(data stored in ACNUC8465 zone)

EMBL: AM270403

ID   AM270403; SV 1; linear; genomic DNA; STD; FUN; 46238 BP.
XX
AC   AM270403;
XX
DT   28-JAN-2007 (Rel. 90, Created)
DT   14-MAR-2015 (Rel. 124, Last updated, Version 5)
XX
DE   Aspergillus niger contig An18c0110, genomic contig
XX
KW   .
XX
OS   Aspergillus niger
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
XX
RN   [1]
RP   1-46238
RA   Pel H.J.;
RT   ;
RL   Submitted (01-MAY-2006) to the INSDC.
RL   Pel H.J., DSM, 624-0295, P.O. Box 1, 2600 MA Delft, THE NETHERLANDS.
XX
RN   [2]
RX   DOI; 10.1038/nbt1282.
RX   PUBMED; 17259976.
RA   Pel H.J., de Winde J.H., Archer D.B., Dyer P.S., Hofmann G., Schaap P.J.,
RA   Turner G., de Vries R.P., Albang R., Albermann K., Andersen M.R.,
RA   Bendtsen J.D., Benen J.A., van den Berg M., Breestraat S., Caddick M.X.,
RA   Contreras R., Cornell M., Coutinho P.M., Danchin E.G., Debets A.J.,
RA   Dekker P., van Dijck P.W., van Dijk A., Dijkhuizen L., Driessen A.J.,
RA   d'Enfert C., Geysens S., Goosen C., Groot G.S., de Groot P.W.,
RA   Guillemette T., Henrissat B., Herweijer M., van den Hombergh J.P.,
RA   van den Hondel C.A., van der Heijden R.T., van der Kaaij R.M., Klis F.M.,
RA   Kools H.J., Kubicek C.P., van Kuyk P.A., Lauber J., Lu X.,
RA   van der Maarel M.J., Meulenberg R., Menke H., Mortimer M.A., Nielsen J.,
RA   Oliver S.G., Olsthoorn M., Pal K., van Peij N.N., Ram A.F., Rinas U.,
RA   Roubos J.A., Sagt C.M., Schmoll M., Sun J., Ussery D., Varga J.,
RA   Vervecken W., van de Vondervoort P.J., Wedler H., Wosten H.A., Zeng A.P.,
RA   van Ooyen A.J., Visser J., Stam H.;
RT   "Genome sequencing and analysis of the versatile cell factory Aspergillus
RT   niger CBS 513.88";
RL   Nat. Biotechnol. 25(2):221-231(2007).
XX
DR   MD5; 76600caa23213c6847baa81af5ff7628.
DR   ENA-CON; AM270997.
DR   BioSample; SAMEA3283178.
DR   EnsemblGenomes-Tr; CADANGAT00013997.
DR   EnsemblGenomes-Tr; CADANGAT00013998.
DR   EnsemblGenomes-Tr; CADANGAT00013999.
DR   EnsemblGenomes-Tr; CADANGAT00014000.
DR   EnsemblGenomes-Tr; CADANGAT00014001.
DR   EnsemblGenomes-Tr; CADANGAT00014002.
DR   EnsemblGenomes-Tr; CADANGAT00014003.
DR   EnsemblGenomes-Tr; CADANGAT00014004.
DR   EnsemblGenomes-Tr; CADANGAT00014005.
DR   EnsemblGenomes-Tr; CADANGAT00014006.
DR   EnsemblGenomes-Tr; CADANGAT00014007.
DR   EnsemblGenomes-Tr; CADANGAT00014008.
DR   EnsemblGenomes-Tr; CADANGAT00014009.
DR   EnsemblGenomes-Tr; CADANGAT00014010.
DR   EnsemblGenomes-Tr; CADANGAT00014011.
DR   EnsemblGenomes-Tr; CADANGAT00014012.
DR   StrainInfo; 791018; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..46238
FT                   /organism="Aspergillus niger"
FT                   /strain="CBS 513.88"
FT                   /mol_type="genomic DNA"
FT                   /clone="An18c0110"
FT                   /db_xref="taxon:5061"
FT   CDS_pept        join(<1..42,202..1569)
FT                   /locus_tag="An18g03600"
FT                   /note="Function: ereB from E. coli inactivates erythromycin
FT                   and oleandomycin."
FT                   /note="Function: the enzyme of E. coli confers resistance
FT                   to erythromycin through inactivation by hydrolyzing the
FT                   lactone ring of the antibiotic."
FT                   /note="Remark: truncated ORF due to contig border."
FT                   /note="Title: similarity to erythromycin esterase type II
FT                   ereB - Escherichia coli [truncated ORF]"
FT                   /note="See PMID 3523438"
FT                   /note="See PMID 3541783"
FT                   /db_xref="GOA:A2RAL7"
FT                   /db_xref="InterPro:IPR007815"
FT                   /db_xref="InterPro:IPR014622"
FT                   /db_xref="UniProtKB/TrEMBL:A2RAL7"
FT                   /inference="profile:COGS:COG2312"
FT                   /inference="profile:PFAM:PF05139"
FT                   /protein_id="CAK43188.1"
FT                   /translation="FDRKSSVIVCFDRYFLSKRKKKIMSLQNLLSTAARPLPPIHDPNF
FT                   ASHFDSFANYRVVLLGDGSHGTSEFYAARAEITKRLIEHHGFTTVAVEADWPDAEAIDR
FT                   YVRQRPGPQAHLTNDKHEPFQRFPTWMWRNREMQDLVEWMRDHNANLPDHQKAGFYGLD
FT                   LYSMGASIRAVVDYLDRVDPEAGKLARRRYGCLQPWVDDPTAYGLASLRGLADCEKGVV
FT                   DMLRDLLRKRLQYAEEDPHDGEESHSSQQNAYLVRDAERYYKAMYYSSASSWTLRDTHM
FT                   VDTLRRILRHKPPGSKAVVWAHNSHCGDARYTGMGIRRNEVNIGQLCREQFGRDKVALI
FT                   GCGTHTGTVAAAHEWDEDMEIMKVKPSRPDSWEWLAHQTGIESFLLDLRPTKMSPEMRD
FT                   LMAAEDQRLERFIGVIYRPDTERMSHYSQADLQNQFDAYVWFDSTEAVKPLETVQPRTA
FT                   MGTEETYPFGL"
FT   mRNA            join(<1..42,202..>1569)
FT                   /locus_tag="An18g03600"
FT   exon            <1..42
FT                   /locus_tag="An18g03600"
FT                   /number=1
FT   intron          43..201
FT                   /locus_tag="An18g03600"
FT                   /number=1
FT   exon            202..1569
FT                   /locus_tag="An18g03600"
FT                   /number=2
FT   CDS_pept        join(1857..1904,1993..4269)
FT                   /locus_tag="An18g03610"
FT                   /note="Function: MUC1 of yeast is a cell surface flocculin
FT                   involved in pseudohyphal differentiation and invasive
FT                   growth in response to nitrogen starvation."
FT                   /note="Localization: MUC1 of yeast is thought to be an
FT                   integral membrane protein."
FT                   /note="Phenotype: deletion of MUC1 in yeast abolishes
FT                   pseudohyphal differentiation and invasive growth."
FT                   /note="Remark: MUC1 of yeast is a component of a signal
FT                   transduction pathway downstream of MEP2 regulating
FT                   pseudohyphal differentiation and invasive growth."
FT                   /note="Remark: MUC1 of yeast is also known as FLO11, STA4
FT                   and has a systematic name of YIR019C."
FT                   /note="Remark: there are no hints for any MUC1
FT                   1,4-alpha-glucosidase activity in the literature."
FT                   /note="Similarity: blast hits result from repetitive
FT                   stretches in the sequence."
FT                   /note="Title: similarity to mucin-like protein Muc1
FT                   -Saccharomyces cerevisiae"
FT                   /note="See PMID 9987114"
FT                   /note="See PMID 11152942"
FT                   /note="See PMID 8710886"
FT                   /note="See PMID 9383611"
FT                   /db_xref="UniProtKB/TrEMBL:A2RAL8"
FT                   /protein_id="CAK43189.1"
FT                   /translation="MAVRRSARLRSRQATEPEAPADPVVTDNNAPCDTNNHNNSENTSE
FT                   IDTTMARLGKQPERLPPVVEHEEPADAAKDVPVQRSRKKTKTETASKRRSKVEAKEPVA
FT                   EVTPVIAESQSNTDTTEPAVAETEKKPTPKAVPEPAVAETEKNPTPKALPETASKLSTP
FT                   KKSIPTLKGTPVHRNTPVHRSTPVHKSTPTRTPSSTLVRPSHQEMHPSKVRQSTTKQAD
FT                   SGLILGFKPIKKDAEGKVIKDTLADNTPTKAKASPAPYYGTPAFEFKFSCESQLSDEAK
FT                   KLMETVREDAAKIKAQMTLEPDQNRAEAADRKIVQPKGKASRFSDVHMAEFKKMDSIAG
FT                   HASAFRATPGRFQPVVKTLKRTNSKARLDESDRNSPSPSKIARPSPAIVAPASNKRVKH
FT                   DKADDASTRRPTAASPPKPVQPRPRSTVRSSLMTPTRSSAARASSVTARPPRTSMIPSL
FT                   VRSPAAKPADVPRTPQTEFNPRLKSNLPTLGNLKSILRRHQPLFSKDPSKIAAGTHVAA
FT                   PDFTSNLLFGSRGTTEEPAQTPSPKKRVEFTPSVKARHEEVMFSPSPSKVPVASPSRTT
FT                   SDVVYPTLPVLTPEQNRVSAKSPAQATTPTIRHVRPSDVHANPLPEVAGVPHGIGHKKR
FT                   TRESGEDTKTNDLPEVAGVPHGIGQKKRNRAALEDETDTENVPPVDLTADARSAKRMKM
FT                   TSPSPLKAPTLSARKVAAPSPTKAATPSPTKPRSHTPLRSATTSRMSTPGISTPASVRA
FT                   RNRGVLSVSRLNMLAQPKNRG"
FT   mRNA            join(<1857..1904,1993..>4269)
FT                   /locus_tag="An18g03610"
FT   exon            1857..1904
FT                   /locus_tag="An18g03610"
FT                   /number=1
FT   intron          1905..1992
FT                   /locus_tag="An18g03610"
FT                   /number=1
FT   exon            1993..4269
FT                   /locus_tag="An18g03610"
FT                   /number=2
FT   CDS_pept        join(5233..5431,5810..7662)
FT                   /locus_tag="An18g03620"
FT                   /note="Similarity: shows only partial similarity to N.
FT                   crassa protein."
FT                   /note="Title: weak similarity to mediator of mating-type
FT                   associated vegetative incompatibility tol - Neurospora
FT                   crassa"
FT                   /db_xref="GOA:A2RAL9"
FT                   /db_xref="InterPro:IPR010730"
FT                   /db_xref="UniProtKB/TrEMBL:A2RAL9"
FT                   /inference="similar to AA sequence:UniProtKB:NCB13H18.14"
FT                   /protein_id="CAK43190.1"
FT                   /translation="MDENEGVSQPVVDDEVKSCPLCSCLEWVELCSHDEPRPRLISQRI
FT                   EPSAMIDVRYTLFHQQCAQCDEGNESSTKRTQLQQPMVDWSTVRTWLGKCDKEHDGKLG
FT                   FPCDNGPLETPPLEFRVIDTERGCVVGAPPGCRYATLSYVWGSTTDTYALATTNTIQAL
FT                   EEEGYLFKIPLPATIRDSIRACIELKIRYLWIDRLCIVQDDNITVKDSQINAMGNIYSH
FT                   SYLTLVDLEGRSMDHGLPGVTQERTLEYQTHGMKLGVLEHGIFTLITYAKWGTRGWTFQ
FT                   EALLSTRVLLLADTGVLFECSRASQEVTSSGVSRPLDLMFNLAQDYRSLVSDFTSRTLT
FT                   FDADVLKAFSGIMHWKYGSEHYFGVPYCEFVKGMLWNLDTIHKHKVLVARSAETGDIFP
FT                   TWSWSSMMGPARLDSKTDIHTLLGVWGIPSFEAKELVHIIRPHNSELSWDEAEDGGMVR
FT                   GLGIVLAWKEGCFPEPSPLMLNVNTTWEDYKTVIRSRWASVDKLNEEALGVANIRGKED
FT                   FERIFPSSYVEHADQPGALLAHTQSLRARMVQRGDTKIKPHKWPPHIHASLHSLGDEKV
FT                   DVWIQSNPAHWQFLGHDYSKDHDTKLDVLALSMNHEYSKYEFLGRGEQGQWYDSEGTGL
FT                   FERDYDIFVVNVLLVETRNGLSRRVAIGQVELHDWISASPEFRNFTLV"
FT   mRNA            join(<5233..5431,5810..>7662)
FT                   /locus_tag="An18g03620"
FT   exon            5233..5431
FT                   /locus_tag="An18g03620"
FT                   /number=1
FT   intron          5432..5809
FT                   /locus_tag="An18g03620"
FT                   /number=1
FT   exon            5810..7662
FT                   /locus_tag="An18g03620"
FT                   /number=2
FT   exon            complement(9237..10496)
FT                   /locus_tag="An18g03630"
FT                   /number=1
FT   CDS_pept        complement(9237..10496)
FT                   /locus_tag="An18g03630"
FT                   /note="Similarity: shows weak similarity to GntP family
FT                   permeases, a family of integral membrane permeases that are
FT                   involved in gluconate uptake."
FT                   /note="Title: similarity to hypothetical protein encoded by
FT                   An07g02000 - Aspergillus niger"
FT                   /db_xref="GOA:A2RAM0"
FT                   /db_xref="UniProtKB/TrEMBL:A2RAM0"
FT                   /protein_id="CAK43191.1"
FT                   /translation="MITGPTASPGNGVVGPYSGDSLALRIVIATMAALSWYNAIELVIL
FT                   VFVTFSQYRGPYFWSLLISALGLIPYSVGFLLKYFALTSATALSITFITIGWYAMVTGQ
FT                   SVVLYSRLHLVLPNPKVLRRVLTMIIVNAFLLHIPTSVLTYGSNLSSHPAIFIDGYSIM
FT                   EKIQMTGFCLQEFILSVLYIWETIRMLRLDPDRGKRKIMYQLVAINLIIIALDLALLVI
FT                   EYRDLYILETMIKGVIYSIKLKLEFAVLGKLVLLVRSAHNLTWKPDSPLYAATAAVTVP
FT                   PPIPCRNGDIVHDNFNNDFPDFVDATRVPSDLNHAAAGAAPRRRPPPRMDSEELSIAMF
FT                   EHSESGGAGTGNILRSGVGRDRSLDRDHGHSLDLPPSGHSNGSQSWSGETQTNNSATER
FT                   ELSPLDFTKSFGKQDSRSSF"
FT   mRNA            complement(<9237..>10496)
FT                   /locus_tag="An18g03630"
FT   CDS_pept        complement(join(11681..12021,12057..12087))
FT                   /locus_tag="An18g03640"
FT                   /note="Similarity: shows similarity to aminoterminal part
FT                   of viral proteins, putatively belongs to transposable
FT                   elements, viral and plasmid proteins in the funcat."
FT                   /note="Title: weak similarity to polymerase-associated
FT                   nucleocapsid phosphoprotein - Parainfluenza virus type 1"
FT                   /db_xref="GOA:A2RAM1"
FT                   /db_xref="UniProtKB/TrEMBL:A2RAM1"
FT                   /protein_id="CAK43192.1"
FT                   /translation="MAPIPLSTVDITNSIFCPADLKDVIQHLFEIQSAVHGYLGPETQQ
FT                   ELVRKMYPPSYPCHLPHLRFHSTNGLRVMHSERTSPSRSPPSAHTPPIITPTHNHNHQE
FT                   TATTLPSTASNSPPRLSTT"
FT   mRNA            complement(join(<11681..12021,12057..>12087))
FT                   /locus_tag="An18g03640"
FT   exon            complement(11681..12021)
FT                   /locus_tag="An18g03640"
FT                   /number=1
FT   intron          complement(12022..12056)
FT                   /locus_tag="An18g03640"
FT                   /number=1
FT   exon            complement(12057..12087)
FT                   /locus_tag="An18g03640"
FT                   /number=2
FT   CDS_pept        complement(join(14081..14143,14195..14222,14469..14581))
FT                   /locus_tag="An18g03650"
FT                   /note="Remark: this region might be destroyed by a
FT                   transposable element because it only shows parts of
FT                   similarities."
FT                   /note="Similarity: shows similarity to different proteins
FT                   of various species, but is much shorter."
FT                   /note="Title: weak similarity to hypothetical protein
FT                   CG6066 - Drosophila melanogaster"
FT                   /db_xref="GOA:A2RAM2"
FT                   /db_xref="UniProtKB/TrEMBL:A2RAM2"
FT                   /protein_id="CAK43193.1"
FT                   /translation="MQIEIYPRSTRQHTNRQTKNGISAKRRRDTRPNSPQRSSTASKMM
FT                   NIESKAMPGRWRLGIPKICSVT"
FT   mRNA            complement(join(<14081..14143,14195..14222,14469..>14581))
FT                   /locus_tag="An18g03650"
FT   exon            complement(14081..14143)
FT                   /locus_tag="An18g03650"
FT                   /number=1
FT   intron          complement(14144..14194)
FT                   /locus_tag="An18g03650"
FT                   /number=1
FT   exon            complement(14195..14222)
FT                   /locus_tag="An18g03650"
FT                   /number=2
FT   intron          complement(14223..14468)
FT                   /locus_tag="An18g03650"
FT                   /number=2
FT   exon            complement(14469..14581)
FT                   /locus_tag="An18g03650"
FT                   /number=3
FT   CDS_pept        complement(join(14974..16983,17030..17127,17174..18056))
FT                   /locus_tag="An18g03660"
FT                   /EC_number="2.7.1.-"
FT                   /note="Function: Prk1 protein kinase of S. cerevisiae
FT                   regulates the actin cytoskeleton organization by modulating
FT                   the activities of some actin cytoskeleton-related proteins
FT                   such as Pan1p/End3p."
FT                   /note="Similarity: shows higher similarity to probable
FT                   serine threonine-protein kinase of S. pombe."
FT                   /note="Title: similarity to ser/thr protein kinase Prk1
FT                   -Saccharomyces cerevisiae"
FT                   /note="cytoplasm"
FT                   /note="See PMID 9885245"
FT                   /note="See PMID 10087264"
FT                   /db_xref="GOA:A2RAM3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A2RAM3"
FT                   /inference="profile:COGS:COG0515"
FT                   /inference="profile:PFAM:PF00069"
FT                   /inference="similar to AA sequence:PIR:S50889"
FT                   /protein_id="CAK43194.1"
FT                   /translation="MSYQSQAAPHLPIPVYNPMAAINAPAGTFLPGTKVQVGSHRVVVE
FT                   KYLSEGGFAHVYVVRLPQPVDGSDRAVLKRVAVPDKAALANMRTEVETMKKLKGHRHIV
FT                   TYIDSHASQLQGGGYEVFLLMEFCAGGGLIDFMNTRLQNRLTEPEIIRIFSDVAEGVAC
FT                   MHYLKPPLLHRDLKVENVLISRHGSSTLYKLCDFGSTAPPRPAATSAAEGRLIEDDVQR
FT                   HTTLQYRSPEMIDVYRKQPIDEKSDIWALGVLLYKLCYYTTPFEEVGQMAILNASYKFP
FT                   SYPPFSDRLKMLIAWMLKEHPQKRPNIYEVVREICHMQGKDVPIRDIYANRSTSEARRY
FT                   QELPPSPTETPQVGAVFSPPMQETQIIPEIAPMRRGRPTRPTPSQHNSAKPSPSPFRGS
FT                   GDPFSVLDAGNRQRDSADEFSNRFPSLDQFQILHEKGGKFDFEPTVSEKTEDEDLAQRL
FT                   TNALADDAFAKRPAAENDPLPKTSSEPTIQRRPQPAPIKTKSSEVIETYREESRPQVPL
FT                   YQPVPQKPTMVSTGTMTSPPATPGVPNSKPASRPIYKFPSSDHQRRPSSQPWPAEADKK
FT                   AARQSKAPSPTSSSFPNPRVSNDRVSDLSASPRPSLDGLRPTNLDVEEPVGRSRSANSR
FT                   SRPVSVHASARFELPRGSESARSSLDLPRSPYEGGAPLQHARTETDQLYDRNISSDVDY
FT                   LRAREEESSRKREKRYSGTSKHTKRSSLSTLSLSGTKTLFAGRFGDAFRRFEHSNQESK
FT                   AQSPVAEEFPKPVLPSPEVTAEPASELIEMDSEDISPEMRRELERRRLSQEEKRVAKAA
FT                   EEYRRRVAEGGAGGFKGGDGSRSQAIQSKVQSLLSESNRPPVPPKTATGYGRYTDESSA
FT                   ALQAKPTEARPDTRGSRVSGTTTSSMQERYESRGLPRQETASTGYAASQRTGSSRPALP
FT                   PKPKGLRVGGIETRTESQPASPTVSSPATAGDDWEANFSRRFPSLSGLEMETEIEMARV
FT                   PLRTREV"
FT   mRNA            complement(join(<14974..16983,17030..17127,17174..>18056))
FT                   /locus_tag="An18g03660"
FT   exon            complement(14974..16983)
FT                   /locus_tag="An18g03660"
FT                   /number=1
FT   intron          complement(16984..17029)
FT                   /locus_tag="An18g03660"
FT                   /number=1
FT   exon            complement(17030..17127)
FT                   /locus_tag="An18g03660"
FT                   /number=2
FT   intron          complement(17128..17173)
FT                   /locus_tag="An18g03660"
FT                   /number=2
FT   exon            complement(17174..18056)
FT                   /locus_tag="An18g03660"
FT                   /number=3
FT   CDS_pept        join(19889..20562,20601..21929,22158..22245)
FT                   /locus_tag="An18g03670"
FT                   /note="Function: Caldesmon is a smooth muscle and nonmuscle
FT                   regulatory protein that interacts with actin,
FT                   myosin,tropomyosin, and calmodulin."
FT                   /note="Similarity: blast hits and predicted protein contain
FT                   long stretches of repetitive sequences and similarity is
FT                   restricted to these sequences."
FT                   /note="Title: similarity to calmodulin- and actin-binding
FT                   protein h-caldesmon - Gallus gallus"
FT                   /note="See PMID 2760048"
FT                   /db_xref="GOA:A2RAM4"
FT                   /db_xref="UniProtKB/TrEMBL:A2RAM4"
FT                   /inference="profile:COGS:COG3468"
FT                   /protein_id="CAK43195.1"
FT                   /translation="MDEGPPPPPPPHGEKPQTTQGEYRKTSDLPPGNYDIFIIPPHSAG
FT                   SGFLYLPSLQPQRNSFIAGSACTLFVVLLWTLLSPLLKAWYAATVASGSGMAIAVLAIG
FT                   VGVAGWAVGASQSDSGGGRRRANFGFSTGGGPGAGGPSGNGAGGEYARGQQYGAQNQGP
FT                   NGHNGGQGQGQGQQQYGGNFNSGPPPGAGQYGGNHQYQNTGGPGSGPPPQPPPQAGGSN
FT                   KTGGADWEKAREETRRKEELRRKMEEFKRKREAEQREKQQKREREAMERELRERREQLE
FT                   KEMAAAKEAAAREARERAEREAAEAKAKAEREAAEARAKAEREAAEARAKAEREAAEAK
FT                   AKAEKEAREAREREARRAKEAREREARRAAEAKARAEREAAEAKAKAEREAAEAKAKAE
FT                   KEEEERKAAAKKEADAKFAALKEAAAKKYAEKKAKDAQEAAAKEAASQKASSTSTPRTP
FT                   SPKKPAYSRTDTDSSYSNFRPTDRPRRPYGGATSGSSVYSDSSYAPSQTTARTTPPPSN
FT                   RGAYETKDPDKIVIKGVFEFNNNFVRSPVAQLVSGQGMVSDGLVLRITTEGLFIDDDVR
FT                   GVGQREWDVKAWTMNLVEVWCPKFGAQRQPPKPPPGPFNRRGNEPTPEESEAFLGNLLK
FT                   MCKNTCRLSTGGGEDQRTLHVLRASVRDHEGKRNSGVSPKPTSPECGVPIHIHLYTHHV
FT                   DK"
FT   mRNA            join(<19889..20562,20601..21929,22158..>22245)
FT                   /locus_tag="An18g03670"
FT   exon            19889..20562
FT                   /locus_tag="An18g03670"
FT                   /number=1
FT   intron          20563..20600
FT                   /locus_tag="An18g03670"
FT                   /number=1
FT   exon            20601..21929
FT                   /locus_tag="An18g03670"
FT                   /number=2
FT   intron          21930..22157
FT                   /locus_tag="An18g03670"
FT                   /number=2
FT   exon            22158..22245
FT                   /locus_tag="An18g03670"
FT                   /number=3
FT   CDS_pept        join(22549..22669,22702..22817)
FT                   /locus_tag="An18g03680"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2RAM5"
FT                   /db_xref="UniProtKB/TrEMBL:A2RAM5"
FT                   /protein_id="CAK43196.1"
FT                   /translation="MSLWTISLVTQILCLALVTAFVALRGVVAWRFKKGVDVEDDIIKM
FT                   ALANAGVKLGFCFVSLVYYTTYPNHTISIYTEL"
FT   mRNA            join(<22549..22669,22702..>22817)
FT                   /locus_tag="An18g03680"
FT   exon            22549..22669
FT                   /locus_tag="An18g03680"
FT                   /number=1
FT   sig_peptide     22549..22635
FT                   /locus_tag="An18g03680"
FT                   /inference="protein motif:SignalP:2.0"
FT   mat_peptide     join(22636..22669,22702..22814)
FT                   /locus_tag="An18g03680"
FT                   /product="hypothetical protein"
FT   intron          22670..22701
FT                   /locus_tag="An18g03680"
FT                   /number=1
FT   exon            22702..22817
FT                   /locus_tag="An18g03680"
FT                   /number=2
FT   CDS_pept        join(23166..23617,23682..23995,24045..24172)
FT                   /locus_tag="An18g03690"
FT                   /note="Similarity: shows only similarity at the
FT                   aminoterminus."
FT                   /note="Similarity: shows weak similarity to a keratin
FT                   domain that is common in avian keratin proteins, found in
FT                   feathers, scale and claw."
FT                   /note="Title: weak similarity to integral membrane protein
FT                   PTH11 - Magnaporthe grisea"
FT                   /note="See PMID 10521529"
FT                   /db_xref="GOA:A2RAM6"
FT                   /db_xref="UniProtKB/TrEMBL:A2RAM6"
FT                   /protein_id="CAK43197.1"
FT                   /translation="MVLLAKLTLLTILARLFILRRGQILTVYLTIIITTLYYIIIFFIK
FT                   IFICNPVSTFWTSPNDPHNPNCLSEGAVFLADAIMSVITDLAILLLPIGLMFPLRLAVV
FT                   KKVKVGAMLGCGGLAVGFSIYRVVLVVGEGEGGLGDSRVYARVLLSGNAEGGFGLICSC
FT                   IPALHILLSRVKGKMRKGSTSTRKGSSSTASGDGSGGKKRDQGTSSTSGGTAAPIVITS
FT                   SPEDVLHDPGGLLASLDVDVYDHVYDHDEEEGRVDYLRLKVTTQLLGSSYIHPIPTHQS
FT                   SQVYNASGIRQHTINQ"
FT   mRNA            join(<23166..23617,23682..23995,24045..>24172)
FT                   /locus_tag="An18g03690"
FT   exon            23166..23617
FT                   /locus_tag="An18g03690"
FT                   /number=1
FT   intron          23618..23681
FT                   /locus_tag="An18g03690"
FT                   /number=1
FT   exon            23682..23995
FT                   /locus_tag="An18g03690"
FT                   /number=2
FT   intron          23996..24044
FT                   /locus_tag="An18g03690"
FT                   /number=2
FT   exon            24045..24172
FT                   /locus_tag="An18g03690"
FT                   /number=3
FT   CDS_pept        complement(join(24339..24588,24641..25802,25862..26063))
FT                   /locus_tag="An18g03700"
FT                   /note="Function: P58, expressed as a histidine fusion
FT                   protein in Escherichia coli, blocked both the
FT                   autophosphorylation of PKR and phosphorylation of the alpha
FT                   subunit of eIF-2."
FT                   /note="Similarity: PKR inhibitor is a member of the
FT                   tetratricopeptide repeat family of proteins, the only
FT                   member identified thus far with a known biochemical
FT                   function."
FT                   /note="Similarity: predicted protein shows higher
FT                   similarity to other TPR and DNAJ domain containing proteins
FT                   and is clearly a member of this family."
FT                   /note="Title: similarity to inhibitor of the
FT                   interferon-induced double-stranded RNA-activated protein
FT                   kinase (PKR) p58 - Bos primigenius taurus"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A2RAM7"
FT                   /inference="profile:COGS:COG0457"
FT                   /inference="profile:PFAM:PF00226"
FT                   /protein_id="CAK43198.1"
FT                   /translation="MDVDTNDPRLGSPSATNGVNGTHTEKSPTPPPHRSNGNTAEADSF
FT                   KLAGNKFFKDGNYARAIEEFTKALEISPNSSVYLSNRAAAYMAANQYLAALEDCERACE
FT                   LDPTNTKIMYRLARILTSLGRPTEALDVLSRIEPPASATDRAAAEKMLRFVSQAEEALS
FT                   QDRGVSMVLFCLDQARQLLGQGVKEPRKWTLMTAEAQLKMGNDNSYGKAQDIAISMLRV
FT                   NSQDPDALMIRARAFYGMGDTEQALKLLKMCLGLDPDMKAAIKLLRTVQKLVRTKEEGN
FT                   TAFKAKDYRRAIDLWGEALTVDPKNKDQNAKILQNRAQAYINLKEYDSAVADCNEALRL
FT                   DPGYLKAQKMRAKAHGGAGNWEEAVRDYKAVAESNPTEKGIQEEIRRAEFELKKAQRKD
FT                   YYKILGVSKDAGEQEIKKAYRKMAIQYHPDKNRDGDAGDEKFKEIGEAYETLSDPQKRA
FT                   AYDNGDDLMDPADMFSHGGFGGMGGMGGMGGMGGMGGMGGMGGTHINIDPSVLFNMMNG
FT                   GGGFAHAGGQRGGFPGGFPF"
FT   mRNA            complement(join(<24339..24588,24641..25802,25862..>26063))
FT                   /locus_tag="An18g03700"
FT   exon            complement(24339..24588)
FT                   /locus_tag="An18g03700"
FT                   /number=1
FT   intron          complement(24589..24640)
FT                   /locus_tag="An18g03700"
FT                   /number=1
FT   exon            complement(24641..25802)
FT                   /locus_tag="An18g03700"
FT                   /number=2
FT   intron          complement(25803..25861)
FT                   /locus_tag="An18g03700"
FT                   /number=2
FT   exon            complement(25862..26063)
FT                   /locus_tag="An18g03700"
FT                   /number=3
FT   CDS_pept        complement(join(27639..27961,28015..28391,28443..28468,
FT                   28509..28639,28671..28746,28793..28946,29118..30939,
FT                   30991..31194,31259..31388))
FT                   /locus_tag="An18g03710"
FT                   /note="Function: the conventional myosin motor proteins
FT                   that drive mammalian skeletal and cardiac muscle
FT                   contraction include eight sarcomeric myosin heavy chain
FT                   (MyHC) isoforms."
FT                   /note="Similarity: shows partial similarity to myosin heavy
FT                   chain of several species."
FT                   /note="Title: similarity to secreted polypeptide #102 from
FT                   patent WO2003025142-A2 - Homo sapiens"
FT                   /db_xref="GOA:A2RAM8"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2RAM8"
FT                   /protein_id="CAK43199.1"
FT                   /translation="MEGGARPSSVFPRNQDQVLKRAELHFVTEQTARHERSWEGKVDKP
FT                   ACPNFNAIWAYATPNMRRLYIDCVKYVETKGWHCMYADYECSLKALYEEYYARTDQRAA
FT                   EMTSCVDFADFKVFVDSIDSESNFPQNAVSKEESGDNDVVPDLMLVDQAGREPETEMEA
FT                   APSDVDVPMTDPAEQSLECGIKDADSQEIIALENAVAKGADVLKELHAVFAGSTAFGTE
FT                   TDRKAEIERIQKYACTEKVIIGVVGSTGAGKSSLINAVLDEKAVLSTDCMRASTAVATE
FT                   ISYNYRSTKYRAEIEFIKHIEWERELEVLFAELQDHQEEVTRGAIPKNSDAAVALDKIQ
FT                   AVYPTMTADNILNTSAADLMANRRVTDLLGTTKAFEGSDPRAFSMKLKSYIDSKGKRGR
FT                   SKKSARSQDAAEHPDSASDTDTANQGIGLWPLVRVVRIYTKAPALATGAVLVDLPGIFD
FT                   SNAARVAVAEDYMRRCSAHWIVAPINRAVDDKVARDLLGKNYKLQMQMDCAFNDMTFIC
FT                   TKTDDIVPTEVIQSLGLDLPAFNEVQQLPARVELMMGEIDALEEAKKKISTQLDLIETE
FT                   IEDLEERLNDEFGCDVLEITPKRKKPHGHEPSETPTVHEASATELSEVDKLKNQFLKLK
FT                   VERKALRSQRKHINQQMENKEAELQKLEDGKKEMEHAVLSSCIEARNRFSKCQIKRGFA
FT                   LEIQSLDQEIADDDSENPVQAPVCKEDSSRRFLTQLNELFQSMTLWYSVRSAADVSEQR
FT                   VKELEAGFECALDALDEDMGAHKNRFNRTVRDIFQQNILNKLTNGTGGASRHAILQFPE
FT                   AVSRWNEGLRWNTYKAICRRRGVYRTTPIQDWNRDLARPMFDKIAAAWRRYIYDRKSLN
FT                   ESNVNRTFNELLPHAMRTMTDDLEVVLGRFHKKAIDSVEQDVSDETKKRLQSTLVACQQ
FT                   SMRQRFWEMRKSTTLEQKRISRAFAEAIAERLEDTYRACASETGLGSWKRSRALMQQVA
FT                   DDHAKEVLRGSTEHAKHELEELLDSQEAEVDQIIQSRLRRISRDYHGALIAPQIQLCTE
FT                   EQARIKREVAKIVERAEAELQLGHLLGGVRSS"
FT   mRNA            complement(join(<27639..27961,28015..28391,28443..28468,
FT                   28509..28639,28671..28746,28793..28946,29118..30939,
FT                   30991..31194,31259..>31388))
FT                   /locus_tag="An18g03710"
FT   exon            complement(27639..27961)
FT                   /locus_tag="An18g03710"
FT                   /number=1
FT   intron          complement(27962..28014)
FT                   /locus_tag="An18g03710"
FT                   /number=1
FT   exon            complement(28015..28391)
FT                   /locus_tag="An18g03710"
FT                   /number=2
FT   intron          complement(28392..28442)
FT                   /locus_tag="An18g03710"
FT                   /number=2
FT   exon            complement(28443..28468)
FT                   /locus_tag="An18g03710"
FT                   /number=3
FT   intron          complement(28469..28508)
FT                   /locus_tag="An18g03710"
FT                   /number=3
FT   exon            complement(28509..28639)
FT                   /locus_tag="An18g03710"
FT                   /number=4
FT   intron          complement(28640..28670)
FT                   /locus_tag="An18g03710"
FT                   /number=4
FT   exon            complement(28671..28746)
FT                   /locus_tag="An18g03710"
FT                   /number=5
FT   intron          complement(28747..28792)
FT                   /locus_tag="An18g03710"
FT                   /number=5
FT   exon            complement(28793..28946)
FT                   /locus_tag="An18g03710"
FT                   /number=6
FT   intron          complement(28947..29117)
FT                   /locus_tag="An18g03710"
FT                   /number=6
FT   exon            complement(29118..30939)
FT                   /locus_tag="An18g03710"
FT                   /number=7
FT   intron          complement(30940..30990)
FT                   /locus_tag="An18g03710"
FT                   /number=7
FT   exon            complement(30991..31194)
FT                   /locus_tag="An18g03710"
FT                   /number=8
FT   intron          complement(31195..31258)
FT                   /locus_tag="An18g03710"
FT                   /number=8
FT   exon            complement(31259..31388)
FT                   /locus_tag="An18g03710"
FT                   /number=9
FT   exon            complement(32198..33022)
FT                   /locus_tag="An18g03720"
FT                   /number=1
FT   CDS_pept        complement(32198..33022)
FT                   /locus_tag="An18g03720"
FT                   /product="hypothetical protein"
FT                   /note="Similarity: blast hits result from repetitive
FT                   sequences."
FT                   /db_xref="GOA:A2RAM9"
FT                   /db_xref="UniProtKB/TrEMBL:A2RAM9"
FT                   /protein_id="CAK43200.1"
FT                   /translation="MDLSSLEGPPIADTRFTVSPRRANVPSIRLDTSTPVSPISPLTPH
FT                   DLPPRPSSTDAIFSPVSESEYSYALFQQEPEANLNLWQRCHSPQPPVTADEHEYQQQPR
FT                   PQPTLNLPPPPPSSSFSLHPWSSRTRSVSDLTPHQSPIPMLSTTTTTTVTTQAVTTTIT
FT                   TEGNRLVWLEKEKLWFLKPSPCPSPHLSPDYAVTTRPTPDAHYAPYRPSSFHGQVHLAA
FT                   LAQRRDVPPPYGRHILDRPLPPLPTDDSENEGSCGSRWTEVARRRANRAVSR"
FT   mRNA            complement(<32198..>33022)
FT                   /locus_tag="An18g03720"
FT   CDS_pept        complement(join(35041..35146,35205..35791))
FT                   /locus_tag="An18g03730"
FT                   /note="Similarity: blast hits mainly result from repetitive
FT                   sequences."
FT                   /note="Title: weak similarity to hypothetical protein
FT                   CG2779 - Drosophila melanogaster"
FT                   /db_xref="GOA:A2RAN0"
FT                   /db_xref="UniProtKB/TrEMBL:A2RAN0"
FT                   /protein_id="CAK43201.1"
FT                   /translation="MRFSVATVALFASLVAAIPQDVETVYSTEDVTVVSCAPTVTNCPG
FT                   TLHATSTPEAVAAATTSGAEGVSPVGVTSAVPEAPSATPAAGSSPAGGAGAGVVPSGGA
FT                   PSGAAPSGAAVPSGAAAVGGGAGTTAAPQVTVIPVTTCVPTVIMSTSTIGGGSGAGAYG
FT                   SGYPSGKPAKSSSPVIPSGAAAYGSGYPSGSATPSPSSALYTGAASSVNGNGFAFAGAA
FT                   AAAAFFLA"
FT   mRNA            complement(join(<35041..35146,35205..>35791))
FT                   /locus_tag="An18g03730"
FT   exon            complement(35041..35146)
FT                   /locus_tag="An18g03730"
FT                   /number=1
FT   mat_peptide     complement(join(35044..35146,35205..35740))
FT                   /locus_tag="An18g03730"
FT   intron          complement(35147..35204)
FT                   /locus_tag="An18g03730"
FT                   /number=1
FT   exon            complement(35205..35791)
FT                   /locus_tag="An18g03730"
FT                   /number=2
FT   sig_peptide     complement(35741..35791)
FT                   /locus_tag="An18g03730"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        join(42143..42880,42939..43230,43286..43655,43708..43807,
FT                   43838..43966)
FT                   /locus_tag="An18g03740"
FT                   /EC_number="2.7.1.-"
FT                   /note="Function: MKK2 is involved in a signal transduction
FT                   pathway that plays a role in yeast cell morphogenesis and
FT                   cell growth."
FT                   /note="Title: strong similarity to protein kinase of the
FT                   MAP kinase kinase 2 Mkk2 - Saccharomyces cerevisiae"
FT                   /note="See PMID 9443897"
FT                   /note="See PMID 9618441"
FT                   /db_xref="GOA:A2RAN1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A2RAN1"
FT                   /inference="profile:COGS:COG0515"
FT                   /inference="profile:PFAM:PF00069"
FT                   /inference="similar to AA sequence:PIR:S69045"
FT                   /protein_id="CAK43202.1"
FT                   /translation="MSSSPVPLLKPPVPGNRGNNNGSRPPKLTLGIPPSPNVRPVTGTG
FT                   VPVAAAAAAPAPAPAPPTEVPQLQRPAARPAPPQLRLKTPMGSSQNVQQVKSRPAPPPL
FT                   ATTGLNEPNGHSRSGSFTYLDGKASGPASASSSNYSALSFAMGLRQPHGSTPDPSSAIS
FT                   VYSDRESGVQMERDSSVNSLIPDLDKMSLEKGRPLDVDDLDDEAWLAASEQKKIVELGS
FT                   LGEGAGGAVTRCKLKEGKTVFALKIITTDPNPDVKKQIVRELNFNKDCASEHICRYYGA
FT                   FMDKSTGTISIAMEFCEGGSLDSIYKEVKKLGGRTGEKVLGKVAEGVLNGLTYLHSRKI
FT                   IHRDIKPSNILLCRNGQVKLCDFGVSGEFGTKGDANTFIGTSYYMAPERITGQSYTITS
FT                   DVWSLGVTLLEVAQHRFPFPADGTEMQPRAGLIDLLTYIVRQPIPKLKDEPDNGIRWSE
FT                   NFKYFIECCLEKEPPRRATPWRMLEHPWMLDMKNKKVNMANFIACMQQLDLGNHSCTFR
FT                   TKCSTSNTIAHNGLSFDAYKWLALG"
FT   mRNA            join(<42143..42880,42939..43230,43286..43655,43708..43807,
FT                   43838..>43966)
FT                   /locus_tag="An18g03740"
FT   exon            42143..42880
FT                   /locus_tag="An18g03740"
FT                   /number=1
FT   intron          42881..42938
FT                   /locus_tag="An18g03740"
FT                   /number=1
FT   exon            42939..43230
FT                   /locus_tag="An18g03740"
FT                   /number=2
FT   intron          43231..43285
FT                   /locus_tag="An18g03740"
FT                   /number=2
FT   exon            43286..43655
FT                   /locus_tag="An18g03740"
FT                   /number=3
FT   intron          43656..43707
FT                   /locus_tag="An18g03740"
FT                   /number=3
FT   exon            43708..43807
FT                   /locus_tag="An18g03740"
FT                   /number=4
FT   intron          43808..43837
FT                   /locus_tag="An18g03740"
FT                   /number=4
FT   exon            43838..43966
FT                   /locus_tag="An18g03740"
FT                   /number=5
FT   exon            complement(45443..>46237)
FT                   /locus_tag="An18g03750"
FT                   /number=1
FT   CDS_pept        complement(45443..>46237)
FT                   /locus_tag="An18g03750"
FT                   /note="Remark: truncated ORF due to contig border."
FT                   /note="Title: similarity to hypothetical protein 15E6.130
FT                   -Neurospora crassa [truncated ORF]"
FT                   /db_xref="GOA:A2RAN2"
FT                   /db_xref="InterPro:IPR013244"
FT                   /db_xref="UniProtKB/TrEMBL:A2RAN2"
FT                   /inference="similar to AA sequence:PIR:T48805"
FT                   /protein_id="CAK43203.1"
FT                   /translation="AISSALSSNDFGTAYSYILTRLTPPSLLPTSSPLTNPTSPKDDIT
FT                   WRAVYNAGRYRAPATSATPNNQTQITHLSQRMELLSLALVLAPSPEPLPEILGAWRRCD
FT                   EELAALRARESEEEDIWDTKADNLTSTTLPGGFGPTDSEQDAFETRQHQARRARAHASQ
FT                   NRLHHEEAPMGLFEVARGAALALQKNAFPLRSAAASAKTNTHDHDDHSVPSSSHLRSGS
FT                   SMSTDDQDGEGRVRKRDVVSNMVTDGLVSGIGWVLGAQPVNR"
FT   mRNA            complement(<45443..>46237)
FT                   /locus_tag="An18g03750"
XX
SQ   Sequence 46238 BP; 11217 A; 11671 C; 12158 G; 11192 T; 0 other;
     tttgacagaa agagttcagt tattgtatgc tttgataggt atgtatgcag tgaagtcatc        60
     atgagcggga ggtgatctca tcttaaccct aacaccattc ttatactgca gttctcgtac       120
     aacccgtatc ccagtcaact gcaaccatca tgggctaact acagtactat acataccgta       180
     ctggtataat ctatgttcaa gttcttatca aaaaggaaga agaagatcat gtccctccaa       240
     aatctcctct ccaccgccgc ccgtcccctc ccccccatcc acgaccccaa cttcgcctcc       300
     cacttcgaca gcttcgccaa ctaccgcgtc gtcctcctcg gcgacggcag ccacggcacc       360
     tctgaattct acgccgcccg cgccgagatc accaagcgcc taatcgagca ccacggcttc       420
     actaccgtcg ccgtcgaagc cgactggccc gatgccgaag ccatcgaccg ctacgtgcgc       480
     caacgccccg ggccccaagc ccacctcacc aatgacaagc acgagccttt ccagcgcttt       540
     ccaacctgga tgtggcgcaa tcgcgaaatg caagacctag tcgagtggat gcgtgaccac       600
     aatgccaacc tacccgatca tcaaaaggct ggattctacg gtcttgatct gtacagcatg       660
     ggcgcttcca tccgcgccgt cgtagattac ctcgaccgcg tggacccaga ggcaggaaag       720
     ctggcgcgtc gtcgctacgg ttgtttacaa ccgtgggtgg atgatccgac ggcatacggg       780
     ctcgcgtcgc tgcgcgggtt ggcagactgc gaaaaaggcg ttgtggacat gctgcgcgat       840
     ctgctgcgaa agcgactgca gtatgcggag gaggatccgc atgacggcga agagtcgcat       900
     agcagtcagc agaatgcata tttggtgcgt gacgcggaga gatactacaa ggctatgtat       960
     tatagctctg cgtcatcgtg gaccctgcgt gatacgcaca tggtggatac gctgcgacgc      1020
     attcttcgtc ataagccgcc aggcagtaag gccgtggtgt gggcgcataa ttcgcattgc      1080
     ggcgatgcgc gatacacggg catgggtatc cggcgcaatg aggtgaatat cgggcagttg      1140
     tgtcgggagc agttcggtcg ggataaggtt gctctgatcg gctgtgggac acataccggg      1200
     actgtggcgg ctgcgcatga gtgggatgag gatatggaga tcatgaaggt gaagccgtcg      1260
     agaccggata gttgggagtg gttggcgcat cagacgggca ttgagagctt cttgttggat      1320
     ttgaggccta cgaaaatgag tccggagatg agggacttga tggcggcgga ggatcagcgc      1380
     ttggaacgct tcatcggcgt catttatcgg cctgatactg agcgcatgtc acattactcg      1440
     caggctgatc tgcagaacca gttcgatgcg tatgtctggt ttgatagcac cgaggctgtt      1500
     aagccgttgg agacggtgca gccgcggacg gcgatgggga cggaagaaac gtacccattt      1560
     gggttgtaga gtagattgta atgtattggt agaatgtgta atgagcaaaa gtaaatagtg      1620
     ttttaaaata atgatgatgg acgtcgataa ctatagttaa tgaagggata atgcatagca      1680
     caacgcgctt agctaagccc tgacgtcagc tcaccgcctg cgggtgtttg tttattcttg      1740
     aatctcgcct tcgccctgca ttcatttaat tcataatcca tccccccaca caattccaat      1800
     tcttcgacat ctcgataccc aattccaacg tcacccgata tacattgacc accaccatgg      1860
     cggttcgacg gtccgcccgc ctgcgcagcc gccaggccac cgaggtgagc acaccacacc      1920
     atcccactca gcctccattc cgatgggctg ctcgcgccct tgcatgacat tcactgactc      1980
     gaccttaagg agcctgaggc ccctgccgac cccgtcgtca ctgacaacaa cgccccctgc      2040
     gacacgaaca atcacaacaa ctccgagaac acgtccgaaa tcgatacaac catggctcgt      2100
     ctcggcaaac agccggagag attgcctccc gtcgtggagc acgaggagcc agctgatgct      2160
     gctaaggatg tccccgtgca gcggtcgcgg aagaagacca agaccgagac cgcgtctaag      2220
     agaaggtcca aggttgaagc taaagagcct gttgctgagg tgactccggt gatcgctgag      2280
     tctcagtcca acacggatac gactgaacct gccgttgctg agacagaaaa gaagcctact      2340
     cccaaggctg tgcctgaacc tgctgttgct gagaccgaaa agaaccctac ccccaaggct      2400
     ctacctgaaa ctgcctccaa gctatcgact cctaagaaat ctatcccaac tctcaagggc      2460
     acacctgtcc acagaaacac gcccgtccac agaagcactc ccgtccacaa aagcacaccc      2520
     accagaaccc cctccagcac cctcgtgcgc ccgtcccacc aagaaatgca ccccagcaag      2580
     gtccgccaga gcaccaccaa gcaggcagac tccggtttga tcctgggctt caagcccatc      2640
     aagaaggacg ccgaaggcaa ggtgattaag gacactctcg ccgacaacac tcctaccaaa      2700
     gccaaggcct cacccgctcc ctattacggc acccccgcgt tcgaatttaa gttttcctgc      2760
     gaatcgcagc tcagtgacga ggccaagaag ctcatggaga ccgtgcgcga ggatgctgct      2820
     aagatcaaag cccagatgac cctggagccc gaccagaatc gcgctgaggc agcggaccgg      2880
     aagatcgtac agcccaaggg caaggccagt cgtttcagcg acgtgcacat ggccgaattc      2940
     aagaagatgg actccattgc tggtcatgcg tcggctttcc gtgccacccc aggacgcttc      3000
     cagccagtgg tcaagacgct caagagaacc aactccaagg cgcgtttgga cgaatcggac      3060
     cgcaactcgc catcgccatc caagattgca cgtccttcac ctgccattgt tgcccctgct      3120
     agcaacaaac gcgtcaagca tgacaaggcc gatgatgcat cgacgcgtcg tcccactgca      3180
     gccagtcctc ctaagcctgt gcaaccccgg cccagatcta cagtgcgcag ctcgttgatg      3240
     accccgacgc ggtcctctgc ggcgcgtgct tcttccgtta ccgcaagacc gccccgcacc      3300
     tcgatgatcc catcgctcgt ccggtctcct gctgcgaagc cggccgatgt gccgcgcacg      3360
     cctcagacag agttcaaccc tcggctgaag agcaacttgc ccactttggg taacctgaag      3420
     tcgatcctcc gccgccacca gcctttgttc tccaaggatc cttctaagat tgccgcgggc      3480
     acccatgtgg ctgctcccga ctttacctcg aacctgctgt tcggatcgcg aggcaccacg      3540
     gaggagcctg cacagacgcc gtcccccaag aagcgcgtgg agttcactcc tagtgtcaag      3600
     gcccgccacg aggaggttat gttctcgccg tctccatcga aggttccggt tgccagtccc      3660
     tcgcggacca cttccgacgt tgtctatccc accctgccgg tgttgactcc ggagcagaac      3720
     agggtcagcg ccaagtctcc tgcccaagcg acaaccccga ccatccgcca tgtccgcccg      3780
     tcagatgtcc atgccaatcc cctgcctgag gttgcaggcg tgccgcacgg aatcggccac      3840
     aagaagagga cccgtgagag tggtgaagac accaagacta atgatctccc tgaggtcgcg      3900
     ggtgtgccgc acggcatcgg ccagaagaag agaaaccgtg ctgccctcga ggatgagaca      3960
     gacacggaga atgtgccgcc tgtcgacttg accgcggacg cgcgcagtgc taagcgaatg      4020
     aagatgacct cgccctctcc gctcaaggcg cccactctga gtgctcgcaa agttgcagcc      4080
     cctagcccaa ccaaagctgc gactcccagt cccaccaagc ctcgctcgca tactcctcta      4140
     cggtcggcca cgaccagccg catgagcact ccgggcatca gcactccggc cagtgtgcgt      4200
     gcacgcaacc ggggtgtgct gagcgtcagc cgcttgaaca tgctggcgca gccgaagaac      4260
     cgtggctgat taaatgagac taacattgat tgcatttttg agcgttggac gcatggtact      4320
     tactgcgaca tttcttgttg atgcttcttt tctttggcgg ctgccgtgta tttagtgctc      4380
     cggattggtg tctgtgggac tttgattctt gtgaaattgt aggcgctggg atgcatccga      4440
     tatgcaaggc gttcatgatt tgattgtttg ctgaataaag agattgagac tgtattatat      4500
     tcaatttggt aaccagttag ttgatcaacc atacgatgat gtatgcgata acactagttc      4560
     agcagcttgt tcttgtgttg atacgcggga gtagatttaa aaggaagttt gtgataacgt      4620
     tgcgtgcatt tgaggcactt ggggagcaac gtataacata catcgcatag atgatacaaa      4680
     gttactgaca cattccacgc ctgatggggt gggagttatt ttaggaaggc agcttatctg      4740
     acagatgaaa caggtgatcc aatggaatgc accttcctct ttcctcttgt ctcttcctcc      4800
     atcattgtca gagacctcca catcttcttc cctttcgatg tgcgtgtcag atacgttgac      4860
     cagcaagcca ccactatatt atcgagcacc tttggagatc tttcagctca tctatgatgc      4920
     ttacgttcga gtcgacgatt cgttcagcac taagcacgca agtgcctcac catgtgatat      4980
     gattagttcg atcacccgcg cagacgccta agaggtgggg ttccatgcat tgagcagatc      5040
     cctatctttc agctctgcca actcagcaga gagggctctt attgaagaat tggaacaaac      5100
     ctccacccca gcctcctgaa aaccgactac tacgcttgct ctgcttgtca cagcttgttg      5160
     cattttaaat ctttggggtg atccttcctc tccggaactt tcctatacga gctacctcgt      5220
     cgaagggtca tcatggacga gaatgagggt gtgagccagc ctgttgtgga tgatgaggtc      5280
     aaatcgtgtc ccttgtgttc gtgtcttgaa tgggttgaac tatgttcaca cgatgagccc      5340
     cgtcctcgtt taatcagtca gagaattgag ccttcagcta tgatagatgt tcgatatacc      5400
     ctcttccacc agcaatgcgc tcagtgcgat ggtatgccct atgcttcgct ctgtgaattt      5460
     tgcaagcatc ttaggccgtg gcacatcgca catgaaagga tgtttgtcaa ccccatgttt      5520
     aggctaaact ttgggagcgt tcaggtcata ctgcagcggt ctggagattg tgaattttgt      5580
     cgcattatta cccaacttat gggccttgaa ggagacaacc tagattcatt ttgtttcctg      5640
     gatattattt acaggaattc atacaaggat cttgacttta tcatgggaat ctgcgtcaag      5700
     agtttgtata ataattttat cacgaatttg agcgtaggct aatcatgatt gtaaggctac      5760
     tcaacatctg catatcgcat ttttggtggg aactttattt cttcccaaga gggtaatgaa      5820
     agttctacca aacgaacaca attgcagcag cctatggtgg actggagcac agttcgtacc      5880
     tggttgggga agtgtgacaa agagcatgac ggaaagcttg gatttccgtg tgacaatgga      5940
     cctctagaaa caccgcccct tgaatttcga gttattgaca ccgaaagagg atgcgtagta      6000
     ggggctcctc ctggctgcag atatgctacc ctgagctacg tgtggggtag cactaccgac      6060
     acatatgcat tggcaacaac aaacaccatt caagcactgg aagaagaagg ctacctcttc      6120
     aaaattcctt taccggccac cattagggac agtatccgtg catgcattga attgaagata      6180
     cggtacctct ggatcgacag actttgtatt gtgcaagatg acaacatcac cgtgaaagac      6240
     tcacagatta atgccatggg taatatctac agccattctt atcttacatt agtggattta      6300
     gaaggccgca gtatggatca cggtcttccc ggggttacgc aagaaagaac attagaatat      6360
     cagacacatg gaatgaaact gggcgtccta gagcatggca tctttacgct tatcacatat      6420
     gcaaaatggg gaacccgggg ctggacgttt caggaggcac tgctatcaac aagagtgttg      6480
     ttgcttgcag atacaggggt attatttgag tgctcacggg cttctcagga agtcacaagc      6540
     tctggagtgt cgaggccact ggatttaatg ttcaatttag cccaggatta caggagccta      6600
     gtgagtgact ttacttctag gactcttact tttgatgccg atgttcttaa ggcattctct      6660
     ggcattatgc attggaaata tgggtctgag cattattttg gtgtaccata ctgtgaattt      6720
     gtgaagggta tgctctggaa tctcgacacg atccataaac acaaggtact agtggcgagg      6780
     agtgcagaaa caggtgatat atttccgacc tggtcatggt cttctatgat ggggcctgct      6840
     cggttggatt caaagacaga tatccataca ttactgggtg tgtggggcat cccatctttc      6900
     gaggccaagg aactggtgca cataattcgg cctcataact cagaactgtc atgggacgaa      6960
     gccgaggacg gcggcatggt tcgaggactt ggtattgtat tggcgtggaa agaaggttgc      7020
     ttcccagagc catcaccgct catgctgaat gtcaacacga cttgggaaga ttataagacc      7080
     gtcatcaggt ccagatgggc atcagttgat aagcttaacg aagaagcact tggggtagca      7140
     aatattcggg gaaaggaaga tttcgaaagg atatttccct catcatacgt ggaacatgcc      7200
     gatcagccag gagcattgct ggcacataca cagtcactcc gtgctcggat ggtccagcgg      7260
     ggagacacaa agatcaaacc ccataaatgg ccaccgcata tacatgcaag tttgcacagc      7320
     ttgggtgatg aaaaggttga cgtgtggata cagtctaacc ctgcccattg gcaattcctc      7380
     ggccatgatt acagcaagga tcacgatacc aaactggatg tgcttgctct gtcgatgaat      7440
     catgaatatt ccaaatatga atttctaggt cgaggcgaac aaggtcaatg gtatgattcg      7500
     gagggaactg gcctctttga acgtgactat gacatctttg tggtcaacgt attgcttgtc      7560
     gaaactcgaa atggactcag tcgacgagtg gctataggtc aagtcgagct tcatgactgg      7620
     atttctgcgt cacccgaatt tcggaatttt actctggttt agaatgtttg gagaggtaga      7680
     ttttcagcga atgagctagg tacgagctgg actatctgct ctcatacaat gaattgcatg      7740
     gctgtttctt agacaaatag taggatcgtt accatttatt ctcaagttta tcctgggaga      7800
     tgttagatct acaacgtaag atattttcta tcatcttgtt tcctgcattc ccatgtcatt      7860
     accaagggac tacgatgtcc aacttctgtc gaggcataag aatctgccac tgcttagaag      7920
     cctatggttt cccatctaat tatggggttt caaacacatg tatgcgtaat gggaatacct      7980
     caattctacc gtcccacaac ccttcaagcg gatctgcttt tttgggtgca caatgctcat      8040
     agcatcatat gtaaaagcac actatctgat aaaacagcct gactaccttc aagcagaact      8100
     tgactgaaat gagcataagt gatacaatct catgtatttc gttgtactcc atagcaccac      8160
     catcactatc attacgatcc acctctgacc caacccacct tcacttttaa tctttgatga      8220
     atgatccctc accatccaaa atagcacctc ccactcctta acattactca ccccatattc      8280
     caagcatcaa ctcaaccttg aaataccaag gtgatctgat ctatacctca atccaaccag      8340
     aactccattg acttatataa gttcttccaa tgtgtgctca catacacaaa ccatgaatat      8400
     ccatcacatg gtttataaca tccaatctat ttgggaatat catcatactc tcatacccaa      8460
     atcccatcca gtacccaact cacacaaaga aacaaaccct aaacccaaac ctaaaaccac      8520
     tgaagtaaga acctactccc aacatccacc tccacctcca cctagactac tcacccagaa      8580
     aatgtcggtg aacgccaacc aaactcaacc aacccaagcc taaacaggta aagtgggaca      8640
     agaaaacaaa tcactgatta tcattcatgg agaaatgagg ggtagacaaa accactcact      8700
     cactcactca ctagtttaac tagtatgtac taagtactac tttactccgt gttggccagt      8760
     gagatgatcg atcatcgctc ggaattttat gatttatttg attggtgggg agaaatgact      8820
     cactcacctt agttactatt tcttaacgaa ctgtgggatt ttcgtgccgg gttgccggtt      8880
     tgctttccct gatttacaga gttcatagta cgtagtatgc attttaccga gatttgaaag      8940
     ttttgtttta tttaatttga ttagatttgt attcagctat gtttaaaata tactcaagaa      9000
     ggaagaatga tatattaacg ccgtcccatg gatcgatccc acccacggca aagtaaaaaa      9060
     gtaaagataa tcaaaagtgg gtatcgtatc gggtatctcc gcaaaggcaa ccaaaccaca      9120
     acaacaacca ctacacaatg ttcgtagtca gtagtagtgt tgtcagtact gtacaagaaa      9180
     aatcaatcat cagttcatca aaccataatc atcaaaatca tcatcgtcat agcagcttag      9240
     aaactactcc tactatcctg cttcccgaac gacttggtaa agtccaacgg acttaattcc      9300
     cgctccgtgg cggagttatt cgtttgcgtc tccccactcc acgactgtga gccatttgaa      9360
     tgtcccgatg gcgggagatc caaactatgg ccatgatctc ggtctaaact tcggtctcga      9420
     ccgaccccac tgcgtaaaat gttgcccgtc cccgcaccac cgctctcgga gtgctcgaac      9480
     atggcgatgg agagttcttc cgagtccatg cggggagggg gccgtcgacg gggtgcggcg      9540
     ccggccgcgg cgtggttgag atcagagggg acgcgagtgg catcgacgaa gtcggggaag      9600
     tcattgttga aattatcgtg aacaatgtcg ccattccggc atgggattgg cggcgggacc      9660
     gtgacagccg cggtggccgc atagagcggc gaatcaggtt tccaggtgag gttgtgggcg      9720
     ctgcggacga gcaggacgag tttaccgagg acggcgaatt cgagtttgag cttgatgctg      9780
     tagatgacac ccttgatcat ggtttcgagg atgtagaggt cgcggtattc gatgacgagg      9840
     agggccaagt ccagagcgat gatgatcaga ttgatggcga cgagctggta catgattttg      9900
     cgttttccgc ggtcgggatc gagacggagc atgcggatgg tttcccagat gtagaggaca      9960
     gagaggatga attcttgcag gcagaagccg gtcatttgga tcttttccat gatgctgtag     10020
     ccgtcgatga atatggctgg gtgggaggag aggttggagc cgtaggtcag gacggaggtg     10080
     gggatatgca gaaggaaggc gttcacgata atcatggtga ggacgcggcg gaggactttg     10140
     gggttaggga ggacgaggtg cagtcgcgag tagagcacga cggattggcc ggttaccatg     10200
     gcgtaccagc cgatggtgat gaaggtgatg gagagggctg tggcggaggt gagggcgaag     10260
     tatttgagga ggaagccgac ggagtaggga atcaggccga gagcggagat gagcagggac     10320
     cagaagtagg gaccgcgata ttgggagaag gtcacgaaaa cgaggatgac cagttcaatg     10380
     gcgttatacc aggatagagc ggccatggta gcgatgacga tgcgcagggc caggctgtcg     10440
     cctgagtagg gcccaaccac gccattgccg ggggaggcgg tagggccggt gatcatgatg     10500
     ccattgcaga gaagacgata taagatggga aggaagtaaa agaggaagag aagagaagag     10560
     aagagaagag agaaagagga agtagagaaa gaggaagaag aggagagaga ggaagcgaga     10620
     ctaagcgagt aagaggaagg ctagacgagt gagcgactaa caagaggaag aggcagacag     10680
     agacagcagc agcagcagag gccgatgcag gatccggggc aggcgggcaa ttacccgaca     10740
     tgtaatgaat caagaatcat gacaggtcgt cgggctcaga tccttgccgt ctggggacac     10800
     tgaaaggcag tcagtgcccg gctgacgggc gggggccggc gtgacgcggt gcattgttat     10860
     ttgcagttgc ccttcgcctg gtttattggg cggggagact gttcactctg ttgtcattat     10920
     tattgttcag ctgagcgttt atctgttagt tagttaatgt tgtgttatgt taaactctga     10980
     gatactccgt cctgaggtgg atcctaactc tggtggatga tctcccacat agggttatgt     11040
     tatgcctgct atacctgctc tcctcccctt ccatatgaga tcatatagga gaagaataaa     11100
     ggagaaaaac agtccttgca tccccacgtg catcccatta tttttatttc gatcattcat     11160
     tcagttttat ttttatccct ctgctcctgg tctgaagagt taataataac tccagggggc     11220
     agcagcagca gccactgcca cacacaaggc tgaacttgct tgctgacctg agtttcagtc     11280
     tagtcggcat tggattccga tcatcacatt ccttccatca tccatcatca caaatcactc     11340
     atcataatta ttaacccccc aaaataaagc aagcaaaaaa taactccact cccaaactcc     11400
     atcccaatat agttctatcc ctctattcga tcataaccat catcatgaac taaacatcat     11460
     cccctcccct ccccattatt attcccattt ccatcaccac cgaacgaagc aaccactcta     11520
     tccacctccc ccctaacctc cggcatcgct cccctcatct ccctcgctaa cacatcccgg     11580
     aaactcccaa acgcctcctt cttccccctc agatcctggt tcccgcgctg gatcaactcc     11640
     acgaattctc ttgtgtagat atccggattc cttgctgcat ctacgtagtc gataatctcg     11700
     ggggggagtt ggatgctgtg gatgggaggg tcgttgctgt ttcctggtga ttgtgattgt     11760
     gcgtcggggt gattatcgga ggtgtgtgtg ctgagggtgg agagcgcgag ggtgaggttc     11820
     tttctgaatg cataacacgt aatccgttag tagagtggaa tcttaggtga ggaagatggc     11880
     agggatagga aggagggtac attttgcgga cgagctcttg ttgagtttcg ggaccgaggt     11940
     agccgtgaac ggcggattgg atttcgaaga ggtgttggat tacgtctttg aggtcggctg     12000
     ggcagaagat agagttagta actgatcaca ttaaattaga gaaaataaat acacactgtc     12060
     gaccgtgctg agggggatgg gagccatgat gtgctgctct gaaacgtgaa gcttgaagct     12120
     gaggcggatt cttgttggat gatgacgaga gcaaagaaga gtcgagtccg gggtagacta     12180
     accgttttgg gtaatacgat gctaacatgg ttttgatttc ctacggatcc cgccgcttta     12240
     tgattatggc acctgagcac ctccgggcca cacactcgtt gctcgcagag catgcactac     12300
     attttgctct gctttggatg gtcgcgtccc taactctgcc aaatggagct gttactagat     12360
     atctttgggt actaagccga tcaggctgat tctgtacgtg acatgtagag ccctacgtag     12420
     catttacaac aacgtaagaa cacgatacag ttctctggtc caaccttcta ttatcctgat     12480
     actgatccag tatggcaaat gtcggattat tatgagcaca tgcccctctt tgtcgatggc     12540
     atgatgaagt atatgggacg agatgaattc agaaattcct gtccccattg gataaggatc     12600
     gcgagccagc gcgacagcca cgggtgagtc catgcatcag ctggtcgtga cacagcaggc     12660
     cagcgcctcc ctccgacccg acccgaggga catggtcgtc cgtgcagtct gaatagtcgt     12720
     caaggtattc actgagaagg tttactaggc aatacggcgt ttgttgagcg agcatacgta     12780
     ccgtgaaagg tgtccatgtg aaacttcctt agttcaatag aggataaacg ggttaaaaga     12840
     aagcatgctg gcagtcacaa gttcctagac gtcatcttct tatgtgcagc cacctttttg     12900
     agtatccata ttctattgtt gtcacgtgtt tgctactaag cctgatcaat gtcttattac     12960
     aattgcttat gccgattgtc gagttgtgac tgactgtatt tatgaagaac ccagaaaata     13020
     gcaatataga agattttaac aactatttca tccaccaatg ggcctcggat atctgtacat     13080
     aagttgacca ggtagagtag aaggatggaa gacaacgaac gcgagccaaa cgtcatctcg     13140
     tctcaccgtg gacatctaca ttcattatgg atggtcctgg cctccaaaac acccatagct     13200
     tgtttaaaaa ggtaactatg ctataataat tgacatgcac atcttgccat ccactcataa     13260
     aaccataatc agtcgaatta gtggatatag aagattgatg ctgtgagatg actagagaat     13320
     gtagactgac agtttctgaa tatgaatagg atatatgtgg gcgacccctt ccacccgaga     13380
     gagagaactg gagaatatag gctaacatta taaatttgga tagattgtat gtgtttgacc     13440
     ccttcttacc tgaaagataa ctctagatta taggctgaca gtgataggat tacatagtgt     13500
     gatggtatga atgtgagtga ccagttctgt ctgagagatg acttgagcat atctttcgta     13560
     cagataaaat ttagtaaaca ttttaccgga tttgctagat actgcagtat tgccaaaccc     13620
     ttattcttgt aagatctctg aattacatta tgcttgttgt ccactaataa acttttacaa     13680
     gaatgtccga attattatac tgctcgatcc cttgggggca tgccatggat aattcggcat     13740
     caagcctgaa tagggctctt tagacgcctt ggtttaggtt tttcctattg aattaagatt     13800
     ccctatactg ttatgcaaat gcaaaggctt tttttatatg aaatatcatt ctatattatt     13860
     tctgagtagt ctttcaatgc taggttatac ggatttattg atatgtcttt cccgattatc     13920
     gcttttgttt gagagactgt ttgaacccgt tcaaacttcc tctaatttga tctcatttct     13980
     ggcagtacac aactttcgac atatgataag atagggagac caattcaata cgtagtgtac     14040
     taaacgatcc gtgttgcaac caactttact cttcttattc tcatgtcacc gagcaaatct     14100
     tgggaattcc aagtctccag cgaccaggca tggctttgga ttcctaaaca ccgagtacta     14160
     gtaaatggta aacttcgcct actatgagac gtactatgtt catcatcttc gacgcggtcg     14220
     agctgaagtt tcaagcagcc ataagcactg aagtctctgg actaaccgga aaatcagttc     14280
     agtgatcacg cctagctctt atatgtgact tgtgcggtcg accttacgcg agttatatgg     14340
     aagtcgactg gatataccga ccacccccct ccacggtgga atttctatgc taatccgctg     14400
     ggctgtacag tatattcgaa cctataagat gcgagtgatc tatatagggc tgcagtaatg     14460
     gctcatacct tcgttgagga ctgttgggac gcgtatctct ccgtcgcttg gctgatatac     14520
     cgtttttggt ctggcggtta gtgtgttgac gagtacttct agggtagatt tctatctgca     14580
     tattgatttt gaattagtga actggaatgg tactctttat aatggaatat tctataagtc     14640
     taaacgaata cccaagggac ctttctttga gcaaccgtgg gcgttgcggc caagtctgat     14700
     tacgtccgga ttgcagcaca cgcaccgacg cgctcatgcc ttgatcccag ctgaccctaa     14760
     gcgaaaagcg gcgctacctt aagacctatt ttggaaatgg aaagtcgaca gcgttccgca     14820
     gaaatcctgt ttagtaaaag gtatacttcg ttattatact cgatatagtt catagaaact     14880
     atgattcaat gcaatgctcg ctcgctgata caagtctacc tatgtatacc agataccgct     14940
     ctatctatat tcaaccctca catctgcact cagctatact tcgcgcgtcc gcagcggcac     15000
     ccgcgccatc tcgatctccg tctccatctc taaccccgac aggcttggga atcgccggct     15060
     aaagttggct tcccagtcat cgcctgccgt cgccggcgag ctcaccgtcg gactagcggg     15120
     ttggctctcc gtccgcgtct cgataccccc cactcggagc cccttgggct tgggtggcag     15180
     agccggtcgg gacgacccgg tgcgctgaga ggcggcatag cccgtcgaag ccgtctcctg     15240
     tcgaggcagt ccgcgcgatt cgtaccgctc ctgcatcgat gacgttgtcg tgccgctgac     15300
     ccgcgatcct cgcgtgtccg gacgtgcctc cgtgggcttt gcctgcaaag cggcgcttga     15360
     ctcgtccgtg tatcgcccgt agcccgtcgc cgttttgggc ggaaccggtg gccggttcga     15420
     ctcgctcagc agcgactgca ccttgctctg gatcgcctgc gaccgggacc cgtcgccgcc     15480
     cttgaagcca cccgctccac cttcggccac ccgccggcgg tactcctctg ctgccttggc     15540
     tacgcgcttc tcctcctggg agagccgccg ccgctccagc tcccgccgca tctccggcga     15600
     aatgtcctcg ctgtccatct cgatcagttc gctggccggc tctgccgtca cctccggcga     15660
     aggcagtacg ggtttgggga actcttccgc cactggagac tgtgccttgc tttcttggtt     15720
     actatgttcg aaccgccgga acgcatcgcc gaatcgtccc gcaaatagcg tctttgtgcc     15780
     tgacagggac agcgtcgaca agctcgaccg tttcgtgtgc ttggacgtgc cgctataccg     15840
     cttctcgcgc ttccggctgc tctcctcttc gcgtgcgcgc agatagtcca catccgacga     15900
     gatgttgcgg tcgtacagct ggtctgtttc ggtgcgcgcg tgttgcagcg gtgcgccgcc     15960
     ttcataaggg ctgcgtggca ggtcaaggga ggagcgcgcg ctctccgacc cgcgaggcag     16020
     ctcaaaacgt gcgctagcat gaacagacac aggccgggag cggctgttgg ctgaccgaga     16080
     tcggcccacg ggctcctcca catccaaatt ggtaggtcgg agtccgtcaa gcgacggccg     16140
     tggcgaagca gacagatcgg agacgcggtc gttcgagact cgcgggttgg ggaaggacga     16200
     agaggtgggt gacggagctt tgctttgccg agctgctttt ttgtccgcct ctgccggcca     16260
     cggttggctg gatggccgac gctggtggtc gctggacggg aacttgtaga tgggccggct     16320
     ggctggcttg gagttcggca caccaggcgt cgccggcggg gaggtcatgg taccagtcga     16380
     gaccatggtg ggtttctgcg gcacaggctg gtacaaggga acctgaggcc gggactcctc     16440
     gcggtaagtc tcgatcacct cggacgactt ggtcttgatc ggtgccggct ggggacggcg     16500
     ctgaatggtc ggctccgaag atgtcttggg aagaggatcg ttctctgccg cggggcgttt     16560
     ggcgaacgca tcgtctgcca gagcattggt aagtcgttga gccagatctt cgtcttccgt     16620
     tttctcggac acggtgggct caaagtcgaa cttgccccct ttctcatgca ggatctggaa     16680
     ctgatccagc gacgggaacc ggttcgagaa ctcatccgcg gaatcccgct gtcggtttcc     16740
     agcatccaag acggaaaatg gatcgccaga tccacggaat ggtgacggac tcggcttggc     16800
     cgagttgtgc tgggacgggg ttggtctggt cgggcggccg cgtcgcatgg gggcaatctc     16860
     gggaatgatc tgcgtctctt gcattggggg agaaaagacg gcgcccacct gtggtgtttc     16920
     tgtgggggaa ggtggcagct cctggtaacg gcgggcttcc gacgtcgagc gattggcata     16980
     gatctatccg tgtgagtatc cgcactgcgt ctgcaggtac ctgacttacg tctcggatcg     17040
     gcacatcctt gccttgcatg tggcagatct cgcgcaccac ttcatagata ttcgggcgtt     17100
     tttgcgggtg ttctttcaac atccaggctg ggagagtcaa tacaatgcct ttctttcgcg     17160
     cagagggtct taccaatcag catctttaag cggtcggaga agggtgggta gctagggaat     17220
     ttgtagctgg cattcaaaat ggccatctgt cccacctcct caaacggagt cgtgtagtag     17280
     catagtttat ataggaggac tcccaaagcc cagatgtcgc tcttctcgtc aataggctgc     17340
     ttccgataga cgtcgatcat ctccggactg cgatactgca gcgtcgtatg gcgctgcacg     17400
     tcatcctcaa tcagccggcc ttcagccgcc gaagtggccg cggggcgcgg cggcgcagta     17460
     gacccaaagt cgcacagctt atagagcgtg gagcttccgt gacgggagat cagcacattc     17520
     tcgactttaa gatcccggtg caacagcgga ggcttgaggt agtgcatgca tgcgacaccc     17580
     tcggccacgt ccgagaagat cctgataatc tctggctcgg tcaaccggtt ctgcaagcgc     17640
     gtgttcatga agtcgatcag tccgccgccg gcgcagaatt ccatgaggag aaagacctcg     17700
     tatccgccgc cctgcagttg cgacgcatga gagtcaatgt aggtgacaat atggcggtgt     17760
     cccttgagct tcttcatcgt ttcgacctcc gtgcgcatgt tggccagggc cgccttgtcg     17820
     gggacggcca cgcgcttcag caccgcacga tcggagccat cgacaggttg aggcaggcgc     17880
     acgacgtaga cgtgggcgaa accaccttcg gagaggtatt tctcaaccac gacccggtgg     17940
     ctgcccacct ggaccttggt cccgggcaga aaagtaccgg cgggggcatt gatggcggcc     18000
     atggggttgt agacggggat cgggagatgc ggagccgcct gtgactggta ggacatggtg     18060
     gatgggacgg gccctcgagg ggcacgagag cgatggtcaa caaggacagg ctatagcggc     18120
     atcaaaggga aacgctgatt gcgcgagaga gtaagaaata gaggtcggct gaggctgaag     18180
     ccggggcagg acggagagaa ggacagttgg cggcggggaa gggggcggta cctgacaggg     18240
     ccaggggcaa gaaatgacgc caacaggggg gtgggagacg ggaggaagag gaggaagaga     18300
     aggaagaggg aatttctggt aaacaagtcg agaggatggg agacagcagc cagcagagcc     18360
     ggatgggatt agactgacca gcagcagcag caacgcagca ggcgtcagga ctggagactg     18420
     gagacttgaa tggattggat ggcgtcggcc ggcttccgtt aagcgtggag tcaccgcctg     18480
     gcagtaagtt tggtgcagca aaaggctgaa acaaggcgga tctcgaattt caggctgaca     18540
     gaagttgttt tactataaaa ctggggagag agaggcagaa gttttgaggc gtaagtatct     18600
     cccctctttc cctctccttt ctctccgcaa ctgacttaac gcatcccgtg atcgcttggt     18660
     gcctggagat cacggacgga catcatcgtg atcatcccgg ctgcaggcgg tcagaatccg     18720
     accatatgag tgactgcggt ggctacttta gctttactat ctaatacgac tggacggaga     18780
     tatattagtg ttcaagatga ctggcagtca tccgtgaggc catccgaccc ttttattgcc     18840
     tgaggcataa aacggagaag attcacacgt gataatcatt agtcatgaat tgaaccaacc     18900
     agcgagtgcg gagacgttga ccaatcagaa gactgccggt tccccacgcg atgctccaaa     18960
     acagcgaaac caaaacaaac acaaacactc aatatttagt gatcctgcag agatataagc     19020
     aaatcttgat cgctattatt gcaatcagcg gatacaacaa ggaatccatg gtagtctacc     19080
     cagtagataa ctctaagccc acccggccag ggttctaatt aaggttgtga gatcccagcc     19140
     gggttcgcgg cgggtgcttg tgctctatag acttccgctg gaatgtggac gtgccactgc     19200
     attcatcacg acattgtata gcaggctgca ccggagctca ttgggagtgc cgatagaatt     19260
     ccagtagccc tccagaatgt agtgtacagc tgaagccgat cccatcggaa tccccgtttg     19320
     acaagggatc gaatcagaaa ctgtcaatcg gtcgtgctca gcaactgaaa cccagccatt     19380
     gagtgatcat cgtttatccc gatttattgt caactattcc atctccttcc actgccacat     19440
     cagccaggtt acacacacag aatatcccac cgcttcagcg ggtgagcttt atagtatata     19500
     catagtatat ctcatttaac gctggtcgcc agggatccgt tagcgttgct gcgaggatca     19560
     cacaaacgga gtcgatcctg attaggcgtt cctcttgccg ccagccgatc tctcatccca     19620
     cgtcgcctgt cttctccgtc ttctttctcc tccctcgcaa tcatcgtgtc acctattatt     19680
     attgttccac caggtatgtg ctctcactga cgattgctga gctatctgac ctcctatctc     19740
     gatctagacg cgctggattc cagcgcctgc cttgtcgtct gatcatgtcg cctcgatcgc     19800
     aaatgcgcct ccactagcca tcaacaagcg atatatatat tatataaaca cctatcgaag     19860
     cctaatttat tcttaacgac cgcctaccat ggacgaggga cctcctccac cccctccccc     19920
     tcacggcgag aagccacaaa ccacccaggg cgaatatcgc aagacttccg acctccctcc     19980
     tggcaactac gacatcttta tcatcccccc tcactccgcc ggctccggat tcctctacct     20040
     cccttccctc cagccacaac gcaatagctt catcgcgggg tccgcctgca cactctttgt     20100
     tgtcctactt tggaccctcc tatcacccct tctaaaagcc tggtacgctg ccaccgtcgc     20160
     cagtggcagc ggcatggcca tcgccgtgct ggctatcgga gttggggtcg ccgggtgggc     20220
     cgtgggcgcc tcacaatcag attctggggg aggccgacga cgggccaatt ttggatttag     20280
     caccggcggg ggtccaggcg cgggtggacc ctccggcaat ggcgccggag gtgagtatgc     20340
     gcggggacag cagtatgggg cccaaaatca gggcccgaac ggtcacaatg gtggacaggg     20400
     acagggacag ggacagcagc aatatggggg caacttcaac tcgggtccgc ctccgggtgc     20460
     aggccagtat ggcgggaacc atcaatacca gaacactggt gggcccggaa gtggaccacc     20520
     cccgcaaccg ccgccgcagg caggcggatc aaataagaca gggttcgtct gccacccggc     20580
     tctgaaagca aacctcaaag tggagctgat tgggagaagg cccgtgaaga gacccggcgc     20640
     aaggaggagc tgcgccgcaa gatggaggag tttaagcgaa agcgggaagc cgagcagcgc     20700
     gagaagcagc agaagcgcga gcgcgaggcc atggagcggg agctgcggga gcgcagagag     20760
     cagctcgaga aggagatggc tgccgccaag gaggcggccg cccgtgaggc ccgagaacgg     20820
     gcggagcgcg aagcagccga agccaaagcc aaagcggagc gagaggccgc ggaagctcga     20880
     gccaaggcgg aacgagaagc agcggaagcg cgtgccaagg cggagcgtga agctgcggag     20940
     gccaaagcta aagcggagaa agaggcccga gaggcccgcg agcgagaagc acgtcgggca     21000
     aaagaagccc gagaacgaga ggcgcgacgc gccgccgaag ccaaggcccg tgctgagcgc     21060
     gaggccgcgg aggccaaggc taaagcagag cgtgaagctg ctgaggcaaa ggccaaggca     21120
     gagaaggagg aagaggagcg taaagctgca gctaagaagg aagctgatgc taagttcgcg     21180
     gcgctcaaag aggctgccgc gaagaagtat gccgagaaga aagccaaaga tgcgcaggag     21240
     gcagcggcca aagaagcggc cagccaaaag gcatctagca cgtccactcc ccgcactcca     21300
     tcacccaaga aacctgctta ttcccgcacc gataccgaca gctcatattc caattttcga     21360
     ccgactgacc gtccccgccg gccgtacggc ggcgccacct ctgggtcatc agtgtactcg     21420
     gactcttcat acgcgccgtc acagacaaca gcacgcacga ccccaccacc atcaaatcgc     21480
     ggggcctatg aaaccaaaga tcctgacaag attgtcatca agggcgtgtt cgagttcaac     21540
     aacaactttg tgcgcagccc tgtggcgcaa cttgtctcag gccagggcat ggtcagcgac     21600
     ggattggttc tgaggatcac gacagaaggc ctcttcatcg acgacgacgt gcgcggtgtc     21660
     ggtcagcggg aatgggatgt gaaggcgtgg acgatgaacc tcgttgaggt atggtgtccg     21720
     aaattcgggg cgcagcgcca accaccgaag cccccgccgg ggccattcaa tcggcgcggg     21780
     aatgaaccga ccccagagga atcggaagca ttcctcggca acctgctcaa gatgtgcaag     21840
     aacacgtgcc gattatcaac aggcggagga gaggatcagc gcacgctgca tgtgttgcgg     21900
     gcgtcggtgc gtgaccacga gggcaaacgg tatgtgtttg tgttgcagga gacggagggg     21960
     tggaaggtgg cgattggatt gcagcggttg cgacggggga cgttgtcgcg ggcattaggg     22020
     gtgatggggt tgggagtgaa tgagagtcgg atgatattat caggattagg atatgagtga     22080
     tgatacctta tgtatatacc agccagtcag tctttagcac ataattatca aactttccag     22140
     tttacttact agtatagtaa tagtggcgtt agccctaagc caacatcacc ggaatgtggc     22200
     gtccccatcc acatccatct atacactcac cacgtagata aataaaacta cacagatact     22260
     aaacaagata tattcaatac atcatcccaa ccccacagca aatgagtgca ggaaaatccc     22320
     ccttgggaat aaacctcccc agggtcatga cgtcggaacc aaacaactcc cttccccccg     22380
     cttaacccca acccaaccac caacgccaac atcaaaccca gacaaaacct gtcgcaacat     22440
     caccaccact cattcatccc atgattaagg caaatggcta cagctactgc agacaacaag     22500
     accaatatgg aatgatacca acaatacgaa ctcaggaagg acaggagaat gtccctctgg     22560
     acaatcagcc tcgtcacgca gatcctgtgc ctggcgctgg taacggcgtt tgtcgcgcta     22620
     cggggagttg tcgcgtggcg gttcaagaag ggggtggatg ttgaggatgg tatgtatcat     22680
     cataccttta aaccctctta gatataatta agatggcgtt ggctaatgcg ggtgttaaac     22740
     tagggttttg ttttgtatcg ctggtatact atactaccta ccctaaccat accatatcta     22800
     tctatactga gttatagaat gagagactga tataaagagg ggtagatatt cttcgacgca     22860
     tactgtatat tagttctttt ctgttcgcat attccccttc ccttatatta cttacatatt     22920
     atctcgacat actaatcaat gaattggaat aaatggatag acatcttcaa caacggcgcc     22980
     gaacccccct caaccctcac cacctcggaa gcgacactcg tctacaaggt gcgattcccc     23040
     tatccctcat acattagtat ttctatattc cacctgaaag ttgaagttat atatcccacc     23100
     tgaaagttac taaatgaact aaatgaaaat agatattcta caccctaaca atcctctacg     23160
     tccccatggt cctcctcgcc aaactaaccc tcctcaccat cctggcccgg ctcttcatcc     23220
     tgcgccgcgg ccaaatcctc accgtgtacc taaccatcat catcacaacg ctctactaca     23280
     tcatcatctt cttcatcaaa atcttcatct gcaaccccgt ctccacattc tggacctcgc     23340
     ccaacgaccc ccataaccct aattgtctat ccgaaggggc ggtatttctc gctgacgcga     23400
     tcatgagcgt catcacggac ttggctattt tgttgttgcc gattgggttg atgtttccac     23460
     tgcgattagc tgtggtgaag aaggtgaagg tgggggcgat gcttgggtgt ggcgggttag     23520
     ctgttgggtt tagtatttat cgggttgtgt tggtggtcgg ggagggggag ggcgggttgg     23580
     gtgatagtcg ggtatatgcg agggtgttgc tttctgggta aggttttttt gttttctttg     23640
     gggggtggtg atgtgggtga tatatgctga cttgtggata ggaatgcgga gggaggattc     23700
     gggttgattt gtagttgtat accggcgctg catatcctcc tctcgagggt gaaggggaag     23760
     atgaggaaag ggtcgacgag tacgaggaag ggatcttcgt cgactgcttc tggggatggg     23820
     agtgggggga agaagaggga tcaggggact tcgagtacta gtgggggtac tgctgcgcct     23880
     attgtcatta cgagttcgcc ggaggatgtt cttcatgatc ctggggggtt gcttgcttcg     23940
     cttgatgttg atgtgtatga tcatgtgtat gatcatgatg aagaggaggg acggggtgag     24000
     aagagtgaca atagggagga aggctagatg tacataaatt acagttgact acttaaggct     24060
     taaggttact actcagttat taggatcatc atacattcat cctatcccaa ctcatcagtc     24120
     atcccaggta tataacgcct ctggcatccg ccagcatact atcaatcaat aatcaataag     24180
     acactccgtc cacaacggat gaaggaaaga accaaaggaa aataagaaaa aaaaaaaaga     24240
     acagtctatc gcccagtctg tcatgcgggt gggaatcaga ggaaaggaaa atcgaacaag     24300
     aaaacagcag cagcaacact ttttagcatg cacgctgtct aaaagggaaa tccgccgggg     24360
     aatcctccgc gctgtcctcc tgcgtgcgca aatccgccgc cgccgttcat catgttgaac     24420
     agcacgctgg ggtcgatgtt gatatgggtt cctcccatac cgcccatacc acccattccg     24480
     cccattccgc ccataccgcc catgcctccc atgccgccga agccgccgtg cgagaacatg     24540
     tcagctgggt ccatcaggtc atcgccgttg tcgtaggcag cacgtttcct atgcttggtt     24600
     agcgaaagcc actcatcacc acatcaaagg atgaacttac tgaggatcac tcaaagtctc     24660
     gtacgcctca ccaatctcct tgaacttctc gtcacccgca tccccgtccc ggttcttgtc     24720
     cgggtggtac tggatcgcca tcttgcggta cgccttcttg atctcttgct cgcccgcgtc     24780
     cttggacact ccgaggatct tgtagtaatc cttgcgctgc gccttcttca gctcaaactc     24840
     ggcccgacgg atttcctctt ggatgccctt ctcggtcggg ttcgactccg ccaccgcctt     24900
     gtagtcgcgc acagcttctt cccaattgcc ggcaccgccg tgcgccttgg cgcgcatctt     24960
     ctgcgctttg aggtacccgg ggtccagccg cagggcctcg ttgcagtctg ccactgcact     25020
     gtcgtactcc ttcaggttga tgtaggcctg cgcccggttc tgcaggatct tggcgttctg     25080
     gtccttgttc ttcgggtcca ccgtcagcgc ctcaccccac aggtcgatgg cgcgacgata     25140
     gtccttggcc ttgaatgccg tgttaccctc ttccttggtg cgcaccagct tctgcacggt     25200
     ccgcagcagc ttgatcgccg ccttcatatc cggatccaga cccagacaca tcttcagcag     25260
     cttcagcgcc tgctccgtgt cacccatacc gtagaaggcc cgggcgcgga tcatcagcgc     25320
     atcagggtcc tggctgttca cgcggagcat gctaatagca atgtcctgtg ccttgccgta     25380
     cgagttgtcg ttgcccatct tcaactgggc ctctgcagtc atcagcgtcc acttgcgggg     25440
     ctccttgacg ccttgtccga ggagctgacg ggcctggtcg aggcagaaca gcaccattga     25500
     gacaccacgg tcctgcgaaa gagcctcctc cgcctggctg acgaagcgga gcatcttctc     25560
     tgcggccgca cggtcagtag cggaggccgg gggctcgata cgagacagca catcaagagc     25620
     ctccgtcgga cggcccaagc tggtcaggat acgggccaac cggtacatga tcttagtgtt     25680
     ggtggggtcg agctcgcagg cccgttcgca gtcctccaga gcagcgagat attggttggc     25740
     cgccatgtat gctgcagccc ggttggacag gtagacggac gagttggggc taatctcgag     25800
     agctgtacca ttgttactaa cactgcagaa gattgtccgg cagaatcagg tattaaccta     25860
     cccttggtaa attcctcaat ggcgcgggca tagttgccat ccttgaaaaa cttgtttcca     25920
     gccagcttga aggagtcggc ctccgcggtg tttccattgg accggtgagg gggcggggtc     25980
     ggactcttct ccgtgtgagt gccattcaca ccgttggtgg cagagggaga gccgaggcgg     26040
     ggatcgttgg tgtcaacgtc catcgagctc cggagatcat cgcgagcagc agccatagcg     26100
     gaaagacgac gtagttcgtc gggatgaagg ttaagcgggt gaaagttagg gtcgtgcgag     26160
     taccgatggt gaacggcaga cagcgacgac gcggaccggg ggacggacga gggtttcgac     26220
     cggaccgagg ctgatttaga gggagtggag gtggaacgac tgtgcgccgg ccgagtaggt     26280
     tttcgaggaa tggaagggcg ttgagtcgga gtaggaaacg actgcggatg gtgaagcgga     26340
     ggcgcaggag gagaatgggg gtggcgagag ggagccgaat gaacggtctt tgcccggtga     26400
     ggagggggcg gaggtcgagt cgggaatgag tcgtcggtct tgactcttgc ggatggacgt     26460
     gggggaggag gggaactcgc tgaaaatgaa gaagaataag gaggagggag aggagaggaa     26520
     ggaggaggag gagaagaaga agaagaagca ggaatcgagc gagtaggagg aggagcagga     26580
     gcaggaacag tcgtcggagt agatttagac ttggaagaag aggatttgga ggaagaagat     26640
     ttgtgacgag agaaaagatg cgggagcccc atcgccgctg ggctgacttg attggtggcg     26700
     ccgatcgaag ggcagcgaag gcggtggaat tttgttttct cttgcgttct ttcttcctcg     26760
     tcagatccgc tggttatccc tcacgtcgcg cgggtctgca ctggttaatt ttattatgct     26820
     tattagtcgt gtcggtggac agtccgtgtt atgttaaata tatcactggt tctgtcgcta     26880
     tctgtctctc tcgctctcgg tactgtcgta atcccgattt gtcgctgttc gtcctcagtc     26940
     tcaaaactca agcactcatc atgttcatgg cttgttcagt gcaacttccg gaaaagaata     27000
     ccagcgcgga gtagtatcaa cttttaatgt cacttcttca ctgttcgcgg attgaacaca     27060
     aagcacggca aataaatgtc actaaacaca ctcaagttaa aagtcaacac tcaacaacaa     27120
     cacagatgaa tgaaagtgat gtgaagaaaa agttcaacgg cgctggcctc catctgtcac     27180
     gctgctacta atattaatag tctccatccc agacggcctc ccagtcgctc gaaaattcgg     27240
     aggctgggtc accgaccatc actggctagc gtcttgcctt cgtcatgcga gttgccaaca     27300
     gcaacactac gcgctgccaa tgattcccct ccatcctacg cctctagtct gtcatggcgg     27360
     tcgcagtttg acaagctttt tctcttttta cgatgtggcc tagactatct tgacactgcg     27420
     gttggcttat cgctccgtcc accaccttct ctacccaaag ctggggccac ccgcatgctg     27480
     gtgcgtccag tccacgttta ccctaactgc agacgtgtaa cattgctttc ctttctcgct     27540
     acctctctgt tcttctcctg ctctcccgcc ttccatctgc atcgatcctg cctccccaca     27600
     gtgctccact ctcttaggtc acggctgctg ttcccctgtt acgacgaacg aacgcctccc     27660
     aaaagatgtc ccagttgcaa ctccgcctca gctctctcga caatcttcgc gacctccctt     27720
     ttaatccgag cctgctcttc cgtacacagc tggatttgtg gcgcgatcag cgctccatgg     27780
     taatcccgtg agatccgccg tagacgagac tggattatct gatccacctc agcttcctga     27840
     ctgtccagaa gctcctcgag ctcgtgcttc gcgtgctccg tactgcctcg gagaacttcc     27900
     ttggcgtgat cgtcggccac ctgttgcatc agtgccctac tgcgcttcca gcttcctagt     27960
     cctgtcgtga cgatcattta gaataattct tggccagcta ggatagagtc tcacccgtct     28020
     cggaggcaca cgcccggtag gtgtcttcaa gtcgctcagc gatcgcctcc gcaaaagctc     28080
     gactgatacg cttctgttcc agcgtggtcg actttctcat ctcccagaat cgctgacgca     28140
     tcgactgttg gcatgcgacg agggtgcttt gcaatctctt cttggtctca tcggaaacat     28200
     cttgctcgac ggaatcaatg gccttcttgt ggaatcgccc gagtacgact tccagatcat     28260
     ccgtcatagt acgcatcgca tgaggtagta gctcgttgaa agtcctgttc acgttagatt     28320
     cgttcaaact ctttcggtcg tagatgtacc ttctccaggc ggcagcgatc ttgtcaaaca     28380
     tgggtcgggc tctgtacgca attagacctg tcgttagcat tgctgcaaaa gcttccactc     28440
     acaggtctcg attccagtcc tggatcggct gtcagcttag tatattgagt ccgcatcaag     28500
     atacttaccg tagtacggta tactcctcgc cggcgacaga tggccttgta ggtattccat     28560
     cggagtccct cattccagcg cgaaacagct tcgggaaatt ggaggattgc gtggcgcgat     28620
     gctccgcctg tgccattagc tgtgttcaat aatacaatca aaagacgtac tgagcttgtt     28680
     caggatattc tgttggaaaa tgtccctgac agtccggtta aaccgattct tatgcgctcc     28740
     catatcctta aagggtcagt atcggttcaa gaagtacatt cgagagacat acttcatcta     28800
     gggcatccaa agcacattca aatccggcct caagttcctt caccctttgt tcagatacat     28860
     ctgcggccga cctcacagaa taccaaagcg tcatcgactg aaagagctcg ttcaattggg     28920
     tgaggaacct acgagacgaa tcttccctgg ccttctcagt gagttatata acatgccgct     28980
     gcagaagcgg aatttcggtc tcctctagct gggagaagcc accaacgagc tttgccatat     29040
     cagagcgtcc ccgaagactt tggtaggctc gggtcgacac gcaaaacaca ggtaggttcc     29100
     tctccagctc gtcatacttg caaactgggg cctgtactgg gttttcgctg tcatcgtcgg     29160
     caatttcctg gtccagactc tgaatctcca aggcaaagcc acgcttgatt tggcatttcg     29220
     aaaacctgtt ccttgcctct atgcaggaac ttaggacagc atgttccatt tctttctttc     29280
     cgtcttccag cttctgcagc tccgcctctt tgttctccat ttgctggttg atatgcttcc     29340
     gctgagaccg tagggcttta cgctcaacct tgagcttcaa gaattggttc ttaagcttgt     29400
     ccacctccga aagttccgtg gcgcttgcct cgtggactgt tggcgtctca gagggctcat     29460
     gtccgtgagg cttctttcgt tttggggtta tctccagtac atcacagccg aactcatcgt     29520
     tgagacgttc ttcaaggtct tcaatctcgg tctctatcaa gtccagctgc gtggagattt     29580
     tcttcttagc ttcttccagg gcgtcgattt cacccatcat caattcaacc ctggctggca     29640
     gctgttggac ctcattgaat gctggcaaat cgagacccaa agactggata acttcagtcg     29700
     ggacaatgtc gtcggtcttt gtgcaaatga aggtcatgtc attgaatgca caatccatct     29760
     gcatttgtag cttataattc ttcccaagca ggtcccgagc gactttatca tcgacagccc     29820
     ggttgattgg ggccacaatc caatgagccg aacatcgtcg catgtaatct tcggcaacag     29880
     caactcgtgc tgcatttgag tcaaaaatgc caggaagatc caccaagacc gcaccagtcg     29940
     ctaaggctgg ggctttggtg taaattcgca caacacgcac aaggggccaa agtccaatac     30000
     cctgattggc tgtgtccgtg tcgctagcgg aatctggatg ttcagcagca tcttgacttc     30060
     tagcagactt cttcgatcgg ccacgcttgc ctttactgtc aatgtacgat tttaatttca     30120
     tagaaaaggc tcttggatcg cttccttcga aagccttagt ggttcccaga agatcagtaa     30180
     ctctcctatt agccatcaag tcggctgcgg aggtgttcaa tatattatct gcagtcatcg     30240
     taggatagac cgcctggatc ttgtccagtg ccaccgctgc atccgaattc ttgggtatag     30300
     cacctcgagt cacttcctct tgatggtcct ggagttctgc gaataacact tccaattcac     30360
     gttcccactc aatatgcttg ataaactcga tttctgctct gtacttcgtg cttctgtagt     30420
     tgtaggaaat ttctgttgca acagcggtag aggcacgcat gcagtctgta gacaagacgg     30480
     ctttctcatc gaggactgcg ttgatgagcg atgattttcc ggcaccagtg cttccaacca     30540
     ctccgatgat caccttttcc gtgcaggcat atttctggat ccgctcgatc tcagctttcc     30600
     ggtctgtctc agtgccaaaa gcagttgagc ctgcaaaaac cgcatggagc tccttcaata     30660
     catcggcacc tttagccaca gcgttctcta aagcaataat ctcttggctg tcagcatcct     30720
     tgataccgca ctccaaagac tgctcagccg ggtccgtcat agggacgtcc acgtctgaag     30780
     gggcagcttc catctctgtt tctggttctc gtcctgcctg atcaacaagc ataagatcgg     30840
     gaacgacatc attatcacca ctttcttcct ttgatacagc gttctgtgga aagttcgatt     30900
     cagaatcgat actgtcaacg aagaccttaa aatcggcaac tgaatccagt cagtcaacat     30960
     gcgaataaaa ccagataaaa tcacactcac aatcaacaca agaggtcatc tcagccgctc     31020
     tctgatcagt acgcgcataa tattcctcgt acaatgcttt cagggaacat tcgtagtctg     31080
     cgtacataca atgccaacct tttgtttcaa catacttgac acagtcaatg tacaaccttc     31140
     gcatattagg cgtggcatag gcccagattg cgttgaagtt gggacatgca ggttctttgc     31200
     gtatgatgag tttctatacc cactaccaac cacggaagaa gtaaagaaaa tcactcacta     31260
     tccaccttcc cctcccaaga ccgctcatgc ctcgcagtct gctcggtcac aaagtgcaac     31320
     tcagcacgtt tgagaacctg atcctgattt ctcggaaaca ccgagctcgg tctcgcaccg     31380
     ccctccatta ttaaaccggc ccagcaacct cactgcgaaa cctcgatgaa gtactgcaac     31440
     acggcataca agaagcacca gagaatgaag acagaggttg ctattaagga aatatagaag     31500
     atccagtaga cgagaagtaa aagggagtgg aacacggtgt ttatgatagt aaacatagct     31560
     gagagaggag acgcgaatat gtggagtgaa ttgactgtgt ttggggagca gattctactt     31620
     atccatggtc attcactggc tctctgcaca gaatcgcact tgtttccatt ttggagtttg     31680
     ccatggtgac cggaagtggg gtgttgtgtt gctgggttag taggaagggg agagagatga     31740
     tggctgaggc tgtgatgagg attggaaggt gcgggattcg gtggtttggt tgtgttcgtg     31800
     tggtatcaca tgatggggat agtgagtaag tgactggaga gagagaaaga ccgaggtaag     31860
     atgaaacgaa gaggacgagg taagtggtaa gaatcaagag aaaggagaaa atgaactatt     31920
     acagattggg tatctcgaac gatgcagaac tacctagtaa gcagataaag gagagaaata     31980
     tgagataatg tacaggatga aagacatcaa gaaacagaca atctaatagt actacacatg     32040
     caccccctaa acaccctggc tatgcgtggt aattggtgac gctactaagc tcgatcaagg     32100
     attattttaa attaagatag ccggccagca gctgataata tccgttccat cccatctcta     32160
     caactccgcc tcttcctaac acactaaacc aacatcctca cctcgacaca gcccggttgg     32220
     ccctcctcct cgccacctcc gtccaccgag atccgcacga gccttcattt tcactgtcat     32280
     ccgtgggtag cggaggcaag ggccgatcca ggatgtgccg cccatatggc gggggtacat     32340
     ctcttctctg ggctaaagca gcaaggtgga cttggccgtg aaacgaagaa ggacggtaag     32400
     gcgcatagtg agcatcaggg gtgggtctgg tggtcacggc gtagtcgggg ctgaggtgtg     32460
     gtgaggggca tggggaaggt ttcaagaacc acagcttctc tttttcgagc cagacgagac     32520
     ggttgccttc ggtggtaatg gtggtcgtca cggcctgagt ggtgaccgtg gttgtggtag     32580
     ttgtgctcag catagggatg ggcgattggt gaggggtaag gtctgaaacg cttcgagttc     32640
     gggagctcca cgggtgaagg gagaaggagg atgaaggagg ggggggtggt aggtttagtg     32700
     ttggttgtgg ccttggttgt tgttggtact catgctcgtc ggctgtgacc gggggctgtg     32760
     ggctgtggca gcgttgccag agattgagat tggcttccgg ctcttgctgg aacagcgcgt     32820
     atgagtattc tgattcagac acggggctga agatcgcgtc cgtcgagctt ggtcgaggag     32880
     ggaggtcatg aggtgttaat gggctgatcg ggctgactgg ggtggacgtg tccagacgaa     32940
     tactggggac attcgctcgt cgcggtgaga cggtgaaccg agtgtcggcg ataggcgggc     33000
     cttctaagga tgaaaggtcc attgtgaaaa tgtgaaagac ggtataagga gaagataaaa     33060
     agtggaggta ggccaagcaa ttatacgcaa atgtcataga aagaccattg cacgcgacca     33120
     atgtagccga tggaaggaat taaagtcggt gtgggaatgt atgatcgtca agaatcgagg     33180
     gaaaaggtac ttggaggtcc aaaagggatg atcacagttc atatatcgga cagttgttga     33240
     tacttgaggc agtgctggaa caatgtcccc tgtggaaaag ggtgatgttg tcttctgtct     33300
     gcacggctat ggccggtttc tttgacgggc acagcaacaa agacacaata atacgagcca     33360
     acaacaccca tgacagtcag gaaatcgcct tgcgcctcac agtggattcc tcctcgtagg     33420
     tcgttccatc ctcaaatagt gggttgcagc tgcggaaagg gcgcaagccc tgttggcaaa     33480
     gctttcggct tgtccggctg atgttcgcct tggtttagga gcgaacaagg aagccaatcc     33540
     gtcggctcat gttaaacccc gccgtagaag gatctcccga tgttcgatag tttctttttt     33600
     gcccttcggg atgggcccgg aactggggca gaagaaggat ttggggtccg agactgatgt     33660
     gctgtcatcg taaaccatga agctgtagtt tcatcgtgga agcgacaata agcgcaggta     33720
     gaagctccta tgagtttaga cgccatttgg agcgattcca tgggcctgag cgatatagca     33780
     tgtccacaag tggaggctgc gcgataatgg gggcatttgg ttcgttggtt gaaggattcc     33840
     gagtgaggtt ggaaaacaac actgccacat cctttgtcgt ccgagctttg gatgagtcca     33900
     atttaaaggg gagaagtatt ttgcgtagca ctaggtgttc tccctattcg tagcctatat     33960
     tgcatagcaa ttatccatcg cgatagccat atggtgacct taatggagtc aaacacagtg     34020
     aggatgttgc cgttgtcaac caagtaaccg gcacgtgttg tttgttggtg gccccggggc     34080
     taaagaggat agcgtcaaac ccgaccagat cacggatctc ccaaaccccc aaacacagcc     34140
     acacacacaa ttatgaaata cttactacac actgacagcg tttacaactc aatgatcgtc     34200
     aaatccttcc agaattgccc ggtataaccc ccccaaaaga agtaattaat atcgcacaaa     34260
     tagggctgag ggcgacactc ggactttaag ccagagaata tctgaaacag ccacccaatc     34320
     aatcgcccgc actggcgaga ccaacatgat acaccggtgg gcgcaggcca gcaacgagac     34380
     gaaccgcgaa ttcggatcac agccggtcgc cgatagatga aagaaaagaa aattttaatt     34440
     cgagatcttg aaacatttac gctgaagccc ccaaactcat gcggcctccc cggattcagc     34500
     cctccattca gcctcctgct tacatgttca ctgagttctt ccaacctgcc ccatgccacc     34560
     acgcgggaat cacttagggg atgggtagat ctatccattg agatccgggc cggcccctgt     34620
     cgtcggacat gcccgatcgt ctggcagttc tacaacaggt ggatggcgag gtgatctgga     34680
     ccggatgtga ttgaaagctc tagcatgagc acaaattata atgtataaac tgcttcgaat     34740
     tgggtatgtg aaagcgtcat gggttacatt aatcgtatcc agccaccaac tgcttcacaa     34800
     caggactccg aagcaatcct ggaagcgtaa atatctagaa ggaaatttcg aataaaaagt     34860
     ggtataagag aggatataaa aagcaacgaa tcggatttct ctccccaaaa agcaaaaccg     34920
     caactaagta tggaccaatc cccgacactc ttcaccaatt cacatgcgcc caagatcccc     34980
     gcctatagcg gcaaccggac tcacgagtga cccggggcta ctataaacaa gaaggggaat     35040
     ctaagccagg aagaaagcag cggcggcggc ggcaccagcg aaagcgaagc cgttaccgtt     35100
     gacggagctg gcggcaccgg tgtagagagc agaagagggg gaggggctgt gcgtattgtt     35160
     agtacgattg tttatttatt tattccagga gtcagaatac tcacgtagca ctgccgctag     35220
     ggtagccaga gccgtaggca gcggcaccgc tagggatgac aggggaggaa gacttggcgg     35280
     gcttgccgct ggggtagcca gagccgtagg caccggcacc ggagccacca ccgatggtgc     35340
     tagtggacat gatgacggtg ggaacgcagg tggtcacggg gataacggtg acctgggggg     35400
     cagcagtggt gccagcgcca ccaccgacgg cagcagcacc ggagggaaca gcggcaccgc     35460
     tgggggcagc accggaggga gcgccgccag agggaacaac accagcacca gcaccaccag     35520
     caggggagct gccagcagcg ggggtggcgg agggagcctc agggacagcg ctggtaacac     35580
     caacggggga gacaccctca gcgccgctag tggtggcagc agcgacggcc tcgggggtgg     35640
     aggtggcgtg cagagtaccg gggcagttgg tgacggtggg agcgcaggag acgacggtca     35700
     cgtcctcagt ggagtagaca gtctcgacat cctgggggat ggcagcaaca aggctggcga     35760
     agagagcgac ggtggcaaca gagaaacgca tcttgaatgt tgtgttggga aagaataaaa     35820
     ccgtcaaggt cgatgataat ttgattttta tgtgtgggtt gttttgtatg taaaacacag     35880
     ggagctgcgt ttagataaaa gagagtgtgg ctagttgggg ttttgcttgg ggggtttggt     35940
     taaaagagtg gctgaccgaa gtcaatggga tgcttcaagc agtcaaagaa gtctggtctt     36000
     gaaagagaaa gaacagagag aaccaggaac gagctgggag gcagaggggg gaaccggggg     36060
     ccctttgtat gagccgggag attaacctgg agatcgtctc agggacgaaa aggggagagc     36120
     gcaactgcac gcgggtggag ttgatggccc ccgaatcaat cagagcgccg atgcggtgtg     36180
     agagcacctt catgggcaag tttggggcaa cccgcgatgg cccctctcac ttctcacttc     36240
     tttcgctcgt tttttttcgt tttcgcgcct cgtgggttct gcgcccgtct cacccacagc     36300
     tcttggttgg tccaaccagc cccttcgcca gtttgactag accaactagt gccgccaagt     36360
     gactttcgtc cctggccctg aattactgtc catgctgtcc aagctgtcca tgcgttgcga     36420
     gacaagtgct gttgatcggt cgctccattg ctcttttcga ccggaagaac agtcgactaa     36480
     ctcttcggct caggggggga ggggggagtt aatggggtcg gtagatactt agttgggtca     36540
     tcgatggttc ccctactgga tttttaggtt cgaacttttt tggatttcaa gcaatagtag     36600
     atagcaatta tttactttga tgaaccgcgc gggattccgt acctgcatca gtcaggcaca     36660
     tcgtcccgtc actacagcgt agtacatcac cactactact actggtactt tacttactag     36720
     tacatacttt agtctaccag gcagtaacat tcaccactcg gtcccaacgg taaaagcggg     36780
     atcaactaaa ctgactactt gtaacccgtc caaaaattag gatgtcatca tcatccacct     36840
     cccccgataa tcaaaaggaa ataagttcag ggggcagaaa cctcgcttta ctgagccaca     36900
     ggacgttgaa tgccaactta gactttgttt catgtttctc cctgctgtcc aatgagtgtt     36960
     ggggtcagtg gggcctgcag gctgttcctg atgccgttgg ccactcatcg ctctggccac     37020
     tatcccgctg tggctctctc ttccccgctt ttgacccaat ggctggttgg ctgctggacc     37080
     cacttgtgcc ccctgtctct cttttttccc acctggaact aatcttgccc tcgatacgta     37140
     ccatttttat ctggaggttt cattagtagg gtcgcttcgg atagtgctca tgggttcgat     37200
     gggctcgttt gttgttattg ctattgttca atgtttgggt gacaggtgca agggtcccac     37260
     aaaaaggaaa ttccatgaga taagggcgta ataataataa cattaatatt aattcgaaaa     37320
     taaaaataaa tgagagatta aaataaagaa cgagcagaga actgaaggaa aacatgtcgg     37380
     gttcaaccgt ctctcattgt cagagggcat tcgtcagcgg aaagctttct ttcccgtcgt     37440
     ttgcgtggat tgcagccgat ctactactgt aaggtacaaa gagttagcga atggtgttgt     37500
     caccccacgc agtatgacgc ctactattct accacttctt cgaaggagta tctatcttta     37560
     tcgattatac cgactatacc gactattttg ataccaagca gaatataccc tacaaggaca     37620
     agtcagtaca cactctcttc tgctaaatta ggaagtaaaa tagttctcgg cgctttttgg     37680
     catccctgtc actgccggtc tagaagctcg tccgacaggt aaaataatcc ttccatacag     37740
     ctccggcccc gttcctattg gaatgggggc ttcattgcta agaccaggcc tggctcggcg     37800
     ccacggtcgc attcattaat tgcttaatca aagcttagtg cgtggtgact aaactgctct     37860
     ccgactagtc tgatgtcgta cattgtagtc tagccatcat atgttagtta ctgattgcaa     37920
     aattgttcct aatcgatatt attgcgcgca atttcgagcc atatgtcctt ctttgtaaaa     37980
     acggaaattt gtgtatgcgt caacttttga cgtggtcctc acgagtcaga ttcgtgttcc     38040
     ttgtagtccg tttatggcgc aatagcaagc gctgatctta ttggaagagc cagaggagga     38100
     caggaattga gtgtgcgcaa gactgcatac agtacagtaa gtagtttaag cgccgagaaa     38160
     gacggcggat gacaatcatg tagcaatcgg gaagtgaact acaccggatg gatcttcaaa     38220
     gtcggaattt atgaatcaat tgccgtggat tcgatggcat gaataatagg accaaatgcc     38280
     aagacttgga ttattgccca gtctaccact tgagtgagct gtaagtataa caaacacaga     38340
     gggtaggggc taaaatctgt gtgtgcacat catcactact atcagcaatg aaactattga     38400
     aaccctcttc tttctattga aagctcagac ttttctctgc cattgcatat atttggttga     38460
     tactaacgta ctcaggaact aagtagttta cagtaggtct ccagattcct tcccacggta     38520
     gtccgttgag aacggagatt tctggtttct ttttttaggg cgctctcgtg acgaactgcg     38580
     aaaaggggga tctgtcaggg tttatgccca gtccttttgg gacaacagtt ttccccaatt     38640
     ggaaaatcaa tagtttgcag tgtctagctg tagttaatct gtctctaaat agcacctgag     38700
     gatatactat cttccgcctt acattttggt tatgtgaacc gctatagtag aggggactat     38760
     gactaaagca ggctgcgcac ggagtaacat gtacttcact accttgggac aacaattagg     38820
     atcttagtca gtaattatgt gtaagtagaa ctcaactcgt tattaaatca atcccgaggg     38880
     aaatactatc gaaccacatg ccattatcat tattattgca agtgagccga cgacgatgat     38940
     gtgtgcaaga attgagtttt ggttgctcca ccgatcaaca ggggagaggc gggctggcag     39000
     tcggtgaaat tctacccaag gcgacgcgga cttcctttac cccagtttta ggggctcctt     39060
     gggatccata gagtgttgcg tacgtccaaa aggctgggat ttccccatcc cctcctcctc     39120
     tttccccaaa gatatttctg aactatgtgc tatgtttgct aatctctcaa gtttgtggga     39180
     gaaggggtac cttaccacac actctctcgt cccgtgtgtt gatttattca atgaagggcc     39240
     ctacatggac ttcaatgcgg caaataagcg acaatggctt ggagttgttg ggattgttgg     39300
     aaggatggca tgagccgtct tggacggcta atagctaacg ttaactaact acttctacag     39360
     gagtgaggag taccactgcg cttggttatt tgccctttcg cacttgtgtt gttccttctt     39420
     gggtcgtcgc gtctacgagt tcttcatatc ggcctatggt gaagaagagt gtgtttttaa     39480
     atgaactgca tggagttaac aacagacttg gggcccaatt ctgtggtatg tgacgagagc     39540
     gcacagatgg tgacagaacc ctgcatatac aaagtagact actaatttct actccgtact     39600
     ttgggcaaat gccggcgtca aagcgacatc tggttgttgg ttacaccatg gccttactct     39660
     cctctactcc acagtaatca tcaacagtaa gcatccttgg ggccacacga ccacttatca     39720
     agcaaaacgg ctggatgatc gggtggggga gggcttttcc aagcgaggat cgtcatgccg     39780
     cgcgtctacg ggaagatttt ccaggtacgc acaatcaaca cttggtcagc agggcaggac     39840
     cctgcaccaa ctccaacttc caaggactgt tgtcctttct agtggcacta gttacttggt     39900
     cgacatggtc cgggtggata actagataga tggagagatg gtcaacccct gctaccccca     39960
     tgtgaacgtc atgggggttg acccgagcgt ttcgcttaga tgtcacggcg aaccggtagt     40020
     taggaacagg gcttgcgagg ataatgatga tgaagattga gaggatcgga atgtttcttt     40080
     ctttagtggc ccatttagat tgggtgtcat ctttattatt ggcctgtcag ttgggggcgc     40140
     agtgttgcca tttggccccg ttgctatggc ggtgcaaagg cttgggggag ggggattgct     40200
     attttaaacc ggagtgggtc tggatcgatt tgtggctgcg gaaatcgtcc aggttggcgg     40260
     gcatcgggat cgaggaaaga cggtagagag attcgtcaca gatggactgg atgatgtcag     40320
     ttgtccctaa ctagtagcta tccatatagg ggggatagtg ggaaagaagt gtctgtgaga     40380
     gtgagagatt ggacaaggct gagaatggca cgtgtcaatc tgtatcggtt gctgacgcgt     40440
     tgatgcacgg caactagtag ttgcttggta gtcatgatta tggatctact gttgacaaag     40500
     agactgtgat agatggccgt actatgtacc agagtgctac tagtatgtcc ggtgtcaatg     40560
     cgaatgtctg atcatattgg gcccgtttac tatgatcaga cagccttgag gaccataatc     40620
     ctaatcagta actgtcgtgt atattcttag aactgcgtaa cgtccgccga gatgaattgt     40680
     gctgaacaag caccgtcggg gcataatgag agtggagccc cggagcaaga tgccggcgca     40740
     gattggatgg agcagcaatc aatttcgata gtggcaccga gtatcagaga cactcaaccg     40800
     gcggatgatg taaaacatcc gcacgctact aagtcgtttt gggtgatttg tccatcgaca     40860
     tcatctggtt gggatgttgg accctggcac acccaattct tcaatgaaca agcagcttcc     40920
     gtcgacatca tcaggatagt ctatcggggt cgctgtttgt ggaaacttcc gaggaaacat     40980
     ggttcatttc aggcggagtc gatctttaag ttcagaattt tttaggtggg atgcctgact     41040
     ggccaggcca gatgattcag gcacccgaac aggttcccat ccaccatcaa cttgatacac     41100
     acagtatagt ttatagctac tatattagat tgacaggtat cagaatagat tagagacaat     41160
     catagctccg atacacacag acataaactt agacatggga agaactggag ctctgtcgct     41220
     gtcaagaata gtagcaatgg attccgaaaa tatctctcat cgcaagcact tctcatttta     41280
     ggcgccattt gaaacaggcc ggttccacca ggccggcgac cctccagcgc ctccattcga     41340
     tccctcgccg gtcgcgagtg cggagcatgg cactgactga ccggcagaga tggacctgac     41400
     aggaatggct ataactattt aaccaatgct gcggtgactt tcttgacctg actaactaac     41460
     taactagtct aactcatcac taaacgacac ctgagttcga tcccagtcag tgggaaagaa     41520
     aggatcttag tggtcaccct acgagcggtg gagtccagcc gccaactgac aaaatcgaca     41580
     caaaactcgg ccccagtttc aaaagcaaga atcgctggcc tcgccgaccg tcaaagtcac     41640
     atcttctcct ctttcttcct tccttccttc ctgctcggct tcttcctctc ctctcctctc     41700
     ctcctcctcc tccttctcct tcctatatat ctatctactc ttttcttcat tattattatc     41760
     atcatcgctg gggatcaaac attcgcttag tgctttgatt catcgtttat ttgtattctt     41820
     tttttctttc tccctctcct cctctgtctt cattctctca cactctctcc ccctctccga     41880
     tcagccaacc cctcttgtca gccaaccgcc gctctgttca gccaattaac cccacggccc     41940
     tctttgttcc gaccacctcg tccaactcct cttcctctta cttatcacac cttctcctct     42000
     tttctcctct ttcacttaat ccctttcccc agagtcctcc cgtccctctt tcaaagtgtc     42060
     ctactcaaac accgccgatc tggctacctt ggctgacccc aacgagttgt ttttgcctgg     42120
     tgagaggcaa aacaatctcg caatgtcatc ctcgccggtt cctctcctca agccgcccgt     42180
     gcctggcaac cgcggcaaca acaatggttc ccgacctccc aaactcacct tgggaatccc     42240
     tccatctcca aatgttcgtc cggtcacggg aaccggtgtt cctgtcgctg ccgccgccgc     42300
     cgctcccgcg cccgcgcctg ctcctccaac agaggtccct cagctgcagc gtccagctgc     42360
     tcgcccggcg cctccccagc tacgtctgaa aacccccatg ggcagcagtc agaatgtgca     42420
     acaagtgaag agtcgacccg ctccaccacc gttggcgacg accggcttga acgaaccgaa     42480
     tggacactcg aggtctggta gcttcacgta cctggacggg aaggccagtg ggcccgcctc     42540
     cgcatcatcc tccaactatt cagccctatc attcgccatg ggccttcgcc agcctcacgg     42600
     cagcactccg gatccctcgt cagcgatttc cgtctactcc gaccgggaaa gtggtgtaca     42660
     gatggagcgc gatagcagtg tgaacagcct aatcccggat ctggacaaga tgagtctgga     42720
     aaagggcagg cccctcgatg tggatgattt ggatgatgaa gcctggcttg cagctagtga     42780
     gcagaagaaa atcgtggagt tgggtagctt gggtgagggc gctggaggtg ccgtcactcg     42840
     atgcaagctc aaggagggta agacggtgtt tgcgttgaag gtaggtttca ttggcggttt     42900
     gcatcgtctg gtgttttggt atgttaacaa ctttctagat tattacgacg gaccccaatc     42960
     ccgatgtgaa aaagcagatt gttcgagaac tcaacttcaa taaagattgt gcctcggagc     43020
     acatctgtcg ctactacggt gcttttatgg acaagtcaac ggggaccatc tccattgcaa     43080
     tggaattctg cgaaggtggc agtttggaca gtatctacaa ggaggtcaag aagcttggtg     43140
     gacggacggg agagaaagtg ctaggcaagg ttgccgaggg tgtcttgaac gggttgacct     43200
     accttcatag cagaaagatc attcaccgag gtcagtcagg ttctggattt gtagttgttt     43260
     atcatccagc taacgttaat tttagacatc aaaccgtcga acattctcct ctgccgaaat     43320
     ggtcaggtca agctttgtga ttttggtgtc agtggagagt ttggcaccaa gggagacgcc     43380
     aatacgttta tcggcacatc gtactacatg gcccctgaac gcatcaccgg ccaatcatac     43440
     accatcacct ctgacgtgtg gtcactcggt gtgaccttgc ttgaagtcgc ccaacatcgc     43500
     ttccccttcc ctgccgacgg caccgaaatg cagccacgcg ccggtttgat cgatctgttg     43560
     acctacattg tccgtcaacc gatccccaag ctgaaagacg aaccggacaa cggtattcga     43620
     tggtccgaga acttcaaata cttcatcgag tgctggtacg tgttgaaatg cctaatagga     43680
     gatggattgt gctaactttt cgtctagttt ggagaaagaa cctccgcgac gagcgactcc     43740
     ctggcggatg ctcgaacatc cctggatgct ggacatgaaa aacaagaagg tcaacatggc     43800
     caatttcgta aggcaagtct gggactggaa agactagatt gcctgcatgc agcaactgga     43860
     tctcggcaat cattcatgca ccttccggac gaaatgctcc acctctaata cgatcgcaca     43920
     taacggtctc tcctttgatg cttacaagtg gctggccctt ggttgacccg gatgtcaaag     43980
     catacgaatt gtgatcatga cgacactcat tttcttcgcg gcactgtcta tcctttattg     44040
     gaatcatgga gttgggaatg ttttcttcat tatcatcacc cgacatgatc acgccttcct     44100
     ttaatttgct tccccgctgg tccagcattt atcccgtcct gtgcattgcg tccgattgtc     44160
     atctcggttc tttatttcta cccaaaaccg tcgtcatttc atccagcaac ctgaggttgt     44220
     ttctgttcaa atcatcgcca gcggtgctga cgcttgttcc tcttttccgg ttgagacggg     44280
     gagagattgg tattcttggt tctcttttat catctatctt gtcgagtttg ttccatatat     44340
     catcatacat acattatcct ctgtgatcct catccattga tctggtttat catcatttcc     44400
     ggctttcatt ctcccattgt acgcatgcag atacatacat acagccacac ggaagacata     44460
     ttcatttata gtctattagc ctgttctttc tgcttgtgag cgtgcgttgt gacaaggcag     44520
     ggtccgcata ttgtgtatag tgattggcac cggaatagcg atacaggaat atcaagactg     44580
     attatattag caaaagctgt cctataaacg tgaagtatag agtccagtgg atttagttac     44640
     gaaatgaaat atttaggaag tagaagatct gttacgccac aaaccctagc taaatctgaa     44700
     ttatttaatg ggcaataaga taaagaaaca gataagtagc acttgcacca cctgactgac     44760
     cgacatgcaa gtagttagcc gacgaggtct tcttcccccc caccccgcca aaaacgctca     44820
     ttctttcccc ttccatttac gagtgtcatc tacagaccaa aaatctaggt aaagatgcga     44880
     tagaaaaagc cgaagcttgc tggttctaag tcattagtac gcagacgtac actcatagca     44940
     tatactcact actcgtaatc ggtatgttcg ctagttgctt ggcttgttgg ttgctttggc     45000
     tgttctgact aaggcaatgg agcatacata gatcaatatt tgtctgtcta ttaagtacct     45060
     gcctatctct ggcacagggg ataatagtat agaaagccag gtgcagatac tactacatac     45120
     gatattctta gcttcaacga aagcaaaaag gaaattataa gacttaatta ttctctcatt     45180
     cattaatatg ctagattatg caacctatca ctcattcact aatccactca cccactcatg     45240
     caaagctatg gaatatgacg atatatgtat agagggaagt taaaagaact aatgttatag     45300
     caatccacgc ttataaagga caagataaga tagcttctag ctttctgtat ggcgaaacgt     45360
     tccatctcac ttcaaataat catgtcgtac ttcgtaatat gaccttgatc tactggtatc     45420
     tcgggggtag ttgaaacttg gttcaccgat tgacaggctg agcacccaat acccaaccaa     45480
     tgccactgac gagtccatcc gtgaccatgt tactgacgac gtctctcttg cggacgcggc     45540
     cttcgccgtc ctggtcatcg gtggacatgg aggagccact gcggagatga gaagaggagg     45600
     ggacggagtg gtcatcatgg tcgtgggtgt ttgtctttgc ggacgctgca gctgaccgga     45660
     gcgggaaggc gttcttttgc aacgctagag cggcgccgcg ggcaacctcg aacagcccca     45720
     tgggagcttc ttcatgatgg agacggttct gtgaggcgtg cgcccgtgct cgtcgggctt     45780
     ggtgctgtct cgtttcgaac gcgtcttgtt cgctgtctgt ggggccgaag cctcccggaa     45840
     gggtggtgga ggtgaggttg tcggctttgg tgtcccagat gtcttcttcc tcggattcgc     45900
     gtgcgcggag agctgctagt tcctcgtcgc agcggcgcca ggcgcccagg atttcgggca     45960
     aaggttcggg gctgggggcg aggacaaggg cgagagagag gagttccatg cgttgggaga     46020
     ggtgcgtgat ttgggtctgg ttgttggggg tggcgctggt ggctggggcg cggtagcgac     46080
     cggcgttgta gacggctcgc caggtgatgt cgtctttggg ggaagtgggg ttggtgagag     46140
     gggaggacgt agggagaagg gatgggggag tgagacgggt gagaatgtag gagtaggccg     46200
     tgccgaagtc gttcgaggaa agggcggagg aaatagcg                             46238
//

If you have problems or comments...

PBIL Back to PBIL home page