note="See PMID 347305"
FT                   /note="See PMID 1990284"
FT                   /db_xref="GOA:A2R2L8"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2L8"
FT                   /inference="profile:PFAM:PF04082"
FT                   /inference="similar to AA sequence:PIR:A41697"
FT                   /protein_id="CAK46459.1"
FT                   /translation="MSQVQSYRKRVSVACDVCRRKRIKCNGAKPSCAGCLGQAEKCEYQ
FT                   YDKEKRKPPTKQHIQALQARIEFLESQLAQYEHKEGKTLTTTTHQMLDRDETFGSRELS
FT                   GTQPRSLDPIDDITDLLGGLSIGEGDQLRYFGSRSNLSFVERQGTKHTTFRQNSHQPLQ
FT                   RIDMDPQIQEELLDIYWKWQNPWQYLVYQKVFLRGLENQIDDGYCTPLLLHSMMALAAR
FT                   YSDNPEVRTVPNDPSTAGDCFSHKARALLFEEIKAPRVSTVVAAAHISLYEMAKDNEPA
FT                   GWIYLGIAIRMAYNLGLHIDPHLWVSSGFMASEEAELRSIAWWGCYMIEKLFTVGIGRP
FT                   SIIHERDIQVNFPSNLADVEYGQWNGDSMPSIDRSPLSYSITTLHNTCRLLRLATRPLD
FT                   DIYTPEQFVTSAEKKSIMTKTNIALTSFYNNLPSVLRLPPTSSRPLPPHMYCFHMHFYT
FT                   LVILLHRPFINIPSNARPPQRSMNGAVSTSLETCTKAAEKVTVLFRAYAKFFTLRKISI
FT                   SVVDTARTAAFIHLFNSTAKDHQIRDKSRQLFLETLQYLEQMSIAWGWAKRSVRALSMI
FT                   ARKWRVHDILNNRDSSSVEPSLAHQHERQDRDSELAGDFDAWLQDPFDLQSAVQVIDNN
FT                   NSSLGEGFNLEQELFHLQDFLSVGDDAYSSSSFLNTDWEHELGL"
FT   mRNA            complement(join(<47069..47572,47639..47816,47872..48027,
FT                   48098..48307,48355..48487,48557..49260,49315..49397,
FT                   49485..>49556))
FT                   /locus_tag="An14g01200"
FT   exon            complement(47069..47572)
FT                   /locus_tag="An14g01200"
FT                   /number=1
FT   intron          complement(47573..47638)
FT                   /locus_tag="An14g01200"
FT                   /number=1
FT   exon            complement(47639..47816)
FT                   /locus_tag="An14g01200"
FT                   /number=2
FT   intron          complement(47817..47871)
FT                   /locus_tag="An14g01200"
FT                   /number=2
FT   exon            complement(47872..48027)
FT                   /locus_tag="An14g01200"
FT                   /number=3
FT   intron          complement(48028..48097)
FT                   /locus_tag="An14g01200"
FT                   /number=3
FT   exon            complement(48098..48307)
FT                   /locus_tag="An14g01200"
FT                   /number=4
FT   intron          complement(48308..48354)
FT                   /locus_tag="An14g01200"
FT                   /number=4
FT   exon            complement(48355..48487)
FT                   /locus_tag="An14g01200"
FT                   /number=5
FT   intron          complement(48488..48556)
FT                   /locus_tag="An14g01200"
FT                   /number=5
FT   exon            complement(48557..49260)
FT                   /locus_tag="An14g01200"
FT                   /number=6
FT   intron          complement(49261..49314)
FT                   /locus_tag="An14g01200"
FT                   /number=6
FT   exon            complement(49315..49397)
FT                   /locus_tag="An14g01200"
FT                   /number=7
FT   intron          complement(49398..49484)
FT                   /locus_tag="An14g01200"
FT                   /number=7
FT   exon            complement(49485..49556)
FT                   /locus_tag="An14g01200"
FT                   /number=8
FT   CDS_pept        complement(join(51009..51273,51331..51574,51627..52434))
FT                   /locus_tag="An14g01210"
FT                   /EC_number="1.5.3.-"
FT                   /note="Function: protein oxidatively degrade glycated low
FT                   molecular weight amines and amino acids under formation of
FT                   hydrogen peroxide and glucosone in Aspergillus."
FT                   /note="Title: strong similarity to fructosyl amine oxygen
FT                   oxidoreductase - Aspergillus fumigatus"
FT                   /note="See PMID 9013588"
FT                   /note="See PMID 9139700"
FT                   /db_xref="GOA:A2R2L9"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2L9"
FT                   /inference="profile:COGS:COG0665"
FT                   /inference="similar to AA sequence:UniProtKB:AFU82830.1"
FT                   /protein_id="CAK46460.1"
FT                   /translation="MAPNNTSYLIVGAGVFGVSTAYHLIQKYPNATVTLVDRDAYDAES
FT                   RVAASWDWNKVVRADYDDMTYCKLALEAQEIFKSDPLWQPYFHQTGVYWTCRSDYAQNV
FT                   ITNHKKLGRNDDIIALPVAEARKLYNGIFDNADYTGVKEVLINRASGWAAAGDALRAVT
FT                   KKCLDLGVKYVKADIATLEFDGRGSCIGVRTRDGDVLSASRVVIAAGAFTPTLLEWSAA
FT                   KSGNGGLRAGDRILAAGITTGMAQLDKEQYERFKDMPVGFQGYTPEEGKPFIGTIPPTK
FT                   DGELKWWGSKIFTNTREVLPGRHISSPPPTDDYNQWKVPGPLKQDIVESRNLWYGPKSA
FT                   EWKMTKHRICWDAFTTSADFIISPHPASKGLYVATCGSFHGYKFFPVLGKYILQMIEGE
FT                   LEPELVEKWAWDRQRPDSSQNVEYPNAEMKHLLEPPAKL"
FT   mRNA            complement(join(<51009..51273,51331..51574,51627..>52434))
FT                   /locus_tag="An14g01210"
FT   exon            complement(51009..51273)
FT                   /locus_tag="An14g01210"
FT                   /number=1
FT   mat_peptide     complement(join(51012..51273,51331..51574,51627..52371))
FT                   /locus_tag="An14g01210"
FT   intron          complement(51274..51330)
FT                   /locus_tag="An14g01210"
FT                   /number=1
FT   exon            complement(51331..51574)
FT                   /locus_tag="An14g01210"
FT                   /number=2
FT   intron          complement(51575..51626)
FT                   /locus_tag="An14g01210"
FT                   /number=2
FT   exon            complement(51627..52434)
FT                   /locus_tag="An14g01210"
FT                   /number=3
FT   sig_peptide     complement(52372..52434)
FT                   /locus_tag="An14g01210"
FT                   /inference="protein motif:SignalP:2.0"
XX
SQ   Sequence 53423 BP; 13337 A; 13134 C; 13777 G; 13175 T; 0 other;
     tcgggggtgt actggagggt cttgccgcca cggccaacgg tcgcaaaacc tcgtcatcac        60
     cggcggtgga aagagcaggg gcttcgatac gctcaatctt ggtcaggcga ggggcggcgg       120
     cgacgggacg ggccacttcc tccttggctt ccatgaagcc atccttgtcc ttcctgtact       180
     tgtcgatctg aacggcgtag tccttgttgt tcttcttgat acgctgctta acggcgttga       240
     atcccttggc gttgctggcg ttcatcttct tgttgctcga cttctgcttc gagatggtcc       300
     cgttgacgaa atcctccagg tccgcaacgg tcttgacgta gatcttcggg gtcgggccag       360
     actggacaat cttgacgatt tgacggttca gcttgtcaaa ctctataaaa cggatgttag       420
     tatcaaaaac ccatccttcc ctccgctgcc ggtcccgcaa ttccattctt tgattccagg       480
     gccaaacgca cctgtcgaga taaccgccca gtcgctgatc ttctcggcat tttcaatcaa       540
     cttgacggtg ttttcgagtt cctccaaccg cttgtccttg gcactcttga cgatagttac       600
     tcgttcctca tcctcgcttt cttcgctttc ggaaacattc ttcatgaaac ggttggcacc       660
     ggtcttgccg gcatcctcgt cctcggaaga ggactcctcc tcctcctcag actcttcctc       720
     gctggactcc tcctcggact gctcctcctc ctcgcgatca ctgtagagct cctcctcctc       780
     agaggagctg gactcgctgt cgctaccgcc accgtagaaa aagcgcgaca tgtttgcgga       840
     tattattcag acgctcgaga tcgggaaagt cgcgggaatc gaagaacggc ggtctcagtc       900
     gtcgccgggg ggataacacg caggtggtag ggcggatcgg gctggttctt ttgcctggca       960
     ggaaaatccg ttgtgagggt tccgagccgc agaggttggg cggcgcgagt cacacacgaa      1020
     atttaagcga ggcggcgcct aaccacaaca ggcaggcggc cagtctccgg gacgcggatt      1080
     gccattgttc ttttccccct caactccaga tctcaatgga tgctatttta tttacttcac      1140
     tgatgggacc ttgtcagatc aagatccacg gcctacagtc attgcggaga tccgggcgtc      1200
     agagaccaga tgagactaca gcgttttccg gcttattgga gttccaccgg cctcccgtga      1260
     ttcgattgtc gcccgtgtcg ttcacttcac ccgccaaagt accaccacac cacacccaca      1320
     ccccccccgt ggggaagaga aaaagagatc aagcagctct agcttttcca gcccatctaa      1380
     actcgggcct catatctcat attttactat ccaagttaca gtcatgttgc tctttgaatc      1440
     gtgcaaaaag ggacggaact aacaaaaagg acatgtcttg catagcacat aacaggtggg      1500
     atcttcgtgc aaatatttgg gtagaaggaa aagaaaattc aagaatcaac ataaatcacc      1560
     tctttccgag tactcctggc tatgccgaaa acagccacat acaggaacct aggagaattg      1620
     acaggggaaa aggaataaat gaggatgagc attgggaagc actgcagcgc tcaactatag      1680
     ggcaagggag cacctgtcca ccgtagcgtg ctgctgtagc ttgacaagca ggccatccgt      1740
     gttcgccgcc acggcggagg tctgacgtta aatatatccc ttgggaactt atgttgcctg      1800
     tcacgtaggg gactttcatt tgtcccgtgc ctaacaacaa ggcaaaccgg ctgtcacagg      1860
     actttcatgg agacagaact cacacgtacc aaggaccaat tcaggtctcg aggaaagctg      1920
     acggtaatga gctttaaatc gagcaggctc ccagatacca ggaaggaggc catttgagtg      1980
     tagctctgcg tccagtttct ggtgatggac gcgcaaagga gcacacactt gcctatacag      2040
     aaaaaatggc ttgtccgtaa ggccgatgga catccatgtg ccatcggcct gttcctgggt      2100
     atgcgtgttc tcaatgccac tggttttggc ccataaagcc ttcaccccct aacaccccat      2160
     cctcgagggt tcgaatgaag tcgcggtttc ttgtaccgcc tgtacgactt cctcgtcgcc      2220
     tctgaccagc ggaattgggg tcgacatacc catctggagg tggggggtag tatgccggac      2280
     taggctgtaa tcgaataggt gcattggggt cgaggtggct ggccacacgc tggattgttg      2340
     gcggaatacc tccaccctga ggatccatgg tagacgcccg ttgccgccca gcccttgttg      2400
     tcgcttgcgc gtagaggctc tgggagggcg catactgtgc ttggggcact tggccaggga      2460
     tgaggttcat ctgatgaccg tacgccggtg gctgcgtggg gtagggcgga ggggcacctt      2520
     gctgatgacc agtaaagatt ccattgtaca ttggcggcgg ctgagcatgc gtgggcgtgt      2580
     ggaactgatt cagctgcata gcgtaggcat tctgtgcggc tgactgggca tgggctgctt      2640
     gtgcggccct ctgcttgctg gcagcttctg cctgctgctg ctgttgaatt ccagggggaa      2700
     cagtcttgtt cagagatgag tacttcaggt tcatcggggg cataaaaggg cctgtgaact      2760
     tctgttgcgt aatgaaagga tgcagtttgg cctgttgtgg cgaccaacgc tcgaggggat      2820
     tgatggccaa taggccacga acgaagtcaa tgaaggctac ccggttgttc aattctaaca      2880
     acaatagtga gcaaatgtat gtatggcgga tcgggtatta cctacctcgt tcaatctctg      2940
     cttgtttcat attcttcctc ggcatcgggt agctgcggat gatttcttcc agggtcgacg      3000
     cttggaagta cttcttgctc ggctgctctt tcgtgttgtg ctctcgagaa tattgctcta      3060
     gacttttaag gcgatatgtc ttgcgaccga actcgtcctg ggtcttctca aagaattcgc      3120
     cagactgctt gcccatctcc agcatccatg ttggcggcag gccgagcatt tccacaatgc      3180
     ggcagacttg gttgtattcc gaagatccag ggaaaagcgg caagcctagg aataactcaa      3240
     cgacgatgca accaagagac cacatgtcta tcgcggatga gtagctagaa gtgtgttagt      3300
     ttagccgtgc gtatacaggg aagaacaagg cgaggtgcgc gtacggtaag ccaagaagaa      3360
     cctctggtga gcggtaaaac ctagattgaa tataggtata gactgtctgt cgctcgtcac      3420
     aggctgaacc aaagtcaatg actttgataa tggggctctc cagactgcga tggagctaag      3480
     ttagcatagt gcattcgaag gaagttggag agattgctaa cttttttagt agaatattct      3540
     ccggcttcag atcgcagtga atcaagtgcg ccttgttcaa aaggctcaat gcattcagaa      3600
     gttgctgagc aaatacgcgt actaatgtcg tacttaagcc ccggaactga ttctgcttga      3660
     tcagttcgta gagattcaca ctcaacaatt caaacaccaa gcacaaatgc tgtcggtgaa      3720
     tgaaagtatc tttcaagcgg agtaagtggt ggtcgtcatt cttgtcgtat ctgctgttga      3780
     gctgcgacag ttgtgagcaa cggagcaaca acttcgaccc gctgagatat aaacacttac      3840
     caaatccaaa accgacacct ccatcatgct ttgattgaaa tatgcagtct tgttcttgat      3900
     gaccttgaca gctacaacct ccccagtttt caggttttga cacttgacaa cttgaccgaa      3960
     ggttccttga cccagcacat caagaatgag gtaacggttc ctagacgcga ttagcttagg      4020
     tcctcgggga acttcggtcg aacacgcttt agggttagac gtacttgtgg cccgcttcct      4080
     cactgcccaa gatgtcattg acatagagaa tgtagtcact atcctcgtta tcgtaaccat      4140
     cgttcttcac gcctttacta ggcttggtaa gaacacgcct cgggttccgg gacgattcgt      4200
     agttgaagcc cgggttgcat attcgataag tggcggggag atgtgttgtc aacgcttgca      4260
     gaggctgtac acatgttaac gaatggctat tccagagcct ttgatttcct gtgtacttac      4320
     gctgatgaaa ccaccatcag ggttggcgcg tctgtaaggt ggctgcgcat tcatgcgtgg      4380
     ttgaagttcc tggatggact tgatcttctg gaacttcgga acagggcccc ggcctggctg      4440
     ctggctccca ccggatatag acgcagagcg cggtgacctt ccatcttgtg caaatgcggc      4500
     gttgagctgt gagcccgccg agggtggata gtactgatcg gggctcatgt cggtaggctg      4560
     aagcggggga agtctagggg ggcgtgacgc agctgtgagg agatatgtta gctgccatag      4620
     tatccataaa acccaaagat ctcaaaggcg ttgatactca cagggtgggg attggaacgc      4680
     ctgaggaggt gaggcgtagg ttgaacctct tgtcggcgac cgtcgtggtt gattcggccc      4740
     gggcgggaaa gcatacgagt tatgcgattt tccaggactc gcattgaacg acatggaagg      4800
     agacaaaaca ttcatagggg agtacctgcg agcagctgac gactcttcgc ttgggaaata      4860
     ttgggatgac ggtcggctat gatggctcgg tcttgtcgag tacttggccc ggttgtacgg      4920
     atccgcatct tccatcgtgg tgtccgcatc ggtgacataa tcccgactac gtggcgtcgc      4980
     agcgggagac gaagccatag agacggttct ggaatttgca ccgatggatg gtggtttggc      5040
     ggtggtgcca ggagactgga agggttcgta ggtgtagccc accggcggct gcgagtgctg      5100
     tggctgggcg ccgtattttg aggctagctg ttgtggatta gacgtcaacc cgttgttgaa      5160
     ctgcgcggga tgccccatta agggatcctg gtatgcctgc cactgggaat ccatgcttcc      5220
     tcctcccgta tagcggcgtc tcgtgaaggt caagtgggag atcagatcag atcggacata      5280
     tgatgatcat ttatcactgt cgacagcgca catgcaccac gatcgggggt tagatagtag      5340
     cagcggggac ggcagacgca cgtagcgcaa tcaggcggag acgacgcggg acaccgggga      5400
     gtggtggtgc aattcgaaaa tcggaggaga gacgagacgg aggaattgat gctagattcg      5460
     gattgcgtcg aacctcatta ttcggaacag cagactgttc tggtgatgag ggctcagaag      5520
     gggcgagagg ggaggcggcc agtggatgga cggagtgggc ggtcgcaatc cacaatgacg      5580
     ggtgcgacgc agcagccaat atcgatgcgg cagctgacac gcgaaggggg tttagtcggt      5640
     taagatgggg aaaggaaggc gactgaacca actgttggaa cccccaaggg aaggatggga      5700
     atccagacag caagttatac agtcgaggag cagagatggg taaagggggg gggggtggaa      5760
     tctggaagca agtccagacg acgggcactg ggtgaaacta gtgcggaggg ggggaaaaga      5820
     aagaagagag ggaagagagg gtagtaaagt tgatttcagt tcgtggaggt ggagataccc      5880
     tctgactctg actgactctg agcactgagc agcagcgaga tccgacgcgg gcctcaggct      5940
     gccgttgggt tggggcttgc tttgcaaatg gaatggtgcc gggaaagggc cacccacgga      6000
     ccaacctgat actacactct cttctttctt cgctggatta tttctaatgg ctgatctcac      6060
     gactcgggga gggcccctct ttcatctcct cgaacccttc tgcaggaggg ttgtgtgtat      6120
     gtgtgtgtgt gtgtgcgcgt gcaggcagat tggtagggat cctgttaata gatgatgaat      6180
     cgactgccag caaatcgagg ccaacccccg gtttcgaaag gcaaacgaaa gggagggaca      6240
     ggcaagaaca acctaagcca gagaatggaa agaccaatgc agttaaatac tagctagcat      6300
     tcccatctag ccaccgtcca gggttagaac cacaataata ttggactaca tcaaggtgta      6360
     acgaggcaat taaatcatgg agactatttg atgtctgtct gaggtctgac tgagtctgtg      6420
     cctgcctgcc tgcctcgcga ccagcctctt gaacgacgat ctgccttcat tcggaaacat      6480
     ccgctgcccc ctttggcatt caagtccaac ggcactgttt tggtatagct cgctatacga      6540
     gcagacttat aacaatgcct tttcttgcgg ctattcgagg gaaggatgac ctggaccaga      6600
     ggcggttact aatgccatga ttggtgattg taattatctc gagttctgta ctacggttcc      6660
     ctctgcgtca ttgccgtttg cagaaggggt tgccaatctc catacatgtt atttgctctt      6720
     gttccaggcc caacaacacc cggaacaagg ccaaacggta tattccactc ctcccgataa      6780
     tcatgaaggc tgacaccgga gggcataccc gaagcttaag ggaattcagt gtggtgatga      6840
     cattatcacc tgggcaattc gagcatggat ggtgtgtgaa gtgagaggtg gactgaggca      6900
     acacacgggc cccagccagt cccggtgacg tgggaggcta cgtggtggat gactaaccgc      6960
     ccaagggcta ggcacccagg gcggtgagtg ccaggctgcc gtcggtgaaa tctttctgcc      7020
     gggtttatgg ttatcgtcgc agtccttgta gacatggtct ggcgcggtcc ctcgccagtc      7080
     ccatccagtc ctcggagatt tcaatctctt tacaatcact ttctcgctct cggctgtgaa      7140
     tcgtccagag tgggtgtgta ttaaacactt tatgtgctat agactggctc tcaaggatcg      7200
     gtattggtta attcgaaccc tgtcagattt acttctcact acacatcggt gacgccactt      7260
     gctgcaatga ccccggtatc atcattttta cgaccactat aatatcacac ataactctta      7320
     cttatccttt aaagacatct ataaaataca gtcacatatt agacttgcgg ggataaattg      7380
     aacgaccgtg gaaattatca gactttatta aatgtgtctg tccattgaga ttcatacagg      7440
     atcatggatg gggcaaaatt gaacgacgtg gatgtcgctg catcccggag tggctttgac      7500
     gaagacatga aaaaggagga agagccggag caacaagcga aatctacatt ggatccagct      7560
     gagtctgaag catctctaaa tcaagggcat tcggcaaacg ccgatgaagc aagtcgatta      7620
     cgtgaattgc aggccgatgt tcgtgatcaa gatgacctcg aaagggacat atctcgtcag      7680
     gtacgcttta ctggtcaatt ttcaaatgag ccgaggatgt tgacgactat gttaggccga      7740
     caggttgctc atggagcagg ctgacgaacg ggatagtaaa agattggaga aaaccacatt      7800
     agagaaacag tatgttcata ttactgctga gctttacacg tggaacttac agtgaatgtt      7860
     ttctaggaaa cttgagagcc aaatcttgaa actacatcag cgtttgtcgc agccagttgg      7920
     cacgtctgcg agagttcgca tcagcaatga gattgagaag ctggagagcc gcaatacggc      7980
     actggcaact gaccttaaag aaattcagca aagaatggac gaaagacatc aaggagatga      8040
     ggctggttct cagactaccg ggactgggcg catgcctaat gagtcccgcc gggattatct      8100
     cattcgaact ggaaagatta cgccattttc caacatgagc tctgggccaa atcatggccc      8160
     tcttgctagt cttcaggatg ccttgatcga tgcagaggac gaacgcgatg aaaaggaagc      8220
     actggagcag gtgaagaacc ggtcagctgt ttcacatcgt aatctcgtac gacctggatt      8280
     cggtttcgat gagactcctg cttccagctt agtggatgaa gcgcctacct ctcgagcaag      8340
     taagcgtcga aagatagacc gcgagtctca tgaggaggag gaagaagctc ttgaacaaga      8400
     aaccaaggta tccctcgaag acaatttcga ggatcaagat gagtctgcta gctatgttga      8460
     atctgaaagg cagtcttctg tatcggaaga tgaagaagaa ttcctgcctg aagaaaggcc      8520
     aaaacgtacg gcaaagccag taaaggctcc aaagtcttcg gacgaggttg aagatttcag      8580
     cggaatggac gatggaaatg aagagctcta tcaaactagg cttcaatatt gggtcagtcg      8640
     aagggcagct gctaggaaaa gagcgcttga gtcgcgtgtt gcaggtcatg gacccgaggt      8700
     ggatgctgct ggggacaatg tggatgtgct cgatcaagat gaacaggaag aatggttcat      8760
     gcctcatccc acagtttcag atatgcccta cgacaacggg tatcgaatac ctggtgatat      8820
     acatcccctt ttgttcgatt atcaaaagac cggagtacaa tggttatggg aattacaaca      8880
     gcagcaagta ggtgggatca tcggcgatga gatgggtctt gggaagacta ttcaagtcat      8940
     ctctttcctt gctggtctcc attacagcaa aaagttgacg aggccagtca tcgttgtatg      9000
     tcccgctacg gtcatgaagc agtgggtgaa tgagttccac cgttggtggc ctcctttccg      9060
     tgtatccatc ctgcacacgt ccggtagtgg aatggtcaac attcggaacg agagcagcag      9120
     agaagatgct cttttgtctc aggcgtggaa cgcctcgagt actcgtggca tgccaagtgg      9180
     cctgaaagca gccaggaaag tcgtcaagcg tgtagtagaa gaagggcatg tactggtaac      9240
     cacttactcg ggcctacaga cctatgcttc tctcgtgata ccgattgaat ggggctgtgc      9300
     tgtcctggat gaagggcaca aaatccgcaa cccgaacacc tcgattacta tccattgcaa      9360
     ggaactccgg acaccccatc gcattattct atctggcacc ccgatgcaga acaatcttac      9420
     agagctctgg tctttattcg acttcgtctt tccaatgcgc ctgggaactc tggtgaattt      9480
     ccggaaccaa ttcgagttcc cgattcgtca gggagggtac gcgaatgcct ctaatctgca      9540
     agtccagaca gctgccaaat gtgccgagac cctcaaggat gccatcagcc cctatctttt      9600
     acagcggttc aagatcgatg ttgcggcaga tcttcctaag aagagtgaac aagtgctgtt      9660
     ctgcaagttg acaaagccgc aacgacaggc gtacgaggcg ttccttggct ccgaggagat      9720
     gaaatccatc ctcaacgggc gtcgacaagt cttgttcggt gtcgatatat tacgaaagat      9780
     ttgcaaccat ccggatctac aaaatcataa gctgatgtcc tcaacaaccg gctatggtag      9840
     cggatccaag tcgggtaaaa tgcaggtcgt caaatcgctg ctggagctat ggaaggatac      9900
     cggtcacaag actttgctgt tcacgcagca tcggatcatg ctcgatattc tggagaaatt      9960
     tgtgaactca ctgtctggat ttagctaccg tcgaatggat ggcaccacac ccatccagca     10020
     ccggcaagct atggtggacg agttcaacaa tgacccaagc ctacatgttt tcctccttac     10080
     cactaaagtt ggcgggctgg gggtaaatct aacgggtgct gatcgggtga tcatatacga     10140
     tcccgattgg aacccatcaa ctgatgtgca ggcgcgggag cgggcctgga ggctaggaca     10200
     aaagcgcgac gtcaccgtct atcggcttat gaccgcaggc actattgaag agaagatcta     10260
     tcatcgtcag atctttaagc agtttctcac gaataaaatc ctccgggatc ccaagcaacg     10320
     ccagactttc cagctaagcg acctccatga tctcttctct cttggagacg aaggccaagg     10380
     ccccaccgag accagtaaga tctttaaaga tgcggacgtc acatatgaag acagcgatgg     10440
     cacctcgcgc aagtctaatg cagcgatcaa atcatctgcc tcctcgcata gcgcgcagga     10500
     ggagaagaaa gacatcagca aggtcgtggg tgtcgccgct gtcgaacagt tccagggaga     10560
     ccaagagcaa cagagcgagc aggagaaggg cacttcaggt gccaactccg agtcccgcat     10620
     catggagggc atctttgccc gatccggggt ccattcggcg ctggagcatg atcagattgt     10680
     gaatggcaag cgcgtggtgc gagcggaccc caaaataatc gaggccgaag cgaagcgggt     10740
     ggcagctgaa gctgcagagg agctgcggcg agcgggtgaa gcagcgcggt ccgtccccat     10800
     cggcactcca acctggacgg gtcaattcgg cctggccggg aaacctgagg aacagttacc     10860
     cagccggcct gcatttggag gaagcagtag cgccgccaga cgagcggtag ccggaccatc     10920
     ctcagccagc attttggcga atctctcggc gcgcacacct tcaccgcgca gcagcagcaa     10980
     cagtcctgcg ccatcgcgga ctcccagtgg aatcgatttc atcaccatga tccgggattt     11040
     cattacggcc cagggcgggt cagtctatac ccaaatgttg atcgatcatt tcaaccggta     11100
     ctgcaccacg ccgcaacggt cggccgagtt caaggagatg ctgaagacga tagccgtgtt     11160
     ggacaagggg ggacgaaacg ggcgcgggaa atgggctttg aagccggaat atgccaagcg     11220
     acgatgattt gccaatgaga aatagtagac tcgatatgca tttgtataat atggatcatt     11280
     cccaggcgtt gggcaaccat ggatggatag atgaattgcg tcttggaagg atcaatacct     11340
     atacctcagc tagttatgat atactacaat gaccagggat acccatgtcc cgaagggctg     11400
     aaagttgaaa caaacaattt catgcagccc gggatgatgt cgatcccatg ccctgtgtaa     11460
     ttctactata attgtcattg ttgtacaatt caagatcacc cagagaagcc aagcagacga     11520
     cgtaaccgta atctcgatga cgtataaccc gactccataa ccataacccc ccggtacctg     11580
     acaaaactga ttattgagac tttaggtatc taaacgacat tgacgagtca ctttgactcc     11640
     taccaaagta gtaacttatt cggaataccc cgcgggaaac gagataacgg ttccgtggat     11700
     aaggatcgtc tactcaaccc cattgtggga tgtcatagca gccgatagtg tgtgaaccag     11760
     agaaagggag tgtacggaac ggggaatcat gatgtcagtt accaaagtag atggagagga     11820
     ggtgcggcgg gctttccgtg aggaatgtgt gtgcgcgatg aatggatact atgaatttgt     11880
     ctggaccaga ggatagcata ggcacggtgt taggactgtt agagtgcagg tacgaaagtc     11940
     tagacatttt gtagttactc tgtaactaag tgagtgatga gttgtttcaa gaccaatcgg     12000
     agtggatgtg atcgggaagt ccaagtccac tttttgctgc aggttaaaat ttctccagtt     12060
     acgtgattat cgtgatcggc ttcaggggga ggaggggtta ccttgcacag taatacaata     12120
     tactacagag gaagtgtggt tcttgtgatg tcaatgattt ctttgtccag aaaaaaagac     12180
     aaagaaaaga caatccgatc cacgaggcat atgacgatat gatggatgaa tgaatggatg     12240
     gataacggtg gaaacccgag ccgagggagg agaaatctga gacaaaaagt caatcatctg     12300
     acccgggcag tgatcggtcg ggcatcgggc atggaggaga gagagagggt cactgaaaat     12360
     ccgatcatcc gatagattaa gatcgactgc ttacaagttt tgaggattag tacggagtag     12420
     actatgttgt tgcagggaaa taaaaataga aaagatagtc ttgtatcatg tcagatcagc     12480
     ccacagttgc catctgatct taacttgaca tggtatatag acagatgggt gaagaagtta     12540
     ctaatgaacc attgtgttca ttctctatag gaatactgaa catacaatac ctatacactg     12600
     aagtgtacca cttacttagt atgcggggat gagtccagtc tcctcccgcc atcctcgttc     12660
     attccgagcc tgtccaatca gcctctgcct cgcagggatc tgctgtttct gctgaattcg     12720
     ccgccctgca ttgattggtc cggctgaaga ccctccacca gcgcagccaa gaccggatca     12780
     accaatcggg ctgtgaggac aagggcggcc agtccgaacg aggctccagc aggaagagga     12840
     aggcgcgggc aaaagtggag cagggatttg cctctccagt tgttcctgcc tttcattctg     12900
     ccaactcaaa aagtattcct cagcttttga actgaagctc caaccaccaa ccaccaaccg     12960
     ccccctccac ctgtcggcat tcgcccaagt ttctattctc agatttcgcg caaagttttc     13020
     cctagtccgt agtcttgtct gtcctgcccc tgcgctgtcc ttggatcctc ctccactcgt     13080
     tccaactttc ctgtaggcat ttcggcgccg gcgcacccgt gtccccaact gctgtggggg     13140
     agaatcgtgg tggctgtccg atataaagac gctgggcatc cccctccatt cagccatcct     13200
     gtatcacacg caccatcctc cccttttctc ctacatcccc tgttctattt caggatccat     13260
     ccacgagtct tgtcctttct attctaattt ctctcttctt catccacctt tctcatccac     13320
     atcatccatc ataatgaagt tccttgcctc tcttgccctg ttggcgtcta ctgtggctgc     13380
     tagccctatg ctgtaccccc gccagtccag caactccacc cagtccttct acctcaagac     13440
     ctcgggcgct tccaacgata accacaacaa cctctacgtt tatgcctacc acaccggtgc     13500
     gggattcaac gatgccgtgc tgacctcgga tgtcggaacg gccagcccgg ccttcctcaa     13560
     cggcacccac acccaattcg acctgggaac ttccttccct tggggattca agatgggcgt     13620
     ccagaacaac tatgcagcat gggagtctgt ccagatcaat gttggatacg gcgatgatga     13680
     tttcgccatt ggcactaccg gtctggagtg gtcggcacag gatggcttcg gaggctggct     13740
     aggtgagtga ccttgaacat atacccatac gaactttcta gaacatgcca ctaactgcgg     13800
     ctatgtagtg tgcgattggt acccaacgca ccccagctct tctacatcta ccgctacgaa     13860
     gagcccacta ttccttcctc ctgcagcact gtcgacctga agcccgaata tagttcctag     13920
     agacacgacg tctagacctc gccactgggc cttgtaacag gggctctatg acgagtgtgg     13980
     cgtgactgat gaatcatgat accgaaggat ctgggaggat acgcgcctct cccggtttga     14040
     aagggaatgc actctgtaac aatacgcctg ttaaacgatc gaccttatac taatgttaat     14100
     atacttaatg atgagtgaga atgagttgtg atgatgggaa ggaaggtgat gtatacgcta     14160
     tgcgtggcat gttgcatagt caggaatatc aggtttagat aatctcacgt aaatatatgc     14220
     atttactaca tactacttgg tatcttgaca agaacgatag ctgcaaaccc acagtaacaa     14280
     aagtgaacta gattgatgtg cttcccatcc gcccttcgct tatcgtagcg gccaataatt     14340
     ggcaatagtg gctgccggga tccggttagt gttgcaggtt tgcggggaca gcaaacactg     14400
     acttctacaa accatgacag tatggggaac ggagtttcat tcagaagttg gggcgagaat     14460
     gatagagtca cagaaatgac agacacggga tgattctttc actattactt tatacctgcg     14520
     acgagggaat attttctatt cggtgtacgg gaaagggact attctaggtg aaacaaggtg     14580
     cataaatctt gatccccgac cgggtcagat gcactggatg cctcaggcgc acagccaaaa     14640
     atagcgccgt gtctcactcc ctgtcccaat cgggcaaggc gcgccttcaa tggctgctcg     14700
     tctggtcttt tagtctctcg ccctcgtctt tctttcttcc cctcgggtcg gacaatgctt     14760
     cgctcgtctg tcgtttgact cttctgacct tcgctatcgg ttgatcggtc ctatcttttc     14820
     atctgtctgc cacccccggt tcgctggaat cagaccggtc cctgtcactc gctttgttta     14880
     catctcttct cctccccccc gaccctcgtt ggaccctgcc gagaatctat cggacgatct     14940
     gcatgtttca gtcccgctgg cctgaaaaaa ccaccatttc tgcagcccgt atcgcttcat     15000
     ctctggattt gattatcgct tatcgtgctc gacggttcat cttcgccatc ctggtgtagc     15060
     ttcatctgtc gcccgtcagt ccatcgcagt taccgatacc cctgtcgctt ctgccgccgt     15120
     agacgggaaa gggtccacgt cgatcggacc ctgaatcttg ccaagggagt caaccgaccc     15180
     ctctgccttt cagtcaacac cactacagta cagtccgatc ggtcttttca agatgcgttc     15240
     catgtctcgt ctgtttattc tgtgcctcct cttgctgctg gggacggtaa cttcggcctg     15300
     gccatggcgg ccacatggtg aattgttgcg acgagctggt tagttccgtc ttttggcatt     15360
     accttctacc actgtcctat tttttatcgt gcttcgtgtg tgatgtgttg ctgattcgcg     15420
     aagatactac cgcagctgag agcgcaacca ctggagccgc cgctaccacc gagagtgcat     15480
     cgaagaccga ggcagcgacc aagaccgccg ccgcaacagg aaccgatacc acggccacgg     15540
     ccaccggcac caataccaag tcagctacca aaacaggcac ggctagcggc aaatcctctg     15600
     gctcttcctc aaacagcaca acgagtgttt ctatcaaccc cgctgccggt gctggtggta     15660
     tctccatgct cattcccacc gagggagcca catcctacta caagattggc gattttgtga     15720
     cattggaatg gaactacacc tcgttgacca tcagcccaac ggctgtcaac gtcgtcgcgt     15780
     cctgcagtct gaacagtgcc acctacacca tctcgtccaa catgaccatg tcgcctaccg     15840
     gaaaggtggt ctgggacacc aagaagtacc aggccaacgc gactgttccg ctgttgacag     15900
     catcgtacac gttgatcgtt tgggatgcca gcaaggccat cactgagacg gctagtgccg     15960
     gttatctcag tgcggctagc agttacattt tcggaatgta cagctcgcag ccgtacactc     16020
     cactcaatgg tatgttatcg cctctatata tcgtaatgaa cctgctaact tccgacagga     16080
     tttgtctgcg ctacctgcag cggcgctttc tccgagctcg aacggttagg gatgaagttc     16140
     acctttggca tgttcgccat caccgtcctg tccttcacct ggttcgccgg gggcttcggt     16200
     ctcttctcca catgagtgta atctccggat gacgaccaag aaaacaaaca tttttatgca     16260
     ttagaatgtt gcattgagca aagcgaattt cgtttgagtt atgatgatag aaatctatca     16320
     gctgggtcgg attggcgttt gcgagtttcc ttttctgatt cgatataatg gctgggaatt     16380
     tcctctttac ttttgacctt tgttcactcc tttgatgcgc agcaatagcg ggatatcagt     16440
     gtaatagtgt gtgcatgcgg tgattatgac atgtgattgt atctccattt ggcctgtcta     16500
     tacttaatgt tctctgcatt ttatctcatg gatgtacgta tacatatctg aacttattat     16560
     tatcggatac ttcctcagat ttaatatatg ctacccctac ctacgaccac tgcagactgg     16620
     aaactagtag atacacctgt aattctaact gagactgtcc cagccaacaa agtactagta     16680
     ctagtactaa caatacactc ctccttcacg gcattatgca tccatactat taccaaaagc     16740
     cggaacaagc cacactctcc tccccaggca ccacagccaa ccaacatacg ttgatattac     16800
     ctaatgtcga tgcccgcaag gaagtagata agccgtagta tatatatata tactatcccc     16860
     tgaaatacta acaatatcaa ggaaatcccc gaattcatag ctactactaa cgcggattat     16920
     ctcatcgata gaattcgttc atatatatac tactcgtagt atatcgccag cctcgtatga     16980
     caagcatgat atttatcttg attttccagg ttccgttcag tgtctagaac tcatagtaag     17040
     tagcactgag acatgacatc atatacaacg atgtgatgga tataaataac tatggaatat     17100
     cccgatgcta ctttgcaagt atctactgtg ttatcatgac tggactggat ataaccagtg     17160
     ttgacagact ggaagatcaa agattaaaat cactggagtt aggttaagat atactctaca     17220
     tccatcgatg aagtaaaatc aaatcaatgt ctcataatca agatttctac cgatacatgg     17280
     gacaagatgt ggacattcgt tagtattcag gatgtaggag ataaccgcgt ttattgatgg     17340
     cttgactatc gggcactcga cttgggtcga tggatctatg tgaggtgctg gatacaaata     17400
     agtccatcta tctcgacttg atcatctatt tctcactcat cattctttgt ttgtgtttct     17460
     cacacttgat gtgatccttg actatactct aaccttctct tgctaagtca ccctcgtgac     17520
     aaattcgcca tcgaccacaa gccgatttcc tcggaagata gaacaaaatg tccagtttct     17580
     ggaaccccac caacatcccc actagcagca gccaccacca ccacaagaga aggtggagaa     17640
     acaaaggcaa acagcgagaa caagacacga taccactgtt tgggtcgtcg acaccggcac     17700
     cccatcggca gagatcgtca tcctcaagat ctgacgacat cgtactcgtc cgtcgcaagg     17760
     gcagtccgcc gtggtggtgg ctgttgtgta cgaaggggac catggggatt acagtcatga     17820
     gagctgtcag ggacgagcac ggcgctcgtc gtcctcgcgg tcagctggtg ctcgagccac     17880
     tttttgaggg aaaagtggca agtttctttc cgacaaagtt ggtggatgtg aaggagtagg     17940
     tgtgaatgcc agatgcacct ttgttttttt gtttgtgttg gatgttccga ggaacatgca     18000
     ttgattttac ccgcgaaatg ccattgacgt gaatatttat ctgggatcga cctgtctgat     18060
     atatgaaacg ttgaggcatc tggggattgt tggaatggga tattccatca ttaatgatat     18120
     atatattcct catttgtttt gttttctttg ttcctctttc attcagtgca gccttgatgg     18180
     taggcttccc aggtttgact tccctgttct tggggagtag aggatggttt gcggatggtg     18240
     ggaagggttg ctgtgctgtc ggtcatcttg gtgcattttg cacagggtgt ctgcttgata     18300
     gttgagtagg acgatatcat gtcctaatat aaatgtcagc attttgttca cataaaccat     18360
     attcagcaac gtaagaagaa gggccaggcc ttacaagtag ataaagcaaa tcccactgtc     18420
     ggggccttga attcaagcac tgcgccaccg ccgtctcgac cttcgaaggc gtttgccccc     18480
     caggcgtcct agtaaagacc cgccagtcag gaacaccatt cccatcctga ccagcaatag     18540
     cctcaactct gaacaccatc ccagctttga caagcacaac cgtgacagcc gcttcacttt     18600
     gactcgccaa aacacgcaca ccaggcacat tcttttgagc aaagccctca acaatcgctc     18660
     tccatccacc ctcagtggcc tgaatcttcg atcgctccat ctcctcatta gctttctgct     18720
     gctgctcatt ctgagtctgc tcctcctcgc gaagatccgc aagaatggta tcgtaatctc     18780
     tctcccattt ccccgtaggc tgcagcatca cgccgccatt ttctttaatc tgcgcgtcaa     18840
     tgcgatccca gaccgctttc atctcgggac ttctccacat cgactgaaac tcttgcagct     18900
     cggaaacacc cgcgcgtgca gcttgagcca gctgctcgta cagcatttgc ggggacttgg     18960
     ggacgggtct tcccgcagcg gccttggggt tgacaatggg tgccagaggt tccagaaggc     19020
     gctcaggaag tagagtccgc agttggtgga tctgtcatga catgttaatt ggtgtttgag     19080
     cttggacctc agggggtaat actcaccatt gcttccatct tctggagttt cgcgagcgag     19140
     gaaacaagtt gcatttcgga gtcccaggca tcaggactgg ggtcagtgtt actagcaccc     19200
     cctgtagagg cttcagcgcc attcgaggga ggaaccattg caggcacaac cactggcatt     19260
     ctaggaagcg tttgacctgg gttgggagcg gatgccattg ccactgtcag tgaagatagg     19320
     atggcagcga gaatttatcg taaagctagc gcgcagttta taaggtgaag ggaagttcag     19380
     caatcgtcag gtgataggcc agcacgtgta tccagttcag gttaggtaat tgacaagctg     19440
     aactatgaat gcacgtataa ccaagagtga agtacgtctt ttccagtcgt gtatctgatt     19500
     caaattctaa gtgatctcga acatccagag tcgatacggc gcagcaggct atggatctgg     19560
     agacaacgtc aacaatggcg ataggtcgaa tctcggtgga gggaattgcg ccgcggagat     19620
     tcgctgactc agcacacatg atgcccagcc acttaaccat tgcacagcca taacgtgctg     19680
     tggctggaat gaaaatgggc atcgccgtta ggaaaaagca aaaatattat gcataactat     19740
     aattcaagac ttcaccgaac tagcccggct agctcaatcg gtagagcgtg agactcttaa     19800
     tctcaaggct gcgggttcga gccccgcgtt gggcttcttt tttgcttttt gtttctttgt     19860
     gggggcactg atttgaggaa atgactttgg gggatcgcgg gttcagaccc tgctactcac     19920
     agttccatcc acgatagtaa gaatccttca ttatatcacc ctagagcctg tacgtttttc     19980
     aagtagatat tttctactct tgagtaattt ccatatctct agttttatgg ggttcgatta     20040
     ttttttctga gattcacatt attctcataa atggtattac aggtcgggga ctggtatgtt     20100
     acttatatat atttttggaa cgtaatctca gtagattact agtagtcgag gtcacgtgac     20160
     ccgaactccg taacttcaac tgctcctccg agcgcgccta gatagcgaag aatcaagcgt     20220
     tttcaacgac ttcagtattg acctaaaacg tcgtttcaac atatattcac ttttacttgg     20280
     actatctttc aagtattctt tacttgtaat tattgtgcgc ttggcacgtg tcttgtatat     20340
     ccctaggaag gacttcgagg agaataaatg cgataagtca tgtatttgta taaagtttgc     20400
     atggaggccc cgtcatcctt cgacacacac ggtaaaagaa tactcctact acaagtacta     20460
     taatccgagg agctaagata ctcgagtata caaagaaaag aaacttgctt tgagattccc     20520
     gctacaatat gtcagctact ggaatatagc atccgaagag gacattacga ttggaaacta     20580
     tgaaatgtgg aatctcctta aatcaaatta tgtaggctaa tatatgtagt cattgcagaa     20640
     accttcctag ggcattaaaa gtatagctca tcataatgca aagaaatcgt agccatccgg     20700
     cggcttgaac aagtaatggt acggtcaata tctcagcagt gctggcaaat cacgcagaaa     20760
     acaatcgaat atggacgcca cggtcatgcg atagcgtgag actggagttg atgatcggct     20820
     ccatcatatc agggtcggca ttctcgattc tattgtaccg ctgtagcagt ttgaccatag     20880
     tgtagctagc ttcagtgaga gcgtattgct ctggaaaaga atgttagtaa tgtgcactag     20940
     agcatatgag aggtaaactt acggccaaga caaatgcgtg gtccgccgtt gaatggaagg     21000
     tattcccagc cccgcttgct attctcttcc caacgctctg gtcggaaagc atgggcatcc     21060
     gggccgtata aatcggtgcg gcggtgcatt gcatatacac tgtacgacac aagctcgccc     21120
     ttgcgcacgt agatgggcgc cttcccatca ggcccgccac ccaatggcaa cgaagtatct     21180
     ttggcggcga cacgaaagtt cagaggcaca gggggaagga ggcggaggac tagtcttgtt     21240
     aggaaatatt ctaacttgcg gcggggggag gggggtattg cacaccttca ttcaagaaat     21300
     accgcaagta tggagtgtcc ttcagcctgg catgcgtaat ctttccattg gggtgttgag     21360
     cgtcaccaaa ttcatcgacg atggtctggc gaagtctggt ccagacgttg ggatgacgtg     21420
     ccaggtagaa aaaggccgag cttagcagac tggcggtggt gtcgcggccg gccaggagga     21480
     tgttgagcat gttgtcacgg atcactctcg ggtcatcggt atccccagcc aaggcttctg     21540
     cgaagatgta tctgccaggt tccttctttt cgggatgacg ctttgcttcg agagcgaggc     21600
     gcacgtagtg atcgaccacc tcgtgtacaa gctgattcgc ttcacggaac tccttggggt     21660
     taacgagcca atagaatgcc atggctctgg atctagctgc taggtattct tgggcccggt     21720
     tgaaagcctc cgcaaaccct tgggcgtttc caacggtgga cttttccagc agactcgact     21780
     cagcagatgt gcgcattgat ccgacggatt caccaaacag gaaatgggta gccgagtcga     21840
     tagtcaagag aaagaagagg cgctgaatgt cgaaagtaga gccatccttc gggatcaagt     21900
     ccatcatctt cgtgacgtgg ccatccataa ggtcgagatc agcaacctag tcgctcacat     21960
     ccgtcagtag gttctcattg atgatagaat agtagaaata tcagacctga tcgcgagtga     22020
     actgcggcct cagcattcca cgcgcatgag accaacctgc cccatccaag gtgaagatcc     22080
     catttccaag taacgggtag aactcgcgat ggcgagttcc gaggccgaaa tcctggaact     22140
     gagtagccaa cagtgccttg atgttctccg gctcgacggt gttggtgacc atgagtcctc     22200
     ccaaggcctg ctgacggaag gtcggcccac tcgtctggta gtgctcggca atgtattcaa     22260
     cccatcgttt ctccctggct gcctttgcaa tgcgatagaa gccagtgata ccgaggaaac     22320
     cggtatcgac ggaattaggg ggctgacagc ctagagcttt ggccttcttg cgatggtggt     22380
     aagcctggtg aagagagctc aagattcgga aggttaaata gatggcgccg agaaagacaa     22440
     ttgcagcggc caacatgacg caactgtcgg gtagtctagt gcgggggatg aaatgatagt     22500
     atagagacta gaaaaagcaa agggatggat gtgaagaatg cgagatgaga gatagataac     22560
     tttgtagtga aagcttatgt acaaggaggt agtatgacat tcgacagggg cagcctggtt     22620
     ccgaccacag acattatata tatactcgtc ctcccccgca aggaggagtc caggccaaat     22680
     tcacttggcg agggtggttt cagactcctc ggtcgtgagg taccatgtga aggagtggaa     22740
     atccccgcct ccagagccac aattaaaacg taggcgaggg aggggacggg aagggatggt     22800
     tccagcgatc cagcgaagcc agaaggcatg aatgggctag cgatgattgg aaaagccaac     22860
     cttgcgaggg gtcattcccg attcccagta agtatgcttt cggaactcgg aaacatcgca     22920
     agcatctccc aaaagggaaa agcggcacct gcatgcagga ctttggacgt gacgctaaaa     22980
     cccaacgttg atccaaaacc tccgaggctt ctcgttgatc atctaatctg gggtacgagt     23040
     ctaccttcgc cgtgacgcgc cctgtacctt tctaagtaag taggagcatc ccaggatcca     23100
     ctcagtcatc cttgtcctat cttctttatc ctggctccag gctccagcac aaccaaacac     23160
     acccacacct acacacccac acaccccctg gccccccaga tcacctggat tggcttgagt     23220
     tctgtccaaa acattcgagc cattgcaaca aggcggatgt gaagatgccg cgtgataact     23280
     tccccacggt cggcgtcgct tgaaagtcaa agcaatgttc cgagttctgc atgacgtatc     23340
     caaagacggt gtcctcattg gtctgcaccc cacaggctgg gatcgcgctc gtaaactcca     23400
     ccccttgagg tgcgaaatct tctgtcgaca gaatggacaa tgatcgccac ggatcgaatt     23460
     ctcctccgct gaagtaaaca ttggacgggc ggatcgtcca tcccccaaac tcttggttga     23520
     catcatccgc ccgcggcgac ggaggcagca gtcccttgtc cactgcatcg gggaactgcc     23580
     ggttacatac ttcttgctgg tattccaccg actgatatcg cgaggccagc gagtgcggcc     23640
     catcgttgtt cgcctggaag aacccccatt cgctgcagta ttgccaagtc caagtgatgg     23700
     ccgagggatc gccgtatggc ttggaaaagt cacagtcaat tggctgagac gcgtcctgag     23760
     gcccgcagtt ggtccccata ttcagattga ccagctcgag aaaggttggc catgcggccc     23820
     atcgttcggc gacatactgg ccgccatacg taggggcaag gccatccggt cctgtagtcc     23880
     cgttcgtctt gggatcaatt tcgagatact cgcagaatgc gcctagacct ccaatacctc     23940
     ccgccatacc ataactttgg aagtagccgt agatggcagt tagcgctgca gtgaaatcac     24000
     cgttggagtt ggtctcggcg ccagatccga agaaaagttg tttgaccgag gtagctgtat     24060
     cttcatccga aagttgatcg tcaatatatt ccagagcagc gtggatatct gccgagcagt     24120
     tggtccatcc gctggcaacc atgccacgat agacttggtc gtaatacgcg ctcatattga     24180
     cctgtgcttc caccggagac gatgaggaaa aggctgcgaa tatcgtctct gggtactcct     24240
     tgcgagttaa tgcagcacga atccctgcgt acgagccgcc caccatgatc cacggcgtgc     24300
     cctgcggcgt caggtccatg tcaggatact tctcgcggct aaagttacta gcaaagtacg     24360
     gaaggtccgc gagcgcctgc ttggtggtga ggtattgcca tgcctcgggt ggagtttcat     24420
     aggatacggg agccggggtc gagtttccat agtatctgtg ctcccaggcg attcccatgg     24480
     cgttgaattc gatcaggaat tctctgaaga aggagagagt ggaggttagg taggactggg     24540
     ctatcgatcc gccatccgac tccccggtat cgtacacaaa tatcgggttg ccaggctgat     24600
     agaattcatc gctgacccag aaccgatttt gataagtgcc agccgatgcg ttgttatggt     24660
     caatagggat ctgagtctac aatcagtgat caggactaag agccagggct ggtgcttttc     24720
     atacggtggc atattccgtc tccaacgcag tggccatcgc tgaatgtgaa atgagggagt     24780
     tgaggttctg ctggttgtgc aacccaaggt ctgggttgat accaaagtga gcaagtgact     24840
     gagtacccca gccaaagggg gcctttccct gccttgagcc catgacgggc tgcgaaagca     24900
     ggaaagcccc gatggcggct attgtggcgg agtatgaagg catacggggc cttcaaggga     24960
     cactgtgtgt aatggagaag gttcacaaca aaggaagacg gcagtagcac ccaaattacc     25020
     aaattccctt cttgccatga ttgaaggcat tcctttcttg tcttatgtac gaagcataac     25080
     taccatggta gaccgtgagt gagacggttt cggtcacgaa tgtctgccat acagcagaaa     25140
     ttgctctagg agacgtctgc ctacggaaaa tgaattcaac acctatcaac atgctcagcc     25200
     gtgataaaat gggttgcctg gcatcgtgtg cggtcagaaa ttccccgtta tgttggacaa     25260
     gaccataaca atcaacggac gcatcagggt taatgcctcc gttcgggctg cggcttcggg     25320
     gcgcacgggc agccaaaacc acatgtccgt gtgtttattt agtgggttcc tgaacaatgg     25380
     caatgcgtag cttttgcggg gtcccttccg cttgccgaag acgccctgtc gatcatcggt     25440
     gcagcacagg atggttggga atgcgactgc agggtccgga cccagcctcc actcggaatt     25500
     gatgcgtgcg ccgtgtttat cgccactctt cgccttttgt ctccgcagca gctaggcagt     25560
     gctttaagtt attaaaagaa agtgatcaac cctgcaacaa ctcaataatg ggcattactg     25620
     ctcccagctt ctgtctcgct tttgccacga cttctgcgtc gcatgttgga gcaaggggtg     25680
     gtgaaacaga gagggtagcc gaacttaagc gtaatagttg actgagacgg gtacaagggg     25740
     tatgaatagt gttctggact tgaatttagt taaattaatc tgtgtgcagg atatgctcgg     25800
     cgtcgccagt ttgctaattc agtcagcatt cgtgtatcat cgatgggaga tgaatagaat     25860
     atgaaatgtt agtccagggc ctagaggcta atagtagatg agtagatgat ctggcactga     25920
     atgaatctcc gaagctgtcc aaactttcat agcttacggc tggatgagcc atcagcatgc     25980
     ctgctacctc gaacttcagc tgtagttcgc cttgagaagg acttccatcg tagatgtagg     26040
     cacgatcgaa tgtgatcaat tgtactgcag ctttgagatc agcaagtgat atgaagagta     26100
     tacgccgatt gagcaataag agcaatattg ccgagatcct atgaaaatgt gaggaagaat     26160
     gctgagcgtg gccggaatga gtgtttactt ctgggcggag agtctggctc gggattgcac     26220
     gagaccaaac gttcagtgtt tgttttgcat ggcttgcctt gcattcctct gcaaattgcg     26280
     ttcggaaatc ctcatgccat cggcatctgc cgacccatgc ttttgcagct cctgtgacag     26340
     gtgggccgat cgcctccatc aattaggatc ttagaggatc tactcaagtc tgcagcttca     26400
     ggaaccatgg gatctcttgt gagatctttg ttgttgaaat gaggctgtga ctgagtgccg     26460
     ttgactccca tctccagtat cttcattgac tgacagggga tttaaattat cacagcattt     26520
     agcaaatgag gcaacatagg cccttgcgtc agatccttgc ttacaacgat aagctgatgc     26580
     agcccaagtt taaggttaaa tttccaatgt gtgatgcatc tcacgagagc cgttgaaata     26640
     taagactttg atgcacggtt gacatatgct atgtgacggt gttctgatcc acgacagctc     26700
     gagcaatcta ggcatagtat tacctggaaa catccctttt ctatccagga ctaagctact     26760
     tgcaagagtg tctgaacgca ccatgggttg acatctataa atattcgaaa caaacacaac     26820
     gtgatggatt tctacaaaac agccgttgct ggaaaaggcc gttgaaatac acgatagcac     26880
     aaacactacc aagcatcctg caaatgtcgc ttaagaagat cggcgttgct cgggacgagg     26940
     tacggtccac cggtgctgtc tcggacatca tatggtgcgt ttcagcatca acctgagctc     27000
     ttggcatcta gcggagcgcg tacatatcca aaggacacaa agatccgttc cacgtgcgga     27060
     tgctttccat actgccgtct aggtttggcg aagaatatat taaattgagg agagagccta     27120
     gagaaggcaa ccccctggaa tgcaaccgac acttctgact cgtggattgg cgcttatgct     27180
     agtcagtcac accaggtgat atcgcgcgga gctccctccg tccgccagcc aagaaacgag     27240
     tccgtccacc actgaagagt ctggccaaga catgggatgg ggtccaaagc cctctaaagt     27300
     gattatttgg gtaaatgatc gacaacatca tggactgtac ccttccagag gcagtgggag     27360
     tttttgaccg cagaatgctt ttctctacat gctgtgctga aagaaaagat ggtaacatac     27420
     aatgatgtta tatttggcca tcttgaatgt gcgtggtggt cttagaaaac gagatttcat     27480
     aatagaggtc tgatacagtg tcagctgcag aaggagccaa gccagccatt ggtggaagct     27540
     actcattgtc caagacttta gaccaggggt catgcattag aatcgctagc ttgacggctc     27600
     tggctccatc ggtactcaag attcggcagt gctcctgcgg aaacagctat ttaaggtgtc     27660
     tagctcgcga ctgacaagaa aacctttgaa ttggtctgac aatgtcaaac gccaagatgt     27720
     tgtccaaaac gtcgcttctg tcgctcctct cacttgcagc tggggtcgtc aatgcagact     27780
     ttggcataac gaccaacgat gattcctatg tcataaacgc caattctccc aactcgttgg     27840
     tgtttaccgt tgatcgcgga agttgcgata tcacttctat cgtgcattat ggcacagagc     27900
     tgcagtattc cggcaagggt agccatatcg gctccggtct tggaactgcg acagtttctg     27960
     ctaccaagag cggtaagtgg attttgagta cggcgagagt gacaagctga ttaggagcag     28020
     gcgactacat caaggtgacc tgcgagacgg atacattgac ccagtatatg gttgtccatg     28080
     atggggatcc tatcattcat atggcaacct acattaccga gggtgagtat tgtgtcaaag     28140
     ttttctacgt tagtctctaa catccaccag agccatctat cggtgaattg cggtttattg     28200
     ctcgactcaa ctcagatgta ctccccaacg aggagccatt cggcgatgtg tccaacaccg     28260
     ccgatgggga ggcgattgaa ggatctgacg tggtatgtct tttgcataat ttcgatgacg     28320
     ttgctaattg cacggcagtt cctcgtcgat ggcgagactc gcagcaagtt ctactccagc     28380
     cagcgtttca ttgacgatca gagacactgt aagaaataat ggaatatcta cagggttatc     28440
     gctgactatt caaggcattg cgggcgatga gcaccgcgtc tgtatgatcc tcaatcaata     28500
     cgagacctct tccggtggcc ctttccacag gtaggcacat actctctatc gcaaggatta     28560
     tgctcacagc tacagggaca tcaactccaa caacggaggt gactacaact ccctctactg     28620
     gtatatggta cgtttactac tttattctca aatccacagc tactgaccat acagaactcg     28680
     ggccacgtcc aactcgagtc ctaccgcatg ggtcttcacg gaccgtactc gatgtacttc     28740
     agccgcagcg gcactcccag caccgacatt gacacgtcct tcttcgcgga cctcgacatc     28800
     gagggctacg tagccgaatc aggcagggga accgtatccg gaaccgcgtc aggcgctgac     28860
     tcgagcttcg actgggtcgt tcactggtat gcctttctca cccacacaac catcaaccct     28920
     agctaaccgg acaggtacaa cgatgacgcc caatactgga catacacatc ctcctccggc     28980
     agcttcacct cccccgccat gaaaccagga acatacacca tggtatatta tcaaggcgag     29040
     tacgtcgtgg ccacgagcga agtgaccgtc agcgccggct cgagcacaag caaggacatt     29100
     tccggctccg tcgaaacagg aacgaccatc ttcaagattg gcgattggga cggacagtaa     29160
     gtacccccct cccttctacc acacacatca attacacatc taaaacgtca tggtatagac     29220
     caaccggctt ccgcaacgca gaaaaccaac tccgcatgca cccctccgac tcccgaatgt     29280
     ccgactgggg ccctctaacc tacaccgttg gcagctcctc cctgactgat ttccccatgg     29340
     ccattttcaa gagcgtcaac agtccagtaa ccatcaagtt cactgcaaca tctgaccaga     29400
     ctggtgcagc gacgctgcgt atcggaacta cgctgtcgtt cgcgggtgga cgtcctcaag     29460
     ctacggtagg catcctcttt ccttcctcct ttatgtgcag cgtagctaag atatataaac     29520
     agatcaacga ctacgaagga tccgcgccgt ccgcacctac gaatttggac tctcgtggcg     29580
     tgactcgtgg tgcgtataga gggtatgggg atgtttatga tgtttcggtt cctgagggga     29640
     cgattgtgga gggggagaat acggtacgtt gccttaccct gaatatatgt tgtgggagtt     29700
     gtggagatct gtgctgatga gcgtagatca cgattagtgt tatttcgggg agttctgggg     29760
     atgacttctt gagcccgaat tttgtaagtt tcttccctga tgtgagagga gatgagatga     29820
     aatagctgac gagagtagat ctttgattgt gtggagttgt ttcagtgagg gatgtcatac     29880
     attgacaact gcactagttg gtacagtata gcttgatgca gtgttcataa tagccctagt     29940
     tgacaattga ttataacgtc tagtctaacc aacaagataa tacaaccaca ccttcatcta     30000
     taggataata tacggacctt atatacccaa ctcctcccac ccaacaaaca agagatcatc     30060
     tacctccccc caacctccta acaatcaccc accccacagc tcccacccca accgccccca     30120
     tcacccacct cacccaccca cccttccccc tcccatctct atcctctccc tcctcccaaa     30180
     cccgatgcac caatctcccc ccaacccaca ccatcctcac gttccgacta tccccattcc     30240
     acacccactt atgcaccttc tccttccaac tctgaccctc atcaaacaca tccaccgcac     30300
     tctccacccc acccgtcttc ccccacctcc ccgccggatt aaacttcccc agcttgacca     30360
     tctgcgcatc ccacaccatc ccctgatcaa acccaccgat ctgatccgcc atatcgacga     30420
     cggctgctcc gccgcgcgtg gcgaggtaaa gtgcttcttc aatggagagg acttcgcgag     30480
     ggactttgtc gtcattatca tctggcgtac cctctctttc ttcaggctga gctcgagaca     30540
     tatgcggcaa caacctcgat actaagcacg cttggcggac tgtttccaga atgctgggat     30600
     tatatccgcc gcttacgtcg gttcccaatc cgacggtgat gccggagtcg atggccttgc     30660
     ggacttcgca gattccggag ccgagggcag agttggacgc ggggcagtgg gagagctttg     30720
     catcattctc ggcgatcatg gcgcgctcgt cgtcggagag atgtacgcag tgtgcgagga     30780
     tcgtgcgcgg ggtaagtagt ttaaagtagt tatacacgga ggtatagtcc ctcgattccg     30840
     gatacagctt cttcacgaga tccaactcgt ccaggttctc agcgagatgg gtttggatat     30900
     gtaatggggg cgagtagctg gccgctagct tggacagttt ccccaacgag cgcggggtac     30960
     atgatggcgc gaaccgcggg gtcacgatcg gctggatgag ggctccctcc gggtcgatgg     31020
     tgtgaatgtg gtcgatactg gcttgggtct tgtcgatggc gatgtccggg gactcgtcgc     31080
     ggaggtcatc ggggcattgt tcagggcggt ccatgcagac gcggccgatg agggcgcgtt     31140
     ggccgcgggc atggcagagg gaggcgagga ggttggtggc ggggacgtgg atggtagcga     31200
     agtaggaggc gcaggtagtg ccgtttgcga gggtgcgggc gacgacttgg ttgtagacgc     31260
     ggtaggcgta gggaggaggg atggagggga atttggagct gccgaagagg cttcgatggg     31320
     gaaggtgtag ttcttgagcc agtggaggag gccggcgtcg ccgaagaggc cggcgttggg     31380
     gtattggggg gcgtggatgt gggtgtctat tggatgtttc tctgtgttag tggtgtatgc     31440
     tggggagttg ggatgtgtag ggtagggtag gggggcatac cgatgaaccc agggaagaag     31500
     aactcattct cctcctctcg cgcaaccacc aacgtcactt ccaccccgtg cttgttctta     31560
     ttgtggccat ctttatcatt cacgacagtc caccccttgt gacggaggaa tctcttcagg     31620
     tctcggtcat tggcaatgga ccagtcgaag ccttcgattg tgccgtcggc agtggacacc     31680
     cagagcgcgc cgcgggtgat ggcgagctgg tggccctctt cggacttgaa gcgggggagc     31740
     tggatgaagg ttccgacaaa gagggtgtat ttgggagaca tgttgctgtg ctcaatgctt     31800
     gctgtaaatg taggaaagag tgttgtatgt aggtaggttc gtagctgaca gctgctagct     31860
     aggagcttgt gtggggaatg tgccaatctg cgtcgcgggt agtgcaaagc tgacgcgggg     31920
     tgatgcgggt gctgcgcgca cttgagccca atgctaggag gagattggaa taagctatct     31980
     atgcgccagc aatgtaatag cgcaacgctc caaaacttca gaaaccgaaa atcacgaagg     32040
     gcaacagccc agcagatggc acgtcttata gtgaggcccg tcgcgtccgg ttccgggggc     32100
     tgctcggccg gctccgatcc tgaaaacagc tagtgcgacg ataagatacg gattgcctat     32160
     ctgggatatc aagtgtttgg tctgtttgca attgagtgga ttgaattgat tgatggaaca     32220
     ttcatgtttt tattaaaatt tctaaaacgc catccatgtc tatcatgaca atgttgaatc     32280
     gctagtcatg cacgtcgtat caatatgcaa tgccaatcca gaatgttgaa aaatatggta     32340
     tcaaacgcaa tcgtacacat gggtatcata gactatctac tcgctatcct ccaccggtcc     32400
     gcaggtacag aagaggttct ggtcaccgta tgctgcaaca tattagcgaa attcttcaag     32460
     gaaatagtgg tataggtgct taccatcatc gacacgagtc accgacggcc agaacttctt     32520
     ctcgaccagg tacggcaacg ggtacgccgc cgtctcgcgg gtgtacggcc ggttccactc     32580
     gctggacaac aggtcacgct gggtgtgcgg tgccatcttc agcacattgc cctcctgggg     32640
     ctgggcgccg ctctccacgg cggcgatctc ctcccggatg gagatgaggg catcgcagaa     32700
     ccggtcaagc tctgccttgt tctccgactc ggtgggctcg atcatcagcg tgttggccac     32760
     gggccacgac atggtcgggg cgtggaagcc gtagtcctgc agacgcttgg cgatatcgat     32820
     agcctcaaca ccgcaagtgt ccttgaactt gcgcacatcg aggatgaact cgtgggcaca     32880
     gcggccattc tcgttggtgt acaggatagg gtagtggtcc ttgagacggg ccagaatgta     32940
     gttggcgttg agcagcgtga tcttagtcgc gtgcgtaagg cccttggagc ccatcatgtt     33000
     gatgtagttg aaggtgatgg gcaggatgct agcgctaccc caaggagcgg cactgatcgg     33060
     gggcgaggac gactcggtcc gcttggactg gagatactcg ctgcccgggt gagagggcag     33120
     gtagggccgc aggtgctcgg ccacaccaat gggaccaaca ccaggaccac cgccaccgtg     33180
     ggggatacag aaggtcttgt gcaggttcaa gtggcacaca tcggcaccaa tctcgccagg     33240
     agagcacaga ccgatctggg cgttcatgtt ggcgccgtcc atgtagacct ggccgccatg     33300
     ctggtggaca atctcacagg cctgcttgat gccaggctca tacacaccga aggtgctggg     33360
     gtaggtgatc atcacagccg ccagctcgtc cttgtgcttc tcacacttgg ccttcaagtc     33420
     ttccaggtcc aggttgccgg tcttggtgtc gcacttgata gtcaccacgc gcataccagc     33480
     catggcagca ctggcagggt tggtaccgtg agccgagacg gggatcaggc aaatgttgcg     33540
     cttgtcgcct tcgtgggcct cctggtactt cttgatgaca cgcaggccag cgaactcacc     33600
     ctgtgcaccg gagttgggct gcacggtgac ttcggccatg ccagtgatgt ctgccagctg     33660
     ctgctccagg tcatcgatca tctgggtgta tcccttggcc acatcagccg gcaggaacgg     33720
     gtgcatctga gagaactcgg gccacgagat cgggatcatc tccgtggtgg cgttaagctt     33780
     catggtgcag gatccaagag gaatcatgga gtgtgccagg gacagatcct tggactcgag     33840
     gtgacgaatg taacgcagca tttccgtttc cgagtggtgg gtgttgaaca cggggtgggt     33900
     cagataggca gaggtacgtt ccaggctggc aggaacagga gcaacagcca gatcctcttc     33960
     caagccaacc tcggccttgg aggcgtgggc ggcaaagaca cggaggatag acttcacctc     34020
     ctcacggccg acagtctcgt ccagggagat tccgaccttg gtgtcgttca gccggcggag     34080
     gaagatggac tgctcacgag cagccgcaat gatggcatcg gtttcttggg caccggacag     34140
     ctcgacaaca acggtgtcga agagagcacc accatcagcg ctgttcgact tgatcggaac     34200
     attgtagccc agtccggcga gcttggcctg cagagtagtg gtcatcgaca tgatgcgctg     34260
     ggcgatagcc ttcaagccag caggtccgtg gtagacggca tacatggcgg tcatgttggc     34320
     aaggagggcc tgggccgtgc agatgttgct agtggccttt tcacggcgga tatgctgttc     34380
     acgggtttgc agggccaatc tcaaggcacg gttgcccagg cggtccttgg aaacacccac     34440
     aacacggccg ggaaccttac gcttgtactt gtctgcgcag gcgaagaagg cggcgtgagg     34500
     accaccgtat cccatgggca cacccagtct ctgggcgctt ccaaacgcaa tatcggcacc     34560
     gaactcgcca ggtgctttga gcagagtcaa agccagaagg tcggtagcga cactgaaggt     34620
     accaccgctg ccgtggatcg tatcactcaa ggactggaag tcgtagatac caccctcggt     34680
     gtcggggtac tgagccagaa caccaatcag cttatcaccc tgctccttga ccagcttgaa     34740
     gtcatccgcc agaatatcgc cgaccaccag gttgatgcca aagccctctg cgcgggagcg     34800
     catcactgca atggtctgag ggtggcagag gtgagacacc acgtaggact tgccggcctt     34860
     cttctgcttc gacatgggta gggtggccaa ggacatggtc atggcctcag cggccgcggt     34920
     accttcgtcc aaaacggagg cattggcgaa gggcagaccg gtgagatcag cagtcagcgt     34980
     ctggaagttc aggagggact ccagacggcc ctgactgatc tctggctggt agggggtgta     35040
     gctagtgtac cacgcagggt tctccaggac gttgcggagg atgaccgggg gcacaatggt     35100
     cgggtagtag cccgttccga ggtatgtctt gcccgaaacg tcgatttgct tgcggtaggt     35160
     atccaagagc ttcagcatat ccgtctcacc caagcccccg tgcacgctgc tgtggggaag     35220
     attggcagta gagtgcggag cagacacctt caagtccttc tcggacagga tatccgccgg     35280
     cagcacctgc ttgacgaact catcgagcga tgctaccgga ggatccaagg tggcaagcat     35340
     ctccttggcg gcatcgggag aggggccaat atgacgtctg gggaaggtat cgaggggttg     35400
     aaaaagatcc gggggatgag gcacgccatg atccgcgacg gagctggtgt atacgggccg     35460
     tcgtgcggag ggcgactgct gtgtggtggt gtgaagggag cggatcaagg gggagactct     35520
     ccgcaccgca attggcgagg gagcagcgcg caaccgtgag cgcagcgcca gctggcgagt     35580
     gccacgcaga gcgcacaagg atgcagccat acctacaatt gagcaggtcc aacgatttca     35640
     agaatggtgg acggtaggta ggtgggtggg tgggtaggaa gggagtatag ggaaggggga     35700
     ggtatagacc cggctgcgcg agagttcagc acatgagata gcgcaacaca gttgagtaga     35760
     agagggttaa gggaatgagg agaggagagg agatgaaaat attcgcgaca atgagtgata     35820
     aaagaaaaga atcgactgga ggggagcaga tagcaagaat aattaatcct cctcgaccgc     35880
     gggcgccacg gatactcgcg tcgggaaact gtctgtccgg ccgataacgc tggccccggg     35940
     ccaatcagaa cgcgggatac agctccggtc cctcgcgatg gagccccgcc atttgcgata     36000
     agcccgcgat aagttgccct tttccgcggg aaattcatac gtgcatttta tctcttcgat     36060
     cagtttgtgc attgttactt cgcaatatct gatggtgaaa gataatctgt gacatcctaa     36120
     atatatctaa ctgagcagat gccccactgt cattttcctc accaattgac ccctacaaac     36180
     tgccgatgat gggatgaaca acctctcctc cgcagtggga gctcctccga tagcgttccc     36240
     cggtgatgca attatgactt tccccgtgga gctgggcccg tcggtaaggg ttccccttgc     36300
     gcgctgtgcg cagctgcaag tgaattttgt atctttgtct ctggcttaca ttactcactg     36360
     tgtacaactg gtcttagctg ttcattggta ctgtgtagac ttacctcatc gacataatca     36420
     tggacgttgc acatcccttg cttacatagt gcaagcagtt atgcaagaat atagatagta     36480
     gcgtgcagct cccgatctag aacatgaaca ccccggctgc tttcccgacg ggcaaattcc     36540
     attctgctcc acattattgg ctatcaccag tttttgacta cacaaatagc acttgagtac     36600
     tcatatcgtc ttccatccaa cagagaaacc agcttaaatc cacaccatac caaagcagac     36660
     ataattttct ttctcccacc tagatagtat accggaaatc ggaggacccc tcaataacac     36720
     gctctccccg atcggcttgc ttattcgcat atcggaacca cacactcagt gcagccaccg     36780
     tgatcatcgt aacaaggttg cacctgtatc acacttagct taggtgcaac aaacacacca     36840
     acagctataa atactcacgc aatagtcgtc catattcccg gtcgatattc tggcgcatct     36900
     ttcgactgaa acaccagact actgataatc cccccaatgg ccccaactcc aatgagcgtc     36960
     gcgctgcaga acgcgcgcgt ccactggcct cggatattgt tggcttgata ggccatgaca     37020
     gcggggatat tggaattcgc cccggcgacc accagaaaca cccccacgta gcgcgcggca     37080
     ttgcccttag caaatcccat caggggaagg ccgatgatgc cgactacggc attaaacgcc     37140
     acgatgggtc cccgcatacg atagcgatcg ctgatccagg ctgtcgtgta catcactatg     37200
     cctgcaaagc cgtagggagg tgcgaccaga cactgtgagg cgccggtgct gaagcccatt     37260
     ccctcttgga ggatgatggg caggaaatat gcgatggcgt acgcgaccgt agtgctgcat     37320
     ctgcttgtcg tcagacaaca accctcagta agagtggaga ggcaggaaga actgacagac     37380
     aaatcaatgc aaaaccccag atcttcaggt cgaatgccgg gctgaagaat cgcttgaacg     37440
     taaagggctc ttcgttacca tcggcacggt ctcggttaat gcgtctcaca atgaaagcac     37500
     tttccctctc gttcagaaac ttccaagact tgtgtgcctt ttcagggaag tcaaccatga     37560
     agacaaaggt caacagtccg atagcgcccg taatctagag atcatcaaca ctaggttgcc     37620
     ttttcgaagg aattacatac cacgccctcc ataatgaata tccatctcca tcctgatatg     37680
     ccttgaatgc ctcccatctg catcaaacca aaggcaagta ccccggctag tgctgatgcg     37740
     acacagccga taaggtaaaa gaccgagtat cgcttttgga tgtcatctgt tttgtcagtc     37800
     aaaatacatg aatgttggtg tgcgccactt acatcgggcg taccaacttg acaggaggta     37860
     cacgcagccg ggaaagtaac ctgcgaggtg tcaattgagc caaactgtat actgttcgtt     37920
     acaccaagtc acactcacct gcttctagtg caccaaggag cacacggatt gcgaccattt     37980
     gcttccagtt cttgacaaag cccattccct atagcagtca tcgtcagacc gcaactttag     38040
     aaaggatcga gagcatggac tcaacgtaca acgagaattg ctccccacga tatgaccaga     38100
     gtgcccagaa acagagtcgg gcccaccttc cggataatca ccgtcatcgg aggttggaag     38160
     accacgtagg gtataaagaa aacgaggatc acgacagact gtcccttgtc agcagttaca     38220
     tccaataata cagaaagtgt agaactcaca tagcgagtcc caaccccaag ttgcaagtcc     38280
     tttgtcatac tgccctccag tcaacagccg attcgacaca acatagacca actatctatt     38340
     ttaagctgaa aggaaaccta ccctgcaacc gcagccatgc ttagattcgt cctatccata     38400
     agcgaaatgc aatacgccaa accagccata gtcaccaagc gacgatcgac ccgatggatg     38460
     atcttgcgct gctctgcagg cgtgaactcc tcatcgtagt ccacatcatg gatttcaggc     38520
     ttatcgatat cctcgatccg ttcgacacta gggggctttt caatgtccgt agatgacatg     38580
     gctgacggca gatatttgaa aacgagctta gaaattcccg atagattgat ttccgagaga     38640
     aaatcgaagc aggctgcagc catatatcaa tgaaacctcc cacaatgcaa tacgaatcac     38700
     cgcgcttgcc cccgcgatgc gtggcaagcc acatttcgca cacaccagct cagctgatag     38760
     aatgcggcat ttgtctaatt actgaacacc aggatacgag tccagattgg gccaacatcg     38820
     actcaatgat gtatagcacc acgcgttctc cacaatttcc ccaggtttat ggattgtaag     38880
     accgatgcgg ggagcagcga tgatcgaatg cgggggagat aataatcagc caccagttaa     38940
     ggctgcgagt gattggatgg accatctccc aggtatattt ctggcgaact tatcgaaatg     39000
     gttattcggg ttgttgtatg ctcgggccga tatagggccg cctgtaccac ttgtgagagg     39060
     tgacattcat accggctggt gtctacataa ggcgaataca agccttcaaa acatggatta     39120
     agaggcaagc caggtgatta acttccaact gataaacaga ggtccaattt catgtcaatt     39180
     gcaagctcat tcgtctattg atgaccgatc atttcacgat gaaacagaag cacagccatg     39240
     tcaatgtaat agtctggccc atttggaaaa agcatatctt gccacaaacc cgagatgaga     39300
     gctcgaaaat ggccattcta tgtggatacg agctagacaa agtttccagt gatgttgaaa     39360
     ggctagctca ccggtttatt cgatccattc agggacatgt tccaggcctg atcgcgacgt     39420
     ccccagctgg agaagcgcaa agctagatat cccgccatcc gatttctttg ttcacttgtt     39480
     cctagtcctc ccgaattcac ccatactagc ttgcactgct tcctgtcctt caactggcat     39540
     gaacctcgcg atggtattca ataatatgct cggcccggct gttgcgtagc cgggccgagc     39600
     ttaagtttag tttctggtcc ccagcggccc gaatatagaa gtccctactc ggtgcgcttt     39660
     tggcatctac gctccaatcg agtagacttg cgcataatgc ggaagacgca tagggccacc     39720
     tactagacac agagtggcgt ccatcatcca tagatcggat cgtgattggt cagcaaatat     39780
     gcgacttcag ggctactatg cgtagagtgc aagcagaggt atagttctca gtcagggcat     39840
     aagcgtgccc agcatgacgt gtatgcctta tcactgctgc agtagcaagc gctgtcataa     39900
     tgaaatagct ctctgatctc cgctttacat gaagcaagtc ggtcacttga cctgttgaga     39960
     gccttatggt tgaccctttt ctgctactat aattccatga taaaccgtta actttagctg     40020
     gactattgga tcgttcgtac atgttaattt ggtcggatag attcgacttc tgattcatca     40080
     cgtcaactca aatcaacacc agcgcaaagg ccctaagaca catgagaaat gtggaaaatg     40140
     atgtgtctat tatctgttcg ggagatgtaa ctagtgcata cagcactcgg tgtagggaga     40200
     ctgggtcttt tcagttgcaa gccgggctca aaaagcatct agtagtttct tgaatagcct     40260
     aggggttagg gagcgcaaat gattgaactg aggtaatgat atgaattgta aatatttatt     40320
     atacagaata aaaatctata aagcaggaaa gagaaagaac aatgaaagac atgagtccag     40380
     ctctggagct caatacatga tgtcgacgta gtctgaccgc ataatgcgac atcagctctt     40440
     ttcaaggccc ctaccagctc gagtaagccc cgcgtgtagt ccattcaaac ccaggattag     40500
     ccatgctatc aaagccgcca gaacttgcga agtatgccga gccccagaga gtgccacgcg     40560
     ggatgcatgt tccgggatcg tagtggtctt gataatctcc ttaggaggat cgacggttat     40620
     cggattacca gcctcggaac tggtacattt tatttctgcc tgttcatcgg actggcttat     40680
     cgtctcagat tcgacaaggg tagagtcaga gctgttcacg gtctgtgtgg atgcagccga     40740
     gctgctcctg ggcggcgcca gggtacttgg agatttgttt ccagtcaact gtcgtgccag     40800
     ctcgagcaag gcttcattcg gaagacagat ctcgctaaat tccgtgtcag gatctttgcc     40860
     tagtgtgtca tctggaacag cagcaggttt ggggtcggat acttctgtaa gtctcttaat     40920
     gaatatgttc agtgagttgc cgatctccag agtgacttac ctgccactgg atgtaagttc     40980
     tcttcgacca taacttgatc tatattcctg actaacttgg aaaagtaagg atcgtctgtt     41040
     gcagagacga cgggcttgat cttagctcga gtaagggcct tcttattccg tggcggacaa     41100
     acaaggcgtt gccggactcg gtgatgccat cgctgcatct tgacttcgat ctgcaggtcg     41160
     aggtagaatg gagaggagtc atgatggaag gtaagtgcag tgtgcacgat tgagtggtga     41220
     accgcttgtc gctctagttc attttcttcc aggtgccaaa caagctgtct atatcgattg     41280
     tttggagtat atgattcgtc atcagagtca tccgtaaatc gggaaccagt gaatttccac     41340
     cgcgacgcat aactggcttg agtctttcgt gaaatgccaa taccttcgac actggcatta     41400
     gcggtgccta ctttgggagt ggcctcgaaa gacttcgaca cttgtcgctc tcgtttctcc     41460
     ccggtgagga tttttggtcc aaagaactca gtgacctcga gacctgtgtt aattcgcctc     41520
     ctccggtgct cggcctcatg gaagttcatg gtaatggtcg cttgtgagag cttgcagtcg     41580
     gtgggttgat gaaatgtgag atccaaatac atcagtcctg catcctgccc acgaagctta     41640
     ccccactgcg tcttggatat cagaaagcag caatcgacgc gaattctgcc aagtttgaga     41700
     tccccaaggc ttgcacttga gcgtgtttga cactcatcga catatctgaa aggcttggct     41760
     tgggtggttg atcgtttggc aggcattgca tctgatgggt tattccagta ctaagttgaa     41820
     ggcgacgtga acattagctg gcgggaaggg gcgaggggcg cccagcctgg gttaaattat     41880
     tcttcactca ccattttcct ctttcttttc tttttcattg actgtggcgg tgctatagcg     41940
     ctaaaatgaa gctctctcat tcgtgccaca tgtgcatttg aggggtcttg gcaaggctgt     42000
     aacctgtgtc ccataaattt cagcctaagg agagatgaat tactcatttc atgatcccac     42060
     ttaacaggct ctcatgacgc tcaatattac cataggctca gaccgtgctt cagatgaaga     42120
     agattcatcg gaatccgggg ttgagatcgc gccaccgtcc atcactggaa gccacgcatc     42180
     tcacgactcg cacgcagaat gggcagacgt cccacttcca gacgagctga agcccggcaa     42240
     aaaagcttat aaaccgccgc cacgagtcca aagtaggtac tgggcagcag cgccgtcccc     42300
     atttagggtt agcaagcagg acgactggtt gatttcatct ggtgacaacg acaaagacat     42360
     cactgcgcac ctcaatctgg atgttgcttt ggatctggaa catgagctag gataccttgc     42420
     gcgcttaaat cgattgggcc actttaaaaa gggtattcgt tactttgaaa gacgcctcgc     42480
     accctatgtc gacttcttcc ccgtggtagc cgaatatgca gacctcctct tggagcaagg     42540
     gaatttcggg aatttgcatc agtttatttc aagtcgcttg aaggaccatc tagttgaata     42600
     ttcgaaggag gaatacatct tgctgaaaat cttgaaggcc tttgcggaga tctatactaa     42660
     aggagcaata gtacctgcat tgaacatggc gaaagagacg ctgagccatt tgtcggtgag     42720
     gaaacatgtt tcaaaagtcc ccagtttatc tactggcgtt aaggtgcgtt ttaaaagttg     42780
     gcaattgaac atgagtcagc attccttatt tgattccctc ttagattcaa ttattggaga     42840
     tgtgcgtacg tataatcacc aacgcggccg catactccaa ccttctcgag accgaatcgt     42900
     tcaatcccct tttgtactgg tctgcttcta gtaatgggac agtaaagtta gacgacaaag     42960
     gcgatagtgg cgaaatacat gcgaggggat atagaactcc ccggcaaagc cctcctcgaa     43020
     taggttcttg gtatcgtttc ctgctccagg aaggcttttc atgggatgca caccgtattc     43080
     tacggtctat attgcccatg cttgggtccc cggatggaca ttacatcttt aacggacgct     43140
     ttgaggaatt cttcgaactg aaaaacatct ctgaggccga gaaagttcta cttcagccgg     43200
     cagagatgtc gttccaggat gagcaggttc tgttggctga gtttgcgaac gcatgcctgc     43260
     ttgcggattt cctgagtgcg gaacgcttta gtgaaattgt ccaggtggcg ggctgccaat     43320
     tcttacagag atcccgctcc ctagcatcgg caatactcct agaataccca cacttaatca     43380
     gcactcgacc atacttggat tggctcttgt ctgagagcat tcgaattttg ccattctccc     43440
     gtcatgtcca accgctagta aagaatacga ggctggttcc tgatagctgg acttggaagt     43500
     ctttcgacaa tatgcaattc cttcaccaga gaaagctgtc tatgaccagg ggaacagagc     43560
     taccaaagac tcctaacgat cctccttcat ttcaaagcct cgaatctata tctgaatgcg     43620
     tcaggggtct gggagattat cgtctggagc ggtctgtgct tcatcaaatg ttctggcatt     43680
     cactggactg ggaccaaagc cttcaagcac taagggacct gacccggctg aatcgcgacc     43740
     taatgagtga cacttgcggg tatctccaat ccttgatcga cgagtgcatt gccctggatt     43800
     atagcaacgc tcccgattgt gagagattgc gagaagatct gtatagtcgc ttctctgcat     43860
     tcgaccactc ctttcctttt cgctttgatt atgatacagc ggtgcatgaa agctctgcca     43920
     ttgtcttttt tgacaacgct ttgctcaaat atattgaaag gaacatgctt ttcgacttct     43980
     tagtcgagac aggacgaggt actgaggctg aattggtggg aatgaaacta tcccgtacag     44040
     gtcactactt gcccggcgag attcgatcct cgttgatttc taccggcagg tatttcggcc     44100
     gcacagattc tctagcagca aagcagattc caaaatcagc agaaattaag ggtcatattc     44160
     ccgattcgac attagctgga tatcgggtcc ctgatctggt tccagggcca tcagatgtgc     44220
     gacgagatgg cccaggtgga ataccccgag cgatcttaca agttccctac cgtagcgatg     44280
     ctgcagctga tgataccgca ttgtcgttag aaaggttgat ccgacaaggt cgagatgcgg     44340
     agcgggccaa acagacggga gacctcgttg aaagggagaa gaaggccatg aagcaggagc     44400
     gtgtgaggtt tacgcaagaa gtagccagat tcaggagaca ctttcaaatt gaagaggaaa     44460
     agaaaagggt ggctcagaca gattctacat ccctagtgac gctcaaggat ccagtgggca     44520
     gggcctttct atttccattt aatcagtgtc gtccctttgc tgtgagttgc tctgtcccct     44580
     acaggacgaa ttcagaagac gaaggatata agttgatata atttcccagg caatgaaggg     44640
     actcatgcag caagtctttc ggtccgataa tattctcgcg cctcacattg ccaaagggaa     44700
     ttataggttc accagcctcg atggtaatcc catcacacgc gacagttggg actccgacat     44760
     ccagcccggt gggaccatta tggttcatat cacgtctgac ttggggcagg acttatctca     44820
     ggagcccgag aaagcaaaca cagaacatga ccagccagtg gaaggagaac gtcttactgc     44880
     ccagttggag tcagtaaaca tcgtagatcc cgaagacaaa caagatcagg gacctagagt     44940
     tgacgatgta tccgatagtt cgacctaaag gattctaggt gagagggaac tgggaatgac     45000
     cgtctatcat taaggggcca ttgtacagtg gcagtcaata tagaacgcga agatactagc     45060
     caatccgtat tgttaattgt ggatccaaga acaagattaa cataatcatg ttacagcata     45120
     gtattacaat catgatttca tgtcaatgat aacaatgacc cttttgggag gagttacgca     45180
     ttgaaaactg tttctatgga gctaacaaca tgagaatagt aacctaaaat actaactctg     45240
     aaccgagtcc ccatcatatt tcatcactcc aaattacatt tgatgttgta ctgattttca     45300
     ttacatcatc tcctccttct ccagtccatt gatttcattt aaaagtagcc tagctctccc     45360
     tgcattagac attgaagaaa atgctcgaaa aaggttaggt gggaaacgag gcagaacgtt     45420
     atgtcattcg cctggataat gcccatccgt gtaaatgtcc ggagaaatcg taatttacat     45480
     aagagttaca cgaaaattca caacaaatgt aagaacccca aatggctcca gaagaaaaac     45540
     ataatcaata aattctagaa gacaatgcaa gcttcaggct atactgagga gggccacttt     45600
     catcattata taatagtagg gttgctggaa agtgattgta tccacgttac acttgaaaag     45660
     tcagtatcaa atcattacat cgtcgatacg gaataccacc ccacatgcat gcagcaggaa     45720
     ccactatata aggctaaaac ttcccaatag ataattaccc aaaacttccc ttttctctcc     45780
     atgttcagca ttcccatcga acctcacttg tcacctccgc catgcccgcc aacgccatca     45840
     ccatcatctt ctcaccctac cacgtcggca tccgcgacca ccgagttggc aacggccccc     45900
     accgcatccg ccaacacgga atcatccaag ccctcgaaga cctaggcgta aaagtcaact     45960
     tcatcgaact cgaccgtgtc gacgaattcg aaggcgaaat tggtcgcagc ttcgagctcc     46020
     tccgacgcac atctacggcc gtcacccaag ccgtgaaaaa caacaccttc cctatcatcc     46080
     tatcaggcaa ctgcatggca agcgcagcgg tagcctgcgg tctcaacacc gatgatctga     46140
     aattcatcta cttcgacgct cacgatgatc tcgactcacc ggacgtcaac gagaacggct     46200
     atctcgacgc gatgggactt tccatgctcc gtggggagag ctggaagact cttacgagga     46260
     cggttccggg atacaagcct ttcacttatg atggcaactt tttgtactgt gggctacggg     46320
     atcagagcga tgttcagcgt cagagggtat ttgatgcggg gatggttgcc atatggggtg     46380
     aaaccgagcg taaggttgat tttgtgggtg agttgagtaa gcagttggaa gcaaagtcgt     46440
     atgatccggc tttggtgcat ttggatttgg atgtattgga cgagtcatat gggaaggtta     46500
     atgattatcc ttctcccggg ggattatttg agtccgaatt gttgggttgt atggatcttg     46560
     tacctaggag gagtacgcct aggtctttga ctgtctgttc ttttgatcct gatgcgggcg     46620
     atggggatag gattgcggtg attgctgttc gtgcggttac ttcttttgtt cagtctttgt     46680
     tggatacagg ggctttgatt aatgatgctt aattcagttg taaaacgaac ttatagtctg     46740
     aaggtgggca gatgtctcat gattagggct ggctgctatg tgtaacgcgg agctgcgtag     46800
     ccaaggaaca cgctttctat atactacatg gtcaaaagtc tcggaatatt caaaatttcc     46860
     tgaaatctca atattactag cgttacgtat aaagcataca ataatctacg aatataataa     46920
     acgcagtagt aattggatgg gtattccgat ggcgtaataa atacaataca ctgtccccct     46980
     tctatgcttt gaaaactcca ttgcacaatg ccttcattca aattactgat aaggtccata     47040
     gacgatccag acagaagtcc ctcaaacgtc agagaccaag ttcatgctcc caatcggtgt     47100
     tcaagaaaga gcttgacgaa tatgcatcat cacctacaga caaaaagtct tgaagatgaa     47160
     ataattcctg ctccaaattg aagccctctc cgagcgagga attgttattg tctatgacct     47220
     gaactgccga ctgtaagtca aatgggtcct gtagccatgc atcaaagtca cctgcaagct     47280
     ctgaatcacg gtcctggcgt tcatgctgat gtgcaagaga tggttcgaca gacgatgagt     47340
     cccggttgtt cagaatatca tgcaccctcc atttccgtgc aatcatgcta agtgccctta     47400
     ctgaacgttt tgcccagccc caggcgatgc tcatttgctc tagatattgg agcgtttcga     47460
     gaaaaagctg tctggattta tcccgaattt ggtggtcttt ggcggtactg ttgaatagat     47520
     ggatgaatgc ggcggtgcgg gcggtatcga ctacggatat tgatattttc ctctggtgat     47580
     aaagaatatt agtactcgtt acgttaactc gaaattgcga cgaatggggt ggtcttacca     47640
     aggtaaagaa tttagcgtaa gccctaaaaa gaactgttac cttttctgcg gcttttgtgc     47700
     atgtttccag gctagtagag acagctccat tcatggagcg ctgaggaggg cgggcgttgc     47760
     tgggtatgtt gatgaatggt cgatggagaa ggatgaccaa agtgtaaaag tgcatgctga     47820
     aggagcatca gttagtattg ggaacttccc aacgttggtc atggcacgta ctggaaacaa     47880
     tacatatgcg gcggcaacgg ccttgacgaa gtcggtggca gacgaagaac acttggtaag     47940
     ttgttataaa aagatgttaa cgctatattt gtttttgtca taatactttt cttctcggcc     48000
     gaggtaacaa attgttcagg ggtatatcta taggcgaaca tgagcgattt gaccgaagcg     48060
     gccaagagtc gaaagaataa actgatagag ttcttacatg tcatctagtg gacgtgttgc     48120
     taagcgtaaa agtcggcatg tattatgtaa agtagtgata gagtaggata aaggtgaacg     48180
     gtctatcgag ggcatcgagt ctccgttcca ttggccatat tcaacatcgg ctaaattgga     48240
     tgggaaattg acctgtatat cgcgctcatg aatgatactt ggtcgaccaa tgccgacagt     48300
     aaacaacctt gtccgttaga gcattgttaa cacgtgagta aactgcacgc ttacttttca     48360
     atcatataac aaccccacca tgcgattgac cgcagctcag cttcttcaga agccatgaat     48420
     cccgaagaaa cccacaaatg tgggtcaata tgtagtccca gattatacgc catccgaata     48480
     gcaattcctg cgtccgaaat gagctaccag attaaggaga tatttcaacg aagggtttgt     48540
     tgggaggtac acataccgag gtagatccaa ccagctggtt cattgtcttt ggccatttca     48600
     tatagagata tatgtgcagc ggccactact gtggaaaccc gtggagcctt gatctcttcg     48660
     aataagagag ctcgggcttt gtgggagaaa cagtcacctg cggtactcgg atcattggga     48720
     acagtgcgga cttcaggatt gtcagagtat ctcgctgcca aagccatcat ggagtgaaga     48780
     agcaacgggg tacagtatcc atcgtctatt tggttttcca gacccctgag aaacaccttt     48840
     tgataaacaa ggtactgcca agggttctgc cacttccagt aaatatcaag gagttcttcc     48900
     tggatttggg gatccatatc gatacgctgt aatggctgat gtgagttttg acgaaaggta     48960
     gtgtgttttg tgccctgccg ttctacgaag ctgagattgc tccgcgatcc aaagtatcgc     49020
     agctgatcgc cttccccaat gcttaggccc ccaagaagat cagtgatatc gtcaatcggg     49080
     tctagggatc gaggctgggt gccagaaagt tctctactcc caaatgtttc atctcggtct     49140
     agcatttggt gagttgttgt agtaagagtc ttcccttctt tgtgttcata ttgggctaat     49200
     tgtgactcca gaaattcaat acgagcctgc agtgcttgta tgtgctgctt ggttggtggc     49260
     cttgattcga gtcaacgaca gagtgacgag gaatatgacc gaaattatgc ttacttgcgt     49320
     ttctccttat catactgata ctcacacttt tcagcctggc ccaagcatcc agcacaggat     49380
     ggtttggcac cattacacta aatcaatatc gaacgttaga gctcatagaa gctcatagct     49440
     ttggtaccat ttgattaaga ttaactgcta aggatttccc ttaccttgat tcttttcctt     49500
     cggcaaacat cacaagcgac agacactctt ttacggtatg actggacttg agacatgacg     49560
     ggaattctct acaatgtatg taacggatgg tgaagtttag gaacgtgctg gtcagtgtcg     49620
     gtggcaagcg ggtacagcgg gcgcggcgga atcttgtttt tcctgactgc ctccactagt     49680
     atctgttggc cgctttggga tacccgcttt gcaaccaggg acttttcgat aatgcatagt     49740
     atggtatcct atataaagcc tggtatgtat ataagaatgg aacaagaaag ttgctaaggc     49800
     gcgaacaatc cgggatgctg ctgttgcgct taatatgatg atcaccatcg acgatacttg     49860
     gggctgcgct ttgacgacag cacaaagcct gcagctagcg gcttcgactc cccctattcg     49920
     tctgcgtgct gtagaccttt ttgttgaatg gaagaatccc gctatctcgg agattcgaga     49980
     ttccaaaatg gagccaaatg gcagagttag tcacagtttg ggccctggga atggccttgg     50040
     ttagatcgac atggatcttc tgggacaacc gatattccag atcaagactc aaacctgatt     50100
     gaataaagga cgtatagctg aaagcattag gctttcgcaa aaatttgcag cggcatgcct     50160
     gaaattacaa tttgccttat tcataatata tgaatcactg ccaaaaacta tttaggagga     50220
     tacgactgcc cctttcccga agcggggagt tcagctgtct tttgagggat gggtctgctg     50280
     tggaagattt ttcgttagga atgaatacaa caaggaattc ggtaacaatc aagactgagg     50340
     ctagggagtt atagcctctt tgagtaatta atgagtctag ttccatgggg gtggtgtgag     50400
     agaacaaaga aaacagtaac tttaggtata cacttcaggc attctgcaag tggcctccat     50460
     tcttgagcta taataaacaa ggcgtcatag aaaacattgc tcgctcaagg gaaccataca     50520
     attcgtaatg agctcattta aaatttccta gatgctacct agcaaacact tgaatctata     50580
     acagactggt gttacacact actggcagag cgcggtgaaa cggagtcttc ggcgtgatac     50640
     ttgcttcaag tattcaggcc ttgaatcttg ttcacaaccg tcccgttacg tacaacgtta     50700
     tacacggagt cgggcccttg gagtgctaag agcttcccta cttataggat gtttggctca     50760
     atatcgggca gtgaagtaga tcaacaatag atccgagtgg caaagcataa ttgaccgcga     50820
     agaaccacag acatgtgttc aagggaattt cgttatatat tcagtccctc ctattgttcc     50880
     aatggtattc ctatcccatt gttggcatgg ggatcccatc ctatcgttag gttatgatat     50940
     tacgtgacac atgtttaccg tgatcttgtt ctcgtggcat aatactcaga agtgattttg     51000
     tctcttcact agagcttcgc tgggggctcc agaagatgct tcatctccgc gttcggatat     51060
     tcaacatttt gggatgaatc agggcgctgt cggtcccatg cccatttctc aaccagctcc     51120
     ggttccagct caccttcaat catttgaagg atgtattttc caagcacagg gaagaacttg     51180
     tatccgtgga atgagccgca ggttgccaca tatagccctt tggaggcggg gtgaggagag     51240
     ataataaagt cggcagaagt ggtaaaagcg tccctgggga tcattagacc tgaaattctt     51300
     tcgaaggtca caattaaaag gagtacaaac cagcaaattc ggtgcttcgt catcttccat     51360
     tcagcgctct taggcccata ccacaagttt cttgactcga caatatcttg cttcagaggt     51420
     ccgggaacct tccattggtt gtaatcatcc gtgggaggag gagaggagat gtggcggcct     51480
     ggtagaacct cgcgagtgtt tgtaaaaatc ttggaacccc accatttcaa ctctccatcc     51540
     ttagtcggag gaatggtgcc aatgaagggc ttgcctgaga tattcttagt tggttcacag     51600
     gcatgttccg aatgatggca acttaccctc ttccggtgta tagccttgga aaccaacagg     51660
     catatccttg aaccgttcat actgctcctt gtcaagctgt gccattcctg tcgtgatacc     51720
     agcggccaag atacgatcac cggctcttag acctccgttg ccgctcttcg cagcgctcca     51780
     ttccaacagg gtgggagtga acgctccggc agcaattacg acccgtgaag ccgatagaac     51840
     atctccatct ctcgtcctga cgccaatgca agagccgcga ccatcaaatt ccaaagtcgc     51900
     aatatcagcc ttgacatact tgactcccag atctaagcac tttttggtca ctgctcgaag     51960
     ggcgtctcca gcagcagccc agccactggc ccgattgatg agaacctctt tgaccccagt     52020
     ataatccgca ttgtcaaaaa ttccgttata tagctttcga gcttcggcga ccggaagggc     52080
     aatgatatcg tcgttgcggc caagcttctt gtgattggtg atgacgtttt gcgcatagtc     52140
     gctgcgacat gtccaataga cacccgtctg atgaaagtat ggttgccaaa gtggatcgga     52200
     cttgaagatt tcctgcgctt cgagagctaa tttgcaatat gtcatgtcat cgtagtctgc     52260
     acgaacgact ttgttccaat cccatgaggc ggccacacga gactcggcat cgtatgcatc     52320
     tcggtccacc aaagttacgg tcgcattggg gtatttctga atcaggtggt aggcggtcga     52380
     tacaccgaac actccggcgc cgacaattaa atatgacgtg ttgttcgggg ccataatcta     52440
     gaagccgtgg cccaaaagtc tgtgttttga tctgttcgag gttttcgcgt cactcgatgg     52500
     agcggcgacg ttctagaata aggaaatgag gaggaggtaa ataaagttgt aagccgtcgc     52560
     ccaccagaac agctccaaga acttatattt gcaactctca gttggcaagt gggccgccta     52620
     ttaatctgac agccagaagt taacttgatt agaatttctc ttttgcgagt cgcctccgtt     52680
     ccgaaccgag ccatatagat gggcgcatag atctggcggt ctaccaggaa attttatcct     52740
     aatcgagtat cgaaattacg gataccaagc gttaggcgcg ctagttatcc attttgggta     52800
     tacgataagg tatctttccg ggtttcggta cagagcgaat ccaattgggc aagaagccgc     52860
     cccagcatcg gcacctcttc cgtgtagccc cggcctacac ttcaaatacc acactttata     52920
     gcaattaagg ctcaagatgg agcatgaata tcgttgccaa aacatctctt tgtctttgga     52980
     cgatattgtg cctttcttct acctcagtta acgcatatct ttatgttaac tgaactcgtc     53040
     aggtcccact ggttacggac ccgtcacata cagatgggcc accaagagtc aatcgggtgt     53100
     gcatgactcg atttgagcac gggtgactgc caacacatgg tgatcatctg tgattatgga     53160
     ttgcaggact ctctattgta tagtccgtca ctcatcatat gaatgataac actacaccgc     53220
     attcatgtct ttcccagctc caacaactcc aaactctagt ttctgcttat tgatctcttg     53280
     tttccataaa tggctgcatc agaaaatcat catacacgag ttcttccgct gttggtcgtt     53340
     cttccggaag ccatcgaaat attctgcgta agaattttag gaaagggact ttgtcctcgc     53400
     cggagagctg aagttcccta gcc                                             53423
//

If you have problems or comments...

PBIL Back to PBIL home page