(data stored in SCRATCH zone)

EMBL: AM286280

ID   AM286280; SV 1; circular; genomic DNA; STD; PRO; 1892616 BP.
XX
AC   AM286280;
XX
PR   Project:PRJNA17375;
XX
DT   12-JUL-2006 (Rel. 88, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 5)
XX
DE   Francisella tularensis subsp. tularensis strain FSC 198 complete genome
XX
KW   complete genome.
XX
OS   Francisella tularensis subsp. tularensis FSC198
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Thiotrichales;
OC   Francisellaceae; Francisella.
XX
RN   [1]
RP   1-1892616
RA   Chaudhuri R.R.;
RT   ;
RL   Submitted (04-JUL-2006) to the INSDC.
RL   Chaudhuri R.R., Division of Immunity and Infection, University of
RL   Birmingham, Vincent Drive, Edgbaston, Birmingham, B15 2TT, UNITED KINGDOM.
XX
RN   [2]
RA   Chaudhuri R.R., Ren C.P., Desmond L., Vincent G.A., Silman N.J., Brehm J.,
RA   Elmore M.J., Hudson M.J., Forsman M., Isherwood K.E., Gurycova D.,
RA   Minton N.P., Titball R.W., Pallen M.J., Vipond R.;
RT   "The complete genome sequence of the European Francisella tularensis
RT   subspecies tularensis isolate FSC 198 suggests that it is derived from the
RT   archetypal laboratory strain Schu S4, originally isolated in North
RT   America.";
RL   Unpublished.
XX
DR   MD5; 54eb82b8fe9259319590ac50acab932d.
DR   BioSample; SAMEA3138200.
DR   EnsemblGenomes-Gn; EBG00000039076.
DR   EnsemblGenomes-Gn; EBG00000039079.
DR   EnsemblGenomes-Gn; EBG00000039081.
DR   EnsemblGenomes-Gn; EBG00000039083.
DR   EnsemblGenomes-Gn; EBG00000039085.
DR   EnsemblGenomes-Gn; EBG00000039086.
DR   EnsemblGenomes-Gn; EBG00000039088.
DR   EnsemblGenomes-Gn; EBG00000039090.
DR   EnsemblGenomes-Gn; EBG00000039092.
DR   EnsemblGenomes-Gn; EBG00000039094.
DR   EnsemblGenomes-Gn; EBG00000039096.
DR   EnsemblGenomes-Gn; EBG00000039098.
DR   EnsemblGenomes-Gn; EBG00000039100.
DR   EnsemblGenomes-Gn; EBG00000039102.
DR   EnsemblGenomes-Gn; EBG00000039103.
DR   EnsemblGenomes-Gn; EBG00000039106.
DR   EnsemblGenomes-Gn; EBG00000039107.
DR   EnsemblGenomes-Gn; EBG00000039109.
DR   EnsemblGenomes-Gn; EBG00000039111.
DR   EnsemblGenomes-Gn; EBG00000039114.
DR   EnsemblGenomes-Gn; EBG00000039117.
DR   EnsemblGenomes-Gn; EBG00000039119.
DR   EnsemblGenomes-Gn; EBG00000039120.
DR   EnsemblGenomes-Gn; EBG00000039124.
DR   EnsemblGenomes-Gn; EBG00000039126.
DR   EnsemblGenomes-Gn; EBG00000039128.
DR   EnsemblGenomes-Gn; EBG00000039130.
DR   EnsemblGenomes-Gn; EBG00000039132.
DR   EnsemblGenomes-Gn; EBG00000039134.
DR   EnsemblGenomes-Gn; EBG00000039136.
DR   EnsemblGenomes-Gn; EBG00000039138.
DR   EnsemblGenomes-Gn; EBG00000039140.
DR   EnsemblGenomes-Gn; EBG00000039143.
DR   EnsemblGenomes-Gn; EBG00000039144.
DR   EnsemblGenomes-Gn; EBG00000039147.
DR   EnsemblGenomes-Gn; EBG00000039151.
DR   EnsemblGenomes-Gn; EBG00000039153.
DR   EnsemblGenomes-Gn; EBG00000039155.
DR   EnsemblGenomes-Gn; EBG00000039157.
DR   EnsemblGenomes-Gn; EBG00000039158.
DR   EnsemblGenomes-Gn; EBG00000039159.
DR   EnsemblGenomes-Gn; EBG00000039160.
DR   EnsemblGenomes-Gn; EBG00000039161.
DR   EnsemblGenomes-Gn; EBG00000039162.
DR   EnsemblGenomes-Gn; EBG00000039163.
DR   EnsemblGenomes-Gn; EBG00000039164.
DR   EnsemblGenomes-Gn; EBG00000039165.
DR   EnsemblGenomes-Gn; EBG00000039166.
DR   EnsemblGenomes-Gn; EBG00001199326.
DR   EnsemblGenomes-Gn; EBG00001199327.
DR   EnsemblGenomes-Gn; EBG00001199328.
DR   EnsemblGenomes-Gn; EBG00001199329.
DR   EnsemblGenomes-Gn; EBG00001199330.
DR   EnsemblGenomes-Gn; EBG00001199331.
DR   EnsemblGenomes-Gn; EBG00001199332.
DR   EnsemblGenomes-Gn; EBG00001199333.
DR   EnsemblGenomes-Gn; EBG00001199334.
DR   EnsemblGenomes-Gn; EBG00001199335.
DR   EnsemblGenomes-Gn; EBG00001199336.
DR   EnsemblGenomes-Gn; EBG00001199337.
DR   EnsemblGenomes-Gn; EBG00001199338.
DR   EnsemblGenomes-Gn; EBG00001199339.
DR   EnsemblGenomes-Gn; EBG00001199340.
DR   EnsemblGenomes-Gn; EBG00001199341.
DR   EnsemblGenomes-Gn; EBG00001199342.
DR   EnsemblGenomes-Gn; EBG00001199343.
DR   EnsemblGenomes-Gn; EBG00001199344.
DR   EnsemblGenomes-Gn; EBG00001199345.
DR   EnsemblGenomes-Gn; EBG00001199346.
DR   EnsemblGenomes-Gn; EBG00001199347.
DR   EnsemblGenomes-Gn; EBG00001199348.
DR   EnsemblGenomes-Gn; EBG00001199350.
DR   EnsemblGenomes-Gn; EBG00001199351.
DR   EnsemblGenomes-Gn; EBG00001199352.
DR   EnsemblGenomes-Gn; EBG00001199353.
DR   EnsemblGenomes-Gn; EBG00001199354.
DR   EnsemblGenomes-Gn; EBG00001199355.
DR   EnsemblGenomes-Gn; EBG00001199356.
DR   EnsemblGenomes-Gn; EBG00001199357.
DR   EnsemblGenomes-Gn; EBG00001199358.
DR   EnsemblGenomes-Gn; EBG00001199359.
DR   EnsemblGenomes-Gn; EBG00001199360.
DR   EnsemblGenomes-Gn; EBG00001199361.
DR   EnsemblGenomes-Gn; EBG00001199362.
DR   EnsemblGenomes-Gn; EBG00001199363.
DR   EnsemblGenomes-Gn; EBG00001199364.
DR   EnsemblGenomes-Gn; EBG00001199365.
DR   EnsemblGenomes-Gn; EBG00001199366.
DR   EnsemblGenomes-Gn; EBG00001199367.
DR   EnsemblGenomes-Gn; EBG00001199368.
DR   EnsemblGenomes-Gn; EBG00001199369.
DR   EnsemblGenomes-Gn; EBG00001199370.
DR   EnsemblGenomes-Gn; EBG00001199371.
DR   EnsemblGenomes-Gn; EBG00001199372.
DR   EnsemblGenomes-Gn; EBG00001199373.
DR   EnsemblGenomes-Gn; EBG00001199374.
DR   EnsemblGenomes-Gn; EBG00001199375.
DR   EnsemblGenomes-Gn; EBG00001199376.
DR   EnsemblGenomes-Gn; EBG00001199377.
DR   EnsemblGenomes-Gn; EBG00001199378.
DR   EnsemblGenomes-Gn; EBG00001199379.
DR   EnsemblGenomes-Gn; EBG00001199380.
DR   EnsemblGenomes-Gn; EBG00001199381.
DR   EnsemblGenomes-Gn; EBG00001199382.
DR   EnsemblGenomes-Gn; FTF0003c.
DR   EnsemblGenomes-Gn; FTF0005.
DR   EnsemblGenomes-Gn; FTF0008.
DR   EnsemblGenomes-Gn; FTF0009.
DR   EnsemblGenomes-Gn; FTF0010.
DR   EnsemblGenomes-Gn; FTF0011.
DR   EnsemblGenomes-Gn; FTF0012.
DR   EnsemblGenomes-Gn; FTF0046.
DR   EnsemblGenomes-Gn; FTF0082.
DR   EnsemblGenomes-Gn; FTF0089c.
DR   EnsemblGenomes-Gn; FTF0092c.
DR   EnsemblGenomes-Gn; FTF0100.
DR   EnsemblGenomes-Gn; FTF0102.
DR   EnsemblGenomes-Gn; FTF0122.
DR   EnsemblGenomes-Gn; FTF0123.
DR   EnsemblGenomes-Gn; FTF0124.
DR   EnsemblGenomes-Gn; FTF0135.
DR   EnsemblGenomes-Gn; FTF0170c.
DR   EnsemblGenomes-Gn; FTF0172.
DR   EnsemblGenomes-Gn; FTF0173.
DR   EnsemblGenomes-Gn; FTF0176c.
DR   EnsemblGenomes-Gn; FTF0179.
DR   EnsemblGenomes-Gn; FTF0201.
DR   EnsemblGenomes-Gn; FTF0206c.
DR   EnsemblGenomes-Gn; FTF0210c.
DR   EnsemblGenomes-Gn; FTF0217.
DR   EnsemblGenomes-Gn; FTF0218c.
DR   EnsemblGenomes-Gn; FTF0224c.
DR   EnsemblGenomes-Gn; FTF0225c.
DR   EnsemblGenomes-Gn; FTF0246c.
DR   EnsemblGenomes-Gn; FTF0275c.
DR   EnsemblGenomes-Gn; FTF0276c.
DR   EnsemblGenomes-Gn; FTF0294.
DR   EnsemblGenomes-Gn; FTF0353c.
DR   EnsemblGenomes-Gn; FTF0358.
DR   EnsemblGenomes-Gn; FTF0375.
DR   EnsemblGenomes-Gn; FTF0379.
DR   EnsemblGenomes-Gn; FTF0415.
DR   EnsemblGenomes-Gn; FTF0421.
DR   EnsemblGenomes-Gn; FTF0426.
DR   EnsemblGenomes-Gn; FTF0427.
DR   EnsemblGenomes-Gn; FTF0429c.
DR   EnsemblGenomes-Gn; FTF0441c.
DR   EnsemblGenomes-Gn; FTF0445.
DR   EnsemblGenomes-Gn; FTF0493.
DR   EnsemblGenomes-Gn; FTF0497c.
DR   EnsemblGenomes-Gn; FTF0498c.
DR   EnsemblGenomes-Gn; FTF0514.
DR   EnsemblGenomes-Gn; FTF0516.
DR   EnsemblGenomes-Gn; FTF0517.
DR   EnsemblGenomes-Gn; FTF0521.
DR   EnsemblGenomes-Gn; FTF0529c.
DR   EnsemblGenomes-Gn; FTF0531.
DR   EnsemblGenomes-Gn; FTF0539c.
DR   EnsemblGenomes-Gn; FTF0542.
DR   EnsemblGenomes-Gn; FTF0551.
DR   EnsemblGenomes-Gn; FTF0567c.
DR   EnsemblGenomes-Gn; FTF0574.
DR   EnsemblGenomes-Gn; FTF0585.
DR   EnsemblGenomes-Gn; FTF0600.
DR   EnsemblGenomes-Gn; FTF0606c.
DR   EnsemblGenomes-Gn; FTF0637.
DR   EnsemblGenomes-Gn; FTF0641.
DR   EnsemblGenomes-Gn; FTF0643.
DR   EnsemblGenomes-Gn; FTF0657.
DR   EnsemblGenomes-Gn; FTF0672c.
DR   EnsemblGenomes-Gn; FTF0706.
DR   EnsemblGenomes-Gn; FTF0717.
DR   EnsemblGenomes-Gn; FTF0724c.
DR   EnsemblGenomes-Gn; FTF0734.
DR   EnsemblGenomes-Gn; FTF0735.
DR   EnsemblGenomes-Gn; FTF0758.
DR   EnsemblGenomes-Gn; FTF0770.
DR   EnsemblGenomes-Gn; FTF0771c.
DR   EnsemblGenomes-Gn; FTF0775c.
DR   EnsemblGenomes-Gn; FTF0828c.
DR   EnsemblGenomes-Gn; FTF0830c.
DR   EnsemblGenomes-Gn; FTF0843.
DR   EnsemblGenomes-Gn; FTF0844.
DR   EnsemblGenomes-Gn; FTF0852.
DR   EnsemblGenomes-Gn; FTF0865.
DR   EnsemblGenomes-Gn; FTF0866c.
DR   EnsemblGenomes-Gn; FTF0880.
DR   EnsemblGenomes-Gn; FTF0882.
DR   EnsemblGenomes-Gn; FTF0883.
DR   EnsemblGenomes-Gn; FTF0921.
DR   EnsemblGenomes-Gn; FTF0929c.
DR   EnsemblGenomes-Gn; FTF0930c.
DR   EnsemblGenomes-Gn; FTF0933.
DR   EnsemblGenomes-Gn; FTF0947c.
DR   EnsemblGenomes-Gn; FTF0949c.
DR   EnsemblGenomes-Gn; FTF0950c.
DR   EnsemblGenomes-Gn; FTF0967c.
DR   EnsemblGenomes-Gn; FTF0974.
DR   EnsemblGenomes-Gn; FTF0996.
DR   EnsemblGenomes-Gn; FTF0999c.
DR   EnsemblGenomes-Gn; FTF1012.
DR   EnsemblGenomes-Gn; FTF1032.
DR   EnsemblGenomes-Gn; FTF1033.
DR   EnsemblGenomes-Gn; FTF1049c.
DR   EnsemblGenomes-Gn; FTF1053c.
DR   EnsemblGenomes-Gn; FTF1067c.
DR   EnsemblGenomes-Gn; FTF1070c.
DR   EnsemblGenomes-Gn; FTF1098c.
DR   EnsemblGenomes-Gn; FTF1101.
DR   EnsemblGenomes-Gn; FTF1102.
DR   EnsemblGenomes-Gn; FTF1104.
DR   EnsemblGenomes-Gn; FTF1107c.
DR   EnsemblGenomes-Gn; FTF1121.
DR   EnsemblGenomes-Gn; FTF1131.
DR   EnsemblGenomes-Gn; FTF1135c.
DR   EnsemblGenomes-Gn; FTF1139.
DR   EnsemblGenomes-Gn; FTF1141.
DR   EnsemblGenomes-Gn; FTF1144.
DR   EnsemblGenomes-Gn; FTF1146c.
DR   EnsemblGenomes-Gn; FTF1162c.
DR   EnsemblGenomes-Gn; FTF1173c.
DR   EnsemblGenomes-Gn; FTF1176c.
DR   EnsemblGenomes-Gn; FTF1180.
DR   EnsemblGenomes-Gn; FTF1182c.
DR   EnsemblGenomes-Gn; FTF1189c.
DR   EnsemblGenomes-Gn; FTF1192c.
DR   EnsemblGenomes-Gn; FTF1195c.
DR   EnsemblGenomes-Gn; FTF1209c.
DR   EnsemblGenomes-Gn; FTF1261c.
DR   EnsemblGenomes-Gn; FTF1264.
DR   EnsemblGenomes-Gn; FTF1286.
DR   EnsemblGenomes-Gn; FTF1289.
DR   EnsemblGenomes-Gn; FTF1301c.
DR   EnsemblGenomes-Gn; FTF1309c.
DR   EnsemblGenomes-Gn; FTF1361c.
DR   EnsemblGenomes-Gn; FTF1362.
DR   EnsemblGenomes-Gn; FTF1364.
DR   EnsemblGenomes-Gn; FTF1378.
DR   EnsemblGenomes-Gn; FTF1379c.
DR   EnsemblGenomes-Gn; FTF1380.
DR   EnsemblGenomes-Gn; FTF1381.
DR   EnsemblGenomes-Gn; FTF1398c.
DR   EnsemblGenomes-Gn; FTF1411.
DR   EnsemblGenomes-Gn; FTF1429c.
DR   EnsemblGenomes-Gn; FTF1430c.
DR   EnsemblGenomes-Gn; FTF1437c.
DR   EnsemblGenomes-Gn; FTF1438c.
DR   EnsemblGenomes-Gn; FTF1440c.
DR   EnsemblGenomes-Gn; FTF1449c.
DR   EnsemblGenomes-Gn; FTF1466c.
DR   EnsemblGenomes-Gn; FTF1482.
DR   EnsemblGenomes-Gn; FTF1501.
DR   EnsemblGenomes-Gn; FTF1513.
DR   EnsemblGenomes-Gn; FTF1516c.
DR   EnsemblGenomes-Gn; FTF1519.
DR   EnsemblGenomes-Gn; FTF1521c.
DR   EnsemblGenomes-Gn; FTF1533c.
DR   EnsemblGenomes-Gn; FTF1535c.
DR   EnsemblGenomes-Gn; FTF1544.
DR   EnsemblGenomes-Gn; FTF1545.
DR   EnsemblGenomes-Gn; FTF1546.
DR   EnsemblGenomes-Gn; FTF1547.
DR   EnsemblGenomes-Gn; FTF1558c.
DR   EnsemblGenomes-Gn; FTF1565c.
DR   EnsemblGenomes-Gn; FTF1582c.
DR   EnsemblGenomes-Gn; FTF1583.
DR   EnsemblGenomes-Gn; FTF1587c.
DR   EnsemblGenomes-Gn; FTF1588c.
DR   EnsemblGenomes-Gn; FTF1592c.
DR   EnsemblGenomes-Gn; FTF1593c.
DR   EnsemblGenomes-Gn; FTF1618.
DR   EnsemblGenomes-Gn; FTF1619.
DR   EnsemblGenomes-Gn; FTF1640c.
DR   EnsemblGenomes-Gn; FTF1641c.
DR   EnsemblGenomes-Gn; FTF1642c.
DR   EnsemblGenomes-Gn; FTF1643.
DR   EnsemblGenomes-Gn; FTF1649.
DR   EnsemblGenomes-Gn; FTF1662c.
DR   EnsemblGenomes-Gn; FTF1670c.
DR   EnsemblGenomes-Gn; FTF1682.
DR   EnsemblGenomes-Gn; FTF1716c.
DR   EnsemblGenomes-Gn; FTF1717.
DR   EnsemblGenomes-Gn; FTF1719c.
DR   EnsemblGenomes-Gn; FTF1729c.
DR   EnsemblGenomes-Gn; FTF1734c.
DR   EnsemblGenomes-Gn; FTF1735c.
DR   EnsemblGenomes-Gn; FTF1739c.
DR   EnsemblGenomes-Gn; FTF1740c.
DR   EnsemblGenomes-Gn; FTF1741c.
DR   EnsemblGenomes-Gn; FTF1743.
DR   EnsemblGenomes-Gn; FTF1745c.
DR   EnsemblGenomes-Gn; FTF1755.
DR   EnsemblGenomes-Gn; FTF1757c.
DR   EnsemblGenomes-Gn; FTF1759c.
DR   EnsemblGenomes-Gn; FTF1770.
DR   EnsemblGenomes-Gn; FTF1774c.
DR   EnsemblGenomes-Gn; FTF1779.
DR   EnsemblGenomes-Gn; FTF1786.
DR   EnsemblGenomes-Gn; FTF1788.
DR   EnsemblGenomes-Gn; FTF1790c.
DR   EnsemblGenomes-Gn; FTF1792c.
DR   EnsemblGenomes-Gn; FTF1799c.
DR   EnsemblGenomes-Gn; FTF1801c.
DR   EnsemblGenomes-Tr; EBG00000039076-1.
DR   EnsemblGenomes-Tr; EBG00000039079-1.
DR   EnsemblGenomes-Tr; EBG00000039081-1.
DR   EnsemblGenomes-Tr; EBG00000039083-1.
DR   EnsemblGenomes-Tr; EBG00000039085-1.
DR   EnsemblGenomes-Tr; EBG00000039086-1.
DR   EnsemblGenomes-Tr; EBG00000039088-1.
DR   EnsemblGenomes-Tr; EBG00000039090-1.
DR   EnsemblGenomes-Tr; EBG00000039092-1.
DR   EnsemblGenomes-Tr; EBG00000039094-1.
DR   EnsemblGenomes-Tr; EBG00000039096-1.
DR   EnsemblGenomes-Tr; EBG00000039098-1.
DR   EnsemblGenomes-Tr; EBG00000039100-1.
DR   EnsemblGenomes-Tr; EBG00000039102-1.
DR   EnsemblGenomes-Tr; EBG00000039103-1.
DR   EnsemblGenomes-Tr; EBG00000039106-1.
DR   EnsemblGenomes-Tr; EBG00000039107-1.
DR   EnsemblGenomes-Tr; EBG00000039109-1.
DR   EnsemblGenomes-Tr; EBG00000039111-1.
DR   EnsemblGenomes-Tr; EBG00000039114-1.
DR   EnsemblGenomes-Tr; EBG00000039117-1.
DR   EnsemblGenomes-Tr; EBG00000039119-1.
DR   EnsemblGenomes-Tr; EBG00000039120-1.
DR   EnsemblGenomes-Tr; EBG00000039124-1.
DR   EnsemblGenomes-Tr; EBG00000039126-1.
DR   EnsemblGenomes-Tr; EBG00000039128-1.
DR   EnsemblGenomes-Tr; EBG00000039130-1.
DR   EnsemblGenomes-Tr; EBG00000039132-1.
DR   EnsemblGenomes-Tr; EBG00000039134-1.
DR   EnsemblGenomes-Tr; EBG00000039136-1.
DR   EnsemblGenomes-Tr; EBG00000039138-1.
DR   EnsemblGenomes-Tr; EBG00000039140-1.
DR   EnsemblGenomes-Tr; EBG00000039143-1.
DR   EnsemblGenomes-Tr; EBG00000039144-1.
DR   EnsemblGenomes-Tr; EBG00000039147-1.
DR   EnsemblGenomes-Tr; EBG00000039151-1.
DR   EnsemblGenomes-Tr; EBG00000039153-1.
DR   EnsemblGenomes-Tr; EBG00000039155-1.
DR   EnsemblGenomes-Tr; EBG00000039157-1.
DR   EnsemblGenomes-Tr; EBG00000039158-1.
DR   EnsemblGenomes-Tr; EBG00000039159-1.
DR   EnsemblGenomes-Tr; EBG00000039160-1.
DR   EnsemblGenomes-Tr; EBG00000039161-1.
DR   EnsemblGenomes-Tr; EBG00000039162-1.
DR   EnsemblGenomes-Tr; EBG00000039163-1.
DR   EnsemblGenomes-Tr; EBG00000039164-1.
DR   EnsemblGenomes-Tr; EBG00000039165-1.
DR   EnsemblGenomes-Tr; EBG00000039166-1.
DR   EnsemblGenomes-Tr; EBT00001570380.
DR   EnsemblGenomes-Tr; EBT00001570381.
DR   EnsemblGenomes-Tr; EBT00001570382.
DR   EnsemblGenomes-Tr; EBT00001570383.
DR   EnsemblGenomes-Tr; EBT00001570384.
DR   EnsemblGenomes-Tr; EBT00001570385.
DR   EnsemblGenomes-Tr; EBT00001570386.
DR   EnsemblGenomes-Tr; EBT00001570387.
DR   EnsemblGenomes-Tr; EBT00001570388.
DR   EnsemblGenomes-Tr; EBT00001570389.
DR   EnsemblGenomes-Tr; EBT00001570390.
DR   EnsemblGenomes-Tr; EBT00001570391.
DR   EnsemblGenomes-Tr; EBT00001570392.
DR   EnsemblGenomes-Tr; EBT00001570393.
DR   EnsemblGenomes-Tr; EBT00001570394.
DR   EnsemblGenomes-Tr; EBT00001570395.
DR   EnsemblGenomes-Tr; EBT00001570396.
DR   EnsemblGenomes-Tr; EBT00001570397.
DR   EnsemblGenomes-Tr; EBT00001570398.
DR   EnsemblGenomes-Tr; EBT00001570399.
DR   EnsemblGenomes-Tr; EBT00001570400.
DR   EnsemblGenomes-Tr; EBT00001570401.
DR   EnsemblGenomes-Tr; EBT00001570402.
DR   EnsemblGenomes-Tr; EBT00001570403.
DR   EnsemblGenomes-Tr; EBT00001570404.
DR   EnsemblGenomes-Tr; EBT00001570405.
DR   EnsemblGenomes-Tr; EBT00001570406.
DR   EnsemblGenomes-Tr; EBT00001570407.
DR   EnsemblGenomes-Tr; EBT00001570408.
DR   EnsemblGenomes-Tr; EBT00001570409.
DR   EnsemblGenomes-Tr; EBT00001570410.
DR   EnsemblGenomes-Tr; EBT00001570411.
DR   EnsemblGenomes-Tr; EBT00001570412.
DR   EnsemblGenomes-Tr; EBT00001570413.
DR   EnsemblGenomes-Tr; EBT00001570414.
DR   EnsemblGenomes-Tr; EBT00001570415.
DR   EnsemblGenomes-Tr; EBT00001570416.
DR   EnsemblGenomes-Tr; EBT00001570417.
DR   EnsemblGenomes-Tr; EBT00001570418.
DR   EnsemblGenomes-Tr; EBT00001570419.
DR   EnsemblGenomes-Tr; EBT00001570420.
DR   EnsemblGenomes-Tr; EBT00001570421.
DR   EnsemblGenomes-Tr; EBT00001570422.
DR   EnsemblGenomes-Tr; EBT00001570423.
DR   EnsemblGenomes-Tr; EBT00001570424.
DR   EnsemblGenomes-Tr; EBT00001570425.
DR   EnsemblGenomes-Tr; EBT00001570426.
DR   EnsemblGenomes-Tr; EBT00001570427.
DR   EnsemblGenomes-Tr; EBT00001570428.
DR   EnsemblGenomes-Tr; EBT00001570429.
DR   EnsemblGenomes-Tr; EBT00001570430.
DR   EnsemblGenomes-Tr; EBT00001570431.
DR   EnsemblGenomes-Tr; EBT00001570432.
DR   EnsemblGenomes-Tr; EBT00001570433.
DR   EnsemblGenomes-Tr; EBT00001570434.
DR   EnsemblGenomes-Tr; EBT00001570435.
DR   EnsemblGenomes-Tr; FTF0003c.
DR   EnsemblGenomes-Tr; FTF0005.
DR   EnsemblGenomes-Tr; FTF0008.
DR   EnsemblGenomes-Tr; FTF0009.
DR   EnsemblGenomes-Tr; FTF0010.
DR   EnsemblGenomes-Tr; FTF0011.
DR   EnsemblGenomes-Tr; FTF0012.
DR   EnsemblGenomes-Tr; FTF0046.
DR   EnsemblGenomes-Tr; FTF0082.
DR   EnsemblGenomes-Tr; FTF0089c.
DR   EnsemblGenomes-Tr; FTF0092c.
DR   EnsemblGenomes-Tr; FTF0100.
DR   EnsemblGenomes-Tr; FTF0102.
DR   EnsemblGenomes-Tr; FTF0122.
DR   EnsemblGenomes-Tr; FTF0123.
DR   EnsemblGenomes-Tr; FTF0124.
DR   EnsemblGenomes-Tr; FTF0135.
DR   EnsemblGenomes-Tr; FTF0170c.
DR   EnsemblGenomes-Tr; FTF0172.
DR   EnsemblGenomes-Tr; FTF0173.
DR   EnsemblGenomes-Tr; FTF0176c.
DR   EnsemblGenomes-Tr; FTF0179.
DR   EnsemblGenomes-Tr; FTF0201.
DR   EnsemblGenomes-Tr; FTF0206c.
DR   EnsemblGenomes-Tr; FTF0210c.
DR   EnsemblGenomes-Tr; FTF0217.
DR   EnsemblGenomes-Tr; FTF0218c.
DR   EnsemblGenomes-Tr; FTF0224c.
DR   EnsemblGenomes-Tr; FTF0225c.
DR   EnsemblGenomes-Tr; FTF0246c.
DR   EnsemblGenomes-Tr; FTF0275c.
DR   EnsemblGenomes-Tr; FTF0276c.
DR   EnsemblGenomes-Tr; FTF0294.
DR   EnsemblGenomes-Tr; FTF0353c.
DR   EnsemblGenomes-Tr; FTF0358.
DR   EnsemblGenomes-Tr; FTF0375.
DR   EnsemblGenomes-Tr; FTF0379.
DR   EnsemblGenomes-Tr; FTF0415.
DR   EnsemblGenomes-Tr; FTF0421.
DR   EnsemblGenomes-Tr; FTF0426.
DR   EnsemblGenomes-Tr; FTF0427.
DR   EnsemblGenomes-Tr; FTF0429c.
DR   EnsemblGenomes-Tr; FTF0441c.
DR   EnsemblGenomes-Tr; FTF0445.
DR   EnsemblGenomes-Tr; FTF0493.
DR   EnsemblGenomes-Tr; FTF0497c.
DR   EnsemblGenomes-Tr; FTF0498c.
DR   EnsemblGenomes-Tr; FTF0514.
DR   EnsemblGenomes-Tr; FTF0516.
DR   EnsemblGenomes-Tr; FTF0517.
DR   EnsemblGenomes-Tr; FTF0521.
DR   EnsemblGenomes-Tr; FTF0529c.
DR   EnsemblGenomes-Tr; FTF0531.
DR   EnsemblGenomes-Tr; FTF0539c.
DR   EnsemblGenomes-Tr; FTF0542.
DR   EnsemblGenomes-Tr; FTF0551.
DR   EnsemblGenomes-Tr; FTF0567c.
DR   EnsemblGenomes-Tr; FTF0574.
DR   EnsemblGenomes-Tr; FTF0585.
DR   EnsemblGenomes-Tr; FTF0600.
DR   EnsemblGenomes-Tr; FTF0606c.
DR   EnsemblGenomes-Tr; FTF0637.
DR   EnsemblGenomes-Tr; FTF0641.
DR   EnsemblGenomes-Tr; FTF0643.
DR   EnsemblGenomes-Tr; FTF0657.
DR   EnsemblGenomes-Tr; FTF0672c.
DR   EnsemblGenomes-Tr; FTF0706.
DR   EnsemblGenomes-Tr; FTF0717.
DR   EnsemblGenomes-Tr; FTF0724c.
DR   EnsemblGenomes-Tr; FTF0734.
DR   EnsemblGenomes-Tr; FTF0735.
DR   EnsemblGenomes-Tr; FTF0758.
DR   EnsemblGenomes-Tr; FTF0770.
DR   EnsemblGenomes-Tr; FTF0771c.
DR   EnsemblGenomes-Tr; FTF0775c.
DR   EnsemblGenomes-Tr; FTF0828c.
DR   EnsemblGenomes-Tr; FTF0830c.
DR   EnsemblGenomes-Tr; FTF0843.
DR   EnsemblGenomes-Tr; FTF0844.
DR   EnsemblGenomes-Tr; FTF0852.
DR   EnsemblGenomes-Tr; FTF0865.
DR   EnsemblGenomes-Tr; FTF0866c.
DR   EnsemblGenomes-Tr; FTF0880.
DR   EnsemblGenomes-Tr; FTF0882.
DR   EnsemblGenomes-Tr; FTF0883.
DR   EnsemblGenomes-Tr; FTF0921.
DR   EnsemblGenomes-Tr; FTF0929c.
DR   EnsemblGenomes-Tr; FTF0930c.
DR   EnsemblGenomes-Tr; FTF0933.
DR   EnsemblGenomes-Tr; FTF0947c.
DR   EnsemblGenomes-Tr; FTF0949c.
DR   EnsemblGenomes-Tr; FTF0950c.
DR   EnsemblGenomes-Tr; FTF0967c.
DR   EnsemblGenomes-Tr; FTF0974.
DR   EnsemblGenomes-Tr; FTF0996.
DR   EnsemblGenomes-Tr; FTF0999c.
DR   EnsemblGenomes-Tr; FTF1012.
DR   EnsemblGenomes-Tr; FTF1032.
DR   EnsemblGenomes-Tr; FTF1033.
DR   EnsemblGenomes-Tr; FTF1049c.
DR   EnsemblGenomes-Tr; FTF1053c.
DR   EnsemblGenomes-Tr; FTF1067c.
DR   EnsemblGenomes-Tr; FTF1070c.
DR   EnsemblGenomes-Tr; FTF1098c.
DR   EnsemblGenomes-Tr; FTF1101.
DR   EnsemblGenomes-Tr; FTF1102.
DR   EnsemblGenomes-Tr; FTF1104.
DR   EnsemblGenomes-Tr; FTF1107c.
DR   EnsemblGenomes-Tr; FTF1121.
DR   EnsemblGenomes-Tr; FTF1131.
DR   EnsemblGenomes-Tr; FTF1135c.
DR   EnsemblGenomes-Tr; FTF1139.
DR   EnsemblGenomes-Tr; FTF1141.
DR   EnsemblGenomes-Tr; FTF1144.
DR   EnsemblGenomes-Tr; FTF1146c.
DR   EnsemblGenomes-Tr; FTF1162c.
DR   EnsemblGenomes-Tr; FTF1173c.
DR   EnsemblGenomes-Tr; FTF1176c.
DR   EnsemblGenomes-Tr; FTF1180.
DR   EnsemblGenomes-Tr; FTF1182c.
DR   EnsemblGenomes-Tr; FTF1189c.
DR   EnsemblGenomes-Tr; FTF1192c.
DR   EnsemblGenomes-Tr; FTF1195c.
DR   EnsemblGenomes-Tr; FTF1209c.
DR   EnsemblGenomes-Tr; FTF1261c.
DR   EnsemblGenomes-Tr; FTF1264.
DR   EnsemblGenomes-Tr; FTF1286.
DR   EnsemblGenomes-Tr; FTF1289.
DR   EnsemblGenomes-Tr; FTF1301c.
DR   EnsemblGenomes-Tr; FTF1309c.
DR   EnsemblGenomes-Tr; FTF1361c.
DR   EnsemblGenomes-Tr; FTF1362.
DR   EnsemblGenomes-Tr; FTF1364.
DR   EnsemblGenomes-Tr; FTF1378.
DR   EnsemblGenomes-Tr; FTF1379c.
DR   EnsemblGenomes-Tr; FTF1380.
DR   EnsemblGenomes-Tr; FTF1381.
DR   EnsemblGenomes-Tr; FTF1398c.
DR   EnsemblGenomes-Tr; FTF1411.
DR   EnsemblGenomes-Tr; FTF1429c.
DR   EnsemblGenomes-Tr; FTF1430c.
DR   EnsemblGenomes-Tr; FTF1437c.
DR   EnsemblGenomes-Tr; FTF1438c.
DR   EnsemblGenomes-Tr; FTF1440c.
DR   EnsemblGenomes-Tr; FTF1449c.
DR   EnsemblGenomes-Tr; FTF1466c.
DR   EnsemblGenomes-Tr; FTF1482.
DR   EnsemblGenomes-Tr; FTF1501.
DR   EnsemblGenomes-Tr; FTF1513.
DR   EnsemblGenomes-Tr; FTF1516c.
DR   EnsemblGenomes-Tr; FTF1519.
DR   EnsemblGenomes-Tr; FTF1521c.
DR   EnsemblGenomes-Tr; FTF1533c.
DR   EnsemblGenomes-Tr; FTF1535c.
DR   EnsemblGenomes-Tr; FTF1544.
DR   EnsemblGenomes-Tr; FTF1545.
DR   EnsemblGenomes-Tr; FTF1546.
DR   EnsemblGenomes-Tr; FTF1547.
DR   EnsemblGenomes-Tr; FTF1558c.
DR   EnsemblGenomes-Tr; FTF1565c.
DR   EnsemblGenomes-Tr; FTF1582c.
DR   EnsemblGenomes-Tr; FTF1583.
DR   EnsemblGenomes-Tr; FTF1587c.
DR   EnsemblGenomes-Tr; FTF1588c.
DR   EnsemblGenomes-Tr; FTF1592c.
DR   EnsemblGenomes-Tr; FTF1593c.
DR   EnsemblGenomes-Tr; FTF1618.
DR   EnsemblGenomes-Tr; FTF1619.
DR   EnsemblGenomes-Tr; FTF1640c.
DR   EnsemblGenomes-Tr; FTF1641c.
DR   EnsemblGenomes-Tr; FTF1642c.
DR   EnsemblGenomes-Tr; FTF1643.
DR   EnsemblGenomes-Tr; FTF1649.
DR   EnsemblGenomes-Tr; FTF1662c.
DR   EnsemblGenomes-Tr; FTF1670c.
DR   EnsemblGenomes-Tr; FTF1682.
DR   EnsemblGenomes-Tr; FTF1716c.
DR   EnsemblGenomes-Tr; FTF1717.
DR   EnsemblGenomes-Tr; FTF1719c.
DR   EnsemblGenomes-Tr; FTF1729c.
DR   EnsemblGenomes-Tr; FTF1734c.
DR   EnsemblGenomes-Tr; FTF1735c.
DR   EnsemblGenomes-Tr; FTF1739c.
DR   EnsemblGenomes-Tr; FTF1740c.
DR   EnsemblGenomes-Tr; FTF1741c.
DR   EnsemblGenomes-Tr; FTF1743.
DR   EnsemblGenomes-Tr; FTF1745c.
DR   EnsemblGenomes-Tr; FTF1755.
DR   EnsemblGenomes-Tr; FTF1757c.
DR   EnsemblGenomes-Tr; FTF1759c.
DR   EnsemblGenomes-Tr; FTF1770.
DR   EnsemblGenomes-Tr; FTF1774c.
DR   EnsemblGenomes-Tr; FTF1779.
DR   EnsemblGenomes-Tr; FTF1786.
DR   EnsemblGenomes-Tr; FTF1788.
DR   EnsemblGenomes-Tr; FTF1790c.
DR   EnsemblGenomes-Tr; FTF1792c.
DR   EnsemblGenomes-Tr; FTF1799c.
DR   EnsemblGenomes-Tr; FTF1801c.
DR   EuropePMC; PMC1832225; 17406676.
DR   EuropePMC; PMC2849404; 20123721.
DR   EuropePMC; PMC4412822; 25918839.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01374; CRISPR-DR61.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; AM286280.
DR   SILVA-SSU; AM286280.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1892616
FT                   /organism="Francisella tularensis subsp. tularensis FSC198"
FT                   /sub_species="tularensis"
FT                   /strain="FSC 198"
FT                   /mol_type="genomic DNA"
FT                   /country="Slovakia"
FT                   /db_xref="taxon:393115"
FT   CDS_pept        1..1521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="FTF0001"
FT                   /product="chromosomal replication initiator protein dnaA"
FT                   /note="Similar to DNAA_ECOLI (P03004) Chromosomal
FT                   replication initiator from E. coli (467 aa). FASTA: opt:
FT                   1298 Z-score: 1484.2 E(): 8.9e-75 Smith-Waterman score:
FT                   1400; 45.621 identity in 491 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08017"
FT                   /inference="similar to sequence:UniProtKB:DNAA_ECOLI"
FT                   /protein_id="CAL08017.1"
FT                   /translation="MAILYILRVIRIFFIMTTWDKCLKKIKKNLSTFEYKTWIKPIHVE
FT                   QNSNLFTVYCNNEYFKKHIKSKYGNLILSTIQECHGNDLIIEYSNKKFSGEKITEVITA
FT                   GPQANFFSTTSVEIKDESEDTKVVQEPKISKKSNSKDFSSSQELFGFDEAMLITAKEDE
FT                   EYSFGLPLKEKYVFDSFVVGDANKIARAAAMQVSINPGKLHNPLFIYGGSGLGKTHLMQ
FT                   AIGNHAREVNPNAKIIYTNSEQFIKDYVNSIRLQDQDEFQRVYRSADILLIDDIQFIAG
FT                   KEGTAQEFFHTFNALYENGKQIILTSDKYPNEIEGLEERLVSRFGYGLTVSVDMPDLET
FT                   RIAILLKKAHDLGQKLPNETAAFIAENVRTNVRELEGALNRVLTTSKFNHKDPTIEVAQ
FT                   ACLRDVIKIQEKKVKIDNIQKVVADFYRIRVKDLTSNQRSRNIARPRQIAMSLARELTS
FT                   HSLPEIGNAFGGRDHTTVMHAVKAITKLRQSNTSISDDYELLLDKISR"
FT   CDS_pept        1558..2661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="FTF0002"
FT                   /product="DNA polymerase III, beta chain"
FT                   /EC_number="2.7.7.7"
FT                   /note="Similar to DP3B_ECOLI (P00583) DNA polymerase
FT                   III,beta chain from E. coli (366 aa). FASTA opt: 826
FT                   Z-score: 955.1 E(): 2.6e-45 Smith-Waterman score: 826;
FT                   35.230 identity in 369 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08018"
FT                   /inference="similar to sequence:UniProtKB:DP3B_ECOLI"
FT                   /protein_id="CAL08018.1"
FT                   /translation="MNFVLNRDDLLKPLQSMLSVANSKSTMPLLSCILFDIDNNNLKIT
FT                   ASDLDTEISCNIAVSCNTTIKLALNADKIYNIVRSLNENSMIDFRINENKVTIVSNNST
FT                   FNLISLNADNYPLIDSNINEQASFDLSQQDFHHIISKVDFSMANDDTRYFLNGMFWEIN
FT                   ANLLRAVSTDGHRMSITEAIIDSKVLDSASQSIIPKKAILELKKIVGKTEENIKICLGK
FT                   NYLKAIFGNYAFISKLIDGRYPDYQKVIPKNNTKLLAVDKQFFKNSLLRTSILANDKYK
FT                   GVRLNISQNQLLLSANNPDNEKAEDKIEVQYNDQPMEICFNYKYLLDIINVLSEETMSI
FT                   YLDNPNMSALVKDEKDNSLFIIMPMKI"
FT   CDS_pept        complement(2692..3096)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0003c"
FT                   /product="conserved hypothetical membrane protein,fragment"
FT                   /note="Similar to Q881T0 Proline/betaine transporter from
FT                   Pseudomonas syringae (438 aa). FASTA: opt: 271 Z-score:
FT                   314.7 E(): 1.2e-09 Smith-Waterman score: 271; 37.594
FT                   identity in 133 aa overlap. Truncation at N-terminal
FT                   according to FASTA hits ORF ftt0003c"
FT                   /db_xref="PSEUDO:CAL08019.1"
FT                   /inference="similar to sequence:UniProtKB:Q881T0"
FT   repeat_region   complement(3105..3116)
FT                   /note="ISFtu1 12bp terminal inverted repeat"
FT   CDS_pept        complement(join(3204..3662,3662..3988))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="isftu1"
FT                   /locus_tag="FTF0004c"
FT                   /product="Transposase"
FT                   /note="ISFtu1. Transposase, member of the IS630 Tc-1
FT                   mariner family. Identical to Q93EJ6 Putative transposase
FT                   from Francisella tularensis (118 aa) from aa 144-261.
FT                   Identical to Q93EJ7 putative transposase from Francisella
FT                   tularensis (126 aa) from aa 1-109. Q93EJ6 and Q93EJ7
FT                   previously characterised as two separate ORF's. ORF1
FT                   (identical to Q93EJ7) contains a programmed ribosomal
FT                   frameshifting motif, 5'-AAAAAAAG-3' at aa position 109
FT                   which permits frameshifting to ORF2 (identical to Q93EJ6)
FT                   to produce a single ORF. Alignment of this single ORF with
FT                   additional members of the IS630 family, and also mariner
FT                   elements, show that this transposase shares strongly
FT                   conserved residues, including a fully conserved
FT                   dipeptide,Asp-Glu (DE), and a block consisting of a fully
FT                   conserved Asp and highly conserved Glu, separated by 34 or
FT                   35 residues (D35E). The conserved dipeptide is only present
FT                   if ribosomal frameshifting occurs."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0004c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08020"
FT                   /protein_id="CAL08020.1"
FT                   /translation="MPSYSQDFRDIVINKHEEGMTEFELSKFFNIDKRTVVSWIEFYKR
FT                   TGDYSSKQGVGCGRVASFTDKTLIEQYLIDHPDASALDIKEALAPDIPRSTFYDCLNRL
FT                   GFSFKKKTPKYKQRKEHERLEYIEKLKEIAQNLLFYIDEMGCDNKLSILRGWSLIGEPS
FT                   YGEVLAYQTQRRSIVAGYNYADKKIIALLEYSGYTNTEIFNQWFEEHLCPSLKPKTTIV
FT                   MDNASFHKSSKLIEIANKFDVQILYLPPYSPDLNPIEKV"
FT   repeat_region   complement(4009..4024)
FT                   /rpt_type=TANDEM
FT                   /note="16bp Short Sequence Tandem Repeat (SSTR)"
FT   repeat_region   complement(4025..4040)
FT                   /rpt_type=TANDEM
FT                   /note="16bp Short Sequence Tandem Repeat (SSTR)"
FT   repeat_region   complement(4041..4056)
FT                   /rpt_type=TANDEM
FT                   /note="16bp Short Sequence Tandem Repeat (SSTR)"
FT   repeat_region   complement(4057..4072)
FT                   /rpt_type=TANDEM
FT                   /note="16bp Short Sequence Tandem Repeat (SSTR)"
FT   repeat_region   complement(4073..4084)
FT                   /note="ISFtu1 12bp terminal inverted repeat"
FT   CDS_pept        4086..4625
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD1"
FT                   /locus_tag="FTF0005"
FT                   /product="Succinate-semialdehyde dehydrogenase, fragment"
FT                   /EC_number="1.2.1.16"
FT                   /note="Similar to Q92TE2 Probable succinate-semialdehyde
FT                   dehydrogenase from Rhizobium meliloti (484 aa). FASTA: opt:
FT                   622 Z-score: 785.3 E(): 6.9e-36 Smith-Waterman score: 622;
FT                   55.294 identity in 170 aa overlap. This CDS is disrupted by
FT                   the insertion of an ISFtu1 element causing a truncation at
FT                   N-terminal"
FT                   /db_xref="PSEUDO:CAL08021.1"
FT                   /inference="similar to sequence:UniProtKB:Q92TE2"
FT   CDS_pept        4661..5869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0006"
FT                   /product="Proline/betaine transporter, major facilitator
FT                   superfamily (MFS) transport protein"
FT                   /note="Similar to Q9ZE69 Proline/betaine transporter
FT                   (PROP1) from Rickettsia prowazekii (418 aa). FASTA: opt:
FT                   605 Z-score: 665.8 E(): 3.4e-29 Smith-Waterman score: 605;
FT                   28.293 identity in 410 aa overlap ORF ftt0006"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08022"
FT                   /inference="similar to sequence:UniProtKB:Q9ZE69"
FT                   /protein_id="CAL08022.1"
FT                   /translation="MRIKSVIISSIGSTFETFDFHIFGLFALQISMSLLHKDSFNSSLI
FT                   LIFAIFGAGYFARSLGAIFWGNFGNKYGRTVPFKWTVILIGVASLVIAVLPSSSVIGVF
FT                   SPLILAACRLIQGFSFGGELIAAVLLVYEQPAKRRSFYTSVVIFCATLGMILASIVYYL
FT                   LSLVLTTEQFFAFSWRLAFAFGGIAVLVSYFWRASIQETLVTEFTGKRGFVALELLKTN
FT                   IRLLLRCVLTAAATAIFLSMFIVFLPTFCQKGLSFDKVTTSVYVLVTIVTYAVSALAGG
FT                   YLGDIIGNKRTQALGIILAIIILIPLSISLLTKSAVALLFIVLFAIVNGLINANYMIVV
FT                   LNRFDKLQRFSGLAITQNISMAIFMGVLPALFAFLVADLKILSAPFYILFVLYIVALMS
FT                   LFD"
FT   CDS_pept        6044..7822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspS"
FT                   /locus_tag="FTF0007"
FT                   /product="Aspartyl-tRNA synthetase"
FT                   /EC_number="6.1.1.12"
FT                   /note="Similar to SYD_ECOLI (P21889) Aspartyl-tRNA
FT                   synthetase from E. coli (590 aa.) FASTA: opt: 2335 Z-score:
FT                   2790.0 E(): 1.6e-147 Smith-Waterman score: 2335; 58.853
FT                   identity in 593 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08023"
FT                   /inference="similar to sequence:UniProtKB:SYD_ECOLI"
FT                   /protein_id="CAL08023.1"
FT                   /translation="MDMRTHYSSDINEKLQGQKVTVCGWVHRRRDHGGVIFLDIRDRTG
FT                   LVQLVFNPDNDNFKVADSLRSEFVIKAEGVVNLRPEGQENKNISSGKVEIIGDSIEVIN
FT                   KSKTIPFQLDDFQSTGEDVKLKYRYIDLRRPEMQHKLITRSKAIRYVRNFLDNNGFLDI
FT                   ETPFLTKATPEGARDYLVPSRNFNGKFYALPQSPQLFKQLLMVSGFDRYYQIVKCFRDE
FT                   DLRADRQPEFTQIDIEASFIDEAFIMSTMERMIAGLFKETIGVEFATPFQVMTFADAID
FT                   KYGSDKPDLRIPLEFVNIKEDMQNEEFKVFSGPANDPQSRVIALRIPGGNDKLTRKMID
FT                   EYTKFVGIYGAKGLAYIKINSLSQGKEGLQSPIVKNISEETLFKVIDKTSAKEGDLLFF
FT                   GAGKAKIVNDSMGALRAKIGEDLDLFNKDWAPLWVVDFPMFEKDDNRLYAMHHPFTAPK
FT                   VSSVEDLVNTNPEELSSRAYDMVINGYEVGGGSIRIHKQDIQAKVFNLLGISDDEAREK
FT                   FGFMLDALSYGTPIHGGIAFGIDRLIMLLTGTTNIRDVIAFPKTQTASCLMTEAPSTVS
FT                   LEQLNELGIAVKKEER"
FT   CDS_pept        7959..8252
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0008"
FT                   /product="sugar transferase, fragment"
FT                   /note="Similar to Q8A5U0 Glycosyltransferase from
FT                   Bacteriodes thetaiotamicron (323 aa). FASTA: opt: 175
FT                   Z-score: 241.3 E(): 1.4e-05 Smith-Waterman score: 175;
FT                   38.144 identity in 97 aa overlap. This CDS is disrupted by
FT                   the insertion of an ISFtu1 element causing a truncation at
FT                   the C-terminal ORF ftt0008"
FT                   /inference="similar to sequence:UniProtKB:Q8A5U0"
FT   repeat_region   8254..8265
FT                   /note="ISFtu1 12bp terminal inverted repeat"
FT   repeat_region   8266..8281
FT                   /rpt_type=TANDEM
FT                   /note="16bp Short Sequence Tandem Repeat (SSTR)"
FT   repeat_region   8282..8297
FT                   /rpt_type=TANDEM
FT                   /note="16bp Short Sequence Tandem Repeat (SSTR)"
FT   repeat_region   8298..8313
FT                   /rpt_type=TANDEM
FT                   /note="16bp Short Sequence Tandem Repeat (SSTR)"
FT   repeat_region   8314..8329
FT                   /rpt_type=TANDEM
FT                   /note="16bp Short Sequence Tandem Repeat (SSTR)"
FT   repeat_region   8330..8345
FT                   /rpt_type=TANDEM
FT                   /note="16bp Short Sequence Tandem Repeat (SSTR)"
FT   CDS_pept        join(8366..8692,8692..8838)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="isftu1"
FT                   /locus_tag="FTF0009"
FT                   /product="Transposase, fragment"
FT                   /note="ISFtu1, fragment. Transposase, member of the IS630
FT                   Tc-1 mariner family. Identical to Q93EJ6 Putative
FT                   transposase from Francisella tularensis (118 aa) from aa
FT                   144-261. Identical to Q93EJ7 putative transposase from
FT                   Francisella tularensis (126 aa) from aa 1-109. Q93EJ6 and
FT                   Q93EJ7 previously characterised as two separate ORF's. ORF1
FT                   (identical to Q93EJ7) contains a programmed ribosomal
FT                   frameshifting motif, 5'-AAAAAAAG-3' at aa position 109
FT                   which permits frameshifting to ORF2 (identical to Q93EJ6)
FT                   to produce a single ORF. Alignment of this single ORF with
FT                   additional members of the IS630 family, and also mariner
FT                   elements, show that this transposase shares strongly
FT                   conserved residues, including a fully conserved
FT                   dipeptide,Asp-Glu (DE), and a block consisting of a fully
FT                   conserved Asp and highly conserved Glu, separated by 34 or
FT                   35 residues (D35E). The conserved dipeptide is only present
FT                   if ribosomal frameshifting occurs. Deletion of carboxy
FT                   terminal region between aa 135 and 238 relative to full
FT                   length ISFtu1"
FT                   /db_xref="PSEUDO:CAL08025.1"
FT   repeat_region   8926..8937
FT                   /note="ISFtu1 12bp terminal inverted repeat"
FT   CDS_pept        8940..9446
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0010"
FT                   /product="modification methylase, fragment"
FT                   /EC_number="2.1.1.37"
FT                   /note="Similar to MTH3_HAEAE (P20589) Modification
FT                   methylase HaeIII from Haemophilus aegyptius (330 aa).
FT                   FASTA: opt: 652 Z-score: 839.7 E(): 6.4e-39 Smith-Waterman
FT                   score: 652; 57.310 identity in 171 aa overlap. This CDS is
FT                   disrupted by the insertion of a fragment of an ISFtu1
FT                   element causing a truncation at N-terminal ORF ftt0010"
FT                   /inference="similar to sequence:UniProtKB:MTH3_HAEAE"
FT   CDS_pept        join(9416..9640,9644..10285)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0011"
FT                   /product="restriction endonuclease, pseudogene"
FT                   /EC_number="3.1.21.4"
FT                   /note="Similar to O68582 FnuDI restriction endonuclease
FT                   from Fusobacterium nucleatum (284 aa). FASTA: .opt: 881
FT                   Z-score: 1029.1 E(): 1.8e-49 Smith-Waterman score: 881;
FT                   50.178 identity in 281 aa overlap . Contains an in-frame
FT                   stop codon after aa 75 ORF ftt0011"
FT                   /inference="similar to sequence:UniProtKB:O68582"
FT   CDS_pept        join(10573..10989,10989..11429)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0012"
FT                   /product="conserved hypothetical protein, pseudogene"
FT                   /note="Similar to Q92C69 Hypothetical protein lin1322 from
FT                   Listeria innocua (290 aa). FASTA: opt: 601 Z-score: 755.7
FT                   E(): 3e-34 Smith-Waterman score: 601; 31.507 identity in
FT                   292 aa. Contains a frameshift after aa 139. ORF ftt0012"
FT                   /inference="similar to sequence:UniProtKB:Q92C69"
FT   CDS_pept        complement(11450..12232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0013c"
FT                   /product="hypothetical lipoprotein"
FT                   /note="ORF ftt0013c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0013c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08029"
FT                   /protein_id="CAL08029.1"
FT                   /translation="MRKIFFFLIPIILLSSCSTSNYTLIKGSEYISMQPNTQYLYKRTA
FT                   LKADKSIFIDIDIQSCNSDQSKCQYFVSVKSDKGKILEQYYETYYVNFFGDVYLTDSLY
FT                   PNGTLILPARIRLGEELLLDNGDNYGPVQEKLLAYKLIPEIQVNNHEYKNCVNILFETT
FT                   TPTETVDLKLVTDEIICKGIGSVRKEMQMSYKPKFANTNTEDINNSIMKFAATKSISKD
FT                   MAPEGSLKPFGQKNVELNTQDYILIDTYLDILQAITHK"
FT   CDS_pept        complement(12472..12870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0014c"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0014c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0014c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08030"
FT                   /protein_id="CAL08030.1"
FT                   /translation="MKKLIVTSTFITALVSVSYATELKGSDYISTEVGSTYNYQRVNAD
FT                   DQDKFTIETTIKSCNNAKTSCDYVSQIKDVNGKTSANSSYQYSYVVSADGAVYITYPNS
FT                   QQQTLLLPAKIEFNKIRNDNVTNADTNS"
FT   CDS_pept        13198..14496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="FTF0015"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /note="Similar to PUR8_THEMA Q9X0I0 Adenylosuccinate lyase
FT                   from Thermotoga maritima (431 aa). FASTA: opt: 1078
FT                   Z-score: 1248.5 E(): 1.1e-61 Smith-Waterman score: 1078;
FT                   41.628 identity in 430 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08031"
FT                   /inference="similar to sequence:UniProtKB:PUR8_THEMA"
FT                   /protein_id="CAL08031.1"
FT                   /translation="MIKRYDVAEISKIWADENKYAKMLEVELAILEALEDRMVPKGTAA
FT                   EIRARAQIRPERVDEIEKVTKHDIIAFCTSIAEQFTAETGKFFHFGVTSSDIIDSALSL
FT                   QIRDSMSYVIKDLEALCDSLLTKAEETKEIITMGRSHGMFAEPMSFGQKFLGAYVEFKR
FT                   RLKDLKDFQKDGLTVQFSGAVGNYCILTTEDEKKAADILGLPVEEVSTQVIPRDRIAKL
FT                   ISIHGLIASAIERLAVEIRHLHRSDVFEVYEGFSKGQKGSSTMPHKKNPISTENLTGMA
FT                   RMLRSHVSIALENCVLWHERDISHSSAERFYLPDNFGIMVYALRRMKNTIDNLVVQRDI
FT                   IEDRVRSTSAYLSSFYLHFLVANTPFMREDCYKIVQQVAFDLKQGESFSKKLQKVMHDE
FT                   HNIILDIPEMDFEGIKKTYLKEIDHVFDRSVKA"
FT   CDS_pept        14530..15108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0016"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0016"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08032"
FT                   /protein_id="CAL08032.1"
FT                   /translation="MYNVVKFGCQERPEISSVEEPTKPLAIQDKKTKDNVMTFWRQKLT
FT                   YVGCGEERSVTLHYFIYNNENPKKVYYSIKAKNDSIPLNKTIFEGSFTSLVLRNDVLND
FT                   VVRFLYSKKCSMPEDKLRDHIKYYTASALRYALILSNQKRIKVPQWQEVWSVDACDKNY
FT                   HFPITFTGDGVGGTYWSIGKVTDTEITKS"
FT   CDS_pept        15195..16736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0017"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="Similar to Q8PAK3 Toxin secretion ABC transporter
FT                   ATP-binding protein from Xanthomonas axonopodis (563 aa).
FT                   FASTA: opt: 454 Z-score: 516.4 E(): 7.1e-21 Smith-Waterman
FT                   score: 454; 24.395identity in 496 aa overlap ORF ftt0017"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08033"
FT                   /inference="similar to sequence:UniProtKB:Q8PAK3"
FT                   /protein_id="CAL08033.1"
FT                   /translation="MLYRQIKTVLKIPKHTVYSLVIYSILLGFLSLTVPVSVQTLVNLV
FT                   GVSLSIRPVISLITILFIFLTAAFFVRIFQLKLVEDIQRKVFVETVLRIISAIYKVDFN
FT                   DLIRVNVREKINRAFELKFLQKSVSVIFIILLDIFLQTLFCVIILAFYHPMFLVFDILL
FT                   ITCIVLVIFVPMRAGYEAGLKESTNIYDIVYWFEEKTAEFLSFRQRPEESSVKKVDAKL
FT                   CNYLDARANFFSVVLRQHVYIGLTYIFINILLLGIGSYLIINGQLSIGQLIAAEILVNI
FT                   VLLGLLKFSQYLYDCYGFMVAVRKILDLLEISKKDSPTSEHKNAKLETEVTSLEIALPD
FT                   YQKARFDYTQNHFNNLCLTRQQAQKLLNAFFDDNSEEIIKINNVCLSNYSKEEICNKIH
FT                   IASGIEVVAGTVLDNLCENDFSQEKLKYLSELLDAFGVSFLEKYFEKKIDSQTIKYNLE
FT                   FDTMVVLKMNLIRAILKHPKLLILIDSYGLTNRSNMTITQILQKLAVPTLIISIQ"
FT   CDS_pept        16744..17817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0018"
FT                   /product="Secretion protein"
FT                   /note="Similar to Q8PMA5 RND efflux membrane fusion protein
FT                   from Xanthomonas axonopodis (354 aa). FASTA: opt: 851
FT                   Z-score: 971.0 E(): 3.4e-46 Smith-Waterman score: 851;
FT                   37.846 identity in 325 aa overlap ORF ftt0018"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08034"
FT                   /inference="similar to sequence:UniProtKB:Q8PMA5"
FT                   /protein_id="CAL08034.1"
FT                   /translation="MMQLKSFEMLKKDLSFKKIILLVLLSIIVVGVVLAMIPWQQTIDG
FT                   YGDVTTLSPSERQQNISAPIGGRLGKWYVFEGDSVKKGDPIVEVLDLDPEVVSRLEEEK
FT                   SAIELGINSVKLAIKNTKNNIERHKYLVDKGASTQRIYEQAQMEMVNYTQELAKLNVDL
FT                   AKVKVQIARQQSRLVKAPSDGVIVDRIHGLGGVIVKDTDVLATIVPDSKSRIVELWVNS
FT                   MDVPLVKIGDKVMLQFEGWPAVQFSGWPQVAIGTFEGEVIFISPQNNAQGQFKIFVKQS
FT                   GKRDWPSPDVLRLGTKVHGWVLLNNVSLGYELWRRYNGFPINLNSSQLRIGIKKSQEVE
FT                   KPTTIKEQVQNQPSNIK"
FT   CDS_pept        17900..18181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="FTF0019"
FT                   /product="Glu-tRNAGln amidotransferase C subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="Similar to Q82T57 Glu-tRNAGln amidotransferase C
FT                   subunit from Nitrosomonas europaea (95 aa). FASTA:i opt:
FT                   188 Z-score: 259.9 E(): 1.4e-06 Smith-Waterman score: 188;
FT                   31.818 identity in 88 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08035"
FT                   /inference="similar to sequence:UniProtKB:Q82T57"
FT                   /protein_id="CAL08035.1"
FT                   /translation="MDKKLVKHIAKLSCFDLTEEQLEQYTKDLINICKILDTVKNFDAQ
FT                   GVKPMISPISVDFKFREDIPQDQDNRTSFDKFACEVVDDYFMVPQVVK"
FT   CDS_pept        18190..19635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="FTF0020"
FT                   /product="Glutamyl-tRNA(Gln) amidotransferase subunit A"
FT                   /EC_number="6.3.5.-"
FT                   /note="Similar to GATA_NEIMB (Q9JYZ9) Glutamyl-tRNA(Gln)
FT                   amidotransferase subunit A from Neissera meningitidis (481
FT                   aa) FASTA: opt: 1527 Z-score: 1734.6 E(): 1e-88
FT                   Smith-Waterman score: 1527; 50.538 identity in 465 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08036"
FT                   /db_xref="GOA:Q14K49"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14K49"
FT                   /inference="similar to sequence:UniProtKB:GATA_NEIMB"
FT                   /protein_id="CAL08036.1"
FT                   /translation="MSYIKKLRARLDSGEISAVELTKEYLAKIKEQDKRINSVITLCEA
FT                   EALKEAEDADAIISAGKQGLLTGIPILHKDLFCTKGIRTTAASKMLDNFVAPYDSTVTK
FT                   NCKDQGMVTLGKLNMDEFAMGSTNEYSYYGAVSNPWDLERVPGGSSGGSAAAVAAGFAP
FT                   ISTGSDTGGSVRQPASFCGLTAMKPSYGSTSRFGMVAFASSFDQAGVLGHYAEDVAIML
FT                   DAIAGECEFDSTCVGVKQNHFTQDLEKDISGKVIGVDESLIKDLPAQIQEAVSKTLDNF
FT                   KKLGAEIKSVKVPDLKEALSTYYIITPAEAAANLARYDGIRYGYRNPEARDLDELYRKS
FT                   RTDGFGAEVKRRIMIGNYVLASSQYDSYYNKAQQLRKVMTDQINQIFTQVDAIFMPASP
FT                   SEAFKKGDKLDPVSAYLSDIYTIPANISGLPAIAFPIGFANNLPVGGQLMAKAFNDNIL
FT                   TQMVVQYQKHYGIEEFILQQARI"
FT   CDS_pept        19638..21059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="FTF0021"
FT                   /product="Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B"
FT                   /EC_number="6.3.5.-"
FT                   /note="Similar to Q9JTZ3 Aspartyl/glutamyl-tRNA(Asn/Gln)
FT                   amidotransferase subunit B from Neisseria meningitidis (476
FT                   aa). FASTA: opt: 1513 Z-score: 1767.6 E(): 1.5e-90
FT                   Smith-Waterman score: 1513; 49.053 identity in 475 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08037"
FT                   /db_xref="GOA:Q14K48"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14K48"
FT                   /inference="similar to sequence:UniProtKB:Q9JTZ3"
FT                   /protein_id="CAL08037.1"
FT                   /translation="MNWEMVIGLEVHIQLSTKSKLFSTSATKYGQHQNTQAAFLDLGLP
FT                   GTLPVVNKEAIRKAVIFGLAVDAKISKDSFFARKNYFYPDLSKGYQISQSTNPIVQEGR
FT                   LEIETSKGLKTIRIERAHLEEDAGKSVHGYIAGETGLDYNRAGTPLLEIVTYPDFRSAE
FT                   EVVAYLKKLHQLVKHLGICDGNMQEGSFRCDVNLSIRPQGQAKFGTRAELKNINSFRFI
FT                   DKAIEYEYARQVSVLESGGEVVQETRLYDADANETRSMRAKEDAFDYRYFPDPDLLPLV
FT                   ITDEYIESIKKQMPLKSEEREAVYREHLAEQEVEFLLSNLEIADYYDKVAVVIGYKPAY
FT                   NWITVDLISTLNRAEKEFSSDVVPAEILLEIIANVQKDIISQANAKKVIAEYIDAPSAI
FT                   EAIIEKLGLKQVSDEGMIRELVQGIIAANPQQAADFKAGKTKLMSFFVGQAMKASKGKA
FT                   NPKQVNQIVQEELNK"
FT   CDS_pept        21074..21481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0022"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0022"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08038"
FT                   /protein_id="CAL08038.1"
FT                   /translation="MNTNKFYYELMKLNVLSSSYVDDSYKAAWHGNVYPFFHDSKYEFH
FT                   YEVAKYFDRADEKTIDKLCSLLDDYVDERADFSDFEAKVEKVVGKGNVYYVLNYIFRAG
FT                   QYKKLLENIRLNKIHFSQHFIDRFEAGGYLD"
FT   CDS_pept        complement(21497..22378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0023c"
FT                   /product="Lipase/acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="Similar to Q9F7Y6 Glycerophospholipid-cholesterol
FT                   acyltransferase from Aeromonas salmonicida (336 aa). FASTA:
FT                   opt: 367 Z-score: 437.4 E(): 1.8e-16 Smith-Waterman score:
FT                   407; 30.183 identity in 328 aa overlap ORF ftt0023c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0023c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08039"
FT                   /inference="similar to sequence:UniProtKB:Q9F7Y6"
FT                   /protein_id="CAL08039.1"
FT                   /translation="MFSNGSIWITMLNGFLENKIPISNYAVGGATAVFEPSWTDLGLPY
FT                   TLGTELRAYAIDKGAHDTNKNLAIFFIGANDYLTISADQDPTSLHIIASEVTDKIIAAV
FT                   NKVNAQMTLIIGLPNLGLTPESKQIGNQNLLKEVSLLHNELLKQFAENQTNIQFVDINQ
FT                   IFEILINDTDNFNKEYQTSIDPNKTTEGCWRGGYFAYEHTNESKHFYKSLLTSNPKPKV
FT                   LQNFNNITSKKIDMGKIPLTPDITTAILTAETITLCKNPQEFVFWDGVHPTYQIHKALF
FT                   KYIAKEYLGIRL"
FT   CDS_pept        complement(22646..22990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0024c"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0024c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0024c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08040"
FT                   /protein_id="CAL08040.1"
FT                   /translation="MENSLLISNFKQWLFLILLSSISISSICYSNARSEIIIENNCSVP
FT                   IFLNVAPGNSTGKKIDNQKLLANEYINLGQYTNDKIFNNTSIININYHSENLQNNGSIQ
FT                   FSLKKWLEIK"
FT   CDS_pept        complement(23038..24567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0025c"
FT                   /product="hypothetical membrane protein"
FT                   /note="ORF ftt0025c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0025c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08041"
FT                   /protein_id="CAL08041.1"
FT                   /translation="MLNKINIVFICFLVLSITPFMGFSNSFKNSNEQSQKSNSIDKQGI
FT                   TQLQSQIANIQAEINHLTQIKNSNNSAQFATYSSKVENIGLPNSLPDNNKLTLDIMTNI
FT                   DSDSSIINLSDCSIGGIFDKDGGINVGGAPAITTQGEVTFLGAYSGNNTVPIGMISSNL
FT                   FASTVMGLRNKFDSYSIFFGGKIEADAQLWFGSSTISNKATNLASNGQNISLTAANLYF
FT                   LSNVGHYVTAEIEFNTTELNNFSLGNAFVIFGNLDTSPFFLTAGRNKLSVGAFGGGGPW
FT                   TGGITKNFLSPGKVTNVSLNYKSDVWNANVAVFGSNDNQFNFSTGLFYAQKWTQDIAVG
FT                   FNTGYVYNMAGAGNPSLSRFLQSQGHPTDTIGSFNVNTNITYTIAGGFLNLGAGWATTT
FT                   NKKDFTGSGKDVLAGAWYAAANYSLVFRGRKTNFGISYGKSYNSTNIPMTLTASPLNFG
FT                   RSSSGIQKQIIVSSQRAYFDNNVLFGPEYSYQQLYNGKHMNTITIDMAVYL"
FT   CDS_pept        complement(24652..25842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0026c"
FT                   /product="conserved membrane protein"
FT                   /note="Similar to Q9HWP5 Probable MFS transporter from
FT                   Pseudomonas aeruginosa (402 aa). FASTA: opt: 568 Z-score:
FT                   586.0 E(): 9.5e-25 Smith-Waterman score: 568; 26.425
FT                   identity in 386 aa overlap ORF ftt0026c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0026c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08042"
FT                   /inference="similar to sequence:UniProtKB:Q9HWP5"
FT                   /protein_id="CAL08042.1"
FT                   /translation="MQIDNKNLKYIPLLVLLTWFLGNMGVHFLLPLLPLLSNNLDASVK
FT                   LTQYVIAFFLAGKALGMIVYGPLSEIYGRRKFMLFGLILYMSSSLLCMLTTDIYWLIFW
FT                   RFVQGLGVSGTILMGRVIINDSYPNDKAANIFGYLFALAAVIIACLPTLGGIIAIFKNW
FT                   QLAFATMMIYSSLIFVIMLKFLPETQSEQFQKSFSLIGIIKDYSNILRNRVFLGYLMCT
FT                   SLMVAGESAFNTNAAFLMIKTYGVSPKIFGMMMSSLLIAHLLGAAICGRYVVKRGISKL
FT                   TGVGALILVLAAMFLSVTSILKFDGPYLTITAMFIYFLGTGFIMTTAAVGVVSPFPKMI
FT                   GTAMAFALSLEFLLSALSSFITSHLSISSLFPITVLITLLSLGSFAMWFFCIKRDK"
FT   CDS_pept        complement(25858..27111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysA1"
FT                   /locus_tag="FTF0027c"
FT                   /product="diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /note="Similar to DCDA_BACSU (P23630) Diaminopimelate
FT                   decarboxylase from Bacillus subtilis (441 aa). FASTA: opt:
FT                   437 Z-score: 538.0 E(): 4.5e-22 Smith-Waterman score: 437;
FT                   27.295 identity in 414 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0027c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08043"
FT                   /inference="similar to sequence:UniProtKB:DCDA_BACSU"
FT                   /protein_id="CAL08043.1"
FT                   /translation="MSKLSDSKSVFSKLSNKQIETIIQRYASPCFIIDENALLERARLF
FT                   QQAILNQYQNSIAAYSVKTQSLNTIIQKFYEVGFIPEVVSSDEFEQIQKLQLCDKSIIF
FT                   NGPYKNDASLIKALQLNAMINCDHFDEILRIAKIAKKLNITAKIGLRVADNKTPQNWSR
FT                   FGFALTDQQSNSDIFTTIDKIQQIANIQLAGLHCHIGTNIRDISRFTAMAKNIAELAET
FT                   ILTKYKLTLEWIDLGGGLAGISPTLSDKRLQPYNPFDLELYAATIIAPLKEYLNKTNDK
FT                   TKLIFELGRSLVDYSVALLTTIVGTREQNEDFQSLITDAGIHTIPTISTYRHPIYHLKT
FT                   DSYHKKTLLLGPSCMQHDFLHDDIFLPKLEYGDKLLIDGVGAYNISRNNEFIHLKPSVI
FT                   LIDKNHQYQVLRVRQTHQ"
FT   CDS_pept        complement(27104..28366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0028c"
FT                   /product="conserved membrane protein"
FT                   /note="Similar to YCEE_ECOLI (P25744) Hypothetical
FT                   transport protein yce from E. coli (408 aa). FASTA: opt:
FT                   364 Z-score: 408.7 E(): 7.1e-15 Smith-Waterman score: 450;
FT                   26.582 identity in 395 aa overlap ORF ftt0028c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0028c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08044"
FT                   /inference="similar to sequence:UniProtKB:YCEE_ECOLI"
FT                   /protein_id="CAL08044.1"
FT                   /translation="MNNHIKAQILLLCFCQLIIIAAMEMSNPFLPIYLQSLGDFDLLPV
FT                   NAWNVLAYAMPLISAMLFSPFWGKYADRFGYKTMILRAALALAIIQLLIYLTNSALLFI
FT                   TLRFIQGAIAGFLLAAQSYAVVIVSKEFRSRILAWLQSSTAIGIAIGPLIGGVLATLLS
FT                   YNQIFLICAVIACCIFIILLIKLESISNPSLLSKQDNNKNCYHKNTSNNYLIYVYFSVI
FT                   FLAILLSQTAKFLPQSFFAIYAKEFFSSDPIIIAAIYAAPAFSLLLFSAPIGYLFDKLL
FT                   NKQVNNQYFFASSYFIILFAISTVAIYVHGFTHNIYLILAARFILGVTFAGTLPCLFSL
FT                   ACRTKDNNFGFLIGYCNTFSKFGNLCGIFLGGFIFQISSMQTVFYVTAIIYMFLVVIYI
FT                   CLLYLFDLKSSNFKNKELINV"
FT   CDS_pept        complement(28373..30292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0029c"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to AAO89973 (Q83EA5) FrgA protein from
FT                   Coxiella burnetii (528 aa). FASTA: opt: 1047 Z-score:
FT                   1237.4 E(): 4.9e-61 Smith-Waterman score: 1053; 34.051
FT                   identity in 511 aa overlap ORF ftt0029c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0029c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08045"
FT                   /inference="similar to sequence:INSDC:AAO89973"
FT                   /protein_id="CAL08045.1"
FT                   /translation="MHIEQLQKNKTPLNIETLELIGLITADLNPTISSIKASTLKNQFK
FT                   RVALSFYREGLLGKSKKINDTLFFYNINNDKILKINNPILKSLNRIELPDQLTIQDCLT
FT                   KRETSLENIEELINWAKDNNPQINHDDWQQFEYELDNSFENELSMNIYRGLRQKQLANT
FT                   INSANYLNLWQWLTTTMSKNQQLAFLEQWGAVGHIYHPSSKTKIGLSKFENILYSPEFE
FT                   NEVNIIFGAIHKNIAHIEIIDNRIDNYQNWMIINYPEQYKIWYHELDNRGLDSNNYLMI
FT                   PIHPWQAEHILPAKHKCLIDCQQLIIINDCKYTTKPSMSFRTMLPVATKDKTLMPHIKL
FT                   PVAIHATSVTRTVSPESVKTGPRISKILLEILAKENHLAKNMDILADIAGIHTTKACRK
FT                   DDIRQLSAIFRTNPEELLDSDEVACPLASLFVKTPQNQALICDILELLDYNQPSQILAY
FT                   FRKYTQITLTACLDLYLLYGIALEAHQQNTLVVFKENMPQKLLIRDLGGMRLHLPSFEA
FT                   SGFHFPKDTFSLTFTNSQTITRRKFIHACLQSNIGELVIQLSSHYKIAEGRFWTIVKGE
FT                   IHQRFEYLKPRISPDKYKQEYTQILEKPWSIKALTRMRLNDKLECDKDDMQGDIYINLK
FT                   NPLA"
FT   CDS_pept        complement(30545..30967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fur"
FT                   /locus_tag="FTF0030c"
FT                   /product="ferric uptake regulation protein"
FT                   /note="Similar to FUR_ECOLI (P06975) Ferric uptake
FT                   regulation protein from E. coli (148 aa). FASTA: opt: 396
FT                   Z-score: 515.7 E(): 7.8e-21 Smith-Waterman score: 396;
FT                   40.714 identity in 140 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0030c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08046"
FT                   /inference="similar to sequence:UniProtKB:FUR_ECOLI"
FT                   /protein_id="CAL08046.1"
FT                   /translation="MNSKNLDLKEFGFKVTQPRVEILKLFEKNKDKHLSPDDVFSKLKA
FT                   QGSTTGIATVYRVLNQFESAGIINRLKLDNEQVMYELNQGEHHDHIICVKCNMIQEFYS
FT                   PGIEALQKQIVESFGAEMIDYSLNIYVKCKSCREKI"
FT   CDS_pept        31176..31574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoA"
FT                   /locus_tag="FTF0031"
FT                   /product="NADH dehydrogenase I, A subunit"
FT                   /EC_number="1.6.99.5"
FT                   /note="Similar to Q9A6X0 NADH dehydrogenase I, A subunit
FT                   from Caulobacter crescentus (125 aa). FASTA: opt: 398
FT                   Z-score: 508.1 E(): 2.1e-20 Smith-Waterman score: 398;
FT                   46.565 identity in 131 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08047"
FT                   /inference="similar to sequence:UniProtKB:Q9A6X0"
FT                   /protein_id="CAL08047.1"
FT                   /translation="MSTSVYEQFAPILIFLIIAFGLGAAFAIIGKVLSVIVGANNPNKT
FT                   KGETFECGFPTFGDAREKLDVRFYLIAVLFLVFDLELAFIIPWGINLRASAGMPAISDH
FT                   AFFAMIIFLVVLFLGLIYAWKKGALEWE"
FT   CDS_pept        31565..32041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoB"
FT                   /locus_tag="FTF0032"
FT                   /product="NADH dehydrogenase I, B subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="Similar to Q9K1C2 NADH dehydrogenase I, B subunit
FT                   from Neisseria meningitidis (160 aa). FASTA: opt: 897
FT                   Z-score: 1164.1 E(): 6e-57 Smith-Waterman score: 897;
FT                   79.747 identity in 158 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08048"
FT                   /db_xref="GOA:Q14K37"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14K37"
FT                   /inference="similar to sequence:UniProtKB:Q9K1C2"
FT                   /protein_id="CAL08048.1"
FT                   /translation="MGIGNENKGFITASADALINWVRTGSLWPVTTGLACCAVEMMHAG
FT                   AARYDLDRFGIVFRPSPRQSDVLIVAGTLCNKMAPALRQVYDQMPDPKWVISMGSCANG
FT                   GGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALVYGIIQLQNKIIRKDTIARK"
FT   CDS_pept        32038..32688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoC"
FT                   /locus_tag="FTF0033"
FT                   /product="NADH dehydrogenase I"
FT                   /EC_number="1.6.5.3"
FT                   /note="Similar to NUOC_NEIMB (Q9K1C1) NADH-quinone
FT                   oxidoreductase chain from Neisseria meningitidis (197 aa).
FT                   FASTA: opt: 516 Z-score: 659.3 E(): 7.8e-29 Smith-Waterman
FT                   score: 568; 44.286identity in 210 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08049"
FT                   /db_xref="GOA:Q14K36"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR020396"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14K36"
FT                   /inference="similar to sequence:UniProtKB:NUOC_NEIMB"
FT                   /protein_id="CAL08049.1"
FT                   /translation="MIVSTKLQDHFDKITKILSGFGVEGCISYGEITFSIRDQRDIHLI
FT                   LKKLKKEYLFEQLTDVTAVDYLTYGQSDWQVGKVVSQTGFSRGRQQDFKTAAVDNRFEI
FT                   IYQLLSMANNVRIRVKCKLKDAQIILVDSVSDLWPSANWAEREVYDMFGIYFNNHPDLR
FT                   RVLTDYGFVGHPLRKDFPQTGYVEMRYDENLGRVVYEPVEIDDRVNTPRVIRN"
FT   CDS_pept        32710..33963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoD"
FT                   /locus_tag="FTF0034"
FT                   /product="NADH dehydrogenase I, D subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="Similar to Q9K1C0 NADH dehydrogenase I, D subunit
FT                   from Neisseria meningitidis (418 aa). FASTA: opt: 2017
FT                   Z-score: 2551.9 E(): 3e-134Smith-Waterman score: 2017;
FT                   69.249 identity in 413 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0034"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08050"
FT                   /db_xref="GOA:Q14K35"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14K35"
FT                   /inference="similar to sequence:UniProtKB:Q9K1C0"
FT                   /protein_id="CAL08050.1"
FT                   /translation="MAEYKNYTLNFGPVHPAAHGVLRLILELDGENVVRADPHVGLLHR
FT                   GTEKLAEFKPYNQSIGYMDRLDYVSMMCNEHAYVMAIEKLLQLEVPERAKYIRVMFAEM
FT                   TRILNHLLWVAACGIDLGAMTVFLYAFRVREDLFDCYEAVSGARMHAAYFRPGGVARDL
FT                   PTQMPQYQKTRFTSKRKAKKLNEPRQGSMLDFLDHFVVDFEKSLDEIDTLLTDNRLWKQ
FT                   RTVDIGTVTAERAKELGFTGPMLRGSGVAWDLRKTQPYEVYHKLEFDIPIGANGDCYDR
FT                   YLVRMAEMRESNKLIKQCVDWLRANPGPVLSDNNKVAPPKRNAMKNNMEELIHHFKLFS
FT                   EGYCTTEGEVYVGTEHPKGEFGVYIKSDGANKPYRLKMRAPGFAHISAMDELLSGHMLA
FT                   DTPAIISTIDVVFGDVDR"
FT   CDS_pept        33973..34461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoE"
FT                   /locus_tag="FTF0035"
FT                   /product="NADH dehydrogenase I, E subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="Similar to Q83BQ9 NADH dehydrogenase I, E subunit
FT                   from Xanthomonas campestris (174 aa). FASTA: opt: 528
FT                   Z-score: 689.7 E(): 1.6e-30 Smith-Waterman score: 528;
FT                   52.318 identity in 151 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08051"
FT                   /inference="similar to sequence:UniProtKB:Q83BQ9"
FT                   /protein_id="CAL08051.1"
FT                   /translation="MSLVDLISPQAREDIDRVLSKFPADQRRSAILEGLHILQDQNGGY
FT                   LTDDLQTALAEYLQVSKVDVYEVATFYCMYNLKPVGRHKLNVCTNVSCMLNGAYEILAH
FT                   IEKKLAIKPGETTKDGRITLKEVECQGACCGSPMLEVDKVFYENLTIEKVNQIIDSLE"
FT   CDS_pept        34468..35742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoF"
FT                   /locus_tag="FTF0036"
FT                   /product="NADH dehydrogenase I, F subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="Similar to Q83BR0 NADH dehydrogenase I, F subunit
FT                   from Coxiella burnetti (422 aa). FASTA: opt: 1851 Z-score:
FT                   2306.0 E(): 1.5e-120 Smith-Waterman score: 1851; 61.848
FT                   identity in 422 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08052"
FT                   /inference="similar to sequence:UniProtKB:Q83BR0"
FT                   /protein_id="CAL08052.1"
FT                   /translation="MANEVCFRTLHLDKPYSLESYLSVGGYSYWNKILTEKIPPEQIIE
FT                   ELKISGLRGRGGAGFPTGLKWSFMPRNAPGQKYVVCNSDEGEPGTCKDREILRNNPHQL
FT                   IEGIAIAGYVVGATAGYNYTRGEFYEPIARFEDALIEAYQAGLLGTNIKSSGISFDLYS
FT                   AIGAGAYICGEETALLNSLEGKKGRPRFKPPFPAFKGLYDKPTNINNTETYASVPAILQ
FT                   YGGEWFKKLGTEKSGGTKLFCVSGHVQQQRVVEIGLGMPFKELLDMCGGVRNGNKLKAV
FT                   IPGGSSSKILTADEMMAVTMDYESIAAAGSMLGSGAVVVLDETTCIVRTLARLADFYYE
FT                   ESCGQCTPCREGTGWLARTLHRIVAGEGRPEDIDTLVRVATNIEGNTICGLGDAAAWPV
FT                   QSYIDKFRHEFVYMIENNGRSIVDQ"
FT   CDS_pept        35760..38126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoG"
FT                   /locus_tag="FTF0037"
FT                   /product="NADH dehydrogenase I, G subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="Similar to Q83BR1 NADH dehydrogenase I, G subunit
FT                   from Coxiella burnetii (787 aa). FASTA: opt: 1640 Z-score:
FT                   1907.6 E(): 2.3e-98 Smith-Waterman score: 1686; 38.677
FT                   identity in 786 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0037"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08053"
FT                   /inference="similar to sequence:UniProtKB:Q83BR1"
FT                   /protein_id="CAL08053.1"
FT                   /translation="MSDNKESKKISIEIDGKDYQALPNQSIIEVADANGIYIPRFCYHK
FT                   KLSVAANCRMCLVDVEGARRASPACATPVMDGMKVKTRSEEALQMQKDVMEFLLINHPL
FT                   DCPICDQGGECELQDIAMGYGNTTSEYLESKRTVEDPELGPLVATDMTRCILCTRCVRF
FT                   GEEIAGVKELGVMGRGDHSAISTYISGEMVDSEISANIIDLCPVGALTSKPFRFKARSW
FT                   ELKQFPTLSAGDALATEINAHIYQNKLVRVVPRENDITGTWIADRDRFEYTGLYSQDRI
FT                   QQPMIKKTGDWVDLSWEEALDFVKVAIQKTIEKDGADAISAIVSETATSEEMYLTKKLL
FT                   AAVGSVNIDARVRQYADIPGISAGKGLSCSLEDIRESDFILVFGSNIRKEYPLVNIAIK
FT                   DAVEKNAAKAVAWNVCDYNFNYDIKQVRLAADNIQYIALSLLKAIFVRANLPYGDLDEI
FT                   LRKVDPAAEVRDVADRIVAAKAPKIIIGQDIVNTSGFETVFSILDVLEKVTSVRGGVLA
FT                   TNVNSVAADRIFSSSKSKFSTYKCLNGRTNTKLLLTVHTELAKDSLYGEQKLRNALENI
FT                   DIVVSFTAFADKFTKDTADIILPIATHYETSGSFVDLFGNRKEFKQVVKPYAGNKELWR
FT                   VLRVLGNLLELEGFDYNSIAEVTNDAYATRARVGVNHVTQILNANLDYQKEVAFVASNS
FT                   MYSTTSLLRRAEPLQKTTDAKRFAGVRISQELADEIGLKGQSGVIKIYNIDNEINPEVV
FT                   VDPSLQAKNIMLPRALFKDFLSSDNISIKLVEEER"
FT   CDS_pept        38128..39138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoH"
FT                   /locus_tag="FTF0038"
FT                   /product="NADH dehydrogenase I, H subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="Similar to Q83BR2 NADH dehydrogenase I, H subunit
FT                   from Coxiella burnetii (340 aa). FASTA: opt: 1510 Z-score:
FT                   1695.3 E(): 1.5e-86 Smith-Waterman score: 1510; 60.843
FT                   identity in 332 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0038"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08054"
FT                   /db_xref="GOA:Q14K31"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14K31"
FT                   /inference="similar to sequence:UniProtKB:Q83BR2"
FT                   /protein_id="CAL08054.1"
FT                   /translation="MLGYILWTSLYVLLIVIPLILVVAYYTYAERKVIGYMQDRIGPNR
FT                   VGSFGLLQPIFDALKLFLKEIIVPTNSNRYLFFIAPILAFAPAYAAWAVIPFSKGVVLS
FT                   DMNLGLLYILAMTSFSIYGIVIAGWASNSKYSLFGALRAGAQVISYELAMGFAIVGVVI
FT                   AAGSMGITGIIEAQSGGIWHWYFIPLFPLFIVYFIAGIAETNRAPFDVVEGESEIVAGH
FT                   HIEYTGSRFALFFLAEYANMILISILTSIMFLGGWNSPFQATALESIFGFVPGVVWLFA
FT                   KTGIFMFMFLWVRATYPRYRYDQIMRLGWKIFIPLTFVWVVIVACMVRLGVGPWW"
FT   CDS_pept        39152..39640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoI"
FT                   /locus_tag="FTF0039"
FT                   /product="NADH dehydrogenase I, I subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="Similar to Q83BR3 (Q83BR3) NADH dehydrogenase I, I
FT                   subunit from Coxiella burnetii (163 aa). FASTA: opt: 721
FT                   Z-score: 964.9 E(): 7.4e-46 Smith-Waterman score: 721;
FT                   62.577 identity in 163 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08055"
FT                   /db_xref="GOA:Q14K30"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14K30"
FT                   /inference="similar to sequence:UniProtKB:Q83BR3"
FT                   /protein_id="CAL08055.1"
FT                   /translation="MRNITNFLKTFLLWELLKGLKVTGKHFFTRKVTVQYPDEKTPISN
FT                   RFRGLHALRRYENGEERCIACKLCEVVCPALAITINSTEREDGTRRTSSYEMDLFKCIF
FT                   CGYCEESCPVDSIVETNILEYHFEERGENIMTKAKLLAIGDKYEAQIAADRLQDKDFR"
FT   CDS_pept        39645..40250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoJ"
FT                   /locus_tag="FTF0040"
FT                   /product="NADH dehydrogenase I, J subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="Similar to Q9K1B2 NADH dehydrogenase I, J subunit
FT                   from Neisseria meningitidis (223 aa). FASTA: opt: 387
FT                   Z-score: 452.6 E(): 2.6e-17 Smith-Waterman score: 387;
FT                   38.191 identity in 199 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08056"
FT                   /inference="similar to sequence:UniProtKB:Q9K1B2"
FT                   /protein_id="CAL08056.1"
FT                   /translation="MVVTDILFYTFASLAIIFALVLVLANNPVNSVIAMIFTFIFTAAV
FT                   WIILQQVYLALLLIVVYVGAVLVMFLFVVFMLDLHVEEQGRVGRFFYALAAVVVCAIFA
FT                   TVISYAATNVFAGAMMQGGVGGLKIIGLTMFSNANLYVFELVDFILLAAMTAAITLTLR
FT                   AKRKGNKTVDPAQQVKVRAKDRLTMVKMPSNNEGAKDE"
FT   CDS_pept        40228..40560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoK"
FT                   /locus_tag="FTF0041"
FT                   /product="NADH dehydrogenase I, K subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="Similar to Q9A6Y6 NADH dehydrogenase I, K subunit
FT                   from Caulobacter crescentus (101 aa). FASTA: opt: 300
FT                   Z-score: 405.7 E(): 1e-14 Smith-Waterman score: 300; 43.000
FT                   identity in 100 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08057"
FT                   /db_xref="GOA:Q14K28"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14K28"
FT                   /inference="similar to sequence:UniProtKB:Q9A6Y6"
FT                   /protein_id="CAL08057.1"
FT                   /translation="MRALKMNSISVSVTHGLIFSTLLFVISVAGIIINRRNILILLMSI
FT                   ELMLLAVNTNFLIFANMHQQAMGGVFVFFIMAVAAAETAIGLAIVVAIFRKRKTIDLSK
FT                   LNTLRG"
FT   CDS_pept        40570..42579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoL"
FT                   /locus_tag="FTF0042"
FT                   /product="NADH dehydrogenase I, L subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="Similar to Q83BR6 NADH dehydrogenase I, L subunit
FT                   from Coxiella burnetii (653 aa). FASTA: opt: 1934 Z-score:
FT                   2065.6 E(): 3.6e-107 Smith-Waterman score: 2090; 50.760
FT                   identity in 658 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08058"
FT                   /inference="similar to sequence:UniProtKB:Q83BR6"
FT                   /protein_id="CAL08058.1"
FT                   /translation="MIINTQVAAVLIAVIVLAPLLGALIAGFGGKSVKNAGVNFFTISL
FT                   CGLSFVLSVILAYGVFSGAEVYSVSFYQWAPISNMFAFDVGFTVNKITVYMMLIVTFVS
FT                   TLVHIYSIGYMKGEEGYARFFAYISGFTFAMLCLVMGNNFLLLFFGWEGVGLFSYLLIG
FT                   FYFNRDKANVASLRAFIVNRIGDLGFLLGIGAVILYTKSVDYTTVFAALPDIDNTQTIH
FT                   FLGISFSPVTLMCSLLFIGAMGKSAQFPLHSWLEGSMEGPTPISALIHAATMVTAGVFM
FT                   VARLSPMFVLSPAALSFVLIIGAITCLFMGLIAIVQTDIKRVIAYCTLSQLGYMMVAQG
FT                   AGAFSIGMFHLMTHAMFKALLFLAAGSVIVAMHHEQDIRRMGGLRKYMPVTYLCMLIGA
FT                   WALAALPPFSGFFSKDLIIEAAQATTVYGHEFAYYMVLACAFVTSFYIFRMFFLVFHGK
FT                   ERMSDEERSHLKESPFSILIPLILLAIPSVFVGEYFFSSILSQEHGLFGNTITPFIQAG
FT                   LGWESVTAHLANEPAIVNSMAFIKHSVTTLPFWLAFSALVLAYVLYVWLPAIPRLFANA
FT                   KSGFGIIYHILVKKYFIDALYDVIFVNIFLAISNFLWKVVDIFIIDKTVVNGTSNLIYH
FT                   TGDSFRKIQRGYLFDYAFVMMVGVLLFMILLISV"
FT   CDS_pept        42605..44194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoM"
FT                   /locus_tag="FTF0043"
FT                   /product="NADH dehydrogenase I, M subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="Similar to Q83BR7 NADH dehydrogenase I, M subunit
FT                   from Coxiella burnetii (506 aa). FASTA: opt: 1099 Z-score:
FT                   1147.9 E(): 4.8e-56 Smith-Waterman score: 1659; 47.228
FT                   identity in 523 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08059"
FT                   /inference="similar to sequence:UniProtKB:Q83BR7"
FT                   /protein_id="CAL08059.1"
FT                   /translation="MNLGNYLLSLIIWLPIVGGFVVLATRTKELHGDAARWVALVFSCL
FT                   TLALCVPLVTSFDYSSSAMQFQESVKWFKVFGMHDIYYSLGVDGFSVLFIVLTSFATLV
FT                   IVLAAWTSIKTKVRQYMAIFLITCGLTNGVFCATDSILYYVFWEALLIPTCLGIGIWGG
FT                   KHKAYAAVKYFMYTFFGSVFLLAAILYIQTRVAASPTHFLVNQDTYSIQNFIAWATQSQ
FT                   GFIDSVKFTLTAQWLVFGAFFLAFAVKIPMWPFHSWLPDAHSEAPAGGSVILAALMLKL
FT                   GAYGFLRFAIPMLPEVTASLEYVLIIMSLIAIVYVGVVAVAQTDVKRLIAYSSISHMGL
FT                   VTLGLFSIFILKNADPVLGTTHAQLALQGAVFQMIAHAFSSGGMFIGIGYLYLRMHTRE
FT                   ISDFSGVAKTMPIFATFFLLFCMANVGLPGTSGFVGEFMILLAVFQYSPLIALIAGLTL
FT                   VIAPIYTLWMYKRVFFGEVVSTQVASLTDLNRMELFVFILLAVPTLLFGFYPEPILQLS
FT                   AAASAHIVGLSL"
FT   CDS_pept        44204..45661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoN"
FT                   /locus_tag="FTF0044"
FT                   /product="NADH dehydrogenase I, N subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="Similar to Q83BR8 NADH dehydrogenase I, N subunit
FT                   from Coxiella burnetii (482 aa). FASTA: opt: 1231 Z-score:
FT                   1222.9 E(): 3.2e-60 Smith-Waterman score: 1231; 39.914
FT                   identity in 466 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08060"
FT                   /inference="similar to sequence:UniProtKB:Q83BR8"
FT                   /protein_id="CAL08060.1"
FT                   /translation="MIMSLSILYILPEILLALGVIVVMFSGLFLHGKIRNINYIFFQVF
FT                   TLLALIATFAKEYLIQTTGSAFEGQVVFSGFAYTLQLVILVLAVFVALYSRDYVKDRKI
FT                   SDGDFYTLLMLCVLGAMVLTAAHSLVTIYVGLELLSLPMYALIAIYRDSGKGLEAAIKY
FT                   FVLGAIASALLLFGMSFVYGMTGKLDITEIANVLAHGNFAGLQQQFLLVCLVMMIATFL
FT                   FKLGAFPFHMWLPDVYQGAPNAVANIVATIPKVAAFAMLVNILFVGFPSLKDSWIYLFR
FT                   IIGILSIFFGSLVALSQTNVKRLLGYSTVSQIGFVLLATTLNPQGYALTAASFYVIVYV
FT                   FTTLAVFGVLTTISVGGYEVQDLNDLKGFNTKDSWLAFILLIVLFSMAGIPPFGGFIAK
FT                   LFVVMGLINDGNYFLACFVLFMAVIASFYYVRVIKTMYFDDPDNDETVKPPLTSLIALS
FT                   INGLVLLFLGIMPMLLLGVLTQVTNVI"
FT   CDS_pept        45737..45931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0045"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Q8DDC7 Conserved hypothetical protein
FT                   from Vibrio vulnificus (83 aa). FASTA: opt: 165 Z-score:
FT                   224.7 E(): 0.00013 Smith-Waterman score: 165; 45.763
FT                   identity in 59 aa overlap ORF ftt0045"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08061"
FT                   /inference="similar to sequence:UniProtKB:Q8DDC7"
FT                   /protein_id="CAL08061.1"
FT                   /translation="MKEILGPLNDVIKNSKENIVNKSLKKLDVVSREEFEVQKKILLKT
FT                   RQKLEQVEAKLDKLLAEKK"
FT   CDS_pept        join(45933..46063,46063..47257,47257..47421)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0046"
FT                   /product="chelatase family protein, pseudogene"
FT                   /note="Similar to CAD84104 (Q82XR1) Probable Mg(2+)
FT                   chelatase family protein from Nitrosomonas europaea (500
FT                   aa). FASTA: opt: 1712 Z-score: 1729.4 E(): 1.8e-88
FT                   Smith-Waterman score: 1712; 54.582identity in 502 aa
FT                   overlap. Contains two frameshifts after aa 44 and 442.
FT                   Second frameshift occurs at a heptanucleotide sequence and
FT                   so could be part of a programmed translational frameshift
FT                   ORF ftt0046"
FT                   /inference="similar to sequence:INSDC:CAD84104"
FT   CDS_pept        47478..48512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemE"
FT                   /locus_tag="FTF0047"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /note="Similar to DCUP_ECOLI (P29680) Uroporphyrinogen
FT                   decarboxylase from E. coli (354 aa). FASTA: opt: 1106
FT                   Z-score: 1322.3 E(): 9.2e-66 Smith-Waterman score: 1106;
FT                   47.674 identity in 344 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08063"
FT                   /db_xref="GOA:Q14K23"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14K23"
FT                   /inference="similar to sequence:UniProtKB:DCUP_ECOLI"
FT                   /protein_id="CAL08063.1"
FT                   /translation="MRKLFLDAFGEKKLDKPPVWIMRQAGRYLPEYRAVRAKFDNFMDM
FT                   CRNADACCEVALHPLQRYDLDAAIVFSDILTIPEAMGMDLKFIKGTGPVFSEPIQSQKD
FT                   LDKLKSIEDSIGSLDYVYNAVKTTSSAINVPLIGFTGSPWTLAAYMIEGSGSKQFNKLR
FT                   KMMYANPQLMHSLLQRLADITIIYLLEQVKAGASSVMIFDTWGGILPLEHYKNFSLKYM
FT                   EYIAKNVKQKINIPIVFFTKGGSNFFEEIKDKSCDGVGVDWSVTLKQARHRIGVGKVLQ
FT                   GNFDPAFLYGSKQSIRETVRANIEFIQSDKLNNYIVNLGHGIYPDIDPDSVRVMIDAIR
FT                   EFSA"
FT   gene            48587..48660
FT                   /gene="tRNA-Met (CAT)"
FT   tRNA            48587..48660
FT                   /gene="tRNA-Met (CAT)"
FT                   /product="transfer RNA-Met"
FT   CDS_pept        48732..49190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0048"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Q88DV5 Conserved hypothetical protein
FT                   from Pseudomonas putida (169 aa). FASTA: opt: 402 Z-score:
FT                   490.7 E(): 1.7e-19 Smith-Waterman score: 402; 43.243
FT                   identity in 148 aa overlap ORF ftt0048"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08064"
FT                   /db_xref="GOA:Q14K22"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14K22"
FT                   /inference="similar to sequence:UniProtKB:Q88DV5"
FT                   /protein_id="CAL08064.1"
FT                   /translation="MKMLLDDLYEIVEPITADLGYILWGIEVVGSGKLTIRIFIDHENG
FT                   VSVDDCQIVSKEISAVFDVEDPVSGKYILEVSSPGMNRQIFNIIQAQALVGFNVKAVTL
FT                   APVGSQTKFKGVLERVEGNNVILNLEDGKEISFDFDELKKLRVSPDFS"
FT   CDS_pept        49208..50677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="FTF0049"
FT                   /product="N utilization substance protein A"
FT                   /note="Similar to NUSA_ECOLI (P03003) N utilization
FT                   substance protein A from E. coli (495 aa). FASTA: opt: 1340
FT                   Z-score: 1512.9 E(): 2.2e-76 Smith-Waterman score: 1340;
FT                   41.283 identity in 499 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08065"
FT                   /inference="similar to sequence:UniProtKB:NUSA_ECOLI"
FT                   /protein_id="CAL08065.1"
FT                   /translation="MSKELLLVLETVANEKDISKDLLFEAMEEALAIITKKELDEHMNI
FT                   EVKIDRVTGDFKADRVWHIVSEDEDLIDYSKELYEDVVQEKGYNVKAGDVMREPVEVKE
FT                   YGRIAATMAKQILMKKIKNFEREKSARFYQNKIGDIVYGEIKRATYEILVVDLGNNAEG
FT                   ILPKKDLIARERYRVGDKIRACVEAVESDESGKPNTIMLSRSSNTMLKALFKLEVPEVE
FT                   EELINIVNVVREPGFRSKVTVKSNDQRIDPCGACVGVRGSRIHSIMSELNGEKVDVILW
FT                   NEDMVQYAINSLSPVDAADILEVNVDEETNSIDIVVKQESLSKAIGKNGVNVRLASSLI
FT                   GWKINVLSDAEQEEKQMSIVEKFVEALDIDHDFALVLIEEGIETLEDLAYLDRAELLEI
FT                   EGFDEEIVDELQERAKAVILSQALGGKKPAQDLLDMQGMSLDLAEQLAQNNIVTMEDLA
FT                   ELSVDELLDIVDIDEEQATNLIMQARAPWFE"
FT   CDS_pept        50716..53256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /locus_tag="FTF0050"
FT                   /product="translation initiation factor IF-2"
FT                   /note="Similar to IF2_ECOLI (P02995) Translation initiation
FT                   factor IF-2 from E. coli (890 aa). FASTA: opt: 2711
FT                   Z-score: 2609.4 E(): 1.9e-137 Smith-Waterman score: 2779;
FT                   53.132 identity in 894 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08066"
FT                   /db_xref="GOA:Q14K20"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14K20"
FT                   /inference="similar to sequence:UniProtKB:IF2_ECOLI"
FT                   /protein_id="CAL08066.1"
FT                   /translation="MAEITVGQLAQQTNKEVDALLKQLKSFGIEKSSEKDTLTPTEMKT
FT                   LLEKINSAKNTATRKKVTSVKLDGKHKINVSVKRKRRVAKKVEQQESTTLEQPQELETM
FT                   VQEVSQQVDIVKEQDNIEQIVENKEAVKVQEQRQAEIAKPVIKDSGFKITAMPEIKIEE
FT                   IVAEDDEGLAASDKQAKKKAAKKVFSEAVNTNTKYKREEEEKKSKAKKAGGKGFKKANP
FT                   RQLSQLAGDLESFDEFGAKKGKLKAPKVKKQEFTKPVENTVRTVEIHEGITVSELAQKM
FT                   AVKGAEIVKVLFNMGVMATINQSLDQDTAILIVEEMGHKYTLHNENALEEAVTIVDRSS
FT                   YKKISRAPVVTIMGHVDHGKTSLLDYIRQTRVVAGEAGGITQHIGAYSVKTDKGSITFL
FT                   DTPGHEAFTSMRARGAKSTDIVILVVAADDGVMPQTEEAIQHAKAARVPIVVAVNKIDK
FT                   PEADPDKVISELAQRNVIPESWGGDVMFVNVSAKTGEGVADLLEAVLLQSEVLELEAFA
FT                   EGLAEGVVIESRLEKGRGPVATVLVQNGNLKQGDNILCGTEYGRVRAMHNDLGKKIKAA
FT                   GPATPVEILGLSGMPAAGDEMVVIENEKKAKELAAQRSQKQKEAKIAQEQSLKLSNMFN
FT                   NMGKEGEQQVLKIILKGDVQGSVEAIRESLLKLSTDEVKVDIIASGIGAITSSDVTLAV
FT                   ASTAVVIGFNVRADSAAKKLAETDGVEFRYYNIIYDLIDDVKKAMSGLLSPEMKEQIIG
FT                   IAEVREVYRSSKFGSIAGCMVIEGVVKRTNPIRVLRNNVVIYEGTLESLKRFKDDASEV
FT                   KKGLECGIGVKNYNDVREGDQIEVFEVIEVAKEL"
FT   CDS_pept        53259..53690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="FTF0051"
FT                   /product="Ribosome-binding factor A"
FT                   /note="Similar to RBFA_ECOLI (P09170) Ribosome-binding
FT                   factor A from E. coli (132 aa). FASTA: opt: 301 Z-score:
FT                   381.1 E(): 2.5e-13 Smith-Waterman score: 301; 41.935
FT                   identity in 124 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08067"
FT                   /db_xref="GOA:Q14K19"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14K19"
FT                   /inference="similar to sequence:UniProtKB:RBFA_ECOLI"
FT                   /protein_id="CAL08067.1"
FT                   /translation="MAAEGRVQRVASEFQKVISLLLRTRIKDAKLASATITEVDLSKDL
FT                   SYAKIYYTCLAIEDAEYIDKAFEKSKGFFRSSIAKSLSLRIVPNLKFIYDTSLDYGMQM
FT                   EEKIQQALEADSKIIKQDDKSLQENYKQNDKETKAEKLR"
FT   CDS_pept        53698..54963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisS"
FT                   /locus_tag="FTF0052"
FT                   /product="Histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /note="Similar to SYH_ECOLI (P04804) Histidyl-tRNA
FT                   synthetase from E. coli (423 aa). FASTA: opt: 1370 Z-score:
FT                   1670.1 E(): 3.9e-85 Smith-Waterman score: 1370; 50.493
FT                   identity in 406 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08068"
FT                   /db_xref="GOA:Q14K18"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14K18"
FT                   /inference="similar to sequence:UniProtKB:SYH_ECOLI"
FT                   /protein_id="CAL08068.1"
FT                   /translation="MSKLTIVRGFNDVLPLDSYKWQLLESKVKLILDRYNYSETRLPIV
FT                   ERSELFHRSVGESSDIVSKETYDFQDRNGDSLTLRPEGTAGCVRMVIENNLATRGQTQK
FT                   LWYCGPMFRYERPQKGRYRQFYQLGVEAYGFDGIAIDLEVIAIAWSLFKELGIYEYVTL
FT                   ELNSLGSSLNRQEYTQALLQYLKPYHAELDEDSIKRLDKNPLRILDSKIEKTQKILANA
FT                   PKLIDFIDHDLRLRFKQTCQYLDALGVRYKLNENLVRGLDYYTGLVFEWTTDKLGSQSA
FT                   ICAGGRYDGLVENLGGQKTAAIGFAIGMERLLLLLEDLGKLPNQDNACDVFFILDSAQL
FT                   HQSLAIVENIRQELPQLKIDMDLKFGSFKSQFKKADKSGAKVAIIIGQDELDNGFAGIK
FT                   FLQQNEEQQQVAFNELINFLER"
FT   CDS_pept        54970..56268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0053"
FT                   /product="major facilitator superfamily (MFS) transport
FT                   protein"
FT                   /note="Similar to AAO90449 (Q83D24) Major facilitator
FT                   family transporter from Coxiella burnetii (437 aa). FASTA:
FT                   opt: 908 Z-score: 1023.7 E(): 3.6e-49 Smith-Waterman score:
FT                   909; 36.603 identity in 418 aa overlap ORF ftt0053"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08069"
FT                   /inference="similar to sequence:INSDC:AAO90449"
FT                   /protein_id="CAL08069.1"
FT                   /translation="MKLHNIKGYAWIVVGLSSFLLIDKYIMNVSPSLIANELMSSFSIN
FT                   ATEMSAMVSLFLWSVVFCQFFVAGPIIDKLGFRKVSFFSLILSAIGLLLFVLSADIHSF
FT                   ALGCVSRLMIGIGASFATVGYIKAAAVWFDPRKFAFVCSFLMTAAMTGALLGQVPLVYL
FT                   IELTGSWHRALISYACFSIVIALLYLALVRDYNPDASYSNQTKGNTGTLAGIKKVLLNK
FT                   NNWYLTLYTGLTFTTIDVFGGIWGNNYFRELYSIPAKDASYIVSMMFLGLAIGSPIIGK
FT                   LSEKFDNRVGIMVAFHIIATISLAVVLQFKLTPTISGVLLFVFGFCLGVYMLAFAIGNR
FT                   INPVVVAATVAALINTGEPLLGALFDLLIGHLLDLTWTGQYIDAQNHISAIASEGAHRY
FT                   FHINAYHHAFLILVFSMIVSFFLLILVKDKEVK"
FT   CDS_pept        56271..57338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0054"
FT                   /product="ATPase"
FT                   /note="Similar to YHCM_ECOLI (P46442) Hypothetical protein
FT                   yhcM from E. coli (375 aa). FASTA: opt: 872 Z-score: 1033.2
FT                   E(): 1.2e-49 Smith-Waterman score: 898; 39.833 identity in
FT                   359 aa overlap ORF ftt0054"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0054"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08070"
FT                   /inference="similar to sequence:UniProtKB:YHCM_ECOLI"
FT                   /protein_id="CAL08070.1"
FT                   /translation="MKLENIYLQKIRELDLKVDSLQLEAIRRLQEIVDQLYSKKKSKLR
FT                   LFKKSFYPAIKGLYMWGGVGRGKTFIMDIFYNNLTIKNKKRQHFSHFMKNIHTQLRKYQ
FT                   GEKNPISKVAFDMAKQTQIICFDEFFVEDIADAMILGSIFTELFKFGVVLVATSNIEPE
FT                   KLYKNGLQRELFLPAIDVLFKNVDVLNLDSGVDYRFRLPTEYLNYLYPYNEHNRKNFFD
FT                   KFFLRNSHFDKDLSIRVLARDIPTILLSHKDVCFDFKVICGDGRSAHDYIDICHKYEQL
FT                   FIYNLVVFGPHNEDMARRFIALIDEFYDQNKKVVILANCDFKDLYNGERLKFEFQRTIS
FT                   RLNDMQNSRFGVINE"
FT   CDS_pept        57331..58260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluC"
FT                   /locus_tag="FTF0055"
FT                   /product="ribosomal large subunit pseudouridine synthase C"
FT                   /EC_number="4.2.1.70"
FT                   /note="Similar to RLUC_ECOLI (P23851) Ribosomal large
FT                   subunit pseudouridine synthase C from E. coli (319 aa).
FT                   FASTA: opt: 791 Z-score: 972.5 E(): 2.8e-46 Smith-Waterman
FT                   score: 791; 40.777 identity in 309 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0055"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08071"
FT                   /inference="similar to sequence:UniProtKB:RLUC_ECOLI"
FT                   /protein_id="CAL08071.1"
FT                   /translation="MNKVELIEVAEDVIDQRIDNFLLSRFSRLPKSLIYRWIRKGELRV
FT                   NKKRVKQTSRVSAGDIVRVPPFSLEEDSKPIKISQSHLDFLEQRILYENDDYIIVDKPS
FT                   GMAVHGGSGVNSGLVERLRQLRPKVRRLDLVHRLDKETSGCVLLAKKHSSLVYFFDIFK
FT                   QRKVDKIYYAIVHGHWDKKIIKIDLPLKRTETKDGQRVVKVDSKDGKQALTRIISVRHL
FT                   QGGFSLLEIKLETGRTHQIRVHTKAMGHPIVADKKYGFATKDQLLLDKGVDRLLLHAAK
FT                   LEFYDDKQNKQISVTAALDSRFEKFIQE"
FT   CDS_pept        complement(58262..59566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0056c"
FT                   /product="major facilitator superfamily (MFS) transport
FT                   protein"
FT                   /note="Similar to Q83D24 (Q83D24) Major facilitator family
FT                   transporter from Coxiella burnetii (437 aa). FASTA: opt:
FT                   1028 Z-score: 1172.6 E(): 2e-57 Smith-Waterman score: 1036;
FT                   40.187 identity in 428 aa overlap ORF ftt0056c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0056c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08072"
FT                   /inference="similar to sequence:UniProtKB:Q83D24"
FT                   /protein_id="CAL08072.1"
FT                   /translation="MEQRIYNIRGYAWIIIILSSFLLFDKYVMQVFPSLITDDMMSNFG
FT                   TNATQTGALGSAFFWSIIICQLFLAGPIIDKFGFRLISPISIIISATGVILFVVAANLG
FT                   SLSMAYIARITTGLGVSFATISYLKAVSVWFEPRKFAFAASFLATAAMIGALCAQAPLA
FT                   YLITICGDWKMAMLLFSVASLLIAVVYYIVVRDFNPKQPEASSPNNQLKTLDVLKEVIK
FT                   NKNNWLLTFYVGLSFTAVDAFAGFWGNAYFREAYHISREEAASIISMIFIGMAIGSPII
FT                   GKLSEILDSRKGVMIFSHIIGTIALSFVLLTKTSSTISAILLFIFGLCLGIYMLSFAIG
FT                   NRINPIIITATVAAFINTGEPILGAIFDPLIGYFLDWSWTGKYINKAGEVVSQYTSSAD
FT                   IKYFELESYHFAFTTLVASMIASLVILVMIKDKKD"
FT   CDS_pept        59643..60074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0057"
FT                   /product="hypothetical membrane protein"
FT                   /note="ORF ftt0057"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08073"
FT                   /protein_id="CAL08073.1"
FT                   /translation="MLIWAFLVLCESVFMNEIHVMLTNIKIDTKKFILLQLILVLVGYF
FT                   VILVFYNYDYANSFLIGSLTMFLANFVFFFRLFINKQFSPGIEIAIFYLSELLKLSIVA
FT                   LLTILLAIYVKPKLFSYIFGLVLLQLAVCFVPILFKRVR"
FT   CDS_pept        60127..60918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="FTF0058"
FT                   /product="ATP synthase A chain"
FT                   /EC_number="3.6.3.14"
FT                   /note="Similar to ATP6_ECOLI (P00855) ATP synthase A chain
FT                   from E.coli (271 aa). FASTA: opt: 847 Z-score: 976.1 E():
FT                   1.8e-46 Smith-Waterman score: 864; 50.758 identity in 264
FT                   aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08074"
FT                   /inference="similar to sequence:UniProtKB:ATP6_ECOLI"
FT                   /protein_id="CAL08074.1"
FT                   /translation="MANTEAGSQVATEYVQHHLHHWQVSLGQGSFWQLNVDSLLVSGIL
FT                   GVVFILAMFLAARKANSGVPGKFQNMIEAVWEWMDGMVANNYHHKRDFVTPLALTIFVW
FT                   VVLMNFMDLLPVDLFGWIISFFTASHEAYFRVVPTADPNVTFAMSIAVFFLVIFYNLKA
FT                   KGFGLIKEVLSSPFGIWLFPLNIFFRLVDEIVKPVSLSLRLFGNIFAGELIFILIALLP
FT                   WWFQWTLGGIWAIFHILIVLIQAFVFMMLTVVYLNMAQEAH"
FT   CDS_pept        60969..61274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="FTF0059"
FT                   /product="ATP synthase C chain"
FT                   /EC_number="3.6.3.14"
FT                   /note="Similar to ATPL_ECOLI (P00844) ATP synthase C chain
FT                   from E. coli (79 aa). FASTA: opt: 229 Z-score: 291.4 E():
FT                   2.4e-08 Smith-Waterman score: 229; 48.000 identity in 75 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0059"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08075"
FT                   /inference="similar to sequence:UniProtKB:ATPL_ECOLI"
FT                   /protein_id="CAL08075.1"
FT                   /translation="MDMSLQVLGNLNGLTAVAVALLISLPALGTAIGFGVLGGKYLEGV
FT                   ARQPELGGMLLGRMFIVAAFVDAFAAISIAIGFLVLYANPLAIPGLAEAAQKVIGA"
FT   CDS_pept        61320..61790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpF"
FT                   /locus_tag="FTF0060"
FT                   /product="ATP synthase B chain"
FT                   /EC_number="3.6.3.14"
FT                   /note="Similar to ATPF_ECOLI (P00859) ATP synthase B chain
FT                   from E. coli (156 aa). FASTA: opt: 434 Z-score: 486.3 E():
FT                   3.4e-19 Smith-Waterman score: 434; 44.231 identity in 156
FT                   aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08076"
FT                   /db_xref="GOA:Q14K10"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14K10"
FT                   /inference="similar to sequence:UniProtKB:ATPF_ECOLI"
FT                   /protein_id="CAL08076.1"
FT                   /translation="MDINITLIGQMITFAIFVGFTMKFVWPPLRKALEERREKIAEGLA
FT                   SADRASRELEVAKRQSAEILREAKAKATEIVENAYVRAHKVDEQAKEEAIAAADKIKSM
FT                   AIAEIEQEKVKAKEQLKQELVNLAMAAASKIIAASVDEKASKKVLEDFVEKV"
FT   CDS_pept        61810..62334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpH"
FT                   /locus_tag="FTF0061"
FT                   /product="ATP synthase delta chain"
FT                   /EC_number="3.6.3.14"
FT                   /note="Similar to ATPD_ECOLI (P00831) ATP synthase delta
FT                   chain from E. coli (177 aa). FASTA: opt: 361 Z-score: 452.8
FT                   E(): 2.5e-17 Smith-Waterman score: 361; 31.073 identity in
FT                   177 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08077"
FT                   /db_xref="GOA:Q14K09"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14K09"
FT                   /inference="similar to sequence:UniProtKB:ATPD_ECOLI"
FT                   /protein_id="CAL08077.1"
FT                   /translation="MTNISVIAKPYAKAAFEFANEHNLLQQWSKLLQTFSELIKDKSVA
FT                   AIVSSPTISQIEVVDALKKQLDENFFNFLALIAENKKMLIMPEIADQFESIKNIHNNVR
FT                   VADVTLAYATDKNILDSLKTSLEKKFGCTIDMHINIDPAIIGGAVVKVGDTVIDSSVSG
FT                   HLEKLKSILLS"
FT   CDS_pept        62353..63894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="FTF0062"
FT                   /product="ATP synthase alpha chain"
FT                   /EC_number="3.6.3.14"
FT                   /note="Similar to ATPA_ECOLI (P00822) ATP synthase alpha
FT                   chain from E. coli (513 aa). FASTA: opt: 2389 Z-score:
FT                   2837.5 E(): 3.7e-150 Smith-Waterman score: 2389; 70.955
FT                   identity in 513 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08078"
FT                   /db_xref="GOA:Q14K08"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14K08"
FT                   /inference="similar to sequence:UniProtKB:ATPA_ECOLI"
FT                   /protein_id="CAL08078.1"
FT                   /translation="MQLSPSEISGLIKQRIEKFDNSVELKSEGTIVSVADGIVTIYGLN
FT                   DVAAGEMIKLPGDVYGLALNLNTDSVGAVVLGDYEHIKEGDKAYCTGRILEVPVGEALL
FT                   GRVVDALGNPIDGKGEVATDLTSPIEKIAPGVIWRKSVDQALQTGIKSIDSMVPIGRGQ
FT                   RELIIGDRQIGKTAIAVDTIINQKGTGVKCIYVAIGQKASTIANIVRQLEEHGAMEHAI
FT                   IVAATASDSAALQYIAPYAGCSMGEYFRDRGQDALIVYDDLTKQAWAYRQISLLLRRPP
FT                   GREAYPGDVFYLHSRLLERAARVNEEYVEKFTNGEVKGKTGSLTALPIIETQAGDISAF
FT                   VPTNVISITDGQIFLETDLFNSGLRPAINPGNSVSRVGGAAQTKIIKKLGGGIRLALAQ
FT                   YRELEAFSQFASDLDEATRAQLNRGQRVTELLKQKQFSTLSVALMALSLYAADNGYLDN
FT                   LEVSEVIPFESALHALAETKYSDVIAEINETGKYDADIADKLKIIVEDCKANQAW"
FT   CDS_pept        63909..64805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpG"
FT                   /locus_tag="FTF0063"
FT                   /product="ATP synthase gamma chain"
FT                   /EC_number="3.6.3.14"
FT                   /note="Similar to ATPG_ECOLI (P00837) ATP synthase gamma
FT                   chain from E. coli (287 aa). FASTA: opt: 594 Z-score: 720.6
FT                   E(): 3e-32 Smith-Waterman score: 884; 50.000 identity in
FT                   298 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08079"
FT                   /db_xref="GOA:Q14K07"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14K07"
FT                   /inference="similar to sequence:UniProtKB:ATPG_ECOLI"
FT                   /protein_id="CAL08079.1"
FT                   /translation="MSNAREIRSKVQSVKNTQKITGAMELVAASKMRGAIVKMNNVRPY
FT                   VESANTIIKNVTAASIDYPNPYLFDRDVKRVGYIVISTDRGLCGGLNINLFKHVLKEIK
FT                   NNIEDRVGVDVCVIGSKAENFFAKLKDVNIVATAHYNDKDKEGSIRAIGGAVKVMLDKF
FT                   TAGEIDRLYMSSNQFVSTIKQRPRLQTLLPIQDIFSAEEIKANKEKATKGHWDYIYERD
FT                   IEEVLNALFIRYIEAQVRGAILENAACEQAARMMAMKNATDNASDIIDQLKLDYNKVRQ
FT                   AMITQELAEICSGAAAV"
FT   CDS_pept        64815..66191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="FTF0064"
FT                   /product="ATP synthase beta chain"
FT                   /EC_number="3.6.3.14"
FT                   /note="Similar to ATPB_ECOLI (P00824) ATP synthase beta
FT                   chain from E. coli (459 aa). FASTA: opt: 2444 Z-score:
FT                   2754.0 E(): 1.6e-145 Smith-Waterman score: 2444; 81.264
FT                   identity in 459 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08080"
FT                   /db_xref="GOA:Q14K06"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14K06"
FT                   /inference="similar to sequence:UniProtKB:ATPB_ECOLI"
FT                   /protein_id="CAL08080.1"
FT                   /translation="MSTGKIIQVIGAVIDVEFARDNTPKVYDALNVVEAGLVLEVQQQI
FT                   GDGVVRTIAMGSSDGLRRGMEVKNTNAPISVPVGHGTLGRIMNVLGEPIDEAGPIEYTE
FT                   KRSIHQAPPAYDELALSTEILETGIKVVDLICPFAKGGKVGLFGGAGVGKTVTMMELIN
FT                   NIAKEHSGYSVFAGVGERTREGNDFYYEMKDSNVLDKVSLVYGQMNEPPGNRLRVALSG
FT                   LTIAEGFRDEKRDVLMFIDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAAEMGALQERI
FT                   TSTKTGSITSVQAVYVPADDLTDPSPATTFSHLDATIVLSRQIAELGIYPAVDPLDSTS
FT                   RQLDPLVVGQDHYETARAVQKVLQRYKELKDIIAILGMDELSDEDKKIVDRARKIQRFL
FT                   SQPFHVAEVFTGNPGKFVSLKDTVASFKAIVNGEYDHLPEQAFYMVGSIQEAIEKAKTL
FT                   "
FT   CDS_pept        66204..66641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /locus_tag="FTF0065"
FT                   /product="ATP synthase epsilon chain"
FT                   /EC_number="3.6.3.14"
FT                   /note="Similar to ATPE_ECOLI (P00832) ATP synthase epsilon
FT                   chain from E. coli (138 aa). FASTA: opt: 262 Z-score: 329.5
FT                   E(): 1.8e-10 Smith-Waterman score: 262; 33.858 identity in
FT                   127 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08081"
FT                   /db_xref="GOA:Q14K05"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14K05"
FT                   /inference="similar to sequence:UniProtKB:ATPE_ECOLI"
FT                   /protein_id="CAL08081.1"
FT                   /translation="MTKKYLKVDVVSPLGSVFKGEADMVSLRGSAGEMGIAYGHTELLS
FT                   TLPAGVVNVRKDQHTDVLYVSGGIVEVTPTRVTIMVDDMERAENLNQAEAEKARARAKE
FT                   VLKNPDASKLDIEAANKRLKEADARLKALNSSNGLYYSKDD"
FT   CDS_pept        66852..69695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0066"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0066"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08082"
FT                   /protein_id="CAL08082.1"
FT                   /translation="MRKLFINLILLTLIFPLILQAEPLSDSDSSSSKSLLPNRTIAGFL
FT                   DIRTPGSTTRVDMQKVKKDGYNVMIVAYGEVYDDNIGFYTNSVTSTQTIIDKIRDAKKA
FT                   GMKVLLAVGGSPNTFHPGVKQGAPDPKIFGNDLTDAQIKSLANNIVSFLNKNDIDGILY
FT                   CIKKFTSPEFITKLSADIKKINAKIIIAAEPEVNNYKLVTTGLSNDYDKAIEDGNIDYL
FT                   FIQEYNTYPEYDPNFISESYPKIIESVNIPIKTKILIEEPTNAVSGGTNTIYHPQGNAT
FT                   KSLSTEQAIKLLLPQLEKLKFKPRFAGVAGWSLNTDYAADLYGDSSHNAGAFAKGLSAC
FT                   IYKNTCTEIDNQIHGPVVAGILPLWGKSSSYNISGQQINTISISISMPKDKEYCDYNPN
FT                   VCKYNVIIAAYLTYTSSKGFELSFNEENGSSKKIYSPEELKAFITYMNSKGKHTIVSIG
FT                   GKYSHINWETINFSDLVKIVQEYGFNGINFDLSSSDMPKNDKVAKIAADKINKLITALR
FT                   QNNHGFWLTFSPEWHYIVAPLAKNDKDNIYVNHNYIELLDSLGMNKIDYIWLNTFADKP
FT                   SDGILSFYKDKDGEHIKITPADGYAKFLASLAWALTTREGYDANMPKYDEIDKPLHIPA
FT                   NKLVLMIPATKGTTHSDMVYVLSEKDIKEVVSLMKGNNASFAGFAVWSIDFDATNINNG
FT                   DLGNDYSHKPWSTTSAISDISLPPIVSQLKDQIKQETKATSPIQEQEQSINTGIINYPD
FT                   KIGAYNVDTIINFQGKKYKCKSNLEVKLCNDKGYIPNGLYGYLAWDEIDSAKQTKVKRK
FT                   QRKLAVGEIVKYPKFIGNYNVGQIVIAGDRKFECQKQELCNDKSYRPIGKSGYLAWSDI
FT                   TDDVAHLATEAKQVKPKGAEYIYPFGIEDYSAGTVVAIGQELYRCKVGPESSLCNSEAY
FT                   KPTGKYGTDAWTKIDSK"
FT   CDS_pept        complement(69712..70041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0067c"
FT                   /product="Glutaredoxin-related protein"
FT                   /note="Similar to Q8D879 Glutaredoxin-related protein from
FT                   Vibrio vulnificus (112 aa). FASTA: opt: 485 Z-score: 630.6
FT                   E(): 2.8e-27 Smith-Waterman score: 485; 65.306 identity in
FT                   98 aa overlap ORF ftt0067c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0067c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08083"
FT                   /inference="similar to sequence:UniProtKB:Q8D879"
FT                   /protein_id="CAL08083.1"
FT                   /translation="MYTPEEQKVVERIEKQLKENDIILYMKGSPNLPQCGFSAHAATAI
FT                   RSCGKPFAFVNILENPDIRAILPKYADWPTFPQLWVKGELIGGCDIIMEMNESGELKKL
FT                   IDSVK"
FT   CDS_pept        70177..70755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sodB"
FT                   /locus_tag="FTF0068"
FT                   /product="superoxide dismutase [Fe]"
FT                   /EC_number="1.15.1.1"
FT                   /note="Similar to SODF_ECOLI (P09157) Superoxide dismutase
FT                   [Fe] from E. coli (192 aa). FASTA: opt: 896 Z-score: 1143.2
FT                   E(): 8.8e-56 Smith-Waterman score: 896; 66.316 identity in
FT                   190 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0068"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08084"
FT                   /inference="similar to sequence:UniProtKB:SODF_ECOLI"
FT                   /protein_id="CAL08084.1"
FT                   /translation="MKFELPKLPYAVDALESTISKETIEYHYGKHHQTYVTNLNNLVEG
FT                   TEHDGRNLEEIVKTSNGGIFNNAAQVFNHTFYWNCLTPNKTEASSQLKAALIETFGSVE
FT                   NFKEQFSKAAIATFGSGWAWLVKNTEGKLEIVTTSNAGCPLTENKKPLLTFDVWEHAYY
FT                   IDYRNARPKYVEALWDIVNWQFVSEQFAD"
FT   CDS_pept        complement(70763..70948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0069c"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0069c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0069c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08085"
FT                   /protein_id="CAL08085.1"
FT                   /translation="MPENKSDSINTIHGNNRIINKIFLNIADSRKPGNNTAIKITTTID
FT                   KTPITKENKEILFFAT"
FT   CDS_pept        complement(70960..72225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampG"
FT                   /locus_tag="FTF0070c"
FT                   /product="major facilitator superfamily (MFS) tranport
FT                   protein"
FT                   /note="Similar to AMPG_ECOLI (P36670) AmpG protein from E.
FT                   coli (491 aa). FASTA: opt: 996 Z-score: 1121.1 E(): 1.5e-54
FT                   Smith-Waterman score: 996; 38.614 identity in 404 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0070c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08086"
FT                   /inference="similar to sequence:UniProtKB:AMPG_ECOLI"
FT                   /protein_id="CAL08086.1"
FT                   /translation="MTSSPSFIDKLKAPFKEAKMFTMLILGYASGFPLMLTASSLFLWY
FT                   KDNGIETKDIGFLTLIAIPYTFKYLWAPFLDKIKIPILGRRKGWILITQVSLVILIAIM
FT                   SRFSPANSPLIIAFIGFLICFISATQDIAINAYQTEVLLEHERALGNAIAVMGYRIGML
FT                   VTGSLVLIIVDKLNNNWNLAWLMIILFFIICPLYTLLIKESQYQDAPKSFKDAFILPFV
FT                   EFFKRQGLYTAIIIIIILISYKLADAIAFSLNSIFFIDLGFSKTTIAVSYKAFSLFASL
FT                   AGLFVGGLIAKQIGVYKSFLYFSIIMACANLTYVLLAIVGKNYYLMLASVSVEYFCGAM
FT                   GTAMLVAMIMSLVNVKFSATQFAILSSIDSLARVFVGPLAGYIQAHYKWEGLFIFSFIV
FT                   GMFISLLIFIFRTRIKLMANLQ"
FT   CDS_pept        complement(72314..73588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltA"
FT                   /locus_tag="FTF0071c"
FT                   /product="citrate synthase"
FT                   /EC_number="2.3.3.1"
FT                   /note="Similar to CISY_PSEAE (P14165) Citrate synthase from
FT                   Pseudomonas aeruginosa (428 aa). FASTA: opt: 1540 Z-score:
FT                   1956.3 E(): 4.5e-101 Smith-Waterman score: 1540; 57.353
FT                   identity in 408 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0071c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08087"
FT                   /inference="similar to sequence:UniProtKB:CISY_PSEAE"
FT                   /protein_id="CAL08087.1"
FT                   /translation="MEVMLMSKYATLKYADKNIEIELPVYSPSLGNDCIDVSSLVKHGI
FT                   FTYDPGFMSTAACESKITYIDGGKGVLLHRGYPIEEWTQKSNYRTLCYALIYGELPTDE
FT                   QVKSFRQEIINKMPVCEHVKAAIAAMPQHTHPMSSLIAGVNVLAAEHIHNGQKESQDEV
FT                   AKNIVAKIATIAAMAYRHNHGKKFLEPKMEYGYAENFLYMMFADDESYKPDELHIKAMD
FT                   TIFMLHADHEQNASTSTVRLSGSTGNSPYAAIIAGITALWGPAHGGANEAVLKMLSEIG
FT                   STENIDKYIAKAKDKDDPFRLMGFGHRVYKNTDPRATAMKKNCEEILAKLGHSDNPLLT
FT                   VAKKLEEIALQDEFFIERKLFSNVDFYSGIILKAMGIPEDMFTAIFALARTSGWISQWI
FT                   EMVNDPAQKIGRPRQLYTGATNRNF"
FT   CDS_pept        73831..74304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhC"
FT                   /locus_tag="FTF0072"
FT                   /product="succinate dehydrogenase, cytochrome b556"
FT                   /EC_number="1.3.99.1"
FT                   /note="Similar to Q884A1 Succinate dehydrogenase,cytochrome
FT                   b556 subunit from Pseudomonas syringae (124 aa). FASTA:
FT                   opt: 332 Z-score: 413.6 E(): 3.8e-15 Smith-Waterman score:
FT                   332; 39.844identity in 128 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08088"
FT                   /inference="similar to sequence:UniProtKB:Q884A1"
FT                   /protein_id="CAL08088.1"
FT                   /translation="MSKNISLRVVCITLVTSDLLLYKNCFGGMSSMKKITNIDLMSIKS
FT                   YNFPITAISSIMHRISGVVLIIAIPLCVVAMNYALAGPDGYQQTVTVLTKSWFSVFFWL
FT                   FLSSITYHVYAGIRHMIMDMGFGESMKVAKITSLLVIVLGVLSAILWGCYLWL"
FT   CDS_pept        74280..74648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhD"
FT                   /locus_tag="FTF0073"
FT                   /product="succinate dehydrogenase hydrophobic membrane
FT                   anchor protein"
FT                   /EC_number="1.3.99.1"
FT                   /note="Similar to Q88FA6 Succinate
FT                   dehydrogenase,hydrophobic membrane anchor protein from
FT                   Pseudomonas putida (122 aa). FASTA: opt: 242 Z-score: 306.8
FT                   E(): 3.4e-09 Smith-Waterman score: 242; 34.677 identity in
FT                   124 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08089"
FT                   /inference="similar to sequence:UniProtKB:Q88FA6"
FT                   /protein_id="CAL08089.1"
FT                   /translation="MGVLLMAVISLTSSGIKDFFVQRVTAVIIAVYFGYLILEALYLSH
FT                   IGALNYDSWRGLFTDGMFFRVATLMAYLAMFFHAWVGIWIICGDYIKFAWASALVMLSF
FT                   VLVYIFCFFWLFAVLFFY"
FT   CDS_pept        74661..76454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="FTF0074"
FT                   /product="succinate dehydrogenase, catalytic and
FT                   NAD/flavoprotein subunit"
FT                   /EC_number="1.3.99.1"
FT                   /note="Similar to Q9I3D5 Succinate dehydrogenase (A
FT                   subunit) from Pseudomonas aeruginosa (590 aa). FASTA: opt:
FT                   2468 Z-score: 2874.7 E(): 3.2e-152 Smith-Waterman score:
FT                   2468; 61.139 identity in 597 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08090"
FT                   /inference="similar to sequence:UniProtKB:Q9I3D5"
FT                   /protein_id="CAL08090.1"
FT                   /translation="MSIATQEFDAIVIGAGGAGLRASFQLSQSGFKTAVVSKVFPTRSH
FT                   TVAAQGGIAAALGNIEFDDGLPSDDWKWHMYDTVKGSDYIGDQDAIEYMCEHAPQSIIE
FT                   LEHMGMPFSRLKNGKIYQRAFGGMSRNYDPANQAERTCAAADRTGHALLHTLYQGNLAH
FT                   KTDFYTEWFAVDLVKADDGSIAGVIALCIETGETVFLKAKITILATGGAGRIYESSTNA
FT                   YINTGDGMGLALRAGLPLQDMEFWQFHPTGIAGAGVLVTEGCRGEGGVLRNKDGERFME
FT                   RYAPNAKDLACRDVVSRASQQEIMEGRGDTFSGTSCVWLDLTHLGEDVINERLPTVREL
FT                   GRTFAGIDPVEKPIPVVPTCHYQMGGIPTNKHGQVITQVDGKDKVIGGLYAVGECASVS
FT                   VHGANRLGSNSLLDLVVFGRAAGMHAEQSLKEGMPMKEVSQENIEKATARITKWDTSEQ
FT                   RGCKEKISELRKELQRVMQQYFSVFRQESTMKEGLDKLFNIRERLDNAVLEDNSRIFNM
FT                   MRIEALELDNLVLTAIATAKLALERKESRGAHSRVDYPERDDKNWMKHTLYFLEGDRTS
FT                   LRDVNMSPTKVKAFQPAERKY"
FT   CDS_pept        76472..77173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="FTF0075"
FT                   /product="succinate dehydrogenase iron-sulfur protein"
FT                   /EC_number="1.3.99.1"
FT                   /note="Similar to Q8EFP1 Succinate
FT                   dehydrogenase,iron-sulfur protein from Shewanella
FT                   oneidensis (235 aa). FASTA: opt: 1170 Z-score: 1456.9 E():
FT                   2.9e-73 Smith-Waterman score: 1170; 67.234 identity in 235
FT                   aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0075"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08091"
FT                   /inference="similar to sequence:UniProtKB:Q8EFP1"
FT                   /protein_id="CAL08091.1"
FT                   /translation="MEVRFKIYRYNPEVDKKPYYDEYTVEVENEGVKVLTALELIKEQD
FT                   PTLALRRSCREGVCGSDGMNINGKNRLACITSVGELKQPIKVNPLPGLPVIRDLIVDMK
FT                   QFYKNYEKVKPYLINDDEPPVKERLQSPEDRAKLDGLYECILCACCTTSCPSFWWNPDK
FT                   FIGPSGLLQAYRFIADSRDTATEQRLEDLKDPFSLFRCRTIMNCVSVCPKGLNPTEAIG
FT                   KIRSALLKKNV"
FT   CDS_pept        77191..80016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucA"
FT                   /locus_tag="FTF0076"
FT                   /product="2-oxoglutarate dehydrogenase E1 component"
FT                   /EC_number="1.2.4.2"
FT                   /note="Similar to Q883Z7 2-oxoglutarate dehydrogenase, E1
FT                   component from Pseudomonas syringae (943 aa). FASTA: opt:
FT                   3013 Z-score: 3478.7 E(): 7.1e-186 Smith-Waterman score:
FT                   3013; 49.523 identity in 943 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0076"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08092"
FT                   /inference="similar to sequence:UniProtKB:Q883Z7"
FT                   /protein_id="CAL08092.1"
FT                   /translation="MGAYMKKKQPDFSQWLETTQFFGGNLEYLESIYDDYIRGNHDGID
FT                   PKWLSFFDSIASSTDTVHGELVDEFKYLAKNKNNTANVNTVVSTEGDIGLKAKALVKAY
FT                   RSYGYKSANIDPLGLTRFERDSDLELAAHGLSEKDLTQLVNLGDFTDNKAIPLQQVINK
FT                   AKAIYESNIGYEYRYIGNKEEKLWLQDRIEDTAVIPSDSKKWILQQLVAAEGLEKYLAL
FT                   RYVGQKRFGLEGGESLIPSLQHIVEKAVSRHSTRFIQLGMAHRGRLNVLVNVMGKNPKD
FT                   LFEEFEGKQSEKSLSGDVKYHMGYSNYRSIDGKEAKIALAFNPSHLEAVDPVVEGAAKA
FT                   IQDKLDGDVYSKVLPILIHGDSAFCGQGVVMETFGFSLTEAYGTGGTIHLVVNNQVGFT
FT                   TSSAFGVNRSSNYSTDVAKMVDAPIFHVNGDDPEAVLKVTDIALEYRMKFNKDIVIDLV
FT                   CYRRNGHNETDEPSGTQPQMYEVIKKLPSTLKLYSDKLIKEGVVDADHFARMNANYRSK
FT                   LDNGKVTIDVLDRKIIKDKLNVCDWLPYLGKQESDYNYMPIPEKTLKELALKISEVPAE
FT                   VEMQMQVKKAVTDRIKMANGELPLNWGFAESLAYATLLSDGYPVRISGEDSGRGTFSHR
FT                   HAVIKNMNTKSQPKEYVPLRHINEKVRFDVIDSTLSEYGVLGFEYGYSCYSPDALVVWE
FT                   AQFGDFVNTAQVVIDQFLVAAEEKWGILSGLTLFLPHGQEGAGAEHSSARLERFLNSCA
FT                   NDNMQVCTPTTPAQIYHLLRRQVIRPLRKPLIVMTPKSLLRNPMAVSSLQELSQGKFEA
FT                   IIDDVNAKAAKVTKLILCNGKVYYDLMAKKQDNYEHIAVVRLEELYPFPQQQLAQIFTK
FT                   YNNVNKVVWLQEEPENKGAWYNIRHFIEKLVDKKQELLCVARERSSTPAVGYHALYVKQ
FT                   QEEIINTALEI"
FT   CDS_pept        80042..81511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucB"
FT                   /locus_tag="FTF0077"
FT                   /product="dihydrolipoamide succinyltransferase component of
FT                   2-oxoglutarate dehydrogenase complex"
FT                   /EC_number="2.3.1.61"
FT                   /note="Similar to Q8EFN9 2-oxoglutarate dehydrogenase,E2
FT                   component, dihydrolipoamide succinyltransferase from
FT                   Shewanella oneidensis (395 aa). FASTA: opt: 1379 Z-score:
FT                   1563.0 E(): 3.6e-79 Smith-Waterman score: 1379; 55.949
FT                   identity in 395 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0077"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08093"
FT                   /inference="similar to sequence:UniProtKB:Q8EFN9"
FT                   /protein_id="CAL08093.1"
FT                   /translation="MVELKVPMFPESVADGTLAQWNKNEGDFVNEGDILAEIETDKVVL
FT                   EVPATSSGVLKGIKKHAGDTVLSEESLAIIDTAVSTSEPNQQTTNQGNASEATATGQEI
FT                   DIKAPVFPESVADGTISEWHKKEGEAVSEGDILAEIETDKVVLEVPATSNGVLTKILKT
FT                   AGETVLSAELIAKITAGGATATTKSEASVGVSQANNDPHLVPSARKAFNASGLDTAANI
FT                   EGTGKKGRITSEDVKKAVASVNKPQQQTVVINQGARYEKRVKMTRLRQTIANRLVEVQH
FT                   TNAILTTFNEVDMSAVMELRNKYKDMFVKEHDTKLGFMSFFIKAATEALKKFPDVNASI
FT                   DGDEIVYHNYFDIGIAVGTDRGLVVPVLRDTDTKSLAELEADVLDKAIKGRDGKLSLED
FT                   MQGGTFTITNGGTYGSMLSTPIINSPQSAILGMHNIVERPVVVKGEIKIRPIMYLALSY
FT                   DHRIIDGGTSVRFLKMIKELIEDPNRILLQV"
FT   CDS_pept        81551..82078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apt"
FT                   /locus_tag="FTF0078"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.7"
FT                   /note="Similar to APT_CLOPE (Q8XJ22) Adenine
FT                   phosphoribosyltransferase from Clostridium perfringens (172
FT                   aa. )FASTA: opt: 602 Z-score: 741.4 E(): 2.1e-33
FT                   Smith-Waterman score: 602; 54.706identity in 170 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08094"
FT                   /db_xref="GOA:Q14JZ2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JZ2"
FT                   /inference="similar to sequence:UniProtKB:APT_CLOPE"
FT                   /protein_id="CAL08094.1"
FT                   /translation="MNLDFIKSKIAAVPDFPKPGIMFRDITPLLADPQGLRKTAEAMAQ
FT                   ELKNKGIQPTIVAGTESRGFIFGVALAEVLGLGFVPVRKPGKLPRATYSVKYDLEYGSD
FT                   SLEIHQDAFKVTDEVLVVDDLLATGGTAKATVDLIEKTQAKVAGLIFVMELDGLGGREV
FT                   LAGYNVSALIKF"
FT   CDS_pept        82089..83420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrsA"
FT                   /locus_tag="FTF0079"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.2"
FT                   /note="Similar to AAO90853 (Q83BY7) Phosphoglucosamine
FT                   mutase from Coxiella burnetii (446 aa). FASTA: opt: 1197
FT                   Z-score: 1395.4 E(): 7.8e-70 Smith-Waterman score: 1197;
FT                   43.991 identity in 441 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0079"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08095"
FT                   /db_xref="GOA:Q14JZ1"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JZ1"
FT                   /inference="similar to sequence:INSDC:AAO90853.1"
FT                   /protein_id="CAL08095.1"
FT                   /translation="MAKYFGTDGIRGEVANSTITVEFTQKLGNAVGSLINQKNYPKFVI
FT                   VGQDTRSSGGFLKFALVSGLNAAGIDVLDLGVVPTPVVAFMTVKHRAAAGFVITASHNK
FT                   FTDNGIKLFSSNGFKLDDALEEEVEDMIDGDFIYQPQFKFGSYKILANAIDEYIESIYS
FT                   RFAKFVNYKGKVVVDCAHGAASHNFEALLDKFGINYVSIASNPDGLNINVGCGATCVSN
FT                   IKKAVKEQKADLGISLDGDADRIIIVDENGQEIDGDGILNILAQYSDICGGTNGIVGTQ
FT                   MTNMSYENHYRANKIPFIRSKVGDRYVLEDLVKYGYKIGGESSGHVINLNFGTTGDGLF
FT                   TAIQLLAIFSQADKPVSEFKLQGELMQQTLINVPLTKKVAREDLQKVASDVNDVEKRLG
FT                   NRGRVLLRPSGTEPVLRVMVEADDKSLATNEAEYLVEKVKQKLV"
FT   CDS_pept        83423..84184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpiA"
FT                   /locus_tag="FTF0080"
FT                   /product="triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08096"
FT                   /db_xref="GOA:Q14JZ0"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JZ0"
FT                   /protein_id="CAL08096.1"
FT                   /translation="MQKLIMGNWKMNGNSTSIKELCSGISQVQYDTSRVAIAVFPSSVY
FT                   VKEVISQLPEKVGVGLQNITFYDDGAYTGEISARMLEDIGCDYLLIGHSERRSLFAESD
FT                   EDVFKKLNKIIDTTITPVVCIGESLDDRQSGKLKQVLATQLSLILENLSVEQLAKVVIA
FT                   YEPVWAIGTGVVASLEQIQETHQFIRSLLAKVDERLAKNIKIVYGGSLKAENAKDILSL
FT                   PDVDGGLIGGASLKAAEFNEIINQANKICTE"
FT   CDS_pept        84172..84525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secG"
FT                   /locus_tag="FTF0081"
FT                   /product="preprotein translocase, subunit G, membrane
FT                   protein"
FT                   /note="Similar to Q9KU83 Preprotein translocase, SecG
FT                   subunit from Vibrio cholerae (111 aa). FASTA: opt: 283
FT                   Z-score: 369.6 E(): 1.1e-12 Smith-Waterman score: 289;
FT                   45.299identity in 117 aa overlap. Together with SecE and
FT                   SecY forming an integral membrane complex."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0081"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08097"
FT                   /inference="similar to sequence:UniProtKB:Q9KU83"
FT                   /protein_id="CAL08097.1"
FT                   /translation="MYGIILTIDIIAAIAIVVLVLLQQGKGANMGVSFGAGASSTVFGS
FT                   KGAASFLFKMTVFFTAVFFVSCLTLGYLGKSSAITANISTANTDSSIASQYDQYQKEVS
FT                   QAGTADTSKQASK"
FT   gene            84535..84617
FT                   /gene="tRNA-Leu (GAG)"
FT   tRNA            84535..84617
FT                   /gene="tRNA-Leu (GAG)"
FT                   /product="transfer RNA-Leu"
FT   CDS_pept        join(84695..85285,85289..85651)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0082"
FT                   /product="transcriptional regulator, pseudogene"
FT                   /note="Similar to Q9CG05 LysR family transcriptional
FT                   regulator from Lactococcus lactis (273 aa) .FASTA: opt: 186
FT                   Z-score: 225.0 E(): 0.00011 Smith-Waterman score: 186;
FT                   23.574 identity in 263 aa overlap. Contains an in-frame
FT                   stop codon after aa 197 ORF ftt0082"
FT                   /inference="similar to sequence:UniProtKB:Q9CG05"
FT   CDS_pept        85736..86212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0083"
FT                   /product="hypothetical membrane protein"
FT                   /note="ORF ftt0083"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08099"
FT                   /protein_id="CAL08099.1"
FT                   /translation="MIMFWRLYMNKILGLILTIVLTVTTLSSNGFAADIPNSTALPLAK
FT                   VVNNIYSQGYSGINKIEFDDGVYKATVINKDGQEQYLYIDPTTAAVPVPKQGTKEINMS
FT                   QAIAAVSQDRCKNITSVEHYNGAYKVECLDANSQQVEVLVDAVSGKISQISYDD"
FT   CDS_pept        complement(86209..87351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemN"
FT                   /locus_tag="FTF0084c"
FT                   /product="Oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /note="Similar to Q87V87 Oxygen-independent
FT                   coproporphyrinogen III oxidase,putative,from Pseudomonas
FT                   syringae (404 aa). FASTA: opt: 1156 Z-score: 1386.6 E():
FT                   2.4e-69 Smith-Waterman score: 1156; 46.791 identity in 374
FT                   aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0084c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08100"
FT                   /inference="similar to sequence:UniProtKB:Q87V87"
FT                   /protein_id="CAL08100.1"
FT                   /translation="MFEINKQIGIYIHFPWCVRKCPYCDFNSHPIKDDSYLSEQYYQKL
FT                   IADFDTHLDDLQAREVISIFIGGGTPSLFKAEYLDKVLQHITKNTKISINCEITLEMNP
FT                   GTVERGSILSYQNIGINRISLGVQSFQDDKLKILGRIHNCENVYTTIDEIKNSKISNFN
FT                   IDIMHGLPNQSFDDGIFDITQAIAMQPTHISWYQLTIEPNTLFAAKRPKFPDEEILESI
FT                   EIAGKEALAHAGFKQYEVSAFAKNTLRSIHNSNYWMFGDYIGIGAGAHSKITNLKTKQI
FT                   KRVWKHKHPKIYTQTDKFIKDSNIVTQDEIIYEFMLNTLRLKNGFKLSEFEQQTFLSSN
FT                   IISQKLQLGIDKGLLELNANQIKPTAKGYLFLNDCINIFS"
FT   CDS_pept        complement(87356..87733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0085c"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="Similar to YWCD_BACSU P39602 Hypothetical protein
FT                   ywcD from Bacillus subtilis (127 aa). FASTA: opt: 162
FT                   Z-score: 223.9 E(): 0.00013 Smith-Waterman score: 162;
FT                   26.667 identity in 120 aa overlap ORF ftt0085c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0085c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08101"
FT                   /inference="similar to sequence:UniProtKB:YWCD_BACSU"
FT                   /protein_id="CAL08101.1"
FT                   /translation="MLKKQLSLFIIVGILASITNFIIVWILVELNIFRPLVANFFAFLI
FT                   AFNVSYFGHRFLTFSTTTQSHKKAATQFFINVMIGLGLNESIYYVLLHILKIQYLLALF
FT                   ITMGLVAVYTFVVSKFLIFKA"
FT   CDS_pept        87803..88681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0086"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Q9I078 Hypothetical protein PA2765 from
FT                   Pseudomonas aeruginosa (299 aa). FASTA: opt: 656 Z-score:
FT                   793.3 E(): 2.4e-36 Smith-Waterman score: 656; 36.678
FT                   identity in 289 aa overlap ORF ftt0086"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0086"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08102"
FT                   /inference="similar to sequence:UniProtKB:Q9I078"
FT                   /protein_id="CAL08102.1"
FT                   /translation="MEIIKYQLGIVENLPLSALYMMFNIKKNSDVSFGLKILQRFVDGK
FT                   SVVAGFGNNLLKMFKIPENESFKRTKFNNPRMSDNDGYDLVLWLRDDDRGELFHKAIAI
FT                   KKALEDYFDIEKVISSYTYRGKYDLSGFEDGIENPKGLEVVPAAIISEGELEGSSFWVL
FT                   QQWLHDFDWLNNASQSAKEECIGRSLDDSHQFESLKDFAHVKRSAKENFNPEAQILRKS
FT                   MPWSDDQLNGGFMFSGFAPSFRSFNLQMGNMLGGSDGIIDGVFKFSKIIETSYLWCPPF
FT                   KKGKLDISLLN"
FT   CDS_pept        88786..91599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acnA"
FT                   /locus_tag="FTF0087"
FT                   /product="aconitate hydratase"
FT                   /EC_number="4.2.1.3"
FT                   /note="Similar to Q9RTN7 Aconitate hydratase from
FT                   Deinococcus radiodurans (906 aa). FASTA: opt: 3462 Z-score:
FT                   3967.5 E(): 4.2e-213 Smith-Waterman score: 3462; 59.081
FT                   identity in 892 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0087"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08103"
FT                   /inference="similar to sequence:UniProtKB:Q9RTN7"
FT                   /protein_id="CAL08103.1"
FT                   /translation="MSDIKNITKLQIEDKGKKYSLYSLKKLSQELGKDVTRLPYSIRVL
FT                   LENQLRNIDGYKVKEDDMHKVLDWDAKASSRPEIPHMPARVVMQDFTGVPAVVDLAAMR
FT                   KAIKDAGGDADKINPLVDTAMVIDHSVQVDFYGTKTALAQNVAKEFERNGERYSLLKWA
FT                   QKAFDDFIVVPPGMGIIHQVNLEYLAKGALVKNINGEDVIYPDTLVGTDSHTTMINGVG
FT                   VVGWGVGGIEAEAVMLGQPYYMVLPDVVGVKFTGKLKTGVTATDLVLKVTEVLRKHGVV
FT                   GKFVEYYGEGLESLSLPDRATIANMAPEYGATIGFFPVDEVTLDFFNNTNRSELVDAAR
FT                   EMYKEQLLFRENPAEEPEYSSIVEIDLSEVESNLAGPKRPQDRVAFHDMKKAFAEALVH
FT                   EQGLHGFGLTDEQLQKLAEVKGLNERITHGSVAIAAITSCTNTSNPSLLLGAGLLAKKA
FT                   NEKGLKVKPFVKTSLAPGSQVVTQYLEKANLLPELENLGFNLVGYGCTTCIGNSGPLDE
FT                   PVVEAINEADLIVASVSSGNRNFEGRINPHVKANYLASPIHVVAYALAGTVDFDPVEDA
FT                   IGKDAEGNDVYLADIWPTTEEIAAIQSHVINSDMFKKAYATVLDGTEDWQKLKAPEGKL
FT                   YEFDSSSTYIQCPNFFEKFAEGNDDLDIKGARTLLMLGDSVTTDHISPAGAIPEEYPAG
FT                   QYLKSHGVEKKDFNSYGSRRGNHEVMMRGTFANIRIRNLLLDNVEGGFTKYHLDGSQQY
FT                   VFDAAMKYKEKGIPLVILAGKEYGTGSSRDWAAKGTFLLGVKAVIAESYERIHRSNLVG
FT                   MGVLPLEYVNGQNAKTLGLDGTEMFNIKNLNNIKPRQIVIVEAVHPKTAHTTTFEALAR
FT                   LDADVDVDYLKNGGILQTVLKDIMGDKKESKSTQSTTSKGCGSADTSSETSCPFAKIAN
FT                   FFKKLFK"
FT   CDS_pept        91694..92722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilT"
FT                   /locus_tag="FTF0088"
FT                   /product="Type IV pili nucleotide-binding protein"
FT                   /note="Similar to Q8EBZ4 Twitching motility protein PilT
FT                   from Shewanella oneidensis (345 aa). FASTA: opt: 1226
FT                   Z-score: 1391.3 E(): 1.3e-69 Smith-Waterman score: 1226;
FT                   57.186 identity in 334 aa overlap Required for pili
FT                   retraction probably by filament disassembly. Homologous to
FT                   pilB but which has the opposite effect. Unique to type IV
FT                   pili."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08104"
FT                   /inference="similar to sequence:UniProtKB:Q8EBZ4"
FT                   /protein_id="CAL08104.1"
FT                   /translation="MIRKLLTLCVQKKASDLHLSSGCKAKYRIDGDLIDIESSPVLNDK
FT                   MISQMLLEIMTDDQKDELIETYECDFSIDDRDNDARFRVNAFFHNRGYGAVFRRLENTI
FT                   PTLDQFGAPRILKEVQAKKGGLILVTGPTGSGKSSTLAALVNEINHKEDSHILTIEDPV
FT                   EFVHTSQRSLVNQREVKRDTKSFNAALKSALREDPDCILVGEMRDLETIRLALEAAETG
FT                   HLVLGTLHTISAIKTVDRVISVFPPAEQELVRNMLAESLQIVISQRLLKRKGGGRVAAY
FT                   EVLISNTGIRNMIKENKLSQIYTALQTGTAKGMATIEQSIENLLKAGTITPEEAAKYIV
FT                   VR"
FT   CDS_pept        complement(join(92789..93313,93315..93569,93569..93787))
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0089c"
FT                   /product="conserved hypothetical protein, pseudogene"
FT                   /note="Similar to Q9HVD5 Hypothetical protein PA4657 from
FT                   Pseudomonas aeruginosa (327 aa). FASTA: 552 Z-score: 636.7
FT                   E(): 1.3e-27 Smith-Waterman score: 552; 28.395 identity in
FT                   324 aa overlap. Contains 2 frameshifts after aa 73 and 158
FT                   ORF ftt0089c"
FT                   /inference="similar to sequence:UniProtKB:Q9HVD5"
FT   CDS_pept        complement(93784..94230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0090c"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="Similar to Q87GR3 Hypothetical protein from Vibrio
FT                   parahaemolyticus (148 aa). FASTA: opt: 160 Z-score: 212.3
FT                   E(): 0.00057 Smith-Waterman score: 160; 29.104 identity in
FT                   134 aa overlap ORF ftt0090c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0090c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08106"
FT                   /inference="similar to sequence:UniProtKB:Q87GR3"
FT                   /protein_id="CAL08106.1"
FT                   /translation="MKNQKSIDVYLAYSGLIPFLFFTICLLFNYKHTLIFGNTIQALSI
FT                   YGLIIASFLAGTHWGRQINIESPIVKLLLQISSNINVITIWFAYLNLNSKYFILLLIIE
FT                   FLVLLKIDYYIYKLKITSSRYFLYIRLPITIAVVILLAISWSLI"
FT   CDS_pept        complement(94241..95203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="appB"
FT                   /locus_tag="FTF0091c"
FT                   /product="cytochrome oxidase bd-II, subunit II"
FT                   /EC_number="1.10.3.-"
FT                   /note="Similar to Q87H27 Cytochrome BD2, subunit II from
FT                   Vibrio parahaemolyticus (335 aa). FASTA: opt: 573 Z-score:
FT                   669.5 E(): 1.9e-29 Smith-Waterman score: 750; 34.743
FT                   identity in 331 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0091c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08107"
FT                   /inference="similar to sequence:UniProtKB:Q87H27"
FT                   /protein_id="CAL08107.1"
FT                   /translation="MDLGLIWLAIIAFALLLYMILDGFALGMGILFPLLDDHQKDIATS
FT                   ILLPTWDGNQTWLVFALACFYGMFPIAFAYIFPKIYLSAILLVVMILLRGICFEFRLKS
FT                   SQKGIKNWDKLFFISSFVATFLQGYIVGELIVGFPHNSFYNFGFSAVTGITLIFGYSLL
FT                   GATRLFLKSEGELFTKAKQLAKICCIILAVLMLVIGGMTPLYVKLPLDNLYKMAILIEL
FT                   FVLTIISFLVLIKVIEAKNHALPYWLAVAIFILTYISMLTLIFPYIIPYQITYTQAQAS
FT                   DTTLIFTLIPAIIMIPLLLLYTSYAYYIFRGKTKEKLSY"
FT   CDS_pept        complement(join(95210..96340,96344..96583))
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="appC"
FT                   /locus_tag="FTF0092c"
FT                   /product="cytochrome oxidase bd-II, subunit I, pseudogene"
FT                   /EC_number="1.10.3.-"
FT                   /note="Similar to Q92IY2 Cytochrome d ubiquinol oxidase
FT                   subunit I from Rickettsia conorii (456 aa). FASTA: opt:
FT                   1445 Z-score: 1673.2 E(): 2.4e-85 Smith-Waterman score:
FT                   1443; 49.083identity in 436 aa overlap. Contains an
FT                   in-frame stop codon after aa 80"
FT                   /inference="similar to sequence:UniProtKB:Q92IY2"
FT   CDS_pept        96819..97700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0093"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Q8FFI5 Hypothetical protein yfcH from E.
FT                   coli (297 aa). FASTA: opt: 498 Z-score: 611.0 E(): 3.8e-26
FT                   Smith-Waterman score: 498; 32.673 identity in 303 aa
FT                   overlap ORF ftt0093"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0093"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08109"
FT                   /inference="similar to sequence:UniProtKB:Q8FFI5"
FT                   /protein_id="CAL08109.1"
FT                   /translation="MRILVAGGSGFVGRELSKYLSTRHHLTLLTRVANQNLGDYKELIT
FT                   WQQLTEDNIVNYDIIINLCGYNIGQKRWTKAVKDRILSSRIEPTNKLIRLISNKNIWLI
FT                   NASAIGYYNFSKLAQDEDNHDRSYDKLTFGQKVVDQWEKCLVDSHLQRYTILRFGVVIG
FT                   NGGVLEKMALPAKFGFLTMFGDGHNYMSWVSAYDLSRAIEFIIDKKLDSKEIFNLTAPD
FT                   ACQHKLLVELLRKYLAKKRIIKIPTFMIKLMFGQMGEELLLSSQNIKPAKLQRLGFVFE
FT                   DSNIQQALERYI"
FT   CDS_pept        complement(97697..99124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qseC"
FT                   /locus_tag="FTF0094c"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="Similar to AAO90737 (Q83CA0) Sensor histidine kinase
FT                   from Coxiella burnetii (478 aa). FASTA: opt: 653 Z-score:
FT                   752.8 E(): 4.9e-34 Smith-Waterman score: 677; 29.083
FT                   identity in 447 aa overlap Sensory histidine kinase in
FT                   two-component regulatory system with QseB, regulates
FT                   flagella and motility by quorum sensing in E.
FT                   coli,according to Q8X524"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0094c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08110"
FT                   /inference="similar to sequence:INSDC:AAO90737"
FT                   /protein_id="CAL08110.1"
FT                   /translation="MFLKNKKESSILSFLVVSFASFFAVFMLVISIFSFYQVKHQNDSL
FT                   LDYQLRTAAEVIETVLKIYPLEDDENTTHMIMNRISNSFLNIKNYNKSIGFIVYDRKHK
FT                   KLLLKTSNLPNFHKNYDGITSTTGFEWVYTNEEDGQKNWYTYTLKTDNGNLITVFANDT
FT                   IKDKISRQIIFKFALLLASTYIVLIGFIYYILKTALHPLERINKRVAKINPRKNEKLNE
FT                   DVIPYEIKSIVDQINLLIEKFHETLEREKRFSGDAAHELKTPIAGVKTLVEIALASDDI
FT                   DEIKQKLERIKSSTNRYSHIIDQLLTLSRIQPNEQVTFGKKLMINKVLESFIAENAIKA
FT                   IEKNIEIVFYPSQQHLYCYSNDYLLGILFKNLISNAIKYTPNGGLIEISSYQEENNIVV
FT                   EIKDNGIGVPQENIERIFDRFYRETGTGEEGSGLGLAIVAEIVRLHNGKIFAQNNINQK
FT                   GLTITVKIPIDHKYEEN"
FT   CDS_pept        99240..100196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0095"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0095"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0095"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08111"
FT                   /protein_id="CAL08111.1"
FT                   /translation="MLNSVNNITQPFYTKYYECVALYFYTQENLKFDVLITCPHAELGK
FT                   SFVEFDFPAISQLIKLSKDDFNDFLAIEYDFGTHSLGHAIAQKLYAEYGLYTLVAEPSF
FT                   PRSILDAGRLYPNCLRNIVDYDQHPQLKQALIKLYDQYMQKLCHIVAVAKSYNAISIDL
FT                   HTMSSYSPNIVQERYSEAVIETPDTLNEYIQLYKNAHKDGEKRVTELFTGDARNGIFAS
FT                   KVLLESLSYELQQIGVEVEYDKPYILAEHLVAHYLVCELEAVCIDIPKDLLSKTTTADE
FT                   LYDIASLEIDHTKLNLMAEAFAKAIMNTQKQKQLKDA"
FT   CDS_pept        100438..101478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0096"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0096"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0096"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08112"
FT                   /protein_id="CAL08112.1"
FT                   /translation="MDNFIFLDKLIEHYRLSTIVMNYADQIQEFSDPEYTHLVPFTVAT
FT                   AVELLGIKYNKNYGLPEALSQFLNDKSFLRQMLHAKGILVLSINIVSTISDDDYVKKAL
FT                   EIYREYENNGIYECAVIMPRACSGYGIHRFESEKELRDILKLMHRVEVFMIDPWLDNLG
FT                   SPAFQVSIADRKEDDICLGLSDQMLDGQTHLGNKYKSKFSEEPAVIELCAQMTEILRDM
FT                   GVRGIVGVDLLIREINGQIVPYVLEVNARQTGAIYAGFLAYELRNGEHKPWIGHNNVVV
FT                   PKGSTIDDYHQYLKVNVVDYNYGDSEGVIITCIDNLDLNNKVMILVIADTDEQFDEILK
FT                   IATSFK"
FT   CDS_pept        101612..102157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0097"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0097"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0097"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08113"
FT                   /protein_id="CAL08113.1"
FT                   /translation="MGLNLLKNMEEKTIYRGINVTIVTKHLVQIERPSKLLEILFYKYV
FT                   FKHQTYADLALEYGKTKRWAYDQIHSYEVAKKEHNPRAVTLLCDTTFYGKRKDKLATVV
FT                   FCDTIENEVLLWRHVDSEKSKYYKEMLQQLLSLGYTVNAVTIDGKRGLNTVKVCPIQMC
FT                   HFHQKIVDRYIVNPRVFC"
FT   repeat_region   complement(102132..102143)
FT                   /note="ISFtu1 12bp terminal inverted repeat"
FT   CDS_pept        complement(join(102231..102689,102689..103015))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="isftu1"
FT                   /locus_tag="FTF0098c"
FT                   /product="Transposase"
FT                   /note="ISFtu1. Transposase, member of the IS630 Tc-1
FT                   mariner family. Identical to Q93EJ6 Putative transposase
FT                   from Francisella tularensis (118 aa) from aa 144-261.
FT                   Identical to Q93EJ7 putative transposase from Francisella
FT                   tularensis (126 aa) from aa 1-109. Q93EJ6 and Q93EJ7
FT                   previously characterised as two separate ORF's. ORF1
FT                   (identical to Q93EJ7) contains a programmed ribosomal
FT                   frameshifting motif, 5'-AAAAAAAG-3' at aa position 109
FT                   which permits frameshifting to ORF2 (identical to Q93EJ6)
FT                   to produce a single ORF. Alignment of this single ORF with
FT                   additional members of the IS630 family, and also mariner
FT                   elements, show that this transposase shares strongly
FT                   conserved residues, including a fully conserved
FT                   dipeptide,Asp-Glu (DE), and a block consisting of a fully
FT                   conserved Asp and highly conserved Glu, separated by 34 or
FT                   35 residues (D35E). The conserved dipeptide is only present
FT                   if ribosomal frameshifting occurs."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0098c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08114"
FT                   /protein_id="CAL08114.1"
FT                   /translation="MPSYSQDFRDIVINKHEEGMTEFELSKFFNIDKRTVVSWIEFYKR
FT                   TGDYSSKQGVGCGRVASFTDKTLIEQYLIDHPDASALDIKEALAPDIPRSTFYDCLNRL
FT                   GFSFKKKTPKYKQRKEHERLEYIEKLKEIAQNLLFYIDEMGCDNKLSILRGWSLIGEPS
FT                   YGEVLAYQTQRRSIVAGYNYADKKIIALLEYSGYTNTEIFNQWFEEHLCPSLKPKTTIV
FT                   MDNASFHKSSKLIEIANKFDVQILYLPPYSPDLNPIEKV"
FT   repeat_region   103022..103040
FT                   /note="ISFtu2 19bp terminal inverted repeat"
FT   CDS_pept        103117..103860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="isftu2"
FT                   /locus_tag="FTF0099"
FT                   /product="Transposase"
FT                   /note="ISFtu2. Transposase, member of the IS5 family.
FT                   Identical to Q8GM03 putative transposase from Francisella
FT                   tularensis (247 aa)."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0099"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08115"
FT                   /protein_id="CAL08115.1"
FT                   /translation="MNYHIKEVFWSIILSFLKSQKGIHTNDEAKLRLFIEAVFYVLRTG
FT                   CQWRMLPFYYGKYRSIHKRFKDWCDKDIFSRLFKSVQNPDLQEVMLDSTIARAHACATG
FT                   YDKDDNQAIGRSVGRITTKIHAMTDALGNPIEILLSEDKTHDSKVAIDLLKNVYNTKVI
FT                   ADRAYHSNEIRQHIQGISSEAVIPCKSNTLNHIPFDSHVYKERHLIENFFSKIKHFRRV
FT                   FSRFDKTILAYIGMIKLACTFIWLR"
FT   repeat_region   103868..103886
FT                   /note="ISFtu2 19bp terminal inverted repeat"
FT   CDS_pept        103888..104301
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0100"
FT                   /product="Transposase, fragment"
FT                   /note="Similar to Q9K0L1 IS1016C2 transposase from
FT                   Neisseria meningitidis serogroup B strain MC58 (222 aa).
FT                   FASTA: opt: 368 Z-score: 482.6 E(): 5e-19 Smith-Waterman
FT                   score: 368; 49.123 identity in 114 aa overlap. This CDS has
FT                   no start codon due to disruption by the insertion of an
FT                   ISFtu1 element at the N-terminal end Identical to carboxy
FT                   terminus of FTF1053c and FTF1792c ORF ftt0100"
FT                   /inference="similar to sequence:UniProtKB:Q9K0L1"
FT   CDS_pept        104530..105543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0101"
FT                   /product="conserved membrane hypothetical protein"
FT                   /note="Similar to Y402_RICPR (Q9ZDC9) Hypothetical protein
FT                   RP402 from Rickettsia prowazekii (317 aa). FASTA: opt: 431
FT                   Z-score: 518.0 E(): 5.9e-21 Smith-Waterman score: 432;
FT                   28.909 identity in 339 aa overlap ORF ftt0101"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0101"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08117"
FT                   /inference="similar to sequence:UniProtKB:Y402_RICPR"
FT                   /protein_id="CAL08117.1"
FT                   /translation="MLLKNNYLVSIILVVLIMIVTKSFACAATDYNKVALINVSTQYYP
FT                   NDIKQAEKALKDTGYNTTYKYLDIYPSDFGYSNPDSIRAKILLDALLDKNIDIIWFLKG
FT                   GGGAFNLLPYLYDHINELKKAKPKILVGFSDVTAIHFFVNNVLGWKSLHGVVAAYNKNA
FT                   YSSQKIGKIRINDLERIPNITEIINNGISYDKLMPMNKMAYNGIDGSIVGGNMTLIYSY
FT                   FSTVYQQDISTKILFLEDTGISFRQLDRSLHQLLYLPENKKPEAIIFGQFYPLDPTDDQ
FT                   RLIYKTVIKKFAKTFNRPVYYFPFIGHGQYNKPLLLGVTSNIKCSKETIFCTLKQK"
FT   repeat_region   106103..106113
FT                   /note="ISFtu4 11bp terminal inverted repeat"
FT   CDS_pept        join(106194..106454,106458..106613,106615..106833,
FT                   106832..107050)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0102"
FT                   /product="Transposase, pseudogene"
FT                   /note="Similar to NP_927686.1| Transposase, IS982 family
FT                   from Photorhabdus luminescens subsp laumondii TTO1. Score =
FT                   170 bits (431),Expect = 2e-41 Identities = 95/258
FT                   (36),Positives = 146/258 (56), Gaps = 5/258 (1). Contains
FT                   an in-frame stop codon after aa 87 and frameshifts after aa
FT                   138 and 216 ORF ftt0102"
FT                   /db_xref="PSEUDO:CAL08118.1"
FT                   /inference="similar to sequence:UniProtKB:NP_927686.1"
FT   CDS_pept        complement(106988..107569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0103c"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0103c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0103c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08119"
FT                   /protein_id="CAL08119.1"
FT                   /translation="MDKDVLDIYTDYLISQTKYATATKLSDILDQEVSHDKITRFLSKP
FT                   YLTSLEFWKYIKPLVRKHNSEYEVLCLDDTISEKPSTDENDIVCWHHSHAKGVHVKGIN
FT                   IVSCILSTSNLSIPIDYEIVKKYKRYYDEKDKRYKRRSKITKNQMFQNMINRAVINQVK
FT                   FKYILTSVRQLFHRQTLRIIDFNWVNNKLS"
FT   repeat_region   107055..107065
FT                   /note="ISFtu4 11bp terminal inverted repeat"
FT   CDS_pept        complement(107814..109091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0104c"
FT                   /product="major facilitator superfamily (MFS) transport
FT                   protein"
FT                   /note="Similar to Q83DX6 Major facilitator family
FT                   transporter from Coxiella burnetii (421 aa). FASTA: opt:
FT                   995 Z-score: 1049.4 E(): 1.5e-50 Smith-Waterman score: 995;
FT                   39.066identity in 407 aa overlap ORF ftt0104c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0104c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08120"
FT                   /inference="similar to sequence:UniProtKB:Q83DX6"
FT                   /protein_id="CAL08120.1"
FT                   /translation="MDKSHLPNTKVLVTLSWIICLIATLNYSYDFFIRAAPSVMGNNLI
FT                   IDFGISHTELGMLSSAYFVSYTIMQIPAGVILDKYNRKVVISIATAFCVLGNYLFSATN
FT                   YYEVAYIGRIFMGIVTAFGFIGAAKMAGMWLPEKLFSTFIGFATVVGILGGLVTDTLLS
FT                   SLVSDLGWRDGNAVFTYIGVGILLLIVIFIRDNPKHVAKFTHLSEANFKETIVKVLKIF
FT                   CNLKFWAASIIGAVLFIPINVLGSLWGVGLIQAKFGLTQEIASHLNGALFIGAAVGFTV
FT                   AAIIASLTNRYRLMLTLSIVSLAMLLAIILYVPMSLSMFTVLYFLLGAAAGPQAVTFGI
FT                   AKIISPKGTTGSATARVNMINNFVPILLPLVGYILTHFGTFIANSRTIYTITSYQNALD
FT                   MVIIFLLVCLPIAMLIPKQIQADLNH"
FT   CDS_pept        complement(109223..112336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0105c"
FT                   /product="Transporter AcrB/AcrD/AcrF family"
FT                   /note="Similar to AAO90606 (Q83CM1)
FT                   Transporter,AcrB/AcrD/AcrF family from Coxiella burnetii
FT                   (1019 aa). FASTA: opt: 2662 Z-score: 2840.6 E(): 2.3e-150
FT                   Smith-Waterman score: 3071; 45.171identity in 1025 aa
FT                   overlap ORF ftt0105c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0105c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08121"
FT                   /inference="similar to sequence:INSDC:AAO90606"
FT                   /protein_id="CAL08121.1"
FT                   /translation="MRLIDLFIRRPVLSLSISFMIIVVGVGSFFKLQVRQYPYIDSATI
FT                   TVTTSYPGANPATIQAFVTRPLEAAVGSSKGIDYMTSESALGTSTITVYVKLGYNTNDV
FT                   LSEVVQNVNSILNQLPQDAYSPAIKLNPADNFPSLILAFTSKTMNTSEISAYINSELTP
FT                   KLLAEGGLSEINVWGNMPYAMRIYPNKTRMAEYGITPTELATAIGSNSLVSAGGQIQGP
FT                   YLNYTLNPETSMSTAQEYRNLIIKKSDNQIVRLSDVARVELGAQNYNSSVYFDGKNAVL
FT                   AGAVVSPEENPLDVVNRLVKQLPNIKASLPNGLNVDVAYNSTLYIESSIDEVLHTLLEA
FT                   VIIVSIVMFLFLGSLRAIIVPIIAIPLSIIGSFFLMSIMGFSINLLTLLAMILAIGLVV
FT                   DDAIVVLENIYRHIEEGMEPFAAAIKGAREIANPVILMTLTLIVVYAPIGMMGGFTGQL
FT                   FTEFAYSLAGAVLISGIVAYTLSPMMCSKVLNREMMSSKLVKFIDNVFSKLAAKYKALL
FT                   MFVLDIKPAIAIVGIIVLASCFIMGKGIKSELAPNEDMGFLGVMGQAPSSANINYLETF
FT                   GKKLANTLDEIPGKQNVFILNGIMSSNVIFGGFIMQPWDERKISQQQAANIAQAKVTEL
FT                   PGVQTYTYQTPALPGIPRGAPLSLVIQSVNDYEAIDEITNKIIAKMMSNGLFVFAQSDL
FT                   KFDNPIVDINIDRDKAGILGITMSDIAKTLGYSYAGGYINYFFLKGYSFQVIPQLARNE
FT                   MLTQEQLGNIYIRSDEMNKLFDSEVPLSALVTFKTEGQPLTLNTFQQLNASTISAVMAP
FT                   GITQGQAIEYVQSVVKSMLPEGFSYNFSGSARQYIENGNTMMVAFAFAIVLIFLALSAQ
FT                   FESFRDSLVILVTIPMAISGALIPLYVGQYLGASWASLNIYTQLGLVTLIGLISKQGIM
FT                   VVEFANHLQKHNGMNKYDAIVTSSSQRLRPILMTVSAMVVGVIPLVTSSGAGAISRNCI
FT                   GVVISSGLVIGAIFSLFVLPVVYMYIASDKSKLVKTDAEQQQIIDQIK"
FT   CDS_pept        complement(112336..113709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0106c"
FT                   /product="Efflux protein, RND family, MFP subunit"
FT                   /note="Similar to Q83CM0 Efflux transporter, RND family,MFP
FT                   subunit from Coxiella burnetti (380 aa). FASTA: opt: 732
FT                   Z-score: 824.0 E(): 5.2e-38 Smith-Waterman score: 781;
FT                   34.748identity in 377 aa overlap ORF ftt0106c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0106c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08122"
FT                   /inference="similar to sequence:UniProtKB:Q83CM0"
FT                   /protein_id="CAL08122.1"
FT                   /translation="MDVKKTFLNIKQKINSSKRNYAIFVIATIILAWLVLGKLGISLAI
FT                   VYFIFQINYIKNKLHKLKDKKTASIAIVVATLILFGGIFSFAEFIQSMIKKGMAAYVPQ
FT                   PVAVTSSVVEKTDWKQVINTIGEAQAVQSTAISSQSGGIVSEIHFKSGQEVKKGDLLFK
FT                   LDTSQLKANLEEALSNLKLAKITKDRYNKLVEQKATSKESADKANADYLSALAQVQNIE
FT                   SQIGFKEVRTPFDGKIGIRNISLGQYFNNGDNAATLTTIDPIFITFPVPQNKVSMISVG
FT                   QEINFYSDSYPGETFTGKITAINSFINDSNRSITVQATYANPHHKIVAGMFLTVHVSLP
FT                   VRKNSIVIPRNAISYSLYGQSVFTLEPVMKDGQPVKASYTSTADGGMKTINTDKTLYKV
FT                   GQANIEVLETRNNLALVTGLEPGTTIITSGQNKVHKGMNAIINNSVEIDNNIYKQGIQ"
FT   CDS_pept        complement(113722..114213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbB"
FT                   /locus_tag="FTF0107c"
FT                   /product="disulfide bond formation protein"
FT                   /note="Similar to DSBB_NEIMB (Q9JYC6) Disulfide bond
FT                   formation protein B (disuphide oxidoreductase) from
FT                   Neisseria meningitidis (162 aa). FASTA: opt: 171 Z-score:
FT                   223.1 E(): 0.00014 Smith-Waterman score: 171; 27.344
FT                   identity in 128 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0107c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08123"
FT                   /inference="similar to sequence:UniProtKB:DSBB_NEIMB"
FT                   /protein_id="CAL08123.1"
FT                   /translation="MKKLSNCIFIFNTLACFVALGVVIFTISVLDWKPCPMCLLQQLCV
FT                   LSIMLLSLLVLATKKFKSFSTLLQLITIIVIATGAYIAADQVYLQYFLTDTSNNNAACG
FT                   AINNKFLLDATKSITGTINSCTDISEKISGVSLTVYSFIFFISLLIINCINFLVRILKK
FT                   "
FT   CDS_pept        complement(114253..115335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cca"
FT                   /locus_tag="FTF0108c"
FT                   /product="tRNA nucleotidyltransferase"
FT                   /EC_number="2.7.7.25"
FT                   /note="Similar to Q8CXX6 tRNA nucleotidyltransferase from
FT                   E. coli (412 aa). FASTA: opt: 828 Z-score: 973.6 E():
FT                   2.4e-46 Smith-Waterman score: 842; 43.020 identity in 351
FT                   aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0108c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08124"
FT                   /db_xref="GOA:Q14JW7"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR012006"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JW7"
FT                   /inference="similar to sequence:UniProtKB:Q8CXX6"
FT                   /protein_id="CAL08124.1"
FT                   /translation="MKFYLVGGAVRDMLLGITPKDKDWVVVGATEDEMLANGFIKIAAN
FT                   FPVFIHPQTKQEYALARSEKKTASGYHGFEVNFSKYITLEDDLKRRDLTINSIAIDQNN
FT                   KVIDPFNGQADLQNRILRHTSIAFIEDPLRVVRLARFKAQLSNFNFSIAQEMLALIKEL
FT                   VKTGELNHLTRERLHIEFVKALNNPKIFFTTLKELEALKIIFPNISCFLPLIPNKSFFE
FT                   NPIYKGSNINEKITLCLLKIPQQQLDDIRKEFLLTNKHYKLLKASIAISKILEDRSITA
FT                   EEIFQLIKNANIIRDKNLFAESLNLYKKYLKICDTITPHRNYQLLQTTINTIKNASIDS
FT                   LTIKTIPKDKLRNTLKQLKL"
FT   CDS_pept        115440..117269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msbA"
FT                   /locus_tag="FTF0109"
FT                   /product="Lipid A transport protein, ABC
FT                   transporter,ATP-binding and membrane protein"
FT                   /note="lipid A transport protein, ABC
FT                   transporter,ATP-binding and membrane protein. Similar to
FT                   Q47908 ValA from Francisella novicida strain U112 (572 aa).
FT                   FASTA: opt: 3334 Z-score: 3684.8 E(): 2.4e-197
FT                   Smith-Waterman score: 3334; 97.810 identity in 548 aa
FT                   overlap (54-601:13-559). Similar to MSBA_HAEIN (P44407)
FT                   Lipid A export ATP-binding protein from Haemophilus
FT                   influenzae (587 aa). FASTA: opt: 1570 Z-score: 1735.1 E():
FT                   9.4e-89 Smith-Waterman score: 1570; 41.913identity in 575
FT                   aa overlap."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08125"
FT                   /db_xref="GOA:Q14JW6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR011917"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="PDB:5DGX"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JW6"
FT                   /protein_id="CAL08125.1"
FT                   /translation="MANMIDKIDLKSQGSSNLSGEMTNHQKVGTLYKRLLLQVKHLWHF
FT                   LLLAAIGSIFFSAADASMIYLINPILNYGFGPGGGITKQSATILMLMGVGMVGLLALRS
FT                   VGSFVSQYFIGSLGQKVVYKFRKDIYKRLMDLPASFFDKHSTGQIISRLLYNVDQVIEA
FT                   TSTAIITVVQDGTFVIGLIVVMFVSSWQLSLFLIVVGPFLGLFISIINKKFRNLSRNTQ
FT                   SSMGNVTHTAEETIRNYKEIRIFGAQQKQQNKFFKNLDYTYSQQIRTIALDALTSPVIQ
FT                   IIASLVLAFSLFTIAIFGTNEGDGSSWLTAGSFASFFAAAAAILKPIKNLTKVNVVIQK
FT                   AVAATEDIFYILDYPAEKETGSKELAKVDGNVTIKDLSFAFGEHKVLSGVSVDIKAGQT
FT                   VAFVGKSGSGKTTLTSIISRFYTQHEGEILLDGVDTRELTLENLRSHLSIVSQNVHLFD
FT                   DTVYNNIAFGLSREVSEEEVIDALKRANAYEFVQELSDGINTNIGNNGSKLSGGQRQRI
FT                   SIARALLKNAPVLIFDEATSALDNESERVVQQALESLTKSCTTIVIAHRLSTVENADKI
FT                   VVMDGGRVVESGKHQELLEQGGLYTRLYQSGLQ"
FT   CDS_pept        117275..118243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxK"
FT                   /locus_tag="FTF0110"
FT                   /product="Tetraacyldisaccharide 4'-kinase"
FT                   /EC_number="2.7.1.130"
FT                   /note="Similar to LPXK_FRANO (Q47909) Tetraacyldisaccharide
FT                   4'-kinase from Francisella novicida (322 aa). FASTA: opt:
FT                   2072 Z-score: 2504.0 E(): 1.4e-131 Smith-Waterman score:
FT                   2072; 99.068 identity in 322 aa overlap (1-322:1-322).
FT                   Similar to Q87YF5 Tetraacyldisaccharide 4'-kinase from
FT                   Pseudomonas syringae (pv. tomato) (331 aa). FASTA: opt: 631
FT                   Z-score: 764.2 E(): 1.1e-34 Smith-Waterman score: 728;
FT                   37.421 identity in 318 aa overlap."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0110"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08126"
FT                   /db_xref="GOA:Q14JW5"
FT                   /db_xref="InterPro:IPR003758"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JW5"
FT                   /inference="similar to sequence:UniProtKB:LPXK_FRANO"
FT                   /protein_id="CAL08126.1"
FT                   /translation="MLDKIWYRSKPNLLSRVLQPISLVFIDIANKRKIKQQLKQYKSKI
FT                   PIIVVGNISVGGTGKTPVVRMLAQQYLAQDKKPAIISRGYGAKADNYPFEVTSGTLATQ
FT                   CGDEPAMLFDALQAQVPIVIAPERVQAVKYIEKNFPDTDIIMSDDGLQHYKLARDKEIV
FT                   VVDAIRMFGNKLCLPAGPLREPIERLKEVDQIIVIGNCSDKDKELLKNYKNVTYAKVVA
FT                   TEFVNILTAKKVAKTEFNHQNAIAIAGIGNPTKFFKTLEESAINITAKKVFKDHHKFTQ
FT                   SDFEGIDSDITVVMTYKDAIKCKNFAKANWWYLDIALDINV"
FT   CDS_pept        118339..121032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="FTF0111"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /note="Similar to AAO91288 (Q83AT5) DNA polymerase I from
FT                   Coxiella burnetii (895 aa). FASTA: opt: 2961 Z-score:
FT                   3329.8 E(): 1.4e-177 Smith-Waterman score: 2961; 52.058
FT                   identity in 899 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0111"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08127"
FT                   /inference="similar to sequence:INSDC:AAO91288"
FT                   /protein_id="CAL08127.1"
FT                   /translation="MKKIVLVDGSSYLFRAYHALPHLTNSQGEPTGAIIGVINMLKKLP
FT                   IMYDTEYVAVVFDAKGKNFRHQLYPQYKAHRKDIDDELRVQIQPLHQIIEKMGFAVIIE
FT                   DGVEADDVIGTLAQKLQKQDYQIIISTGDKDMAQLVTDNIVLYDSMKNVTTDVAGVLEK
FT                   YQISPHQMIDYLALMGDSSDNIPGIPKVGPKTAVKWLQDYQNIDGIIANQQQIKGKVGE
FT                   NLRNNIDLLKLSYQLATIKCDLELDLTVEDLKCKAADKAYLIEAYTRYEFKSLLKDLYN
FT                   SDIKIVTSQAQAADVAIEYITITTQTQLDDLIAELEKYDSFAFDTETDSLNTYEANLVG
FT                   LSFCAKEGRAFYIPLQHRYLGVPQQLELGFVLDKLKPLFADSKKVKVAHNFKFDEKVLS
FT                   KYAIEINGKVDDTMIMAYVLKSSGKHDMDSLSKEHLGIEPIAYTAIAGTGKQQQTLDQV
FT                   DIEIVAKYAAEDADITFRLFNHFKALLEQDKVLFKLYCELEMPLTIILNQMEKTGVKID
FT                   ATKLIQQSASLETSIKELESKCYNLAGQEFNLSSPVQLREILFEKLGLPPVKKTAKGQV
FT                   STSEEVLVQLAEDYEIAALIMKYRHLSKLKNTYTDKLPKMLDANGRVHTSYNQTGTVTG
FT                   RLSSSDPNLQNIPIKSPEGRKIREAFIAEDGYCIVAADYSQIELRIMAHLSKDKNLLKV
FT                   FNQNLDIHSATAAEVLGISIDEVSSEQRRKAKAINFGLIYGMSAFGLARQLEIPRAEAQ
FT                   EYIDIYFNRYPSVKEYMTTAKEFAKQNGYVETILGRRLYLPEINSKNVMQRNAAERAAI
FT                   NAPMQGTAADIIKKAMINVNMMISQEYNSEIKMVMQVHDELVFEVKKTKLEEIVAKIKS
FT                   IMEAAVKLNVPLEVNVDSGKSWDQAH"
FT   CDS_pept        121052..121828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0112"
FT                   /product="transcriptional regulator"
FT                   /note="Similar to Q8R7M2 Putative transcriptional
FT                   regulator, (homolog of Bvg accessory factor) from
FT                   Thermoanaerobacter tengcongensis (255 aa).FASTA: opt: 522
FT                   Z-score: 636.2 E(): 1.5e-27 Smith-Waterman score: 522;
FT                   35.271 identity in 258 aa overlap ORF ftt0112"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0112"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08128"
FT                   /db_xref="GOA:Q14JW3"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JW3"
FT                   /inference="similar to sequence:UniProtKB:Q8R7M2"
FT                   /protein_id="CAL08128.1"
FT                   /translation="MLLVMDMGNSHIHIGVFDGDRIVSQIRYATSSVDSTSDQMGVFLR
FT                   QALRENSVDLGKIDGCGISSVVPHLNYSLGSAVIKYFNIKPFFISMDTTDLDMSAVEAH
FT                   QVGADRIASCISAIADHPNKDLLIIDLGTATTFDLVTKDKKYLSGSIMPGVKLSLNALC
FT                   QGASQLSSVTIVKPEVAIGYDTKTNIRSGLYYGHLGALKELKRRSVEEFGSPVYTIATG
FT                   GFAGLFKEEDIFNEISPDLILRGIRIAFLENNKKGV"
FT   CDS_pept        121833..123077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoB"
FT                   /locus_tag="FTF0113"
FT                   /product="Phosphopentomutase"
FT                   /EC_number="5.4.2.7"
FT                   /note="Similar to Q8ZIQ3 Phosphopentomutase from Yersinia
FT                   pestis (407 aa). FASTA: opt: 1454 Z-score: 1815.0 E():
FT                   3.3e-93 Smith-Waterman score: 1454; 54.501identity in 411
FT                   aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0113"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08129"
FT                   /inference="similar to sequence:UniProtKB:Q8ZIQ3"
FT                   /protein_id="CAL08129.1"
FT                   /translation="MLKDKKVVILLFDSFGIGQAPDAADFGDEGADTLGHIVDYFTNNG
FT                   MSISLPNLSKKGLKKAAEYNRCKEFSQDIAQSEQVENAKYGYCAEVSKGKDTPSGHWEL
FT                   AGVPVMFDWYYFTKKQHQSCFDKEFIDKWVERAGITEGFIDAGHASGTEVLKEHGCESC
FT                   VTKKPIIYTSADSVFQVAAHEDYYGLDKLLKICLVAREVLDEMGMKVGRVIARPFIGES
FT                   ADEYVRTGNRRDFSILPPAPTLLDKLVKAGGEVVSIGKIADIYANQGITKKVKATGLEE
FT                   LFDKTIDEYTLAKQNTLVFTNFVDLDSSFGHRRDPKGYGKALEYLDSRIPDLDAKLDDN
FT                   TIVVLAADHGCDPTAPGSDHTRECVPFLLWGRNIKSEFIGARDTFADIGQTIADFMGIE
FT                   SLEYGKSIFGASHDN"
FT   CDS_pept        123040..123801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoC"
FT                   /locus_tag="FTF0114"
FT                   /product="Deoxyribose-phosphate aldolase"
FT                   /EC_number="4.1.2.4"
FT                   /note="Similar to AAP95774 (Q7VMS9) Deoxyribose-phosphate
FT                   aldolase from Haemophilus ducreyi (258 aa). FASTA: opt: 632
FT                   Z-score: 764.1 E(): 1.1e-34 Smith-Waterman score: 632;
FT                   42.857 identity in 245 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0114"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08130"
FT                   /inference="similar to sequence:INSDC:AAP95774"
FT                   /protein_id="CAL08130.1"
FT                   /translation="MVNQSLGLAMITKQEIVSLIDLTQLGDSDTQVDIVNLCSKARNSL
FT                   GEVAALCVYKQFIPVVKKQLGNNFKVATVVNFPNGDNTIEDVISEVKQALSLGADEIDL
FT                   VIDYKEYLDQGFSEKSCQMMVEVKKLCKDKTFKVIIESGELKTAKLITKVCQDVIDAGA
FT                   DFIKTSTGKTSEGATLAAAQVILETIKSSAKRIGFKASGGIRNYNQAVAYIELAANILA
FT                   NNFINPQTFRFGVSGLLDNLLNEQQEQIDDY"
FT   CDS_pept        123791..124990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nupC1"
FT                   /locus_tag="FTF0115"
FT                   /product="nucleoside permease NUP family protein"
FT                   /note="Similar to AAP07626 (Q81I17) Nucleoside permease
FT                   nupC from Bacillus cereus (392 aa). FASTA: opt: 1236
FT                   Z-score: 1430.7 E(): 7.7e-72 Smith-Waterman score: 1236;
FT                   49.246 identity in 398 aa overlap Paralog of FTF0116"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0115"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08131"
FT                   /inference="similar to sequence:INSDC:AAP07626"
FT                   /protein_id="CAL08131.1"
FT                   /translation="MIIKSLYFILGLIVIYFLAYIWSNNRRNIRYKNLIIILIVQLILA
FT                   KFMLSTSIGINIINYVNKCFEVLLDSTHIGVEFVFGNLANIKEFIFFFNAAMPIVVMSA
FT                   VIGILQYFRILQFLVFAIGSILSKVTGMGKLESFNAVSSLSVGQSENFLYYKKIIKYLP
FT                   SNVLYTMAATAMSTVSIGTAAAYMTIIDPSYVCVAIVMNMFGAFFVLNIINPYEKTKEV
FT                   TYEFLTDQVEDYERQRFFEMLSEYILDGFKVAIIVCVMIMGYIAFLNLADGIFSSLVGI
FT                   SLRDILGYIFYPIAWILNIHGNEIFLSSQIMGTKIVTNEFVAMQELANHSTQLSQHTKA
FT                   VVSVFLVSFANFSSIGIIIGAIQALSREASVKVARFSLKILYGAVLVSFLSANIVGFIL
FT                   "
FT   CDS_pept        125009..126211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nupC1"
FT                   /locus_tag="FTF0116"
FT                   /product="nucleoside permease NUP family protein"
FT                   /note="Similar to (AAP07626) Q81I17 Nucleoside permease
FT                   nupC from Bacillus cereus (392 aa). FASTA: opt: 1351
FT                   Z-score: 1549.9 E(): 1.9e-78 Smith-Waterman score: 1351;
FT                   52.381 identity in 399 aa overlap Paralog of FTF0115"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0116"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08132"
FT                   /inference="similar to sequence:INSDC:AAP07626"
FT                   /protein_id="CAL08132.1"
FT                   /translation="MFVKILYLLLGLVTVFILAFIWSSDRKKIKYKHLFIILFFQLLVC
FT                   FFILQSSEGIKLVAIISTGFDKILQHAHEGTAFVFGSLADTSKNGFVFFFNVGMPIVLI
FT                   SGIIGVLQYFRILPLVIRWVGFILTKITGMGKLESFNAVSSLTVGQQENFLIYKKIIGH
FT                   LPANVLYTMAATAMSTVSLAIAGSYMSIIEPKYVCTAIVLNMLSTFFVLHIINPYDKDP
FT                   SLNYDTLHADYETGRQSFFEMLSEYLLDGFKIAVIVCAMLVGFIALLNLVDGIFQEILG
FT                   ITFRQILGYIFYPIAWVLNIHGNEIFLSSQIMGTKIVTNEFVAMQELAKNSQQLSEHTK
FT                   AVVSVFLVSFANFSSIGIIVGAVQALNKEASIKVARFSLKILYGAVLVSILSACVVGFI
FT                   V"
FT   CDS_pept        126224..126853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nupC2"
FT                   /locus_tag="FTF0117"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="Similar to KTHY_VIBCH (Q9KQI2) Thymidylate kinase
FT                   (dTMP kinase) from Vibrio cholerae (212 aa). FASTA: opt:
FT                   596 Z-score: 740.1 E(): 2.5e-33 Smith-Waterman score: 596;
FT                   50.505 identity in 198 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0117"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08133"
FT                   /db_xref="GOA:Q14JV8"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JV8"
FT                   /inference="similar to sequence:UniProtKB:KTHY_VIBCH"
FT                   /protein_id="CAL08133.1"
FT                   /translation="MQSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKI
FT                   AEELRNLVLHNKYDEEIHSDSELLMIYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMA
FT                   YQGGGRGVELSKIRALNDNFLNGCEPDLVIYLDIDPILGLQRAQKVGSPDRIEKAGLEF
FT                   FNRTRKVFKDLVKDSDNAIEIDAAKSIQEVEKQIYLILDKHFNFQN"
FT   CDS_pept        126915..128492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfC"
FT                   /locus_tag="FTF0118"
FT                   /product="peptide chain release factor 3"
FT                   /note="Similar to RF3_PASMU (P57879) Peptide chain release
FT                   factor 3 (RF-3) from Pasteurella multicoda (529 aa). FASTA:
FT                   opt: 2490 Z-score: 2962.8 E(): 3.9e-157 Smith-Waterman
FT                   score: 2490; 70.209 identity in 527 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0118"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08134"
FT                   /db_xref="GOA:Q14JV7"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JV7"
FT                   /inference="similar to sequence:UniProtKB:RF3_PASMU"
FT                   /protein_id="CAL08134.1"
FT                   /translation="MSEYLQQIAKRRTFAIISHPDAGKTTITEKMLLFGNAIKTAGTVK
FT                   AKKSGIHATSDWMEMEKQRGISITTSVMQFPYNGRIINLLDTPGHEDFSEDTYRTLTAV
FT                   DSALMVVDAVKGVEDRTIKLMNVCRLRDTPIVTFMNKFDRDTRDPLELLDEVENILKIK
FT                   CAPINWPIGMGKYFKGVYDLYNDEVTLFETGHGHEIYPYKKIKGLANAKDAIGIDLYED
FT                   LEMEIDLVRGASHEFDEQEFLEGNLTPVYFGTALSNFGVKEMMDGFTRYAPAPQHREAD
FT                   QRVVAADEQKLTGFVFKIQANMDEKHRNRIAFFRICSGKYEKGMKIFHERTGKQMQISK
FT                   ALTFMAGEREQVEEGYAGDIIGLHNHGSIQIGDSFTQGEKLKFKGIPNFAPEIFKRVKL
FT                   NDPLKMKALQKGLVQLSEEGATQVFKPFISNDLVLGAVGVLQFDVVAQRLASEYNVKCS
FT                   YEGVNVTLARWIFCNDEKKLNDFKKKYEVNLAYDGAGYLTYLAPTGVNLQLAQEKNPDI
FT                   IFSATREH"
FT   CDS_pept        128567..129883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0119"
FT                   /product="hypothetical membrane protein"
FT                   /note="ORF ftt0119"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0119"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08135"
FT                   /protein_id="CAL08135.1"
FT                   /translation="MLKSISRVLVAGFALAKVSPVFSMEIYTVKSNDYLYKIAKNHAVT
FT                   GVSISELTDAIKGINKSEIPGIIDNRIRIGDKLAIPTTKAEVEDGLTLMRNQIIQSSYQ
FT                   QPSSDTTSQQPSTPAANLGDNTAAANDADDSSTPSVVSQDKIPVLIPTDDNSTPETYKS
FT                   NLDTQINSDNIQETASYEQQPTQSSSTWGSLFRFIIYVIILAVVVVVGKRFWETRNSKK
FT                   EQELELISKKKRDHLMSRISPVVSDNEFYRSDKVNNSPQEEFDFFGAAKSSRSEVTTVD
FT                   EKIQSQQESEDTFEQPAQNEEDLFAQRDKNIIVKTEKGVVFETNTDDTLVNSTADETKV
FT                   EEIDSQQQAEQELQYINELIEQFLDSEKYVEASITIQDSLEKDPNNIDLRYKLLEVYAR
FT                   AGDEIAFEGEVHFIKSKNIVSMFDPLHQKIAKLRDKYFE"
FT   CDS_pept        129880..130911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="FTF0120"
FT                   /product="signal recognition particle receptor FtsY"
FT                   /note="Similar to Q9I6C1 Signal recognition particle
FT                   receptor FtsY from Pseudomonas aeruginosa (455 aa). FASTA:
FT                   opt: 1262 Z-score: 1403.4 E(): 2.8e-70 Smith-Waterman
FT                   score: 1262; 61.935identity in 310 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0120"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08136"
FT                   /inference="similar to sequence:UniProtKB:Q9I6C1"
FT                   /protein_id="CAL08136.1"
FT                   /translation="MIIYLTKFLERKMFFKKKKNTEIESPIERVQEQDNKKGLFSRLQA
FT                   GLSKTANKFGSGLSTILMGQKVVDEELLEDIEMQLLTADVGVEATDEIVTYLRDKVARN
FT                   ELQTADKLNQIIQQKLTEIILPCEKPLEVDTQKSPFVILVVGVNGVGKTTTIGKLTKKL
FT                   QSQGKSVILAAGDTFRAAAVEQLREWGDRNNTHVVYQHEGADSASVIYDAIGSAKSKGI
FT                   DVVIADTAGRLHNKDNLMQELKKVVKVIKKTDETAPHEIMLVVDATTGGNALNQAEAFN
FT                   QIVNLTGITITKLDGTAKGGIVFSIAKKLGLPLRFIGVGEKIDDLQVFNARDFTTALFN
FT                   SND"
FT   CDS_pept        131002..133224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrD"
FT                   /locus_tag="FTF0121"
FT                   /product="DNA helicase II"
FT                   /EC_number="3.6.1.-"
FT                   /note="Similar to Q88C31 DNA helicase II from Pseudomonas
FT                   putida (728 aa). FASTA: opt: 1880 Z-score: 2129.9 E():
FT                   9.6e-111 Smith-Waterman score: 2083; 45.867 identity in 750
FT                   aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0121"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08137"
FT                   /inference="similar to sequence:UniProtKB:Q88C31"
FT                   /protein_id="CAL08137.1"
FT                   /translation="MSNYDFTLGLNPEQQKATLLEDRNALILAGAGSGKTKVLTSRIAY
FT                   LCRDKGVSIENILAVTFTNKAAKEIQQRVEKMLGISTFGMWIGTFHGIAHRLLRKHAHE
FT                   LGLDKNFRILDQDEQAQLVKKVINNLDLDDKKYPPKLLQNFINKQKDKAIRSNKLTKQY
FT                   DANYAHIYTAYEERLQLDNALDFADLLLHLYELFSFNQQLREYYQNKFKYILIDEFQDT
FT                   NHVQYMWLKLLITDNNYMMAVGDDDQSIYGWRGAVVDNIHNYVKDLKNVEIIKLEQNYR
FT                   STKNILKVANSVIKNNDNRMSKELWSAAEDGEKVVLYCAVNERDEAKYIIDKIRQLHND
FT                   GVDYSDIAILYRSNYLSRVLEESCIYASIPYRIYGGFRFFDRAEIKDALAYLRLAVTNS
FT                   DNLAFERIINTPTRGIGNKTLETIRNYAQINSLSYWQANLDVIQKELVTKRTASLLLKF
FT                   IELISGISAQINQHSLDKLLESVINQSGLLASYQEKNSEKDRQKIDNLKELISAAKDFE
FT                   PQIELLDDNTDILQDFLSFAVLEAGEMQADEATDSVQLMTIHASKGLEFRYVFLVAAEE
FT                   GVFPPSSIVNFEEVFDNTSSKKMQEKLAEERRLFYVAVTRAMKALTISYAQVRSIFGRS
FT                   SFQVKSRFVAEIDSQHLSQGKLEFTAAKPKTKQKANFGMSPFDFLKSNNTTNSFKPGDK
FT                   VFHKVFGKGVFIKAQAQGTKEFYTVDFGIDVGQKILLADIANLVKV"
FT   CDS_pept        133365..134822
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppA"
FT                   /locus_tag="FTF0122"
FT                   /note="Similar to OPPA_HAEIN (P71370) Periplasmic
FT                   oligopeptide-binding protein (precursor) from Haemophilus
FT                   influenzae (541 aa). FASTA: opt: 924 Z-score: 1112.1 E():
FT                   4.7e-54 Smith-Waterman score: 924; 34.490identity in 461 aa
FT                   overlap oligopeptide transporter, subunit A, ABC
FT                   transporter, periplasmic protein"
FT                   /db_xref="PSEUDO:CAL08138.1"
FT                   /inference="similar to sequence:UniProtKB:OPPA_HAEIN"
FT   CDS_pept        join(134847..135113,135116..135781)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppB"
FT                   /locus_tag="FTF0123"
FT                   /product="oligopeptide transporter, subunit B, ABC
FT                   transporter, membrane protein, pseudogene"
FT                   /note="Similar to Q9CJT2 (Q9CJT2) OppB from Pasteurella
FT                   multicoda (306 aa) FASTA: opt: 953 Z-score: 1065.0 E():
FT                   2e-51 Smith-Waterman score: 953; 46.645 identity in 313 aa
FT                   overlap. Contains a frameshift after aa 89"
FT                   /inference="similar to sequence:UniProtKB:Q9CJT2"
FT   CDS_pept        join(135769..135990,135992..136642)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppC"
FT                   /locus_tag="FTF0124"
FT                   /product="oligopeptide transporter, subunit C, ABC
FT                   transporter, membrane protein, pseudogene"
FT                   /note="Similar to Q87MY7 Oligopeptide ABC
FT                   transporter,permease frim Vibrio parahaemolyticus (300 aa).
FT                   FASTA: opt: 1042 Z-score: 1224.8 E(): 2.3e-60
FT                   Smith-Waterman score: 1042; 52.857 identity in 280 aa
FT                   overlap. Contains no start codon and a frameshift after aa
FT                   74"
FT                   /inference="similar to sequence:UniProtKB:Q87MY7"
FT   CDS_pept        136649..137617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppD"
FT                   /locus_tag="FTF0125"
FT                   /product="oligopeptide transporter, subunit D, ABC
FT                   transporter, ATP-binding protein"
FT                   /note="Similar to Q8D8A2 Oligopeptide ABC
FT                   transporter,ATP-binding protein D from Vibrio vulnificus
FT                   (324 aa). FASTA: opt: 1202 Z-score: 1353.8 E(): 1.6e-67
FT                   Smith-Waterman score: 1202; 56.270 identity in 311 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0125"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08141"
FT                   /inference="similar to sequence:UniProtKB:Q8D8A2"
FT                   /protein_id="CAL08141.1"
FT                   /translation="MKDLALQIKDLNVGFKADDGMFSAVRDISFDLKKGHTLGIFGESG
FT                   SGKSQTVLSLMGLLAGNAVVSGQALFHDQNLINMPTKNLNKIRGDKIAMIFQDPMTSLN
FT                   PYLTIHKQLLEPLTIHKGMSHKDATKKVLEMLDAVQIPDAKNRLKLYPHEFSGGMRQRV
FT                   VIAMALLYSPEILIADEPTTALDVTVQGQILQLLSDLQKEFHMSMLFITHDLGVVAEIC
FT                   HDVMVMYCGNIMEQGTVDNIFANAQHPYTKGLLNTMPSITRDVDILQTIPGETPNIHNM
FT                   PKGCPFVTRCDFAIDICKDTKPELISYLDQRTACHLVKEYK"
FT   CDS_pept        137618..138592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppF"
FT                   /locus_tag="FTF0126"
FT                   /product="oligopeptide transporter, subunit F, ABC
FT                   transporter, ATP-binding protein"
FT                   /note="Similar to OPPF_HAEIN (P45051) Oligopeptide
FT                   transport ATP-binding oppF from Haemophilus influenzae (332
FT                   aa). FASTA: opt: 1227 Z-score: 1398.5 E(): 5.3e-70
FT                   Smith-Waterman score: 1227; 56.790 identity in 324 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0126"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08142"
FT                   /inference="similar to sequence:UniProtKB:OPPF_HAEIN"
FT                   /protein_id="CAL08142.1"
FT                   /translation="MNVLEVKNLTVEFPIKKTITGKITQKVTAVKDVSFDVKEGEIIGI
FT                   VGESGCGKSSLLRALIGLNEITTGEVVWKGEHHLHKYKSHKQWLSVRRDIQMIFQDPFA
FT                   CLNPRMVVRNIIAEPLINFNKNLSKKEVDEKVLKMMKKVGLNESQMYRYPHEFSGGQCQ
FT                   RIGIARALICEPKLLVCDEPVSALDVSIQAQVVNLLKELQKDFKLTILFVAHDLSIVKH
FT                   ISDRLFVMYLGSLVEVSPKQNIYRNPVHPYTKVLLNAIPIADPQLTRQRTIEIERSELP
FT                   SPLNPPKGCAFHTRCKIATDICKKERPYLRLIEDEVYTACHNI"
FT   CDS_pept        complement(138596..139798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0127c"
FT                   /product="major facilitator superfamily (MFS) transport
FT                   protein"
FT                   /note="Similar to Q83CF6 Major facilitator family
FT                   transporter from Coxiella burnetii (443 aa). FASTA: opt:
FT                   488 Z-score: 542.0 E(): 2.7e-22 Smith-Waterman score: 490;
FT                   27.621identity in 391 aa overlap ORF ftt0127c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0127c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08143"
FT                   /inference="similar to sequence:UniProtKB:Q83CF6"
FT                   /protein_id="CAL08143.1"
FT                   /translation="MQKFKLSLILVVGISFYCYEFFLRILTGAYQEQIVEHFNISTHIG
FT                   FSFLVSSYNITYLLMQIPAGILLDRYGSKKVLIGATILCGIGNIIFVSGEYELALFGRL
FT                   LVGLGSSFAFIGVLKLTLENFESKYFPIITSLVISLGTLAAAFSQNISVIISHYDTSWI
FT                   NIFIYSGVIALPLAIFFQLIIPHEKYSSALMPKFSEILKRGKQLIKNSLIWKNAIWAGL
FT                   LYTPTAILTSQYGVLYFKQSYGFDSIYSTTMITAIFIGWIIFSLIMTHLCNKFSGKKII
FT                   TISIVGILLVSILINAQLLKNYAISIAFLFGTFSASQVLVWYYFNKICPPSFAAVRIAI
FT                   TNMLITLVIEIGQLSAGLAIDSGDHFNINANTSITIAFSIVLALAFIIMRSMIKKIKNN
FT                   S"
FT   CDS_pept        139932..140513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0128"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0128"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0128"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08144"
FT                   /protein_id="CAL08144.1"
FT                   /translation="MKKVITFSALFLCSIFGYSDNNLNQQTGMYYITANNFFYRPSTER
FT                   GNEVVDRQNASEFSDRISSSAINITDSLVFDAYTSSTSLIAQGSMGDLKDTKFYTQETK
FT                   LVKKLWNDKLEIYGGTVLGANPYQLNNMNSAYDPGSRIAAFASGRTGAKYNVSRNFGLL
FT                   IEGQYNLTGEMADNTDMFTGFNGAQYRTQL"
FT   CDS_pept        140657..141925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0129"
FT                   /product="major facilitator superfamily (MFS) transport
FT                   protein"
FT                   /note="Similar to Q83BM0 (Q83BM0) Major facilitator family
FT                   transporter from Coxiella burnetii (428 aa). FASTA: opt:
FT                   497 Z-score: 533.3 E(): 8.2e-22 Smith-Waterman score: 529;
FT                   26.355 identity in 406 aa overlap ORF ftt0129"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08145"
FT                   /inference="similar to sequence:UniProtKB:Q83BM0"
FT                   /protein_id="CAL08145.1"
FT                   /translation="MSIILRYLKYIFSYTMQKVTKAGFIIWFICAFFYALEFIIRASGN
FT                   SLYNDFSIAPYNLSPEQISVLSSAFYWAYVASQLPAGILIDKFGVKKIMLVSTLLFSVG
FT                   VFIATRATSQEYLILYRVLAGVGGGFAFLSALKSIAIWLPKRTFPLFTGATQMLMYGAG
FT                   TLTGLPLVILANHFSIQVIMSVILVVSILLFLSVVFFIPTVEPHNQKDTDELADTHTKI
FT                   EDIPIVFKIKQILLNGFFCFTIYGTTAIFADLWSYRFLSLDGYSVHYAGLASSMIFIGI
FT                   AIFSPLWGVIATLLNKQKSLLVLASIFGLFIVIAIVYMHVDPIIMCILCILWGGMQAVH
FT                   VLNFTILRMHISPLYIATGIAAVNLFIPLSGAVLQPFVGFVVSLLENHGFEQLIAFKYA
FT                   LAILPVLMLLSIVLSLFITEKKN"
FT   CDS_pept        141982..143490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpK"
FT                   /locus_tag="FTF0130"
FT                   /product="glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /note="Similar to GLPK_THETN (Q8R8J4) Glycerol kinase from
FT                   Thermoanaerobacter tengcongensis (497 aa). FASTA: opt: 2233
FT                   Z-score: 2691.0 E(): 5.3e-142 Smith-Waterman score: 2233;
FT                   66.333 identity in 499 aa overlap. This CDS is disrupted by
FT                   the insertion of an ISFtu1 element occurring very near the
FT                   C-terminal end. It is not clear whether this insertion
FT                   affects the function of the protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0130"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08146"
FT                   /db_xref="GOA:Q14JU8"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JU8"
FT                   /inference="similar to sequence:UniProtKB:GLPK_THETN"
FT                   /protein_id="CAL08146.1"
FT                   /translation="MSKDFILAVDQGTTSSRAIIFDKKGNIRKIAQKEFTQIYPKSGWV
FT                   EHDAMEIWGTQSGVMREALEFGRVKPDQIAAIGITNQRETVVVWDKETGDPVYNAIVWQ
FT                   CRRTSSICDEIKRDPQFVKYIKENTGLVVDAYFSGTKVKWILDNVEGAREKANAGKLLM
FT                   GTIDTWLIWNLTRGKVHATDYSNASRTMLFNINSLEWDKKILDYLNIPESMLPEVKNSS
FT                   EVFGVTDSHTLGGAEIPIAGVAGDQHAALFGHCCFEKGMAKNTYGTGCFALMNVGDKPV
FT                   YSDEGLLTTIAWAENGKPTYALEGSVFIAGAVIQWIRDGLGLVRSAEDSEYYATKIDST
FT                   NGVYLVPAFVGLGTPYWDMYARGTIVGITRDTKREHIIRAALEAIAYQAKDVLECMKED
FT                   TGLDLAGLRVDGGAVQNNFLMQFQSDILQSEISKPKVNEITGLGAVFLAGLAVGFWKDK
FT                   QELKSILTTEKVFEPQKDSQAVAHDYRGWKKAVERSKAWAECYS"
FT   repeat_region   complement(143484..143495)
FT                   /note="ISFtu1 12bp terminal inverted repeat"
FT   CDS_pept        complement(join(143583..144041,144041..144367))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="isftu1"
FT                   /locus_tag="FTF0131c"
FT                   /product="Transposase"
FT                   /note="ISFtu1. Transposase, member of the IS630 Tc-1
FT                   mariner family. Identical to Q93EJ6 Putative transposase
FT                   from Francisella tularensis (118 aa) from aa 144-261.
FT                   Identical to Q93EJ7 putative transposase from Francisella
FT                   tularensis (126 aa) from aa 1-109. Q93EJ6 and Q93EJ7
FT                   previously characterised as two separate ORF's. ORF1
FT                   (identical to Q93EJ7) contains a programmed ribosomal
FT                   frameshifting motif, 5'-AAAAAAAG-3' at aa position 109
FT                   which permits frameshifting to ORF2 (identical to Q93EJ6)
FT                   to produce a single ORF. Alignment of this single ORF with
FT                   additional members of the IS630 family, and also mariner
FT                   elements, show that this transposase shares strongly
FT                   conserved residues, including a fully conserved
FT                   dipeptide,Asp-Glu (DE), and a block consisting of a fully
FT                   conserved Asp and highly conserved Glu, separated by 34 or
FT                   35 residues (D35E). The conserved dipeptide is only present
FT                   if ribosomal frameshifting occurs."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0131c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08147"
FT                   /protein_id="CAL08147.1"
FT                   /translation="MPSYSQDFRDIVINKHEEGMTEFELSKFFNIDKRTVVSWIEFYKR
FT                   TGDYSSKQGVGCGRVASFTDKTLIEQYLIDHPDASALDIKEALAPDIPRSTFYDCLNRL
FT                   GFSFKKKTPKYKQRKEHERLEYIEKLKEIAQNLLFYIDEMGCDNKLSILRGWSLIGEPS
FT                   YGEVLAYQTQRRSIVAGYNYADKKIIALLEYSGYTNTEIFNQWFEEHLCPSLKPKTTIV
FT                   MDNASFHKSSKLIEIANKFDVQILYLPPYSPDLNPIEKV"
FT   repeat_region   complement(144388..144403)
FT                   /rpt_type=TANDEM
FT                   /note="16bp Short Sequence Tandem Repeat (SSTR)"
FT   repeat_region   complement(144404..144419)
FT                   /rpt_type=TANDEM
FT                   /note="16bp Short Sequence Tandem Repeat (SSTR)"
FT   repeat_region   complement(144420..144431)
FT                   /note="ISFtu1 12bp terminal inverted repeat"
FT   CDS_pept        144683..146215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpA"
FT                   /locus_tag="FTF0132"
FT                   /product="anaerobic glycerol-3-phosphate dehydrogenase"
FT                   /EC_number="1.1.99.5"
FT                   /note="Similar to O51259 Glycerol-3-phosphate
FT                   dehydrogenase, anaerobic, from Borrelia burgdorferii (527
FT                   aa). FASTA: opt: 1330 Z-score: 1506.9 E(): 4.8e-76
FT                   Smith-Waterman score: 1330; 43.333 identity in 510 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0132"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08148"
FT                   /inference="similar to sequence:UniProtKB:O51259"
FT                   /protein_id="CAL08148.1"
FT                   /translation="MKKEYDIIIIGGGATGFGCAIEAVSRGYKTLLLEASDFGKGTSSK
FT                   STKLIHGGLRYLENFDFALVKEGLEERFSFLHNAPHLTHKQSYLIPTRSYFETIKYTIG
FT                   VKLYEFLSGKYKIGKSYNLNKHQTLAELPNIEASKLKKSLVYYDGQFDDTRLLISLMKT
FT                   FEAKGGVALNYHKVEKIFSSTDSKLDTVKVVDTLSGEQKEFTAKHIINATGTFSDKTIS
FT                   LANQQDAHKYVSVAQGTHIVFDREKFPTEHAILIPETEDGRVLFILPWHDHLIVGTTDI
FT                   KKEVPSLEPRADKSEIDFILETFNQYAKDKATIVDIKSVYCGQRPLVTPKKAKNSAKIS
FT                   RKHEIVESKDGLITVVGGKWTIFRRMGQDTLDYIETKKIAQKISKTSDQLLIDAIELKD
FT                   TYPLKVYGKNAEDIKTIQNELDNFELLARGLPYYQAEVVYHVRHEKAKTIEDVLARRTR
FT                   AAFLDIKASIDAAPKVAELMAKELGKDEVWQNQQIDSFIEFSKNFNVEELYK"
FT   CDS_pept        146225..146989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpF"
FT                   /locus_tag="FTF0133"
FT                   /product="glycerol uptake facilitator protein"
FT                   /note="Similar to CAD75967 (Q7UMF0) Probable glycerol
FT                   uptake facilitator protein from Rhodopirelulla baltica (271
FT                   aa). FASTA: opt: 796 Z-score: 888.1 E(): 1.4e-41
FT                   Smith-Waterman score: 796; 50.209 identity in 239 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0133"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08149"
FT                   /inference="similar to sequence:INSDC:CAD75967"
FT                   /protein_id="CAL08149.1"
FT                   /translation="MLTAFIAELIGTMLLILLGNGVVAGVVLNKTKAHDGGWIVITFAW
FT                   GLAVFISVLVAGPISGAHLNPVVTLSLALAGKFSWAWVLPFIISQIIGAMLGQLLVWIM
FT                   YYPHYSATDNPELKLATCCTSPAIKHLPANFASEVIGTFVLVLAILTMHGVVLHVGDSS
FT                   ITTTYPVDMGALGGIPVAFVVVVIGMSLGGTTGYAINPARDFGPRLFHAIMPIQGKGSS
FT                   QWSYAWVPILGPVCGSIIATAFYLLLKVKGVF"
FT   CDS_pept        146993..147706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0134"
FT                   /product="hypothetical membrane protein"
FT                   /note="ORF ftt0134"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08150"
FT                   /protein_id="CAL08150.1"
FT                   /translation="MCEITFIPLLADDVLRLFISFILFLSCVILSYIFAKQKPWDIAFW
FT                   ICFSIFLFSMGGYGYIIHHIYLENTFSYDGFISGAAFITVCGLLFSRKRYINFADSFVN
FT                   KNTAILIATFVVFALIYILTIRYNFSCVEEPHQFFIDALQIVIYPLLLLFAITAFLYRF
FT                   AICLSAFAVSMALFIIENILFIAHAIAAQHKYDIVFEEVLFATISIVLSAIAVYILTRA
FT                   KRIYKENSDVRSIRQ"
FT   CDS_pept        147684..148181
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0135"
FT                   /product="ion channel protein, fragment"
FT                   /note="Similar to YGGB_EDWIC (O52401) Hypothetical UPF0003
FT                   protein in iciA-fba intergenic region from Edwardsiella
FT                   ictaluri (286 aa). FASTA: opt: 317 Z-score: 385.5 E():
FT                   1.4e-13 Smith-Waterman score: 317; 33.121 identity in 157
FT                   aa overlap. Truncation of C-terminal according to FASTA
FT                   hits ORF ftt0135"
FT                   /db_xref="PSEUDO:CAL08151.1"
FT                   /inference="similar to sequence:UniProtKB:YGGB_EDWIC"
FT   CDS_pept        148181..149596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0136"
FT                   /product="Helicase"
FT                   /note="Similar to AAQ00172 (Q7VBG7) DNA helicase related to
FT                   phage enzyme from Prochlorococcus marinus (479 aa) FASTA:
FT                   opt: 386 Z-score: 446.1 E(): 5.9e-17 Smith-Waterman score:
FT                   386; 26.681 identity in 476 aa overlap ORF ftt0136"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0136"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08152"
FT                   /inference="similar to sequence:INSDC:AAQ00172"
FT                   /protein_id="CAL08152.1"
FT                   /translation="MQKTLLSSDEILYLPNGQKIVLNQQQLEAVNQIKKFLKSDERYFL
FT                   LSGFAGTGKTTVVKKILDEYPKKAIVSAPTRKANAVISQATATQGYTIHSLLGLQPDIN
FT                   LEDFNPNDPVFGQIKKATIRSYNLIIIDEASMINTALFELIDSEINRSLITKVLFLGDQ
FT                   AQIPPIGDQLSPIFTLENSYQLTQLMRQATDNPLAPLTQQLRNVNNQLPEFLIKKQTLL
FT                   SEAAEGMLFVDSNEEFREQLIEVFGSSHAKTDPNYAKLIAWRNKTVMQSNRIIRDLVFG
FT                   DDAKLVEKGDVLTGYRAIKANSKEEFLINNCVDYKVVDVSERQRNINGLFGYTVSILEK
FT                   AKIFKGFEQKDIFVIDSQDETNLYDYAEIHDSLLLIARSDKLWNAYYEFRKNNLLLIDI
FT                   DRYRDGRSRSKNNLIKKDLDYGFAVTAHKAQGSTYNKVFVLLKDIQLNTNITERNQILY
FT                   VAMTRARKLSIVL"
FT   tRNA            149754..149835
FT                   /gene="tRNA-Tyr (GTA)"
FT                   /product="transfer RNA-Tyr"
FT   tRNA            149840..149910
FT                   /gene="tRNA-Gly (TCC)"
FT                   /product="transfer RNA-Gly"
FT   tRNA            149942..150014
FT                   /gene="tRNA-Thr (GGT)"
FT                   /product="transfer RNA-Thr"
FT   CDS_pept        150061..151245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tufA"
FT                   /locus_tag="FTF0137"
FT                   /product="elongation factor Tu (EF-Tu)"
FT                   /note="Similar to EFTU_XANAC (Q8NL22) Elongation factor Tu
FT                   (EF-Tu) from Xanthomonas axonopodis (396 aa). FASTA: opt:
FT                   2225 Z-score: 2609.0 E(): 2e-137 Smith-Waterman score:
FT                   2225; 82.071 identity in 396 aa overlap (1-394:1-396)"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0137"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08153"
FT                   /db_xref="GOA:Q14JU2"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JU2"
FT                   /inference="similar to sequence:UniProtKB:EFTU_XANAC"
FT                   /protein_id="CAL08153.1"
FT                   /translation="MAKEKFERSKPHVNVGTIGHVDHGKTTLTAAITKVMAEKNGGMAR
FT                   KFDEIDSAPEEKARGITINTSHVEYESPNRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCSAADGPMPQTREHILLSRQVGVPKIVVFLNKCDMVDDEELLELVEMEVRELLDQYEF
FT                   PGDDTPVIMGSALRAIEGDEAYVEKIVELVQAMDDYIPAPERDTEKPFILPIEDVFSIS
FT                   GRGTVVTGRIERGVVNIGDEVEVVGIRPTQKTTVTGVEMFRKLLDRGEAGDNVGILVRG
FT                   LKRDDVERGQVLCKPGSIKPHTKFEAEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDITG
FT                   AVELPEGVEMVMPGDNVKMTITLINPIAMDEGLRFAIREGGRTVGAGVVAKIIE"
FT   tRNA            151266..151341
FT                   /gene="tRNA-Trp (CCA)"
FT                   /product="transfer RNA-Trp"
FT   CDS_pept        151437..151907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="FTF0138"
FT                   /product="preprotein translocase, subunit E, membrane
FT                   protein"
FT                   /note="Similar to Q83ET6 Preprotein translocase, SecE
FT                   subunit from Coxiella burnetii (127 aa). FASTA: 209 opt:
FT                   252 Z-score: 317.1 E(): 9e-10 Smith-Waterman score: 252;
FT                   37.795identity in 127 aa overlap Together with SecG and
FT                   SecY forming an integral membrane complex."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0138"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08154"
FT                   /inference="similar to sequence:UniProtKB:Q83ET6"
FT                   /protein_id="CAL08154.1"
FT                   /translation="MPVYKLFFLKDCFVKRNQGFNNNKVWISGATKTTEVKKISKSNNL
FT                   MLWLAVVAIIVLGVAVTMYSDILGDSYSTYNTSLAVVVVLLAVVVARFTNQGRRFWAFF
FT                   QASRLELAKVVWPTRKETMTISLMVIVVVIIFALIISLFGVIFENFIQYFLG"
FT   CDS_pept        151923..152456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="FTF0139"
FT                   /product="transcription antitermination protein nusG"
FT                   /note="Similar to NUSG_VIBVU (Q8DD25) Transcription
FT                   antitermination protein nusG from Vibrio vulnificus (181
FT                   aa). FASTA: opt: 687 Z-score: 868.9 E(): 1.7e-40
FT                   Smith-Waterman score: 687; 58.621 identity in 174 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08155"
FT                   /inference="similar to sequence:UniProtKB:NUSG_VIBVU"
FT                   /protein_id="CAL08155.1"
FT                   /translation="MLWYVVQVHSGYEKRVKAQLEENIEIAGLKNNFGRILVPTENVVE
FT                   MKGGQKRKSERKYFPGYVLIEADLSTDAWNLVKSVPRVLTVVGSKGKPIPLSKAEVDRI
FT                   LDFVEGSKSTVEPRLRKSYHVGEVVRVLEGPFNDFTGVIEEVNYEKSRLRVAVSIFGRS
FT                   TPVELEFSQVEKES"
FT   CDS_pept        152525..152959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="FTF0140"
FT                   /product="50S ribosomal protein L11"
FT                   /note="Similar to Q9HWC5 50S ribosomal protein L11 from
FT                   Pseudomonas aeruginosa (143 aa). FASTA: opt: 701 Z-score:
FT                   872.4 E(): 1.1e-40 Smith-Waterman score: 701; 75.177
FT                   identity in 141 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0140"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08156"
FT                   /db_xref="GOA:Q14JT9"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JT9"
FT                   /inference="similar to sequence:UniProtKB:Q9HWC5"
FT                   /protein_id="CAL08156.1"
FT                   /translation="MAKKKIEAIIKLQVAAGKANPSPPIGPALGQHGVNIMGFCKEFNA
FT                   KTQGMEPGMPIPVEISVYSDRSFTFEMKTPPASYLIKKAINVKSGSSKPSKEFVGTITR
FT                   AQLEEIAKVKDPDLTAADLDAAVRIIAGSARSMGVKVEGV"
FT   CDS_pept        152962..153657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="FTF0141"
FT                   /product="50S ribosomal protein L1"
FT                   /note="Similar to RL1_YERPE (Q8ZAP2) 50S ribosomal protein
FT                   L1 from Yersinia pestis (234 aa). FASTA: opt: 1062 Z-score:
FT                   1208.7 E(): 2e-59 Smith-Waterman score: 1062; 69.869
FT                   identity in 229 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0141"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08157"
FT                   /db_xref="GOA:Q14JT8"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JT8"
FT                   /inference="similar to sequence:UniProtKB:RL1_YERPE"
FT                   /protein_id="CAL08157.1"
FT                   /translation="MAKVSKRMKEISAKINAEKKYPVSEAFDLLREVSSVKFVESVDVS
FT                   VALGVDPRKSDQVVRGASVLPNGTGKTVRVAVFAKGPAADAAKEAGAEVVGMEDLADEV
FT                   KKGNMDFDVVIASPDSMRVVGQLGQILGPKGLMPNPKVGTVTMDVAKAVRDAKAGQVRY
FT                   RVDKAGIIHTTIGKVNFTSDALKQNLEQLLTDLKKAKPAVSKGIYLKKVSVSSTMGPGI
FT                   NVDFSDLNI"
FT   CDS_pept        153827..154345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="FTF0142"
FT                   /product="50S ribosomal protein L10"
FT                   /note="Similar t AAO89786 (Q83ET2) Ribosomal protein L10
FT                   from Coxiella burnetii (174 aa). FASTA: opt: 603 Z-score:
FT                   782.3 E(): 1.1e-35 Smith-Waterman score: 603; 56.977
FT                   identity in 172 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08158"
FT                   /db_xref="GOA:Q14JT7"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JT7"
FT                   /protein_id="CAL08158.1"
FT                   /translation="MALRIEDKKAIVAEVAEQVSSALSAAVADYRGLTVNEMTSLRKQA
FT                   RESGVYLRVVRNNLARLAIKGTEFECLADALKGPLVLALSKDEPGAAAKLFKNFQKDHN
FT                   AFEVKNLAMSGELFGPEKLDDFAKLPTREEALATLLNVMQAPVTKFVRTLNEIPSQAVR
FT                   VFAAVGDSK"
FT   CDS_pept        154408..154785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="FTF0143"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /note="Similar to RL7_ECOLI (P02392) 50S ribosomal protein
FT                   L7/L12 (L8) from E. coli (120 aa). FASTA: opt: 517 Z-score:
FT                   634.2 E(): 2e-27 Smith-Waterman score: 517; 70.968 identity
FT                   in 124 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0143"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08159"
FT                   /db_xref="GOA:Q14JT6"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JT6"
FT                   /inference="similar to sequence:UniProtKB:RL7_ECOLI"
FT                   /protein_id="CAL08159.1"
FT                   /translation="MAITKEDILNAVAEMSVMDVCDLVKMMEDKFGVSAAAAVAVAAGP
FT                   VAGPAEAAEEKTEFDVVLVDAGSNKIAAIKAVRGATGLGLKEAKDAVEGTPFTVKEAAS
FT                   KEEAEVLKKQLEEAGAKVELK"
FT   CDS_pept        154939..159015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="FTF0144"
FT                   /product="DNA-directed RNA polymerase beta chain"
FT                   /EC_number="2.7.7.6"
FT                   /note="Similar to RPOB_PSEAE (Q51561) DNA-directed RNA
FT                   polymerase beta chain from Pseudomonas aeruginosa (1357
FT                   aa). FASTA: opt: 5391 Z-score: 6098.6 E(): 0 Smith-Waterman
FT                   score: 5391; 59.191identity in 1360 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08160"
FT                   /db_xref="GOA:Q14JT5"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JT5"
FT                   /inference="similar to sequence:UniProtKB:RPOB_PSEAE"
FT                   /protein_id="CAL08160.1"
FT                   /translation="MSYSYAEKKRIRKEFGVLPHILDVPYLLSIQTESYKKFLTADAAK
FT                   GRLHSGLEIVLKQSFPVESKNGQYELHYVDYQIGEPTFDETECQVRGATYDAPLNVKLR
FT                   LVVYNKDALPNEKIVEDIREEYVYMGDIPLMTTNGTFIINGTERVVVSQLHRSPGVFFS
FT                   KDDSEEGAFSARIIPYRGSWLDFEFDSKGIIWARIDRKRKFCATVILKALGYTQEQILE
FT                   NFSESKTITFNSKGFALRLDNLSNMKGELLKFDIVDAQDNVIVKKNKKLTSRDVKKIKD
FT                   AGVDSVAIDFDLVSTLRVAKDIVNEATGEVIAYANDDVTESLLESCVEVGMLELEVIDF
FT                   ITTERGRYISDTLKYDLTRNTDEALVEIYKVLRPGDPPAAASVKALFEGLFFIESRYSL
FT                   SDIGRMKLNARLGSDKVSKDIYTLENSDIVGVIEELINIRDGKGKVDDIDHLGNRRVRS
FT                   VGEMVENQFRIGLYRVEKGIRESMSLVHKDKLMPKDIVNSKPITAAIKEFFTSGALSQF
FT                   MDQDNPLSEVTHKRRISALGPGGLSRDRAGFEVRDVHATHYGRLCPIETPEGPNIGLIN
FT                   SLASYARVNDYGFLEAPYRKVVDGKVTDEIEYLSAIDEDNYVIAQASTKLDENNHFVED
FT                   LIQCRSGGEAIFTESSRVQYMDVSAKQMVSAAAALIPFLEHDDANRVLMGANMQRQAVP
FT                   TLKSEKPLVGTGMEKIVARDSGNCIIARNAGEVAEVDSNRIVIKVDTEKSQTSNLVDIY
FT                   SLTKFKRSNKNTCINQRPIVNVGDKVEAGDILADGFATDFGELSLGHNLMVAFMPWNGY
FT                   NFEDSILLSERIVKDDKYTSIHIEEFTCVARDTKLGPEEITADIPNVSESSLAKLDESG
FT                   IVHIGANVEAGDILVAKITPKAEQQLTPEERLLRAIFNEKASNVADSSLRMPSGTSGTV
FT                   INVQVFENDKGGKSKRALKIEKELIDKARKDFDEEFAVIESVVKSSIEQEVVGAKIQKA
FT                   KGLKKGAILTKEFLATLPFSKWLEISFEDEKLEEKVQNAREYYEEAKIAIDAKFEAKKK
FT                   SITQSNELSPGVLKTVKVFVAIKKRIQPGDKMAGRHGNKGVVSRVLPVEDMPYMEDGTP
FT                   VDVCLNPLGIPSRMNIGQILEAHLGLASYGLGKKIEKTLEKTRKAAELRKTLEEVYNSV
FT                   GDKKVNLEALNDEEILTLCDNLKGGVPIATPVFDGAKEEDIKSLLKIGGFATNGQMKLF
FT                   DGRTGKPFDRHVTVGYMYMLKLDHLVDDKMHARSTGSYSLVTQQPLGGKAQFGGQRFGE
FT                   MEVWALQAYGAAYTLREMLTVKSDDIAGRSKMYKNIVDGKLTMNVDVPESFNVLRNEVR
FT                   ALGIDMDFDYSSEEE"
FT   CDS_pept        159077..163330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="FTF0145"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="Similar to Q9AAU1 (Q9AAU1) DNA-directed RNA
FT                   polymerase, beta subunit from Caulobacter crescentus (1396
FT                   aa). FASTA: opt: 5089 Z-score: 5550.7 E(): 0 Smith-Waterman
FT                   score: 5089; 56.626identity in 1381 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0145"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08161"
FT                   /db_xref="GOA:Q14JT4"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JT4"
FT                   /inference="similar to sequence:UniProtKB:Q9AAU1"
FT                   /protein_id="CAL08161.1"
FT                   /translation="MNNGILHQNYNSKKFDIIKISLASPEVIRSWSHGEVKKPETINYR
FT                   TFKPERDGLFCAKIFGPIKDYECLCGKYKRLKHRGVVCERCGVEVEQAKVRRERMGHID
FT                   LVCPVVHIWYLKSLPSRIGLFLDMPLKNVEKVLYFESYIVTDPGMTPLEKKQLLTDEEY
FT                   AEALENYGYEFEASMGAEAIRDLLADTDIESEIELLQAECEESKSTAKKEKAIKRLRLL
FT                   ETFQASGNKPEWMVMTVLPVLPPDLRPLVPIEGGRFATSDLNDLYRRVINRNNRLKKLL
FT                   DLNAPDIIVRNEKRMLQEAVDALLDNGRRGRAVTGSNKRPLKSLADMIKGKQGRFRQNL
FT                   LGKRVDYSGRSVITVGPSLRLHECGLPKKMALELFKPFVYSKLRLGGHATTIKQAKRMV
FT                   ELEEAVVWDILETVINEHPVLLNRAPTLHRLGIQAFEPRLIEGKAIQLHPLVCAAFNAD
FT                   FDGDQMAVHVPLTVESQLEARVLMMSTNNILSPASGQPIITPTQDIVLGLYYITREKEG
FT                   ARGEGKLFSSYEDVSRAYNSGTIDIHAKIKLRIDRQVFDTKGNTYNEKGVVNTTVGRAL
FT                   LLNILPEGLSFSLLNKVLVKKEISKIINQAFRVLGGKATVVLADKLMYAGFKYSTLSGV
FT                   SVGVDDMTIPDNKEAKIEEAEKEIKQITEQYQSSLITENERYNNIINIWSKTSDEVGAS
FT                   MMDAISKDTVSINGEKKEIESFNSVYMMAKSGARGSYNQMRQLAGMRGLMAKPDGTMIE
FT                   TAITANFREGLSVLQYFTSTHGARKGLADTALKTANAGYLTRRLVDVAQDLVVIEEDCG
FT                   TDDGLMFSAIVEDGEVKVPLVERALGRTLAADVVTEKGVVLLEAGTLLDENLVELLDDN
FT                   GIDMIKVRSPITCKTRRGLCAKCYGRDLARERQVNVGESVGVIAAQSIGEPGTQLTMRT
FT                   FHTGGAASLGITVSDIKVKTAGKIKFKNIRTVTNKEGQEIVISRAGEIIVSDTMGRVRE
FT                   QHKIPMGAVVPLASGKAVEIGDVIATWDPHAQPLITDVAGKVVLEDVIDGITSKHTYDD
FT                   LTGQQTIEITSISQRTTSKNLKPVVKIVDEKGAELKSIPLAVGAVLNVADDSILEVGDI
FT                   VAKIPLEGSKNKDITGGLPRVAELFEARRPKDAAILSPCDGMVRLGNRDTKEKQRIEII
FT                   DKNGHIVEEILLPKSRHLVVFDGEQVSRGDVLADGPTDPHDLLKYKGLEEFADYILIEA
FT                   QSVYRMQGVVINDKHIETIVRQMLRKAVILDEGDSKFVKDESIELVRILEENDKLRKQG
FT                   KKEVEYELVLMGITRSSLSTESFLSAASFQETTRVLTEASINSQIDNLRGLKENVLIGR
FT                   LIPTGTGLAVRKESAKIEKMREELGVEDNMVFTDLSSFNPEEISFDSIQSQKEDKDINE
FT                   DIEESLRNALESLDF"
FT   CDS_pept        163433..163669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0146"
FT                   /product="hypothetical membrane protein"
FT                   /note="ORF ftt0146"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0146"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08162"
FT                   /protein_id="CAL08162.1"
FT                   /translation="MFDMLAKLFWQIFFGILIILIVILSILNTDKVSFDYIFGTTTLPL
FT                   IVLMSIAFVLGLLLGSFITKFIQITKTSGGAKK"
FT   CDS_pept        163669..164679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcp"
FT                   /locus_tag="FTF0147"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /note="Similar to AAP18393 (Q83Q42) Putative
FT                   O-sialoglycoprotein endopeptidase from Shigella flexneri
FT                   (337 aa). FASTA: opt: 1187 Z-score: 1484.9 E(): 8.1e-75
FT                   Smith-Waterman score: 1187; 55.621identity in 338 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0147"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08163"
FT                   /db_xref="GOA:Q14JT2"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JT2"
FT                   /inference="similar to sequence:INSDC:AAP18393"
FT                   /protein_id="CAL08163.1"
FT                   /translation="MIVLGIESSCDETGLAIYDYSKKKLIADELYSQVKLHKKYGGVVP
FT                   ELASREHIAKLNLLAKKIFKETGLSFEDIDCIAYTAMPGLVGALMVGATFAKTLGLIHN
FT                   IDTIAVHHLEGHLLSPLLDHNSNIEYPFVALLVSGGHTQLFEVKEFGEYSLLGESIDDA
FT                   AGEAFDKTTKLLGMGYPGGVEVANLADQATDKSKYILPRPMKNKPNLDFSFSGLKTAVL
FT                   NTWYDEQDQSLENKANLCYAFQDAAIDVLVSKCAKALQKTKNTRLVISGGVSANKLLRH
FT                   QLDLLAKNRGYQIFFPPMKYCTDNGAMIALAGAYRYVNGFKDSNLEINVKARSPL"
FT   CDS_pept        164793..165959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0148"
FT                   /product="fatty acid desaturase"
FT                   /EC_number="1.14.19.-"
FT                   /note="Similar to Q27437 Stearoyl-CoA desaturase from
FT                   Amblyomma americanum (317 aa). FASTA: opt: 653 Z-score:
FT                   747.5 E(): 9.6e-34 Smith-Waterman score: 653; 36.897
FT                   identity in 290 aa overlap ORF ftt0148"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0148"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08164"
FT                   /inference="similar to sequence:UniProtKB:Q27437"
FT                   /protein_id="CAL08164.1"
FT                   /translation="MNNNEIIHQTIEKQGSIVWKSVFGLLLLPLVALIAIPWYAKTYGF
FT                   STSDYVCLVVFYMLTGVGITMGYHRLWSHKTYKANKIVSYALLLFGTAALQNSVIQWSS
FT                   DHRKHHKDVDDPIKDPYAATRGFWFSHFGWLLRHSSPDVQEIRGVNDLLKDKALVFQHN
FT                   NYTVLAILSCFGLPALLGFIFGFLSGHTLTGAWHSALGFLLLGGLLRVILVHHATFCIN
FT                   SLAHTIGKRPYSTKNTARDSWITAIVTGGEGYHNYHHAFAGDYRNGIRWFDLDPSKWFI
FT                   AGLAKIGWCYDLKTTPKHLIEIAKAKVKLEEALTKKNKTFHLGIEEKYAKLVANVKNMY
FT                   NAKQEYLKAKKDNVLSKADIKEIKSKYKDLKIEFIQAKKKYNKASTIA"
FT   CDS_pept        complement(166171..167331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="FTF0149c"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="Similar to METK_HAEIN (P43762) S-adenosylmethionine
FT                   synthetase from Haemophilus influenzae (384 aa). FASTA:
FT                   opt: 1796 Z-score: 2132.3 E(): 7e-111 Smith-Waterman score:
FT                   1796; 69.554identity in 381 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0149c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08165"
FT                   /db_xref="GOA:Q14JT0"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JT0"
FT                   /inference="similar to sequence:UniProtKB:METK_HAEIN"
FT                   /protein_id="CAL08165.1"
FT                   /translation="MSKNYLFTSESVSEGHPDKLADQISDAILDEILKQDKNARVACET
FT                   LVKTGMALVAGEITTSAWVDIEELVRNVITETGYDNASKGIDGRTCSVINAIGKQSRDI
FT                   TQGVDRGSLEDLGAGDQGLMFGFATNETPTLMPSAIYYSHLLMRKQAELRKSGKLAWLR
FT                   PDAKAQVTLAYENDKPKFIDTIVLSTQHNESISQKELHDAVIEEIVKKVIPNELITKDT
FT                   KYHINPTGVFLIGGPQGDCGLTGRKIIVDTYGGAAHHGGGAFSGKDPSKVDRSGAYMGR
FT                   YIAKNIVAAGLADKCEVQVAYAIGVAKPVSLMVNTFGTGKITDNQIEKLVAEVFDLRVG
FT                   KIIENLDLLRPIYRKTSNYGHFGRELPEFTWEKIDKADILKSAARI"
FT   CDS_pept        167625..167873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="FTF0150"
FT                   /product="30S ribosomal protein S16"
FT                   /note="Similar to AAP96669 (Q7VKG0) 30S ribosomal protein
FT                   S16 from Haemophilus ducreyi (82 aa). FASTA: opt: 423
FT                   Z-score: 598.5 E(): 1.9e-25 Smith-Waterman score: 423;
FT                   75.610 identity in 82 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0150"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08166"
FT                   /db_xref="GOA:Q14JS9"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JS9"
FT                   /inference="similar to sequence:INSDC:AAP96669"
FT                   /protein_id="CAL08166.1"
FT                   /translation="MVVIRMARGGAKKRPFYRIVVADKRSPRDGRFIEKLGFFNPLAKG
FT                   GEERLKLDVAKAEAWLAKGAQPSDRVASLIKEAKKAA"
FT   CDS_pept        167916..168425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="FTF0151"
FT                   /product="16S rRNA processing protein rimM"
FT                   /note="Similar to RIMM_PASMU (P57935) 16S rRNA processing
FT                   protein rimM from Pasteurella multocida (178 aa). FASTA:
FT                   opt: 361 Z-score: 464.1 E(): 5.9e-18 Smith-Waterman score:
FT                   361; 33.333 identity in 177 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0151"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08167"
FT                   /db_xref="GOA:Q14JS8"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JS8"
FT                   /inference="similar to sequence:UniProtKB:RIMM_PASMU"
FT                   /protein_id="CAL08167.1"
FT                   /translation="MSQDFVEIAKIGATYKLNGELNLYPLANSIETLLSYGDWYIQLPA
FT                   TNVWQQLKGESVLKRADKVYIKLANINNADTAKKYVNALIGVPKRALPQLAEDEVYFKD
FT                   LIGCSVKNINNDSFGVVVDIIETDANEVLVCKEDNSEYLIPYVKQYIVSEDLNSKKIVV
FT                   DWEYDY"
FT   CDS_pept        168822..169586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="FTF0152"
FT                   /product="tRNA (Guanine-N(1)-)-methyltransferase"
FT                   /EC_number="2.1.1.31"
FT                   /note="Similar to TRMD_PASMU (Q9CLE1) tRNA
FT                   (Guanine-N(1)-)-methyltransferase from Pasteurella
FT                   multocida (245 aa). FASTA: opt: 941 Z-score: 1166.0 E():
FT                   4.7e-57 Smith-Waterman score: 941; 56.967identity in 244 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0152"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08168"
FT                   /db_xref="GOA:Q14JS7"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JS7"
FT                   /inference="similar to sequence:UniProtKB:TRMD_PASMU"
FT                   /protein_id="CAL08168.1"
FT                   /translation="MKMKFGIISIFPEMFKAINDFGVTARAIKDSKVSISCFNPRDYTT
FT                   DRHATVDDTSFGGGAGMVMKYQPLSAAIEDAKNTLGCGTKVVYLSPQGSIFNHRKAQEL
FT                   LQNDSLILLCGRYEGVDERLIQDYVDEEISVGDFVLSGGELPAMLVMDSLIRLLPEVLG
FT                   NKESVVEDSFYDGLLDYPHYTKPAVLPNGNAVPDVLLSGNHKEIAKWRRKQKLIRTYER
FT                   RKDLIECLCLSAKDKQILDDYKIDKVSTKGEE"
FT   CDS_pept        169586..169933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="FTF0153"
FT                   /product="50S ribosomal protein L19"
FT                   /note="Similar to RL19_PSEAE (Q9HXQ2) 50S ribosomal protein
FT                   L19 from Pseudomonas aeruginosa (116 aa). FASTA: opt: 502
FT                   Z-score: 699.0 E(): 4.8e-31 Smith-Waterman score: 502;
FT                   60.000 identity in 115 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0153"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08169"
FT                   /db_xref="GOA:Q14JS6"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JS6"
FT                   /inference="similar to sequence:UniProtKB:RL19_PSEAE"
FT                   /protein_id="CAL08169.1"
FT                   /translation="MKNKFVELVEKSQLRTDLPEFNPGDSITVNLWIKEGDKQRIQAFK
FT                   GFVLRKRNRGLHSAFTVRKMSSGMGVERTFQTHSPLIDSIIVEKRADVRRAKLYYMRGL
FT                   TGRAARIKEKV"
FT   CDS_pept        170099..170977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerD"
FT                   /locus_tag="FTF0154"
FT                   /product="Integrase/recombinase"
FT                   /note="Similar to Q7ZAJ8 (Q7ZAJ8) Integrase/recombinase
FT                   XerD from Shewanella oneidensis (300 aa). FASTA: opt: 1039
FT                   Z-score: 1285.0 E(): 1.1e-63 Smith-Waterman score: 1039;
FT                   52.414 identity in 290 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0154"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08170"
FT                   /inference="similar to sequence:UniProtKB:Q7ZAJ8"
FT                   /protein_id="CAL08170.1"
FT                   /translation="MSSAVDAFLDNLWLEHGLSQNTISSYRTDLKFLQNYFAKTDLISL
FT                   DFEQLYAFISYRSKNGYSSHSNARMISTLRKFYAWLISTGQTNNNPTAKLTLPKLAKKL
FT                   PKDMTETDVERLLQAPDMTEDVGIRDKAMLELMYATGLRVSELVGLNIDDIDINIGVIQ
FT                   VMGKGSKERIVPIGEYALEYLQKYFAEARRSLSENFKEKAVFISKHAKRITRQSFWHRI
FT                   KNYALIAGINTDISPHTLRHAFATHLLNHGADLRSVQLLLGHSNVSTTTIYTHISQNRL
FT                   QEIYQKHHPRG"
FT   CDS_pept        171094..171945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0155"
FT                   /product="oxidoreductase iron/ascorbate family protein"
FT                   /EC_number="1.14.11.-"
FT                   /note="Similar to Q87HU0 Putative oxidoreductase
FT                   iron/ascorbate from Vibrio parahaemolyticus (279 aa).
FT                   FASTA: opt: 944 Z-score: 1155.0 E(): 1.9e-56 Smith-Waterman
FT                   score: 944; 49.110 identity in 281 aa overlap ORF ftt0155"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0155"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08171"
FT                   /inference="similar to sequence:UniProtKB:Q87HU0"
FT                   /protein_id="CAL08171.1"
FT                   /translation="MVMNILSVDYYADDAAELFTRSLKETGFAVLRTHPIDWNLIQTVY
FT                   KEWQEFLKSGAADKYIFDVENQDGYFPIDVSEVAKGETVKDIKHFYHLYFPNGRYPTEV
FT                   SSAAREMFEKMIRLGETLLQWIDDYMDPAVASKLPQRLRDTASYENTLLRILHYPAIQG
FT                   DEEPGAVRAAAHEDINLITLLPIASSPGLQVLSPFNNQWYDVPCDSESIIVNIGDMLQE
FT                   MTNGEYIATKHRVVKPQDEKENLDRISTPCFIHPKSDVYLSDKYPRAEIFLNERLKELG
FT                   LK"
FT   CDS_pept        171950..172534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0156"
FT                   /product="acid phosphatase"
FT                   /EC_number="3.1.3.2"
FT                   /note="Similar to Q83EI5 Acid phosphatase, class B from
FT                   Coxiella burnetti (221 aa). FASTA: opt: 326 Z-score: 430.9
FT                   E(): 4.1e-16 Smith-Waterman score: 326; 32.642identity in
FT                   193 aa overlap ORF ftt0156"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0156"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08172"
FT                   /inference="similar to sequence:UniProtKB:Q83EI5"
FT                   /protein_id="CAL08172.1"
FT                   /translation="MTQQQVISYYESTAHENEVELILARAKKIIQAQQSLQGNAIVLDI
FT                   DETALNHYYSLKLAGFPQGENHTIWNELLSRTDAYPIKATLDFYLYCLTSGLKVFFISA
FT                   RFAQYLESTKQALRNAGYVNFEDVFVFPENIEQYNSKDFKNFKAERRAYIESLGYKILI
FT                   SIGDQSSDLLGGYTLYTLQLPNYLYGENSRF"
FT   CDS_pept        complement(172531..173415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0157c"
FT                   /product="licB-like transmembrane protein"
FT                   /note="Similar to Q8XMR0 Probable lic-1 operon protein from
FT                   Clostridium perfringens (322 aa). FASTA: opt: 370 Z-score:
FT                   410.4 E(): 5.7e-15 Smith-Waterman score: 396; 30.492
FT                   identity in 305 aa overlap ORF ftt0157c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0157c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08173"
FT                   /inference="similar to sequence:UniProtKB:Q8XMR0"
FT                   /protein_id="CAL08173.1"
FT                   /translation="MNFKKRAFVFGSLSGIFWGLDYTLAGQVHTLLTMTFLVSMWLTSI
FT                   HDLGVAATIAAISTSSVKRIKDLKLWQIISICCIPLLGGFAMTMYMLSTRDIATGTAII
FT                   ISSCYPAVGMIGARIFLRESLTTFKIVGFIIVIIGITLTATNQLYDKSNSFVGLSFAIL
FT                   AAIFWGLEGVIYKMLLNANIAINTLLFLRKISTIIIFLPFTWAIIHSVNISILPLTLAI
FT                   GIIGYIADLSYMKAFKHSNVTLAMSLNITYIIWGPLFALLLFDQNINITITISCAILIF
FT                   LGNFLIFKSKSVY"
FT   CDS_pept        complement(173547..174155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0158c"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0158c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0158c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08174"
FT                   /protein_id="CAL08174.1"
FT                   /translation="MIIMLALLGCLALPFAFAVFLGAPIPLRILFPIPLSIAIVMLLIF
FT                   RVTSNKKLIIAIACLCLFVNFKQICQLTYSQNMVQKYNEYNLEHLYSILHDKFGNKLYN
FT                   TPVVFIASPKADNSFYIRHIYSEPFYFNSDEDFLSNVFPDKMWQTSSINHRVYYFMQWL
FT                   GLFYKLPTEQQIELGKRISPSLAIFPEKSSITKKIILFL"
FT   CDS_pept        complement(174232..175053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0159c"
FT                   /product="hypothetical membrane protein"
FT                   /note="ORF ftt0159c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0159c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08175"
FT                   /protein_id="CAL08175.1"
FT                   /translation="MKKLVTDLRNLPNKLIYSIIVLFSVFIVIYAYFILSWSIGMDTKL
FT                   ATYGLGNSEYLYPLHTQYFLLDRPTLAIITYVLGQVAIPYFTLLISMSLLFVSAIIWMV
FT                   ILTKKNFSIIETLVFCSFYLISPIYIFQFNFVNQAIGISIGFVLTSLAIYHFSLILNHD
FT                   CEKFKNYVASIVYLFLCIGIYQSFIILFAEGVIFLLILEQLKNIKTNLKVIISILTKIL
FT                   FVSLAALIGYLLISKVIYIFIGESHYLANVYEGWHSNSFSEVIKTPITLLC"
FT   CDS_pept        175216..175683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nudH"
FT                   /locus_tag="FTF0160"
FT                   /product="(Di)nucleoside polyphosphate hydrolase"
FT                   /EC_number="3.6.1.-"
FT                   /note="Similar to NUDH_VIBVU (Q8DER5) Probable
FT                   (di)nucleoside polyphosphate from Vibrio vulnificus (172
FT                   aa). FASTA: opt: 665 Z-score: 847.1 E(): 2.7e-39
FT                   Smith-Waterman score: 665; 58.278 identity in 151 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0160"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08176"
FT                   /db_xref="GOA:Q14JR9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JR9"
FT                   /inference="similar to sequence:UniProtKB:NUDH_VIBVU"
FT                   /protein_id="CAL08176.1"
FT                   /translation="MIDKSGYRANVAIVLLNKQNRVFWGQRRNRTSWQFPQGGVATGET
FT                   PLQAMYRELHEEIGLRPQDVEVIASTRDWYKYDIPDSLVRTKEPICIGQKQKWFLLKLK
FT                   SPESYIDLDANDSPEFDNWRWVSYWYPINHVVYFKQEVYRKALTYFKEYIA"
FT   CDS_pept        complement(175693..176319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0161c"
FT                   /product="PAP2 family protein"
FT                   /EC_number="3.1.3.-"
FT                   /note="Similar to Q8FXE8 PAP2 family protein from Brucella
FT                   suis (325 aa). FASTA: opt: 314 Z-score: 375.8 E(): 4.8e-13
FT                   Smith-Waterman score: 314; 31.915identity in 188 aa overlap
FT                   ORF ftt0161c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0161c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08177"
FT                   /inference="similar to sequence:UniProtKB:Q8FXE8"
FT                   /protein_id="CAL08177.1"
FT                   /translation="MNYFDHKLAKTTAIYGFLTPIIAILSYNFLDIKFATLVHSSELFG
FT                   TGISTIAPFTSNIFSPKVWTVITAIATVICIYKHIVKKPSQKLYIMSLSLIMTIIITTI
FT                   VKVILARYRPEMLLFDNHYGFHFFSFKKAYNSMPSGHTALTFAGLLAIANFFEKKYITL
FT                   IAIIISGLVAVSRIIILDHFISDVIVAAYIGIFTYLWSKAFVESK"
FT   CDS_pept        176393..176917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampD"
FT                   /locus_tag="FTF0162"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /note="Similar to Q88PQ9 N-acetyl-anhydromuramyl-L-alanine
FT                   amidase ampD from Pseudomonas putida (190 aa). FASTA: opt:
FT                   623 Z-score: 809.4 E(): 3.4e-37 Smith-Waterman score: 623;
FT                   52.000 identity in 175 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0162"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08178"
FT                   /inference="similar to sequence:UniProtKB:Q88PQ9"
FT                   /protein_id="CAL08178.1"
FT                   /translation="MFNQGWYKKAKCIKSPNFNQRADKNDINLVVIHCISLPEGGYANC
FT                   NVEKFFTNQLDCSLHPSFASLKGVEVSAHFYIKRDGEIVQFVSVDDRAWHAGVSEFQGR
FT                   QGCNDFSVGIELQGTDKTAYTEQQYLSLNSLLKDLRKAYPTLLNITGHEDIAPQRKTDP
FT                   GKCFEWNKVIW"
FT   CDS_pept        complement(176975..178858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parE"
FT                   /locus_tag="FTF0163c"
FT                   /product="Topoisomerase IV, subunit B"
FT                   /EC_number="5.99.1.-"
FT                   /note="Similar to Q87SJ3 (Q87SJ3) Topoisomerase IV,subunit
FT                   B from Vibrio haemolyticus (626 aa). FASTA: opt: 2448
FT                   Z-score: 2700.3 E(): 1.6e-142 Smith-Waterman score: 2448;
FT                   56.709 identity in 626 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0163c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08179"
FT                   /inference="similar to sequence:UniProtKB:Q87SJ3"
FT                   /protein_id="CAL08179.1"
FT                   /translation="MQNYNAKSIEVLTGLDPVKKRPGMYTNTENPNHLIQEIIDNSVDE
FT                   VLAGFASKINITLYEDNSIEVADDGRGMPVDIHPEHKMSGIELIMTKLHSGGKFSNKNY
FT                   THSGGLHGVGVSVVNALSTRLEAEIKRDGNVYHIVFEDGFKTKDLEIIDNVGKKNTGTK
FT                   IRFWPNKKYFDDIKVNFKALKNLLEAKAILCKALTIKYSNEIKKEKLTWHFETGLKGYL
FT                   DHKLEAETLPAEPFMIDNFSNGDSYLDAVFCWCEDPSESIKNSYVNLIPTPQDGTHVTG
FT                   LKNGIYDAIKAYIEKNSLSVKNIKITANDSFAQLNYVISVKITNPQFAGQTKEKLSNKD
FT                   VTNFVATAVKDLLTIWLNQNPDEARQIVENISKVAQKRINADKKTTRKRIMNTTIRLPG
FT                   KLTDCISSDVNSTELFIVEGDSAGGSAKQARDKNFQAVLPLKGKILNSWELDADTIMNS
FT                   QEIHNIATAIGVDPDSDDISALRYNKICILADADSDGLHIATLLCAMFLKHFRKLIENG
FT                   HIYIAQPPLFRIDIGKSTFYALDENERDTILTKNSKLPGKVNIMRFKGLGEMNPAQLRE
FT                   SAMDVSSRRLLQLTISDVYDDTEMLDMLLAKKRAKDRRDWLENYGDRASVE"
FT   CDS_pept        complement(178948..180129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0164c"
FT                   /product="Eflux protein"
FT                   /note="Similar to Q9KRK6 Multidrug resistance protein from
FT                   Vibrio cholerae (401 aa). FASTA: opt: 579 Z-score: 614.0
FT                   E(): 2.6e-26 Smith-Waterman score: 579; 28.989identity in
FT                   376 aa overlap ORF ftt0164c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0164c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08180"
FT                   /inference="similar to sequence:UniProtKB:Q9KRK6"
FT                   /protein_id="CAL08180.1"
FT                   /translation="MYKGIRPSIFILILMVSLGPFGDTIYAPALPELKTILGTDYPHVQ
FT                   LTITSYLLGYSISQLLYGPFSDRFGRKPVMLVGTCFFIISSIICIFSNHINTLIYARMI
FT                   QGFGAAAGGVIATVAVKDAFKVNEQGAVFAIMNIAFALAPAFGAVLGVFLSPTAIFWVL
FT                   LVAASILFIKVAIFFPETIREKNFEALTFKSFFKNYFLLFKDHQFFFATFVLGINISVI
FT                   YACLVTAPDIFVNILKLEKSNFLYLLTIMVTAVVLGSIVCSKLSRLIAYKHLVNFGMFC
FT                   TLISGVLCIYAFKKLTGLELSIALTAILSLTFIGVSFSVPLLTPIALENFTTTAGAASS
FT                   VMGFMQMGIASITTAIMSQISLGSEFTLSFAFVILPLIGLTIFLPYSCYFLKK"
FT   CDS_pept        complement(180129..181499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0165c"
FT                   /product="conserved hypothetical lipoprotein"
FT                   /note="Similar to Q88PJ4 Conserved hypothetical protein
FT                   from Pseudomonas putida (380 aa). FASTA: opt: 644 Z-score:
FT                   755.3 E(): 3.5e-34 Smith-Waterman score: 646; 29.268
FT                   identity in 369 aa overlap ORF ftt0165c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0165c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08181"
FT                   /inference="similar to sequence:UniProtKB:Q88PJ4"
FT                   /protein_id="CAL08181.1"
FT                   /translation="MKKLLFITAPLLLSVLTASCSKSNVPPPTPLAEKPPRETFVKVIW
FT                   KRKTGNGNGGLANYNVAPAYANDTVFVPNQNGMAYALAITNGKIIWKNDTGTNLSVQPN
FT                   TIANAVIFGSIKGTLTAIDDKDGQTLWRTDAPSSIFSQPTIYDNSIYLQTHDGSVSAFD
FT                   ARNGSKEWSVANNIPEITLPSNSSPIILNNTVMIGNAFGAVLGFTIKSGDRTINIPIAI
FT                   SHGSSPADKMVDITANPMLYDHYLIFAAYQGAIVALDKDSGKMLWAKKASIINNMAINN
FT                   GVIFTTQDDSELKAYNIQTGDTVWTQDTLKWRKITAPIYYKGLIVVADYQGYLHFFNSL
FT                   NGEYLGRYKLTSKSDIFDYGISGQLVPTEKGIIIEADNGTTYLVDAYSNKVIYDSILSD
FT                   YQVDKGKSVARIYPLEQDKPTKATAPLATKTTQTTETKSKGINATIIIGDFSKGKPS"
FT   CDS_pept        complement(181502..182158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0166c"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="Similar to Q8FF57 Hypothetical protein yfgM from E.
FT                   coli (206 aa). FASTA: opt: 155 Z-score: 188.7 E(): 0.012
FT                   Smith-Waterman score: 188; 27.778 identity in 198 aa
FT                   overlap ORF ftt0166c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0166c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08182"
FT                   /inference="similar to sequence:UniProtKB:Q8FF57"
FT                   /protein_id="CAL08182.1"
FT                   /translation="MKNLSKKQTQALYTIAGIIIVTIICAIFLQFYNSSNDKKMLEAST
FT                   IYQKALIANENPKSSVETKIAKFEQVVNDYPNTSFGIFASWQLADLYTTPTKPDSKNFN
FT                   VNITNLPKAIAILQQSIENNPKDSLSDISKVRLARLYIVAKQPDQAIKTLQAIKTLQGI
FT                   KSFKDNAYPLMLLGQAYSEKKDKVKAIESWQKALQDPNSSDQFKQIISQLINNTN"
FT   CDS_pept        182339..183589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemA"
FT                   /locus_tag="FTF0167"
FT                   /product="Glutamyl-tRNA reductase"
FT                   /EC_number="1.2.1.-"
FT                   /note="Similar to HEM1_PSEAE (P42807) Glutamyl-tRNA
FT                   reductase from Pseudomonas aeruginosas (422 aa). FASTA:
FT                   opt: 876 Z-score: 1010.7 E(): 2.1e-48 Smith-Waterman score:
FT                   876; 34.689 identity in 418 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0167"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08183"
FT                   /db_xref="GOA:Q14JR2"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JR2"
FT                   /inference="similar to sequence:UniProtKB:HEM1_PSEAE"
FT                   /protein_id="CAL08183.1"
FT                   /translation="MNMALISLAIDYKKSPIEVRSEFALSGLDVSMLYRSILAIDNVVH
FT                   AVILSTCNRTEVYLEISDLRVVDDILVWWQGYVRNPNYKIKDYFKLRQGTEVIMHLMKL
FT                   ACGLESMVLGEPQILGQVKDSYTLSKKNHAIGKELDRVFQKVFATAKRVRSETRIGHCP
FT                   VSVAFSAITLAKRQLDNISSKNVLIIGAGQTGELLFRHVTALAPKQIMLANRTIEKAQK
FT                   ITSAFRNASAHYLSELPQLIKKADIIIAAVNVLEYIVTCKYVGDKPRVFIDISIPQALD
FT                   PKLGELEQNVYYCVDDINAVIEDNKDKRKYESSKAQKIIVKSLEEYLEKEKAIISNSAI
FT                   KELFQKADGLVDLSLEKSLAKIRNGKDAEEIIKRFAYEIKKKVLHYPVVGMKEASKQGR
FT                   SDCLVCMKRMFGLNVEK"
FT   CDS_pept        183590..184675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfA"
FT                   /locus_tag="FTF0168"
FT                   /product="peptide chain release factor 1"
FT                   /note="Similar to RF1_VIBCH (Q9KQ25) Peptide chain release
FT                   factor 1 from Vibrio cholerae (362 aa). FASTA: opt: 1647
FT                   Z-score: 1862.3 E(): 7.7e-96 Smith-Waterman score: 1647;
FT                   67.313 identity in 361 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0168"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08184"
FT                   /db_xref="GOA:Q14JR1"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JR1"
FT                   /inference="similar to sequence:UniProtKB:RF1_VIBCH"
FT                   /protein_id="CAL08184.1"
FT                   /translation="MKDSIKAKLQSLIERHEEVSALLSEAGIISDQNKFRDLSKEYSHL
FT                   EPIVKAFKKYTQALEDKQAAYEMLNEKDAELVEMAKEELKLANEAIEKLESELQIFLLP
FT                   RDPNDDANVFLEIRAGTGGDEASIFSGDLFKMYSKYAEQRGWKIEVISASEGEHGGYKE
FT                   IISRIYGDGVYSQLKFESGAHRVQRVPATESQGRIHTSACTVAVMPEADEVEGIDINPA
FT                   DIKVDTFRASGAGGQHVNKTDSAIRITHIPTGVVVECQDQRSQHKNRAAAMSMLKSKLL
FT                   QAEIDKQQKEQSDTRKSLVGSGDRSERIRTYNYPQGRVTDHRINLTLYKLDEVMEGSLD
FT                   SIIQPLVLEHQADLLATMSDE"
FT   CDS_pept        184668..185522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0169"
FT                   /product="hemK protein homolog"
FT                   /EC_number="2.1.1.-"
FT                   /note="ORF ftt0169"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08185"
FT                   /protein_id="CAL08185.1"
FT                   /translation="MSNITISQLLALSLAKFNQCDISTKHDLQMIICDVLGVDKTYLYI
FT                   NLDKQLDKNTLKKIDEKILRLLAGEPLAYILGYKYFWNQKLYVTKDTLIPRADTETVVA
FT                   TVLDDIQNKDAQLKILDLGTGTGAIALALAAELANSQVVAVDLYQQSLDVAKKNAQANN
FT                   ITNVKFIQSSWYTNLDTDKFDIIVSNPPYIDLADTNIDQSVKDYEPARALFAADNGLAD
FT                   IRIIISQAKDFLNLGGFIYIEHGFTQADAITALFSQCNFTDIKIVKDLNNNDRCTKAQL
FT                   GYL"
FT   CDS_pept        complement(185513..185941)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0170c"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to YCA8_PSEPK (Q88DL7) Hypothetical UPF0247
FT                   protein PP4808 from Pseudomonas putida (155 aa). FASTA:
FT                   opt: 433 Z-score: 550.0 E(): 9.6e-23 Smith-Waterman score:
FT                   433; 42.254 identity in 142 aa overlap. This CDS lacks a
FT                   start codon due to the insertion of an ISFtu1 element at
FT                   the N-terminal ORF ftt0170c"
FT                   /inference="similar to sequence:UniProtKB:YCA8_PSEPK"
FT   repeat_region   185943..185954
FT                   /note="ISFtu1 12bp terminal inverted repeat"
FT   repeat_region   185955..185970
FT                   /rpt_type=TANDEM
FT                   /note="16bp Short Sequence Tandem Repeat (SSTR)"
FT   repeat_region   185971..185986
FT                   /rpt_type=TANDEM
FT                   /note="16bp Short Sequence Tandem Repeat (SSTR)"
FT   CDS_pept        join(186007..186333,186333..186791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="isftu1"
FT                   /locus_tag="FTF0171"
FT                   /product="Transposase"
FT                   /note="ISFtu1. Transposase, member of the IS630 Tc-1
FT                   mariner family. Identical to Q93EJ6 Putative transposase
FT                   from Francisella tularensis (118 aa) from aa 144-261.
FT                   Identical to Q93EJ7 putative transposase from Francisella
FT                   tularensis (126 aa) from aa 1-109. Q93EJ6 and Q93EJ7
FT                   previously characterised as two separate ORF's. ORF1
FT                   (identical to Q93EJ7) contains a programmed ribosomal
FT                   frameshifting motif, 5'-AAAAAAAG-3' at aa position 109
FT                   which permits frameshifting to ORF2 (identical to Q93EJ6)
FT                   to produce a single ORF. Alignment of this single ORF with
FT                   additional members of the IS630 family, and also mariner
FT                   elements, show that this transposase shares strongly
FT                   conserved residues, including a fully conserved
FT                   dipeptide,Asp-Glu (DE), and a block consisting of a fully
FT                   conserved Asp and highly conserved Glu, separated by 34 or
FT                   35 residues (D35E). The conserved dipeptide is only present
FT                   if ribosomal frameshifting occurs."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0171"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08187"
FT                   /protein_id="CAL08187.1"
FT                   /translation="MPSYSQDFRDIVINKHEEGMTEFELSKFFNIDKRTVVSWIEFYKR
FT                   TGDYSSKQGVGCGRVASFTDKTLIEQYLIDHPDASALDIKEALAPDIPRSTFYDCLNRL
FT                   GFSFKKKTPKYKQRKEHERLEYIEKLKEIAQNLLFYIDEMGCDNKLSILRGWSLIGEPS
FT                   YGEVLAYQTQRRSIVAGYNYADKKIIALLEYSGYTNTEIFNQWFEEHLCPSLKPKTTIV
FT                   MDNASFHKSSKLIEIANKFDVQILYLPPYSPDLNPIEKV"
FT   repeat_region   186879..186890
FT                   /note="ISFtu1 12bp terminal inverted repeat"
FT   CDS_pept        186892..187242
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0172"
FT                   /product="hypothetical membrane protein, fragment"
FT                   /note="ORF ftt0172"
FT                   /db_xref="PSEUDO:CAL08188.1"
FT   CDS_pept        join(187312..187992,187995..188114,188118..188213)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0173"
FT                   /product="conserved hypothetical protein, pseudogene"
FT                   /note="Similar to Q87J48 Hypothetical protein from Vibro
FT                   parahaemolyticus (305 aa). FASTA: opt: 1031 Z-score: 1265.1
FT                   E(): 1.3e-62 Smith-Waterman score: 1031; 52.365 identity in
FT                   296 aa overlap. Contains a frameshift after aa 227 and an
FT                   in-frame stop aa at 267 ORF ftt0173"
FT                   /inference="similar to sequence:UniProtKB:Q87J48"
FT   CDS_pept        188232..188801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0174"
FT                   /product="YggT family protein"
FT                   /note="Similar to Q83A22 Hypothetical protein from Coxiella
FT                   burnetti (192 aa). FASTA: opt: 440 Z-score: 543.8 E():
FT                   2.1e-22 Smith-Waterman score: 440; 37.634 identity in 186
FT                   aa overlap ORF ftt0174"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0174"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08190"
FT                   /inference="similar to sequence:UniProtKB:Q83A22"
FT                   /protein_id="CAL08190.1"
FT                   /translation="MLNALINVATFLINIIFGLYAFILLFRFFLQWVKADFYNPICQLV
FT                   MRATNIVILPLRKFIPGFLNLDWSCIVAVYIVFAIKDLLLGWLYGFGFELTFILVKPII
FT                   DIVFAVINMYVYLIIIRAISSWFVQGGYNPIIMVIYQVTEPLLSRARNIIKPTNSGFDF
FT                   SPIIVLIGLFCIQIFIQSIIAQFFHY"
FT   CDS_pept        complement(188795..189577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0175c"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="Similar to AAO80856 (Q836Q5) ABC
FT                   transporter,ATP-binding protein (269 aa). FASTA: opt: 738
FT                   Z-score: 809.5 E(): 3.1e-37 Smith-Waterman score: 738;
FT                   43.137 identity in 255 aa overlap missing 90 aa at
FT                   C-terminus ORF ftt0175c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0175c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08191"
FT                   /inference="similar to sequence:INSDC:AAO80856"
FT                   /protein_id="CAL08191.1"
FT                   /translation="MAQLKNNSLINCYNICLEYHQDKKLTKKVIENLNLSIRENEIIAI
FT                   VGKSGAGKSSLVRILSGILKPTSGKLFYKGSAIDGPLENISMVFQNFALLPWLNVLENV
FT                   LFGADSLGIPRSQSKPKALEIIKKIGLNGFEDAYVSELSGGMKQRVGFARALMIEPEIL
FT                   FLDEPFSSLDIVTAKSLRDDIMHLWHTGETKTKAIVLVIHNIEEAVNMANRVIILDSNP
FT                   GRIASEKTIELDYPRDLECDSTRIVIKDISSTLHAINQ"
FT   CDS_pept        complement(join(189609..190382,190382..191359))
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0176c"
FT                   /product="ABC transporter, membrane protein, pseudogene"
FT                   /note="Similar to Q836Q4 ABC transporter, permease protein
FT                   from Enterococcus faecalis (585 aa). FASTA: opt: 1474
FT                   Z-score: 1670.8 E(): 3.3e-85 Smith-Waterman score: 1476;
FT                   39.519identity in 582 aa overlap. Frameshift occurs at a
FT                   heptanucleotide sequence and so could be part of a
FT                   programmed translational frameshift ORF ftt0176c"
FT                   /inference="similar to sequence:UniProtKB:Q836Q4"
FT   CDS_pept        complement(191761..192186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0177c"
FT                   /product="Acetyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="Similar to Q88IP2 Acetyltransferase, GNAT family
FT                   from Pseudomonas putida (364 aa). FASTA: opt: 250 Z-score:
FT                   324.7 E(): 3.1e-10 Smith-Waterman score: 250; 34.559
FT                   identity in 136 aa overlap ORF ftt0177c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0177c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08193"
FT                   /inference="similar to sequence:UniProtKB:Q88IP2"
FT                   /protein_id="CAL08193.1"
FT                   /translation="MQISKAQLTDLQALIDLENSTFLSDKISKKQFAYNINKQKYFFVA
FT                   KRQDSLAGYILCFEYKKTIRVYSLAVSKNYQGQGIGKKLLEYILNNTDKNISLEVNTNN
FT                   LIAISLYQKLGFEINKQINNYYENGDAAYKMTIIRKI"
FT   CDS_pept        complement(192173..193642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimK"
FT                   /locus_tag="FTF0178c"
FT                   /product="30S ribosomal protein S6 modification
FT                   protein-related protein"
FT                   /note="Similar to Q9KPN3 Ribosomal protein S6 modification
FT                   protein-related protein from Vibrio cholerae (483 aa).
FT                   FASTA: opt: 1367 Z-score: 1648.7 E(): 6.1e-84
FT                   Smith-Waterman score: 1367; 43.149 identity in 489 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0178c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08194"
FT                   /inference="similar to sequence:UniProtKB:Q9KPN3"
FT                   /protein_id="CAL08194.1"
FT                   /translation="MKPLKILIDNKDIWSPYYPYSNLETTHQYLQNISTKPNYIINLSE
FT                   QMNYLEQGYYACLLAHSNKDTIIPTVETLNSISHFEQTLLSNLVNNKDYKSLNTLNVDF
FT                   LAIKVFFGVANIKGIEKIAKKIFETYPAPILELILEKQSSLWKIKTIAVGRINSLSDIE
FT                   QTIFANALNKFSSKVWRKRKIKKNYYYDLAILHDPDEILPPSDSKALKNFQKAAHSLGI
FT                   YTDLITKDDYMSLLEYDGLFIRTSTSINHYSYSFAKKAEDNNLVVIDDTKSITCCTNKV
FT                   YLHNLMIKNKIPTPEGKLIFKDESFSPQKLIDELGLPIVLKIPDGSFSKGVKKANSADE
FT                   LQQILNDMFEQSSIIIAQKYYYTDFDWRIGILNNKPIYACKYYMAKGHWQITNHNKKTT
FT                   QHGSSEAFAIHQVDKAVIKIALKAAKTIGNGLYGIDIKVVDNKPIIIEINDNPSIDSDI
FT                   EDAYIGEQLYTTIMLEFLNRMNYKKLPYANI"
FT   CDS_pept        join(193805..194479,194482..195819)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0179"
FT                   /product="Competence-related protein, pseudogene"
FT                   /note="Similar to CAD86320 (Q82SD2) DNA
FT                   internalization-related competence protein ComEC/Rec2 from
FT                   Nitrosomonas europaea (799 aa). FASTA: opt: 531 Z-score:
FT                   549.2 E(): 9.6e-23 Smith-Waterman score: 554; 23.668
FT                   identity in 638 aa overlap. Contains a frameshift after aa
FT                   225 ORF ftt0179"
FT                   /inference="similar to sequence:INSDC:CAD86320"
FT   CDS_pept        195923..196813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0180"
FT                   /product="Acetyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="Similar to Q8DDF5 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase from Vibrio vulnificus (271 aa). FASTA:
FT                   opt: 749 Z-score: 902.5 E(): 2e-42 Smith-Waterman score:
FT                   749; 40.370 identity in 270 aa overlap ORF ftt0180"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0180"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08196"
FT                   /inference="similar to sequence:UniProtKB:Q8DDF5"
FT                   /protein_id="CAL08196.1"
FT                   /translation="MINTLKYGYYALFSVVCFASSAIIAFIPIFIFSLVKLLIPIKRIR
FT                   HLCTSAVQLSASLWVSFAILITKLFSPTKFEIEQNAKLDSQGSYLIICNHKSWLDTFIL
FT                   MLVFHKKIAFPKFFMKFQVFFIPVLGLIAWALEFPVMKRYSKEYLTQHPDKKGEDLQKT
FT                   LAYCKKLSPRPTTIVNFVEGTRFTLHKALKSNYKNLLNPKAGGIAVILKSLSDRMVGIL
FT                   NTTIIYDNPEQNLWDFMVRKTKKIKVKVELIPITEVPVGDYFNDDKDKHNFQLWLNKLW
FT                   QNNDQYISEQSKIVN"
FT   CDS_pept        complement(197210..197746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0181c"
FT                   /product="conserved membrane protein"
FT                   /note="Similar to Q9X885 Putative small integral membrane
FT                   protein from Streptomyces coelicolor (167 aa). FASTA: opt:
FT                   262 Z-score: 342.1 E(): 3.6e-11 Smith-Waterman score: 262;
FT                   30.723 identity in 166 aa overlap ORF ftt0181c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0181c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08197"
FT                   /inference="similar to sequence:UniProtKB:Q9X885"
FT                   /protein_id="CAL08197.1"
FT                   /translation="MEKISHKDIQDKLWSNEDESNLSNEQYNSLLIEQYRIYVELTDRT
FT                   SYRRIVINLFFLVFNLVLVGVVALAISNNINVENPPSSILVSIPYFAGLVFCYAWWKII
FT                   RFFRHHIQIKNSIVPSLERRLPSRVWLTEEHIAEEKGSFKPIRILEIYMPFIFMGIYTA
FT                   LFLFVEIAWLPHTLN"
FT   CDS_pept        complement(197844..198386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0182c"
FT                   /product="Sua5/YciO/YrdC family protein"
FT                   /note="Similar to Q8D257 YrdC protein from Wigglesworthia
FT                   glossinidia (194 aa). FASTA: opt: 374 Z-score: 473.0 E():
FT                   1.9e-18 Smith-Waterman score: 374; 39.130 identity in 184
FT                   aa overlap ORF ftt0182c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0182c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08198"
FT                   /inference="similar to sequence:UniProtKB:Q8D257"
FT                   /protein_id="CAL08198.1"
FT                   /translation="MLTKDLNKIIGEITEDNVVSIPTDTVYGLSCNISKAAVAKVINLK
FT                   KRDSSKGFIIISHDHKHLLKYADTTKLSNEQINKISSKQAQPTTWIVPGKKDIQWLTGD
FT                   KTTIAIRLVTTEIVTYICENINDAIISTSANISGKDFINNAKSISKTFDNIYVLETEVR
FT                   SSQPSRIIDIISGQQYR"
FT   CDS_pept        complement(198503..200173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsA"
FT                   /locus_tag="FTF0183c"
FT                   /product="30S ribosomal protein S1"
FT                   /note="Similar to Q9HZ71 30S ribosomal protein S1 from
FT                   Pseudomonas aeruginosa (559 aa). FASTA: opt: 2140 Z-score:
FT                   2441.6 E(): 4.2e-128 Smith-Waterman score: 2140; 54.464
FT                   identity in 560 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0183c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08199"
FT                   /inference="similar to sequence:UniProtKB:Q9HZ71"
FT                   /protein_id="CAL08199.1"
FT                   /translation="MSENFKELFEQSLKQTEMRIGKIIEATVVSIDKEFAMIDAGLKSE
FT                   SFIPVSSLKNSNGELEVAAGDRINVVLEALDNSCGETRLSRDKAKKIELWDRIEKAFEN
FT                   NETVLGKITNHVRGGYTMDVEGLRAFLPGSLVDTRPIKDVAHLEDKDIELKVVKIDTKR
FT                   NNIVVSRKAVIEENNSGDRDAMLEKISEGSVLKGIVKNITDFGAFIDLGGVDGLLHITD
FT                   ISWSRISHPTDVLSIGQEIDVKVIKFDKEKQRISLGIKQLGEDPWLNIANELPVGAKLM
FT                   GTVTNITDYGCFVKLKEGIEGLVHTSEMDWTNKNVNPHKAVSIGQEIEVIVLELDADNH
FT                   RISLGIKQCRPNPWSEFEKNYKPGDKVTGKIRSITEFGVFIGLEGGIDGLVHISDVAWD
FT                   NPAKAIKELKKGDEVEAVLVSVNTDLERIALSMKQLSEDPFKNFINIHPKGSLVTGKVT
FT                   KVQDNGAVVMLDEDNNIDGFIRISEISAEHTKDVRDELSEGQEVEARIINIDAKKRSIT
FT                   LSIKAVDEDNTAAGKSNYKVEQMTPTTLGDLIKEQLNKK"
FT   CDS_pept        200321..200782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0184"
FT                   /product="Zinc-binding domain protein"
FT                   /note="Similar to Q83DS3 Zinc-binding domain protein from
FT                   Coxiella burnetii (142 aa). FASTA: opt: 473 Z-score: 642.4
FT                   E(): 6.8e-28 Smith-Waterman score: 473; 52.817 identity in
FT                   142 aa overlap ORF ftt0184"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0184"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08200"
FT                   /inference="similar to sequence:UniProtKB:Q83DS3"
FT                   /protein_id="CAL08200.1"
FT                   /translation="MSNYSDQDIFFMQKAYQQALLAYQAGEVPIGAVLVRDDQIIVQNF
FT                   NQTIGLNDPTAHAEILVLRSAALKLGNYRLVNTKLYVTLEPCIMCLGGLIQARVPELVY
FT                   ACDDSRVGAFSREKLHHNKNINHNLGVTAGVMADECSKLLKDFFKQRRN"
FT   CDS_pept        200786..201676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddlB"
FT                   /locus_tag="FTF0185"
FT                   /product="D-alanine--D-alanine ligase B"
FT                   /EC_number="6.3.2.4"
FT                   /note="Similar to Q88N74 (Q88N74) D-alanine--D-alanine
FT                   ligase B from Pseudomonas putida (318 aa). FASTA: opt: 761
FT                   Z-score: 911.3 E(): 7.3e-43 Smith-Waterman score: 761;
FT                   41.892 identity in 296 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0185"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08201"
FT                   /db_xref="GOA:Q14JP9"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JP9"
FT                   /inference="similar to sequence:UniProtKB:Q88N74"
FT                   /protein_id="CAL08201.1"
FT                   /translation="MKNEKIVVLYGGDSPEREVSLKSGKAVLDSLISQGYDAVGVDASG
FT                   KELVAKLLELKPDKCFVALHGEDGENGRVSALLEMLEIKHTSSSMKSSVITMDKMISKE
FT                   ILMHHRMPTPMAKFLTDKLVAEDEISFPVAVKPSSGGSSIATFKVKSIQELKHAYEEAS
FT                   KYGEVMIEQWVTGKEITVAIVNDEVYSSVWIEPQNEFYDYESKYSGKSIYHSPSGLCEQ
FT                   KELEVRQLAKKAYDLLGCSGHARVDFIYDDRGNFYIMEINSSPGMTDNSLSPKSAAAEG
FT                   VDFDSFVKRIIEQAQ"
FT   CDS_pept        201673..202356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsQ"
FT                   /locus_tag="FTF0186"
FT                   /product="cell division protein FtsQ"
FT                   /note="Similar to Q83F15 Cell division protein FtsQ from
FT                   Coxiella burnetii (243 aa). FASTA: opt: 291 Z-score: 355.4
FT                   E(): 6.6e-12 Smith-Waterman score: 291; 23.176 identity in
FT                   233 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0186"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08202"
FT                   /inference="similar to sequence:UniProtKB:Q83F15"
FT                   /protein_id="CAL08202.1"
FT                   /translation="MTKIIKKFLILSLILLVILGSTIFVAAKTDKTVSKIDVVSNDGLI
FT                   YISKQDLINKIATLDNKQWFDINIANIEKYIYSIDGVDYTLVKKVWPSTLVIYLYDHKP
FT                   VAYWNNNQILLDNMQIITPAVFNYNGDLPYIQSKDDSSKDYIYQTYKELNSIAKQNHMQ
FT                   ILKISYTGNQFGILLSDDIEVMLGSVKLKKRLELFFKSYTKVKDYKSVKYFDMRYSDGF
FT                   AVKYK"
FT   CDS_pept        202458..203720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="FTF0187"
FT                   /product="cell division protein FtsA"
FT                   /note="Similar to Q87WY9 Cell division protein FtsA from
FT                   Pseuodomonas syringae (418 aa). FASTA: opt: 992 Z-score:
FT                   1194.6 E(): 1.2e-58 Smith-Waterman score: 992; 37.621
FT                   identity in 412 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0187"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08203"
FT                   /inference="similar to sequence:UniProtKB:Q87WY9"
FT                   /protein_id="CAL08203.1"
FT                   /translation="MGFGNINFCAVDLGSHKITVAIGQLAENNSIKILGVSQKQSKGIK
FT                   QGSVINLEIAMETLNAALDEAKSIAGVDVKEVTLGVSAPSISGFNSYGLAAVENGEVSI
FT                   EDLAMAIKTAKAVPMSADTEMLHVLQRDYIVDGQAGVTEPIGMFAVRLESNVHIIVASS
FT                   RLLQNVRKCVSNCGYSISNLVVEHLAASSATLTDNEKEMGVCLVNIGADSTSFSVFADG
FT                   GICYTSSIKTGGASISSDISKVFRLPIEAAESLKLQYGYAASKYLKNPDEKIDIPNSLG
FT                   NAKKRISLQDLSLVIEARVEEIFESLYRELDQHRLLEVISSGIVFTGGGAKLKGLARLA
FT                   EDMFKLPVRVGGPIEVSGANEVVHNPSYATVVGLLKYAAENSDTSNQQKIEEDVMEIDE
FT                   NTGKSKKKIISSVKGWFSNNF"
FT   CDS_pept        203764..204909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="FTF0188"
FT                   /product="cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0188"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08204"
FT                   /protein_id="CAL08204.1"
FT                   /translation="MFDFNDSMVSNAIIKVVGVGGGGGNAVQHMCEEVSDVEFFALNTD
FT                   GQALSKSKVQNILQIGTNLTKGLGAGANPEIGKRAATEDRAKIEQLLEGADMVFITAGM
FT                   GGGTGTGGAPVVAEVAKEMGILTVAVVTKPFPFEGPRRMKAAEQGIDELTKHVDSIITV
FT                   PNEKLLSVLGKGASLIDAFNAANDVLGNAVKGVSELITKPGLINVDFADVRAVMTNMGL
FT                   AMMGMGEASGENRAREAAEAAISSPLLEDINLDGAKGVIVNITAGMDMSIGEFEEVGEV
FT                   IRSFISDEAIVIAGTVIDPDMSDSMKVTVVVTGIEKVAMKRGFGVEKTSSLQQSASSFS
FT                   NKTSAPFLRKETEVVTGASNAPKTDSDDVNKSDIPSFLRRR"
FT   CDS_pept        204932..205792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxC"
FT                   /locus_tag="FTF0189"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase"
FT                   /EC_number="3.5.1.-"
FT                   /note="Similar to LPXC_ECOLI (P07652)
FT                   UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase from E. coli (305 aa). FASTA: opt: 912 Z-score:
FT                   1124.8 E(): 9.3e-55 Smith-Waterman score: 912; 45.645
FT                   identity in 287 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0189"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08205"
FT                   /db_xref="GOA:Q14JP5"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JP5"
FT                   /inference="similar to sequence:UniProtKB:LPXC_ECOLI"
FT                   /protein_id="CAL08205.1"
FT                   /translation="MMKQKTIAKEFSVTGVGLHSGVDVSMTVKPADIDSGIVFRRADLT
FT                   PVVDIKVTPSSIKEAIMCTLLTKDGDQNLSVSTIEHLMSAFAMFEVDNVLIEVNAPELP
FT                   VMDGSSYEFTQLLKQVGIVEQNSARKGIKILKPVRVEHEDKFAEVLPSDTLKYEFKIHW
FT                   DHPVIAATNDHIVFEYDLDEYIKMVSKARTFGFYEQLAYLHQNNLAKGASLDNAVGVTN
FT                   EGVLNEGGLRYDDEFVRHKLLDAIGDFYVGGYILGHFNCFKSGHTLNNKLLHAVFADKD
FT                   AWEYI"
FT   CDS_pept        complement(205806..207446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="FTF0190c"
FT                   /product="DNA polymerase III, gamma/tau subunits"
FT                   /EC_number="2.7.7.7"
FT                   /note="Similar to Q8DB24 DNA polymerase III, gamma/tau
FT                   subunits from Vibrio vulnificus (734 aa). FASTA: opt: 1193
FT                   Z-score: 1334.5 E(): 1.9e-66 Smith-Waterman score: 1193;
FT                   44.893 identity in 421 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0190c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08206"
FT                   /inference="similar to sequence:UniProtKB:Q8DB24"
FT                   /protein_id="CAL08206.1"
FT                   /translation="MSYQALARKYRPQSFAEVAGQQHALNSLVHALETQKVHHAYLFTG
FT                   TRGVGKTTLGRLLAKCLNCKTGVTAEPCNKCENCVAINNNSFIDLIEIDAASRTGVEET
FT                   KEILYNIQYMPSQGRYKVYLIDEVHMLSKQSFNALLKTLEEPPEYVKFILATTDYHKIP
FT                   VTILSRCIQLHLKHISQADIKDQLKIILAKENINSDEQSLEYIAYHAKGSLRDALSLLD
FT                   QAISFCGGELKQAQIKQMLGIIDSEEVYSIINAITDNDPKAILPAIKNLALTESSADVV
FT                   LDRIAEIWFACCIYSFTQSLDAVNDIDVDIINNILAKISIEQAHFLYQLTITAKKDIAL
FT                   APNFETGVTMAILRLIAFQKKNLIDKTQTSKSNISPIVSKNDINLLKNTFKSEQPKQTV
FT                   KAVVAQNNDSTASENTQEQSLDKKWFNLLNRIKLKGFTKTLAFNSHLISDNSETFVIHL
FT                   NEDAKKILELDPQSIAKLQASISEYLNNPSFRLDIKNLAMDKVSTDQKSPAEIKRENAI
FT                   SKIHNDENTKLIKQALAIDIKDQNIILTD"
FT   CDS_pept        207719..208696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="FTF0191"
FT                   /product="peptide chain release factor 2"
FT                   /note="Similar to RF2_HAEIN (P43918) Peptide chain release
FT                   factor 2 from Haemophilus influenzae (365 aa). FASTA: opt:
FT                   1542 Z-score: 1839.9 E(): 1.4e-94 Smith-Waterman score:
FT                   1542; 68.405 identity in 326 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0191"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08207"
FT                   /inference="similar to sequence:UniProtKB:RF2_HAEIN"
FT                   /protein_id="CAL08207.1"
FT                   /translation="MELEDGSIWDNPEYAQNLGKQKVELENVVHNCEYISETLETLSEL
FT                   LELGEEDESLMQEIAKDTQNVASEIEKLEFRRMFSGKMDANNAFLDIQSGSGGTEAQDW
FT                   AEMLMRMYMRWADSHGFKVTVDDVSDGDVAGIKGCTLKIEGEYAYGWLRTETGIHRLVR
FT                   KSPFDSNSKRHTSFASVFISPEVDDDIDIEINPTDLRVDTYRASGAGGQHVNKTDSAVR
FT                   ITHIPTNIVVQSQSDRSQHKNRDNAMKQLKSKLYEMELQKRNAEKNALEDSKADIGWGS
FT                   QIRSYVLDQSRIKDLRTGVENTNTQAVLDGDLDKFIEASLKSGL"
FT   CDS_pept        208829..210559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysU"
FT                   /locus_tag="FTF0192"
FT                   /product="Lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="Similar to SYK2_ECOLI (P14825) Lysyl-tRNA
FT                   synthetase, heat inducible, from E. coli (504 aa). FASTA:
FT                   opt: 2003 Z-score: 2242.9 E(): 4.9e-117 Smith-Waterman
FT                   score: 2003; 61.066 identity in 488 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0192"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08208"
FT                   /inference="similar to sequence:UniProtKB:SYK2_ECOLI"
FT                   /protein_id="CAL08208.1"
FT                   /translation="MGLLIANVQQIITGFKMSSKLKDLIKTTIKEYLEANDITVKDAIR
FT                   GKIREQISEFLGEVSEINEQVKEQISALVKKHVTELQESSQIALRKEKLKTLAQQNNGI
FT                   SHPNSFRRNAVAIELQARYADKTKQELEELDNKQQYSLTGRVVLRRVMGKASFITLQDY
FT                   TGRIQVYLKKSDLPDGQYETFKNLCDLGDIVGITGTMFKTNTGELSVEANHFEILTKAI
FT                   RPLPDKFHGLADQEMRYRQRYVDLITNEKAREVFKVRSKVVNFIRNYFDRLDFMEVETP
FT                   MMHVLQGGGAAKPFKTHHNALDMPLYLRIAPELYLKRLVVGGFERVYEINRNFRNEGVS
FT                   SRHNPEFTMLEFYMAYADYNDLMDLTEDMLSKLVQEVIGSEILEYGEYKINFGGKYERI
FT                   SMVDSIVKYNDDITKEDLVTFESAKKIAEKLKIKVEAYHELGHLINEIFEETVEHQLIQ
FT                   PTFITDYPAVVSPLARRQDGNPEFTDRFEFFIGAREVANGFSELNDAEDQAERFRKQVE
FT                   AAASGDDEAMPYDKDYIRALEYGMPPTAGQGIGIDRLVMYLTNSQSIRDVILFPHMKPE
FT                   "
FT   CDS_pept        complement(210944..211486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0193c"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="Similar to Y208_VIBCH (Q9KVD8) Hypothetical protein
FT                   VC0208 from Vibrio cholerae (162 aa). FASTA: opt: 414
FT                   Z-score: 528.5 E(): 1.5e-21 Smith-Waterman score: 414;
FT                   41.875 identity in 160 aa overlap ORF ftt0193c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0193c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08209"
FT                   /inference="similar to sequence:UniProtKB:Y208_VIBCH"
FT                   /protein_id="CAL08209.1"
FT                   /translation="MSKFINKILSIIEMFIFGIRWIQAPIYLLLSLVLFGFIYEIYHEL
FT                   YHLFTHYHTIDEDQLIIIALTLCDVVLVANLVVIVVISGYENFVSKMNLDKKSGGQPVW
FT                   IKKLSPNAVKLKIAGSIIGISSISLLKKFLEVSQATDRDLAWSAAIHMVFVVSALLIAF
FT                   TSFIEGKSHKASYDDDH"
FT   CDS_pept        complement(211585..212457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0194c"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="Similar to Q8X898 Hypothetical 31.1 kDa protein
FT                   (Hypothetical membrane protein) from E.coli (274 aa).
FT                   FASTA: opt: 398 Z-score: 431.1 E(): 4e-16 Smith-Waterman
FT                   score: 398; 26.429 identity in 280 aa overlap ORF ftt0194c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0194c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08210"
FT                   /inference="similar to sequence:UniProtKB:Q8X898"
FT                   /protein_id="CAL08210.1"
FT                   /translation="MINLLFIYLAYILAIVSLLSLWMIKFRIFGYITITTSLVFALLSG
FT                   VLNLTGLLVICVIGILIYLSFYFKDKKGVSLFFFIISAVILFLNYMHFFPGFNNICIIK
FT                   NAQISQDAIAISLYLNYSSIIPTYFLLLFSSEIGILESSNKLLLVIKSGIFYGLLASFI
FT                   LILISYLFDFIRFDFKLTQYTLVFIFVNLIFTCLPEEIFWRGFIQSRLEKYFNSIIAII
FT                   ITSFAFAFIHIAFAGTRFALLAFIASLIYGTAYSKTRKIEASIICHYLVNIGQFIFFTY
FT                   PILAKAYPL"
FT   CDS_pept        complement(212466..214007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0195c"
FT                   /product="L-glutaminase"
FT                   /EC_number="3.5.1.2"
FT                   /note="Similar to Q8IX91 L-glutaminase from Homo sapien
FT                   (602 aa). FASTA: opt: 1441 Z-score: 1670.0 E(): 3.9e-85
FT                   Smith-Waterman score: 1441; 42.887 identity in 478 aa
FT                   overlap ORF ftt0195c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0195c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08211"
FT                   /inference="similar to sequence:UniProtKB:Q8IX91"
FT                   /protein_id="CAL08211.1"
FT                   /translation="MKTIMIKTTSSSGEDYYKNIFSAICDKDGFMTKTDILDILVESGI
FT                   SNDDPRITKLIAKLNKFCDIDKIDFDTFQEITFENIGLIEKAINKGFIIPNFKDFKKEI
FT                   EAIYNETKKNETGRNANYIPQLARVDPNLFAVAFCSVDGQIITLGDYLQPYCVQSTAKT
FT                   ITYCIATEENGEDKVHQHVGREPSGITFNAIALNKYDLPHNPMINSGAIMMCSLIKPEW
FT                   NLADRFEYITNVWQDLAGGEPIGFDNAVYHSEKETADRNYALAHFMKEVGAFPEGTNIH
FT                   TALDFYFQTCSIQVNAKKMAKIMASIANGGVCPFTSKKIFSPTTIRNCLSMMYSCGMYD
FT                   FSGEYAFSVGLPAKSGVSGALAIAIPNVGGFAIFSPRLDPNHNSVRGVEFSKRLIEKFS
FT                   FHNYDHITHCDKINPVENRMVVESNLTFELIWAASAGDLSEIKRAVALGVDINKGDYDK
FT                   RTALHLAAAEGHEDIVKYLIRKGADINAIDRWGKKPLDDAIMNNNISIIELLDRT"
FT   CDS_pept        complement(214089..215126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="FTF0196c"
FT                   /product="glutamine synthetase"
FT                   /EC_number="6.3.1.2"
FT                   /note="Similar to AAO90051 (Q83E31) Glutamine synthetase
FT                   from Coxiella burnetti (359 aa). FASTA: opt: 1369 Z-score:
FT                   1705.1 E(): 4.4e-87 Smith-Waterman score: 1369; 59.226
FT                   identity in 336 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0196c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08212"
FT                   /inference="similar to sequence:INSDC:AAO90051"
FT                   /protein_id="CAL08212.1"
FT                   /translation="MKVITAEYIWVDGSDPVPHLRSKARVLPFKEFETPDEFPEWSFDG
FT                   SSTNQATGDNSDCILKPVNFVIDPLRDYGYLVLCEVYNPDGQTPHATNNRAKLRALLAS
FT                   ADCQDMWAGFEQEYTMFKDGRPLGWPTTGFPGPQGPYYCSAGNSKAFGRDLVEAHMQAC
FT                   LEAGILFYGINAEVMPGQWEFQIGYRGVDGEDAGILNVADHTHLARWLLERLGEEYGID
FT                   ISFDNKPIKGDWNGAGLHTNFSTSKTRNPQTGREAIKKICAALEKNHKKDILNYGHNLH
FT                   ERLTGKLETSDMNTFSVGDADRGCSIRIPRPVALKGYGYLEDRRPGANADPYVIAMALA
FT                   NAAIN"
FT   CDS_pept        complement(215246..216223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holA"
FT                   /locus_tag="FTF0197c"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="Similar to Q88DM9 DNA polymerase III, delta subunit
FT                   from Pseudomonas putida (345 aa). FASTA: opt: 380 Z-score:
FT                   451.8 E(): 2.8e-17 Smith-Waterman score: 380; 28.707
FT                   identity in 317 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0197c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08213"
FT                   /inference="similar to sequence:UniProtKB:Q88DM9"
FT                   /protein_id="CAL08213.1"
FT                   /translation="MELSYFELLQKNDLTAYKLFIITGDEPLQKHNTIEKITNQFKTKN
FT                   FEISYHDLSEQNIDVLYNEVDSLSLFSIDKFIQFNFDKPPQKKLQQTLVDKLINDDDNV
FT                   YLLVFSGMKKQNTSAKWFQSLEHKAIHIRIFQPNLDNAINIIDYETQQLGLSLTKEATQ
FT                   LLALKTEGNLIATKQILKLLSRQDSRVFDENTIRPFLHEHANFDVFDLSEAILSQHKSK
FT                   ALKILNSILNENDKPPLVLWALKRELRILSQLKNTQITYHQKIFKDNNIWSAKQKFYIS
FT                   LANKLSPEKISAGLEKCLDTDLCIKGARKGNIQLKLNEIVFDIF"
FT   CDS_pept        216351..216827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blc"
FT                   /locus_tag="FTF0198"
FT                   /product="outer membrane lipoprotein"
FT                   /note="Similar to Q8EGB4 Lipoprotein Blc from Shewenella
FT                   oneidensis (177 aa). FASTA: opt: 620 Z-score: 813.1 E():
FT                   2.1e-37 Smith-Waterman score: 620; 56.604 identity in 159
FT                   aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0198"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08214"
FT                   /inference="similar to sequence:UniProtKB:Q8EGB4"
FT                   /protein_id="CAL08214.1"
FT                   /translation="MLSGCVTKPANINPVENFQADKYLGKWYEIARFDNSFEKGMTNVY
FT                   AEYSLNPDGTIKVINSGITPSTGKRSYATGIAKFVEDKNIGYLKVSFFRPFYGAYVVFK
FT                   LDDNYKYAYVAGADKDYLWLLARTKTVPQNIKDDFINRAKALGYDTDKLVWVKQ"
FT   CDS_pept        216991..217824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0199"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0199"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0199"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08215"
FT                   /protein_id="CAL08215.1"
FT                   /translation="MKKTLITMVMLTSVGAATNASAEVTNKKFLTATGTNIQYGDAYST
FT                   DSARIAKLTCFEPAVPPMTQAPVGKLSFSQSMIKQELAKDLNVDISASGGFGLFSADAS
FT                   ATYVNSLKDGSTAMTFSYVYSITAESVINSVKLSPQGEQELKYPEKFRENCGDQVFKDF
FT                   QLGSKLIATLSMDFHSEEQKQAFQAKVGASFGIFGTIDSKVQQEINDAKISGTVYINVY
FT                   QIGGDPTKLANIFGEPDENGVYKATSCNLNDLSACNSAIGNINYLCKRRVSEFVR"
FT   CDS_pept        217772..218389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0200"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0200"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0200"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08216"
FT                   /protein_id="CAL08216.1"
FT                   /translation="MEISITYAKGEYQNSLDNAFANNDQSKLKLLLGDRDDYFDLHSVI
FT                   GIEPGTDIPEVKNIDQIKQARERMVSAYLANKYYVDKANKIFKTYPVTLDDSYKIALGQ
FT                   FMDKAQANVNLIQEKIVKNCYNNLQNCPSVASQVLTSSNPNAITEDLVDKINAPIKYAY
FT                   RGYLTDYGPISSEDVNNVFYSTGNPMYWALIILVEMKSLDLV"
FT   CDS_pept        join(218762..218935,219802..220143,220146..220778)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0201"
FT                   /product="Transporter protein, pseudogene"
FT                   /note="Similar to Q87MQ6 Putative HAAAP family transport
FT                   protein from Vibrio parahaemolyticus (441 aa). FASTA: opt:
FT                   848 Z-score: 1002.0 E(): 5.8e-48 Smith-Waterman score: 848;
FT                   36.292 identity in 383 aa overlap. CDS is interrupted by an
FT                   ISFtu2 element. It also contains a frameshift after aa 190
FT                   and an in-frame stop codon after aa 401 ORF ftt0201"
FT                   /inference="similar to sequence:UniProtKB:Q87MQ6"
FT   repeat_region   complement(218937..218955)
FT                   /note="ISFtu2 19bp terminal inverted repeat"
FT   CDS_pept        complement(218963..219706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="isftu2"
FT                   /locus_tag="FTF0202c"
FT                   /product="Transposase"
FT                   /note="ISFtu2. Transposase, member of the IS5 family.
FT                   Identical to Q8GM03 putative transposase from Francisella
FT                   tularensis (247 aa)."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0202c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08218"
FT                   /protein_id="CAL08218.1"
FT                   /translation="MNYHIKEVFWSIILSFLKSQKGIHTNDEAKLRLFIEAVFYVLRTG
FT                   CQWRMLPFYYGKYRSIHKRFKDWCDKDIFSRLFKSVQNPDLQEVMLDSTIARAHACATG
FT                   YDKDDNQAIGRSVGRITTKIHAMTDALGNPIEILLSEDKTHDSKVAIDLLKNVYNTKVI
FT                   ADRAYHSNEIRQHIQGISSEAVIPCKSNTLNHIPFDSHVYKERHLIENFFSKIKHFRRV
FT                   FSRFDKTILAYIGMIKLACTFIWLR"
FT   repeat_region   complement(219783..219801)
FT                   /note="ISFtu2 19bp terminal inverted repeat"
FT   CDS_pept        complement(220957..222504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="FTF0203c"
FT                   /product="bifunctional purine biosynthesis protein"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /note="Similar to PUR9_RHIME (Q92KX6) Bifunctional purine
FT                   biosynthesis purH from Rhizobium meliloti (536 aa). FASTA:
FT                   opt: 1834 Z-score: 2200.5 E(): 1.1e-114 Smith-Waterman
FT                   score: 1834; 55.344identity in 524 aa overlap Includes
FT                   phosphoribosylaminoimidazolecarboxyamide formyltransferase
FT                   and IMP synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0203c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08219"
FT                   /inference="similar to sequence:UniProtKB:PUR9_RHIME"
FT                   /protein_id="CAL08219.1"
FT                   /translation="MSKIKRVLISVSDKTGIIEFAKELSKYNIEILSTGGTSKTLKDAG
FT                   INVIDVSEHTQFPEIMNGRVKTLHPLIHGGILADRDNPEHLDAMLKNHIGQIDMVVVNL
FT                   YPFVNTVKSGADFDTCIENIDIGGPSMVRSCAKNHKHTTIVTNPSQYDLVIKEMAENDG
FT                   KTTLATRREFAKEAFAHTAEYDSHIANWFSKELDEEYPEKLFSVGTLKQVLRYGENPHQ
FT                   KAAVYSTDADCVSITNARQLQGKELSYNNLNDADGAFEMVCEYSEPSCAIIKHANPCGI
FT                   ASGKNAFEAWTKALACDPISAFGGIVAFNCEVDKEFAESLGKMFLEVIIAPSYTQEALD
FT                   ILAAKKNLRVLETGKVFDTKSSRMISKNIHGGILSQSYDNGGVDINDCKVVTDRAPTDK
FT                   EWADLMFAWKAVKYVKSNAIVYARDTQTVGIGAGQMSRVDSARIGAEKAQAHQGAKGSA
FT                   VASDAFFPFADGLEECIKAGATAVIQPGGSKNDQEVIDAANKAGITMVFTNMRHFRH"
FT   CDS_pept        222681..223967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="FTF0204"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="Similar to PURA_PSEAE (Q9HUM6) Adenylosuccinate
FT                   synthetase from Pseudomonas aeruginosa (430 aa). FASTA:
FT                   opt: 1304 Z-score: 1596.2 E(): 5.1e-81 Smith-Waterman
FT                   score: 1304; 46.495 identity in 428 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0204"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08220"
FT                   /db_xref="GOA:Q14JN1"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JN1"
FT                   /inference="similar to sequence:UniProtKB:PURA_PSEAE"
FT                   /protein_id="CAL08220.1"
FT                   /translation="MSNIVIVGAQWGDEGKGKIADTLAEKADLVVRYQGGNNAGHTLVV
FT                   NGKKTFLHLIPSGVLRQHTKCVIGHGVVLDPVALDEEITRLQAKGIAISAENLFVSESC
FT                   TIITSYHKLLDAVRESNTSEKIGTTGKGIGPAYEDKVSRKGIKFKHLFDKDLLRSRLAI
FT                   SLAEKETLFRDLYKVEYPTLEQEFDKLFALGQKLKQYAADTFSIIDQAIAAGKNVVYEG
FT                   AQGVLLDVDYGTYPFVTSSNTSVAGVYSGATTAGHGLDHVIGITKAYTTRVGEGPFPTE
FT                   LFDDVGKFIQHKGGEIGVTTGRIRRCGWLDLPLLKYSAKCSNLTSIALTKVDVLSDMDT
FT                   LKVCIGYKYEGKEIYCAYPGIDLYKVEPILVEMEPFSIDETVTKDNMPAALKTYLKTIE
FT                   NHVGIPISSLAYGPSREQILFFEDYFKKG"
FT   CDS_pept        223971..224504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="FTF0205"
FT                   /product="Hypoxanthine-guanine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="Similar to Q8R7L0 Hypoxanthine-guanine
FT                   phosphoribosyltransferase from Thermoanaerobacter
FT                   tengcogenesis (181 aa). FASTA: opt: 509 Z-score: 658.7 E():
FT                   8.5e-29 Smith-Waterman score: 509; 47.337 identity in 169
FT                   aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0205"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08221"
FT                   /inference="similar to sequence:UniProtKB:Q8R7L0"
FT                   /protein_id="CAL08221.1"
FT                   /translation="MTYSAENTEVYITSQQLEQAVTRLAEQINQDYSGQQVTLVCVLKG
FT                   SFMFFADLVRKLRIDLRTQFITASSYGSSTKSSGTVTLTETSLKEEYVKDKNIIIIEDI
FT                   VDTGHTYHKLIEGIGKYNPKTLKFATLLFKPARLERDVKLDYVCFEIEDKFIVGYGLDF
FT                   DEKYRELPYIGLIK"
FT   CDS_pept        complement(join(224526..225077,225080..225241))
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0206c"
FT                   /product="dienelactone hydrolase family protein,pseudogene"
FT                   /note="Similar to AAO90632 (Q83CJ6) Dienelactone hydrolase
FT                   family protein from Coxiella burnetti (237 aa). FASTA: opt:
FT                   718 Z-score: 895.1 E(): 5.2e-42 Smith-Waterman score: 718;
FT                   46.809 identity in 235 aa overlap. Contains a frameshift
FT                   after aa 54. Frameshift occurs at a heptanucleotide
FT                   sequence and so could be part of a programmed translational
FT                   frameshift ORF ftt0206c"
FT                   /inference="similar to sequence:INSDC:AAO90632"
FT   CDS_pept        complement(225339..226181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0207c"
FT                   /product="permease of ABC transporter"
FT                   /note="Similar to Q8G5L3 Possible permease of ABC
FT                   transporter system from Bifidobacterium longum (277 aa).
FT                   FASTA: opt: 582 Z-score: 622.6 E(): 8.7e-27 Smith-Waterman
FT                   score: 582; 38.372identity in 258 aa overlap ORF ftt0207c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0207c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08223"
FT                   /inference="similar to sequence:UniProtKB:Q8G5L3"
FT                   /protein_id="CAL08223.1"
FT                   /translation="MVNAIIAMSYLVYRRIFVFSYTFMLYAFIAGTIIAIICGIISFFV
FT                   IIRRLSFASHALGHISLTGASGAVLLNLSAMSGQLAINLIAGLLMGAFGDKIKKNDIAI
FT                   GIVLTFFLGLGTYFLFLYQSGYSGSVMSILVGDILTVSLEQIYILIGLAIFTIVLLIII
FT                   ARPLFISSIDPIFAESKKVSNKLLSILLFICIAITVSMACQVVGILLVFSLLIGPAAIA
FT                   TQWVDGFYKPIALSTLISVLTVWSGIVAAYYIDVPISFFITTIICILYLISILKNKFQ"
FT   CDS_pept        complement(226123..226800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0208c"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="Similar to MNTB_BACSU (O34338) Manganese transport
FT                   system ATP-binding protein mntB from Bacillus subtilis (250
FT                   aa). FASTA: opt: 365 Z-score: 426.7 E(): 7.1e-16
FT                   Smith-Waterman score: 365; 30.986 identity in 213 aa
FT                   overlap ORF ftt0208c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0208c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08224"
FT                   /inference="similar to sequence:UniProtKB:MNTB_BACSU"
FT                   /protein_id="CAL08224.1"
FT                   /translation="MIKCSNLVIGYNKPITAALNLEVPTNAWVGIVGKNGVGKSTFFKT
FT                   LLGKIPTISGLITINDNKIDVDTISYIPQEREINFEEKTSGYTLVKYSYKPKSWGLPLF
FT                   DKEFKEKLEYLIALTQTQDYIHKPFKNLSGGQKKRVYLVQALINEPKILLLDEPLSDLD
FT                   PDAKQQFLACLKEIHKKENITLLIISHDMKEISTQLDAFIHFKDGQCHYCNELPCLQED
FT                   ICV"
FT   CDS_pept        complement(226802..227719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0209c"
FT                   /product="periplasmic solute binding family protein"
FT                   /note="Similar to Q88TE8 ABC transporter substrate binding
FT                   protein from Lactobacillus plantarum (297 aa). FASTA: opt:
FT                   555 Z-score: 628.8 E(): 3.9e-27 Smith-Waterman score: 555;
FT                   30.935identity in 278 aa overlap ORF ftt0209c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0209c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08225"
FT                   /inference="similar to sequence:UniProtKB:Q88TE8"
FT                   /protein_id="CAL08225.1"
FT                   /translation="MKKYILIALAAVVIVALVAINLLAESDKPQTTKGSHDISVVAAEN
FT                   QYGSIAKLIGGSNVKVTNIIDNADGDPHTFVSSVKNAKLLAEADVIIYNGADYDSWITP
FT                   ILKTNKNAEIIKVQDLINYPQTEKLGINPHLWYDPDTFPALAAKLKDVFSKQDSVDNSL
FT                   FEKNLENFNHKYQKVYDLVKQIKQSSSGTPVTATEPLFGYMANALGLDMKGLAFQWVIM
FT                   NDSEPSPKMMINYQKLFNDKQVKVLFYNKQVTDNVTSDVLEVAKKNNIPVVGITETMPV
FT                   NDDAINWMIETLQATAVALDKVQK"
FT   CDS_pept        complement(227797..229014)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0210c"
FT                   /product="major facilitator superfamily (MFS) transport
FT                   protein, pseudogene"
FT                   /note="Similar to AAO90981 (Q83BM0) Major facilitator
FT                   family transporter from Coxiella burnetti (428 aa). FASTA:
FT                   opt: 399 Z-score: 467.4 E(): 3.5e-18 Smith-Waterman score:
FT                   502; 25.307 identity in 407 aa overlap. Contains several
FT                   stop codons ORF ftt0210c"
FT                   /inference="similar to sequence:INSDC:AAO90981"
FT   CDS_pept        complement(229135..229599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0211c"
FT                   /product="outer membrane lipoprotein"
FT                   /note="Similar to Q9F6B1 Outer membrane lipoprotein Pcp
FT                   from Edwardsiella tarda (155 aa). FASTA: opt: 294 Z-score:
FT                   329.0 E(): 2e-10 Smith-Waterman score: 294; 35.032 identity
FT                   in 157 aa overlap ORF ftt0211c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0211c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08227"
FT                   /inference="similar to sequence:UniProtKB:Q9F6B1"
FT                   /protein_id="CAL08227.1"
FT                   /translation="MKKVFWIWLLSLCFLLTNCTNSAPSYSANSVGQVSQVEQGQIIDI
FT                   QQVNIKGSDNIGARGGGLAGGLGGALAGSGNIFTSIAGSIGGAIVGGIAGGATEDAITS
FT                   SKDYQFTLKLDNGKTIAILQEDKHGLNIGDRVTIYMSGNNTRIVPARSQA"
FT   CDS_pept        complement(229610..230206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wrbA"
FT                   /locus_tag="FTF0212c"
FT                   /product="trp repressor binding protein"
FT                   /note="Similar to Q9I509 Trp repressor binding protein WrbA
FT                   from Pseudomonas aeruginosa (198 aa). FASTA: opt: 727
FT                   Z-score: 948.0 E(): 6.5e-45 Smith-Waterman score: 727;
FT                   54.974 identity in 191 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0212c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08228"
FT                   /inference="similar to sequence:UniProtKB:Q9I509"
FT                   /protein_id="CAL08228.1"
FT                   /translation="MMMKNILILYYSQGGSTKKMAHTIAIGVEATGATATIRTVPNISA
FT                   KTEQTAPLIPDNGDLYATKEDLANCDGLIVGSPAYFGNMASPLKYFLEIHSDIWFKGSL
FT                   IGKPVGFFTAASGMHAGHESTLLSMMIPFIHHGCLIVGVPYSEQALEHTRTGGTPYGAS
FT                   HLNTFSPNKTMSDDEIKICKTLGKRVAEIANKLSC"
FT   CDS_pept        230213..231400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbn"
FT                   /locus_tag="FTF0213"
FT                   /product="tRNA processing ribonuclease BN"
FT                   /EC_number="3.1.-.-"
FT                   /note="Similar to RBN_ECOLI (P32146) tRNA processing
FT                   ribonuclease BN from E. coli (290 aa). FASTA: opt: 535
FT                   Z-score: 578.5 E(): 2.5e-24 Smith-Waterman score: 535;
FT                   33.813 identity in 278 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0213"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08229"
FT                   /inference="similar to sequence:UniProtKB:RBN_ECOLI"
FT                   /protein_id="CAL08229.1"
FT                   /translation="MFDIRLYKKYLLILKNYWIWVFKEYLRKDCPTVAASITLTSLFAI
FT                   VPAFFIIINILDAFSSLSESLQNFLFENMLPETATTVQQYITKISHKMTSLPITSVIVL
FT                   LVVIFLMIKRLEITLNKIFYANRQRPILQSLLVYWALMTMGPLLMGFVFISSTYLISMA
FT                   WFVKDIGMEQYLLSGLSLIFLTAGFFVVYKILPNTRINSKIALLAAFLVAIVFTLAKKI
FT                   FALYMFYVPTYSVIYGSLSLIPIFILWVFVTWQITLLGAVMIRAMQYMKVTLNFKKEVK
FT                   RDDLSISVNMLKELHIAQRELKNGMSINDLYQKTSVADYDKIKKNLYALEKANIIRITV
FT                   QDICYLNCDVFDISLYKIYLAFNPTINFKTSSIRKINVIKSQLYKQLDIKLYECF"
FT   CDS_pept        231419..231976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0214"
FT                   /product="Transport protein"
FT                   /note="Similar to Q9I2E6 Probable transporter from
FT                   Pseudomonas aeruginosa (191 aa). FASTA: Q8PGT5 PnuC protein
FT                   from Xanthomonas axonopodois (191 aa). FASTA: opt: 216
FT                   Z-score: 281.0 E(): 8.5e-08 Smith-Waterman score: 216;
FT                   27.072 identity in 181 aa overlap. Contains a frameshift in
FT                   Schu S4 but intact in FSC 198"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0214"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08230"
FT                   /inference="similar to sequence:UniProtKB:Q9I2E6"
FT                   /protein_id="CAL08230.1"
FT                   /translation="MLFETLDYSALVINVLYTIYLARLKVWSWSLGIVGAILLLFLFAI
FT                   KGTYSLVLLQFVYVIFFSYGWYKWHTQGVDGEHKTVKWMKFADYLRYLIYVVVLCVFSI
FT                   GFNYITASADIISTGILTGITFTAIIMTIEKFMENWIVWIISDLYFVVVMYQQQLYGQV
FT                   LQNFIFFITAVYGFYYWYMNTR"
FT   CDS_pept        231990..234143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /locus_tag="FTF0215"
FT                   /product="Primosomal protein N'"
FT                   /note="Similar to Q9KNQ3 Primosomal protein N` from Vibrio
FT                   cholerae (734 aa). FASTA: opt: 1587 Z-score: 1770.8 E():
FT                   9.7e-91 Smith-Waterman score: 1619; 37.823 identity in 735
FT                   aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0215"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08231"
FT                   /inference="similar to sequence:UniProtKB:Q9KNQ3"
FT                   /protein_id="CAL08231.1"
FT                   /translation="MIVKVALPVPPSYVLDYSVDCQNVELFERVLVQVGKRQLIGFIVA
FT                   KDVKIGYEAEKLKTIIRILDKPISLAIQKLISWLSQYYCCDIYSAIRLALPNDFLKLQE
FT                   VKPQQDTYVYIDKVRLQQHKLTAKQQDLISAIATQELIKLEELKQLASSYVINKLFANN
FT                   ILNKTYKLKQSENVLNTDKSRVLNQQQQYVLEQILANTNFNVSLLYGITGSGKTEIYLQ
FT                   AIAEVLAKSQQVLILVPEINLTPQTIKRFENRFVDKNVVALHSKLSDKARLTNWLKIKQ
FT                   GKADIVIATRSGVLADFCNLGMIIVDEEHDGSFKQQTTTIRYNARDVAIFRARQLDIPI
FT                   VLGSATPSLQSYYNCVSGKYRLLKLTQRALNSHKNQIELLDLKSAIVDNGISSQLFALL
FT                   QKNIQAHQQSLVFINKLGFAKALVCKSCGEVVECKKCDKPYTLHTQPYQYLECHFCGSR
FT                   KPLVTACPSCGAQELFPYGCGTEKIQARIEAKFPYNRVVRFDRANIKTITDLHAVNQLI
FT                   NDNQVDVIVGTQMIAKGHHFENITLVGLINIDAGLYSSDFNAIEKTAQMIVQVAGRAGR
FT                   ADKPGTIVLQTYQPENKLLQLLVNNDYLEFLDYLLQQRKYAGYPPYAYQAQIIAESKRQ
FT                   GQVLELLNDVYSSISGSVNIQVSKPLPALHLKRNNVYRYSLLLTAKTRKEINSVVKQIN
FT                   NKFVINIPSTVKMCFDIDPIELA"
FT   repeat_region   234209..234220
FT                   /note="ISFtu1 12bp terminal inverted repeat"
FT   repeat_region   234221..234236
FT                   /rpt_type=TANDEM
FT                   /note="16bp Short Sequence Tandem Repeat (SSTR)"
FT   repeat_region   234237..234252
FT                   /rpt_type=TANDEM
FT                   /note="16bp Short Sequence Tandem Repeat (SSTR)"
FT   CDS_pept        join(234273..234599,234599..235057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="isftu1"
FT                   /locus_tag="FTF0216"
FT                   /product="Transposase"
FT                   /note="ISFtu1. Transposase, member of the IS630 Tc-1
FT                   mariner family. Identical to Q93EJ6 Putative transposase
FT                   from Francisella tularensis (118 aa) from aa 144-261.
FT                   Identical to Q93EJ7 putative transposase from Francisella
FT                   tularensis (126 aa) from aa 1-109. Q93EJ6 and Q93EJ7
FT                   previously characterised as two separate ORF's. ORF1
FT                   (identical to Q93EJ7) contains a programmed ribosomal
FT                   frameshifting motif, 5'-AAAAAAAG-3' at aa position 109
FT                   which permits frameshifting to ORF2 (identical to Q93EJ6)
FT                   to produce a single ORF. Alignment of this single ORF with
FT                   additional members of the IS630 family, and also mariner
FT                   elements, show that this transposase shares strongly
FT                   conserved residues, including a fully conserved
FT                   dipeptide,Asp-Glu (DE), and a block consisting of a fully
FT                   conserved Asp and highly conserved Glu, separated by 34 or
FT                   35 residues (D35E). The conserved dipeptide is only present
FT                   if ribosomal frameshifting occurs."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0216"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08232"
FT                   /protein_id="CAL08232.1"
FT                   /translation="MPSYSQDFRDIVINKHEEGMTEFELSKFFNIDKRTVVSWIEFYKR
FT                   TGDYSSKQGVGCGRVASFTDKTLIEQYLIDHPDASALDIKEALAPDIPRSTFYDCLNRL
FT                   GFSFKKKTPKYKQRKEHERLEYIEKLKEIAQNLLFYIDEMGCDNKLSILRGWSLIGEPS
FT                   YGEVLAYQTQRRSIVAGYNYADKKIIALLEYSGYTNTEIFNQWFEEHLCPSLKPKTTIV
FT                   MDNASFHKSSKLIEIANKFDVQILYLPPYSPDLNPIEKV"
FT   repeat_region   235145..235156
FT                   /note="ISFtu1 12bp terminal inverted repeat"
FT   CDS_pept        235158..235394
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0217"
FT                   /product="Hypothetical protein, pseudogene"
FT                   /note="hypothetical protein, pseudogene. This CDS lacks a
FT                   start codon due to an interruption by an ISFtu1 element at
FT                   the N-terminal end ORF ftt0217"
FT   CDS_pept        complement(join(235404..235763,235767..235916))
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0218c"
FT                   /product="cytochrome b561 family protein, pseudogene"
FT                   /note="Similar to Q9I539 Cytochrome b561 from Pseudomonas
FT                   aeruginosa (182 aa). FASTA: opt: 265 Z-score: 332.5 E():
FT                   1.3e-10 Smith-Waterman score: 265; 30.357 identity in 168
FT                   aa overlap. Contains an in-frame stop codon after aa 50 ORF
FT                   ftt0218c"
FT                   /inference="similar to sequence:UniProtKB:Q9I539"
FT   CDS_pept        complement(235996..236991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0219c"
FT                   /product="phosphate transport protein"
FT                   /note="Similar to Q81FW2 Low-affinity inorganic phosphate
FT                   transport protein from Bacillus cereus (332 aa). FASTA:
FT                   opt: 932 Z-score: 1065.7 E(): 1.8e-51 Smith-Waterman score:
FT                   932; 42.470 identity in 332 aa overlap ORF ftt0219c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0219c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08235"
FT                   /inference="similar to sequence:UniProtKB:Q81FW2"
FT                   /protein_id="CAL08235.1"
FT                   /translation="MISSVLIAIIVIALFFEFTNGFHDAANVVATPIATKSLTPYQAIA
FT                   LAAFFNFLGAFFGTAVAATISKGLVDTNVVTDIVLISALLGAISWNFFTWSFGIPSSSS
FT                   HALIGSLVGAVIISSSYQNVSYMTVVNKVLIPMVTSPVIAFFLALIICIVLLNIFMRFF
FT                   RVRTTNKYIREMQVLSTSLLSFSHGSNDAQKTMSIITLALLSAGLVKTTQVPDWVIILC
FT                   GVAMGLGTLSGGKKIIKTLSAKLSKLEPVNAVSAELSSGILVLGASHIGLPVSTTQVAS
FT                   GSIMGAGYADAGVNWKVVKKMAMAWILTIPACVFVTSAIYTVIYYIFGSF"
FT   CDS_pept        complement(237009..237665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0220c"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Q8XMV6 Hypothetical protein CPE0582 from
FT                   Clostridium perfringens (210 aa). FASTA: opt: 207 Z-score:
FT                   248.6 E(): 5.9e-06 Smith-Waterman score: 207; 24.883
FT                   identity in 213 aa overlap ORF ftt0220c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0220c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08236"
FT                   /inference="similar to sequence:UniProtKB:Q8XMV6"
FT                   /protein_id="CAL08236.1"
FT                   /translation="MLRKLVKKLIPSQDKIFFDLMIEATEAVEDSARILDKLVKEEDNL
FT                   TISELSEELRLTRTVTVEVANKIDHELARYFVTPVDRVEIHNITTLLLKLNRRIVKIHR
FT                   YMQILMEEERGNVNIYLANSVETLRKMTKVLDDMMKAFVNGDNKELKNLYIRLTALDEN
FT                   VLEELGHALKKFSHYEEGDVIFIMKVKDIYKAIENAISTCTSVAESIMRLYVKEV"
FT   CDS_pept        237902..239446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpA"
FT                   /locus_tag="FTF0221"
FT                   /product="acid phosphatase (precursor)"
FT                   /EC_number="3.1.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0221"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08237"
FT                   /protein_id="CAL08237.1"
FT                   /translation="MKLNKITLGILSLSIATTTFATDVNNSKPNDYGTLVKIKQKLFNN
FT                   ANTLKTTTPIKHVVIIFQENNSFDRYFGMYPNAKNPEGEPKFVAKENTPNVNGLTKQLL
FT                   ENNPNTKNPYRLDRNFQPCSQNHEYHQEISSFNGGLMNKFVEHGGHDNDTYKQNCDGQV
FT                   MGYYDGNTVTALWNYAQNFALNDNTFGTTFGPSTPGALNLVAGANGPAMSPSGNLENIE
FT                   NSYIIDDPNPYYDDCSYGTSKSGDTNTAVAKITDGYNIGHYLTQKGITWGWFQGGFKPT
FT                   SYSGKTAICDAMSTNKFGIKSRDYIPHHEPFNYWKETSNPHHLAPSDDKYIGSNDQANH
FT                   QYDISEFWKALDQNTMPAVSYLKAPGYQDGHGGYSNPLDEQEWLVNTINRIKQSKDWDS
FT                   TAIIIIYDDSDGDYDHVYSPKSQFSDIKGRQGYGPRLPMLVISPYTKANYIDHSLLNQA
FT                   SVLKFIEYNWGIGSVSKYSNDKYSNNILNMFDFNKKQKTPKLILDPKTGLVVDKLN"
FT   CDS_pept        complement(239453..240229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgK"
FT                   /locus_tag="FTF0222c"
FT                   /product="hydrolase subunit"
FT                   /EC_number="3.5.-.-"
FT                   /note="Similar to YBGK_HAEIN (P44298) Hypothetical protein
FT                   HI1730 from Haemophilus influenzae (309 aa). FASTA: opt:
FT                   308 Z-score: 386.7 E(): 1.2e-13 Smith-Waterman score: 352;
FT                   32.453 identity in 265 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0222c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08238"
FT                   /inference="similar to sequence:UniProtKB:YBGK_HAEIN"
FT                   /protein_id="CAL08238.1"
FT                   /translation="MLFRYVNMALQDKGISPQGAQDQLSFITAYNLVGKPTNFQAVEMI
FT                   YPAEITANQDALVCLSGASYQDTYIDAHKKVSYNQVFMLNKGQKLEFKGIKKGFRTVVL
FT                   AVKAESEIQDLVANTRSPQLASYISETYRNNLIRILKGPEYNILKDKSFLENSWAISVN
FT                   SSQMGLSLEGVAFDTQKIEMISQPVTDGTIQLAPSGPIVLLRHRQTVGGYPRIANVIEA
FT                   DISKLSQYTPGSKIRFKLVSLEEAISENTRLKQLTE"
FT   CDS_pept        complement(240271..240969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgL"
FT                   /locus_tag="FTF0223c"
FT                   /product="lactam utilization protein"
FT                   /note="Similar to Y993_PYRAB (Q9V005) Hypothetical UPF0271
FT                   protein PYRAB09930 from Pyrococcus abyssi (255 aa). FASTA:
FT                   opt: 430 Z-score: 541.0 E(): 3e-22 Smith-Waterman score:
FT                   430; 35.294 identity in 238 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0223c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08239"
FT                   /inference="similar to sequence:UniProtKB:Y993_PYRAB"
FT                   /protein_id="CAL08239.1"
FT                   /translation="MLLINCDLGERGVAHPIDDRLVDYIDIANIACGGHAGDKASVDYY
FT                   VNLCKGKNVKITAHISYPDKQNFGRKVIDIDHNVLCESFDQQFALFDSEIKAIKPHGVL
FT                   YNQLNVDQELAKTFIQWCIKNNIDELLVSPFGVVAEYAKDKGIKTIKESFAERGYMLDN
FT                   HNNPMLIPRGQPNAEIEDVALAVAQYNQLKQGFVKIAGEEIAFKSQTICIHSDSSIALE
FT                   LAQELYKNKG"
FT   CDS_pept        complement(join(240972..241505,241504..241578))
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0224c"
FT                   /product="conserved hypothetical protein, pseudogene"
FT                   /note="Similar to Q8NW92 Hypothetical protein MW1559 from
FT                   Staphylococcus aureus (244 aa). FASTA: opt: 350 Z-score:
FT                   439.8 E(): 1.2e-16 Smith-Waterman score: 350; 38.012
FT                   identity in 171 aa overlap. Contains an in-frame stop codon
FT                   after aa 14 ORF ftt0224c"
FT                   /inference="similar to sequence:UniProtKB:Q8NW92"
FT   CDS_pept        complement(241624..242655)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0225c"
FT                   /product="major facilitator superfamily (MFS) transport
FT                   protein, fragment"
FT                   /note="Similar to AAO91543 (Q83A52) Major facilitator
FT                   family transporter from Coxiella burnetti (443 aa). FASTA:
FT                   opt: 546 Z-score: 623.3 E(): 7.3e-27 Smith-Waterman score:
FT                   546; 28.693 identity in 352 aa overlap. This CDS has no
FT                   start codon caused by insertion of an ISFtu1 element at
FT                   N-terminal ORF ftt0225c"
FT                   /db_xref="PSEUDO:CAL08241.1"
FT                   /inference="similar to sequence:INSDC:AAO91543"
FT   repeat_region   complement(242655..242666)
FT                   /note="ISFtu1 12bp terminal inverted repeat"
FT   CDS_pept        complement(join(242754..243212,243212..243538))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="isftu1"
FT                   /locus_tag="FTF0226c"
FT                   /product="Transposase"
FT                   /note="ISFtu1. Transposase, member of the IS630 Tc-1
FT                   mariner family. Identical to Q93EJ6 Putative transposase
FT                   from Francisella tularensis (118 aa) from aa 144-261.
FT                   Identical to Q93EJ7 putative transposase from Francisella
FT                   tularensis (126 aa) from aa 1-109. Q93EJ6 and Q93EJ7
FT                   previously characterised as two separate ORF's. ORF1
FT                   (identical to Q93EJ7) contains a programmed ribosomal
FT                   frameshifting motif, 5'-AAAAAAAG-3' at aa position 109
FT                   which permits frameshifting to ORF2 (identical to Q93EJ6)
FT                   to produce a single ORF. Alignment of this single ORF with
FT                   additional members of the IS630 family, and also mariner
FT                   elements, show that this transposase shares strongly
FT                   conserved residues, including a fully conserved
FT                   dipeptide,Asp-Glu (DE), and a block consisting of a fully
FT                   conserved Asp and highly conserved Glu, separated by 34 or
FT                   35 residues (D35E). The conserved dipeptide is only present
FT                   if ribosomal frameshifting occurs."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0226c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08242"
FT                   /protein_id="CAL08242.1"
FT                   /translation="MPSYSQDFRDIVINKHEEGMTEFELSKFFNIDKRTVVSWIEFYKR
FT                   TGDYSSKQGVGCGRVASFTDKTLIEQYLIDHPDASALDIKEALAPDIPRSTFYDCLNRL
FT                   GFSFKKKTPKYKQRKEHERLEYIEKLKEIAQNLLFYIDEMGCDNKLSILRGWSLIGEPS
FT                   YGEVLAYQTQRRSIVAGYNYADKKIIALLEYSGYTNTEIFNQWFEEHLCPSLKPKTTIV
FT                   MDNASFHKSSKLIEIANKFDVQILYLPPYSPDLNPIEKV"
FT   repeat_region   complement(243559..243574)
FT                   /rpt_type=TANDEM
FT                   /note="16bp Short Sequence Tandem Repeat (SSTR)"
FT   CDS_pept        complement(243562..243756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0227c"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0227c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0227c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08243"
FT                   /protein_id="CAL08243.1"
FT                   /translation="MIASLLVSSCTIHPLGIPDETWQKMTPQQQADAYQKQADIDAKQR
FT                   AQELAYIVNPKDICRKRYL"
FT   repeat_region   complement(243575..243590)
FT                   /locus_tag="FTF0227c"
FT                   /rpt_type=TANDEM
FT                   /note="16bp Short Sequence Tandem Repeat (SSTR)"
FT   repeat_region   complement(243591..243602)
FT                   /locus_tag="FTF0227c"
FT                   /note="ISFtu1 12bp terminal inverted repeat"
FT   CDS_pept        complement(243791..244327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orn"
FT                   /locus_tag="FTF0228c"
FT                   /product="Oligoribonuclease"
FT                   /EC_number="3.1.-.-"
FT                   /note="Similar to ORN_PASMU (P57885) Oligoribonuclease from
FT                   Pasteurella multicoda (184 aa). FASTA: opt: 711 Z-score:
FT                   917.8 E(): 3.1e-43 Smith-Waterman score: 711; 59.669
FT                   identity in 181 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0228c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08244"
FT                   /db_xref="GOA:Q14JL3"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JL3"
FT                   /inference="similar to sequence:UniProtKB:ORN_PASMU"
FT                   /protein_id="CAL08244.1"
FT                   /translation="MQSADNLIWIDLEMTGLDVDSCKITEIAAIITDKDLNIIAEAEPI
FT                   AIYQPDEVLANMNEWCIKTHTETGLTQRVKDSKISTEAAEQQILEFIRKFVPYQSSPLC
FT                   GNSIWQDRRFLAKYMPNIDEYCHYRMLDVTTLKLLNQYWGDGKSFEKKNTHKALDDIRE
FT                   SIAELKFYRQKLLSI"
FT   CDS_pept        complement(244330..244899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="efp"
FT                   /locus_tag="FTF0229c"
FT                   /product="elongation factor P"
FT                   /note="Similar to AAP96214 (Q7VLM1) Elongation factor P
FT                   from Haemophilus ducreyi (188 aa). FASTA: opt: 821 Z-score:
FT                   1040.5 E(): 4.6e-50 Smith-Waterman score: 821; 67.553
FT                   identity in 188 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0229c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08245"
FT                   /db_xref="GOA:Q14JL2"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JL2"
FT                   /inference="similar to sequence:INSDC:AAP96214"
FT                   /protein_id="CAL08245.1"
FT                   /translation="MASYSTNEFKGGLKVLIDGNPMVIVENEFVKPGKGQAFNRVKLKN
FT                   LLNDRVVEKTFKSGESVEAADVEELTTVYSYFDGDSYVFMHPETFEQYMVSEEALGETK
FT                   KWLKDQDEYQVILFNGQPISIIAANFVNLEIIETDPGLKGDTAGTGGKPATLSTGAVVR
FT                   VPLFVQTGEIIKVDTRTSTYVSRVKD"
FT   CDS_pept        complement(244939..245346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0230c"
FT                   /product="Type IV pili fiber building block protein"
FT                   /note="Similar to Q87B50 Type IV pilin from Xylella
FT                   fastidiosa (142 aa). FASTA: opt: 224 Z-score: 300.3 E():
FT                   7.8e-09 Smith-Waterman score: 224; 32.090 identity in 134
FT                   aa overlap The pili fiber building block protein has a
FT                   highly distinct primary structure; a short positively
FT                   charged leader sequence, and a highly conserved and highly
FT                   hydrophobic amino-terminal domain which forms the core of
FT                   the pilus fiber; A variety of studies suggest that the
FT                   invariant glycine (G) at -1 is required for prepilin
FT                   cleavage and assembly and that the glutamate (E) at + 5 is
FT                   essential for assembly and efficient N-terminal methylation
FT                   but not cleavage. The region near the carboxy terminus is
FT                   often hydrophilic and is stabilized by one or two disulfide
FT                   bridges that may be involved in recognition of receptors.
FT                   The genes with these characteristics are usually termed
FT                   pilA, pilE, pilV, pilW, pilX and FimU. (Mattick John S..
FT                   'Type IV Pili and twitching motility'. Annu. Rev.
FT                   Microbiol. 2002. 56:289-314.) This protein has all the
FT                   characteristics described above. ORF ftt0230c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0230c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08246"
FT                   /inference="similar to sequence:UniProtKB:Q87B50"
FT                   /protein_id="CAL08246.1"
FT                   /translation="MLDKKGFSLVELIVVIAIIAILASIGIPMYNNYILRNHRTEATSE
FT                   LLSAASAADNYEIRFGSFPSGSNIDSFYHTNTQNSYYSLAYCSGEHQCPNVSYVITATA
FT                   QGTQTADTPCANIEIEVKGGIVNKTPAECWN"
FT   CDS_pept        complement(245359..246282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htrB"
FT                   /locus_tag="FTF0231c"
FT                   /product="Acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="Similar to HTRB_ECOLI (P24187) Lipid A biosynthesis
FT                   lauroyl acyltransferase from E. coli (306 aa). FASTA: opt:
FT                   542 Z-score: 697.7 E(): 5.7e-31 Smith-Waterman score: 542;
FT                   32.895 identity in 304 aa overlap (8-307:14-306)
FT                   n.b.Paralog of FTF0232c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0231c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08247"
FT                   /inference="similar to sequence:UniProtKB:HTRB_ECOLI"
FT                   /protein_id="CAL08247.1"
FT                   /translation="MNNNKFSPKNWGIWIVVGIMNCGSKLPLFTHKYIVLTIGLIIKPF
FT                   LKSRNDIAYENLKIAFPEKSNKEIKKLVKKSYYSMVLSGAETTAAWFLSKKRFNKIEFK
FT                   WEEGSRERFEKYHNDPDKKLIILGFHFHCIEIIGRYMGQEFPPFTVMYQKNGNDLIEDL
FT                   IKEYREKSLYKCLDSKNFVSVIKSLKKGYTMWYAPDQDFGLESTGLENSVFAPFFGKLC
FT                   STLTVTPWLAQKTGAVVIPAYYVREKCLKKYKIVTGEPFEFTGDAYKDAEMTNKFLEDA
FT                   VRKYPEQYLWQHRRYRTRPNGEPQIY"
FT   CDS_pept        complement(246343..247242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddg"
FT                   /locus_tag="FTF0232c"
FT                   /product="Acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="Similar to Q8ZNA3 (Q8ZNA3) Cold shock-induced
FT                   palmitoleoyl transferase from Salmonella typhimurium (306
FT                   aa). FASTA: opt: 629 Z-score: 782.5 E(): 1.1e-35
FT                   Smith-Waterman score: 629; 36.755 identity in 302 aa
FT                   overlap Paralog of FTF0231c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0232c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08248"
FT                   /inference="similar to sequence:UniProtKB:Q8ZNA3"
FT                   /protein_id="CAL08248.1"
FT                   /translation="MDKSLLKPKYWGIWIIIWIAKFIVNILPYKMLMRLAIGIGFLAKP
FT                   LLKKRQQIAITNLKIAFPEKSDQEIKKLADASYKSASMAGFESLISWFMTKKNFNKIPF
FT                   DNDLRSFDEIHYDKDKTLLVLGFHFHCLEIAGRYIGENYSPFTVMYQYHNNPLMEYIIT
FT                   SSRKKYVTECFQRKNIIAVIKSLKRKVSMWYAPDQDFREHVVFAPFFGKLCTTLTVTPW
FT                   LAEKTNATVIPAYYVRKPDLSGYSIITGEPIIFSGNDLEDAKLTNKILEEIIKKHPEQY
FT                   LWQHRRYKTRPLGEEKIY"
FT   CDS_pept        complement(247249..248904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yidC"
FT                   /locus_tag="FTF0233c"
FT                   /product="Inner-membrane protein"
FT                   /note="Similar to 60IM_COXBU (P45650) 60 kDa inner-membrane
FT                   protein homolog from Coxiella burnetti (566 aa). FASTA:
FT                   opt: 1434 Z-score: 1537.8 E(): 8.4e-78 Smith-Waterman
FT                   score: 1434; 41.815 identity in 562 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0233c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08249"
FT                   /db_xref="GOA:Q14JK8"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JK8"
FT                   /inference="similar to sequence:UniProtKB:60IM_COXBU"
FT                   /protein_id="CAL08249.1"
FT                   /translation="MKANHIRILLLVTIAIMFISLMGKWEQTFPADNTKQQTSATQNNS
FT                   HYDNADSSTNTDVTTTDAKSSLAKETNFSKYDNAKSITINTGVFKDVKVSLLDGAIISA
FT                   SLKDYSISLDDKTPMSLLTDKSGSEYIAKSTIVVNKQPISVNFEDQGIKIENGKQILTL
FT                   TGSADGLQITRTYTFDDTKYNISVSQNIKNTTSAPVNVIVDDSFARDFDPAGDSFSLLN
FT                   AHSYTFTGVAYSTAKDSFRKESFKDISKTNGQPTVINSDGQGWVAFLQHYFVSAWIPQS
FT                   TNAKIYYKNLNGDVFEAGAFTGATIAPNQSENISSILYTGPIIKANLVDLAPNLEKTLD
FT                   YGMLSFFSEIIFWVMNHIHSLVGNWGLAIILVTCLIKLIFYPLSAKSYRSMAKMRMLQP
FT                   RIKRLQETYKDDRQALGKKMMELYKEEKVNPLSGCLPMLIQIPIFISLYWVLLESVELR
FT                   QAPFIFWIHDLSMKDPYFVLPVLMGLSMFLQQKLSPAPADPMQAKVMMFLPVIFTFLFA
FT                   SFPSGLVLYWLTNNLISISQQWIITRHYQATHKK"
FT   CDS_pept        complement(248913..249125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0234c"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Q8RHA5 Hypothetical protein FN0003 from
FT                   Fusobacterium nucleatum (82 aa). FASTA: opt: 273 Z-score:
FT                   406.9 E(): 8.2e-15 Smith-Waterman score: 273; 53.623
FT                   identity in 69 aa overlap ORF ftt0234c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0234c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08250"
FT                   /inference="similar to sequence:UniProtKB:Q8RHA5"
FT                   /protein_id="CAL08250.1"
FT                   /translation="MLINLYRYCISPFIPARCRYYPTCSEYALEALKTHGILKGLYLTT
FT                   RRLLRCHPLSKRDYYDLVPCKNKKG"
FT   CDS_pept        complement(249137..249538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnpA"
FT                   /locus_tag="FTF0235c"
FT                   /product="Ribonuclease P protein component"
FT                   /EC_number="3.1.26.5"
FT                   /note="Similar to RNPA_VIBCH (Q9KVY2) Ribonuclease P
FT                   protein component from Vibrio cholerae (118 aa). FASTA:
FT                   opt: 189 Z-score: 256.8 E(): 2.1e-06 Smith-Waterman score:
FT                   189; 35.870 identity in 92 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0235c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08251"
FT                   /inference="similar to sequence:UniProtKB:RNPA_VIBCH"
FT                   /protein_id="CAL08251.1"
FT                   /translation="MVEKLSETEELKVEQSLLHNFCLTKQNILDKSEIQQAFDSVENKL
FT                   STLHFTFLLAKRNIKDPGLCVILTKKNIKKATKRNLCRRIIKESFRLHKDLLDHKSLIV
FT                   LSKKTAAQATKEELWQSITEFECFLKKLH"
FT   CDS_pept        complement(249480..249614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmH"
FT                   /locus_tag="FTF0236c"
FT                   /product="50S ribosomal protein L34"
FT                   /note="Similar to Q8EKT3 Ribosomal protein L34 from
FT                   Shewanella oneidensis (45 aa). FASTA: opt: 226 Z-score:
FT                   374.4 E(): 5.8e-13 Smith-Waterman score: 226; 79.070
FT                   identity in 43 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0236c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08252"
FT                   /db_xref="GOA:Q14JK5"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JK5"
FT                   /inference="similar to sequence:UniProtKB:Q8EKT3"
FT                   /protein_id="CAL08252.1"
FT                   /translation="MKRTFQPSNLKRKRTHGFRARMKTLSGRKVIRNRRAKGRAKLAA"
FT   CDS_pept        complement(249706..250164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0237c"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0237c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0237c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08253"
FT                   /protein_id="CAL08253.1"
FT                   /translation="MKKISMLLICGLCFATGFGDEITTNNLSTQSNSGSSLATSTATVK
FT                   TKMPKPSDHATPMAMNATPTPLGKDIREGNIPTIDQPKQHQQLVGSDPSTWTPAYLQVK
FT                   KFKKCLSTENYRGWQGYCFPAEQPKECPDESWDELSKMNLIPCTNTSK"
FT   CDS_pept        250291..251064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE1"
FT                   /locus_tag="FTF0238"
FT                   /product="Shikimate 5-dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="Similar to AROE_VIBVU (Q8DDD4) Shikimate
FT                   5-dehydrogenase from Vibrio vulnificus (277 aa). FASTA:
FT                   opt: 567 Z-score: 672.1 E(): 1.5e-29 Smith-Waterman score:
FT                   567; 37.984 identity in 258 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0238"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08254"
FT                   /inference="similar to sequence:UniProtKB:AROE_VIBVU"
FT                   /protein_id="CAL08254.1"
FT                   /translation="MKDLYHVIGFPVKHSLSPAIQMRLAQQYNQDMLFTAIEVAPQDLE
FT                   AKIQEFKTNPQVKGLSVTVPHKERVYALADDADTTAKAVQAASNVIFTAERKMIALNYD
FT                   GLGIVNDIKNNYKIDFAGKKVLVVGAGGAAKAVVAAVLKESPLSLSITNRTLAKAKAIE
FT                   ELFKVDTKIKIIDFDNISDSFDIVINSTSSSIDGKLLPLKDSNFNKNAFAYDLMYADGG
FT                   TIFTKWCQAHNIAAADGKGMLKELSIAVFKYWRGL"
FT   CDS_pept        251131..252486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="FTF0239"
FT                   /product="UDP-N-acetylmuramate--alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /note="Similar to Q9F1M9 MurC from Shewanella violacae (494
FT                   aa). FASTA: opt: 1010 Z-score: 1212.3 E(): 1.2e-59
FT                   Smith-Waterman score: 1010; 36.761 identity in 457 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0239"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08255"
FT                   /db_xref="GOA:Q14JK2"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JK2"
FT                   /inference="similar to sequence:UniProtKB:Q9F1M9"
FT                   /protein_id="CAL08255.1"
FT                   /translation="MNKKILFLGVGGIGVSALAIAAKRLGAHVAGYDSVANKLTAKLEA
FT                   LGIVIFTSPNGVDVANFDIVVYSSAILSSHPLLSQARSLGIQCLQRAMFLAVLMKDFSY
FT                   SIAITGTHGKTTTSSVLATLLCQLDKYSSFIVGGVVKYADSNIQVNGTDKLVIEADESD
FT                   ASFLFLSPQVVIITNIDLDHMATYNNSYQTLLENFTDFVSKESVKSIYLCVDDQGCRDL
FT                   LAKYNQSDKNVTSYGFSINADVQIYDYHIIDEITHFKIRYKDDDLSFKLQLPGRYNVQN
FT                   ATACIIACLDLGFKYEDIRNALIKVTGVARRFDLYTKVISGHQVTVIDDYGHHPVEVAN
FT                   SISAVRDRYPNKKIIHVFQPHRYTRNRDLIKDWPKALSLADQLILLPTYSADEQIIKGA
FT                   ESQDIVKGLSGYLLADGFDHAIYFLEKLANENTVILIQGAGDVTNLVEILSE"
FT   CDS_pept        252479..253351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0240"
FT                   /product="tetrapyrrole methyltransferase family protein"
FT                   /EC_number="2.1.1.-"
FT                   /note="Similar to Q87SH3 Conserved hypothetical protein
FT                   from Vibrio parahaemolyticus (287 aa). FASTA: opt: 744
FT                   Z-score: 882.7 E(): 2.8e-41 Smith-Waterman score: 744;
FT                   46.996 identity in 283 aa overlap ORF ftt0240"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0240"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08256"
FT                   /inference="similar to sequence:UniProtKB:Q87SH3"
FT                   /protein_id="CAL08256.1"
FT                   /translation="MNSIEKATLYVVATPIGNLEDITYRALNVLSNVDIILAEDTRVTA
FT                   KLLASLNIRNNQKLVSCHDFNEESRVQYVKELLDAAKSIALVSDAGTPLISDPGYKIVA
FT                   NLRKENYKVVPIPGVSAVITALSAAGLPSDSFIFKGFLSAKHNKRQQQIREFQQINTTV
FT                   ILYESVHRINYLLEDLLELLPNSNIVVAKELTKQFENFVFGSVQQVYDYFQANQDTLRG
FT                   EFVVIFDCNSDSEVNDSNNLKIDVDELLKDLLDEMPLNKAVKLVTKITGAKKNFVYEKA
FT                   LKLKDASLN"
FT   CDS_pept        complement(253362..253832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0241c"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0241c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0241c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08257"
FT                   /protein_id="CAL08257.1"
FT                   /translation="MHGIYYRSQQFKKSSLFSHMSENIHYNPQTVLQGIYDHYNQLKPQ
FT                   YELITKDRLNRLISTKLGSLPQQITNSQFSYSLGYNFFEIPNNSPASSIIVKQEFIKGM
FT                   KAGLEGQRYKLSTQQVAEISYIIGTLLYSSEYNVLKNTNAKKQFLAGFYSKI"
FT   CDS_pept        254172..254735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0242"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Q83DS9 Hypothetical protein CBU0616 from
FT                   Coxiella burnetii (196 aa). FASTA: opt: 376 Z-score: 484.1
FT                   E(): 4.5e-19 Smith-Waterman score: 376; 37.634 identity in
FT                   186 aa overlap ORF ftt0242"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0242"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08258"
FT                   /inference="similar to sequence:UniProtKB:Q83DS9"
FT                   /protein_id="CAL08258.1"
FT                   /translation="MLQRGLYTLKEMFKHRKKLYGLSQGYRIDSIINLSAKLLRQQGIK
FT                   YLALDFDGVLASHGKSEMHPEVMLWFKDFVTEFPADRIFILSNKPTEARLKYFNANFPK
FT                   IRFIAGVAKKPYPDGLNKIIQLVGCQAKELALVDDRLLTGCLACLIAGCYPILITNPYI
FT                   DTDNYTKEERFFKFLRYSEQKIFL"
FT   CDS_pept        254808..255587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0243"
FT                   /product="hypothetical membrane protein"
FT                   /note="weak similarity to M. musculus protein,1700056O17
FT                   Rik protein (233 aa) ORF ftt0243"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0243"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08259"
FT                   /protein_id="CAL08259.1"
FT                   /translation="MKKNILVLILLSLWCNAFASYTFTQTFFGSYDPSLDSNFAYKNDD
FT                   YRDDAKIDKYNNKFSKDDSDNYNCSFDSSGQIRCGDYKIKNPKYEDKDVAKKIKANFKK
FT                   LQDVKDISKGDDFNCALDDKDDVYCWGSNKRGQLGIETEKSKIKKPLRIDIDSSINFKK
FT                   VYTKAHYACALDESGYAYCWGDGSNGEVGNGEKGHFTTPQKVKTDIQFSRLSMARTYTC
FT                   GVAKQTNQVYCWGKSKKGQTNLDSAVPVEDISNDSRF"
FT   CDS_pept        255571..258312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0244"
FT                   /product="DNA/RNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="Similar to Q8R5Z3 DNA/RNA helicase (DEAD/DEAH box
FT                   family) from Fusobacterium nucleatum (942 aa). FASTA: opt:
FT                   2318 Z-score: 2654.5 E(): 5.8e-140 Smith-Waterman score:
FT                   2473; 45.087 identity in 916 aa overlap ORF ftt0244"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0244"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08260"
FT                   /inference="similar to sequence:UniProtKB:Q8R5Z3"
FT                   /protein_id="CAL08260.1"
FT                   /translation="MIQDSKQFLTNSRKSKILDEIINQFENCEEFIISVAFITFSGVVC
FT                   ILEVLRQLRAKGIKGKILTGCYLNFTEPKALKKLLEFDNIELKILNDENFHAKGFFFRN
FT                   KDSWQIILGSSNLTQSALTINNEWNLLIKTSLADVTTQQILAEFDYLFDRAKYPSDILD
FT                   EYIQIYQRASKLANTSIQRISHKIQPNKIQCEALESLRQLRDSGKNKALIISATGTGKT
FT                   FLSAFDIASIKPKRCLFVVHRTNIAIKAQETFAKVISDKTLGLYTGGNKTSAEYLFATV
FT                   QTLKNSKVLANFKSQEFEYIIIDEVHHAEAESYKKVLAHFTPKFLLGMTATPERSDAAD
FT                   IFKLFDYNIAYEIRLHQALEQDLLCPFHYFAVEDLYLESEEILAKNFAKLVSDVRVEHI
FT                   IEKINFYGYSGQSRAALMFVSNVDEAKELATKFSNKGIKAKALSSQDSEQIRQTTIAQL
FT                   ESGELEIIVTVDIFNEGVDIPCINQIILLRPTQSAIVYIQQLGRGLRKYQDKKFVVILD
FT                   FIANYTNNFLIAVALSGDNSYDKDELKKFVVSPNNYLAGKSTITFSNIAKEIIYKNIQK
FT                   TNFSQLKNIKRDYTQLKKELGRIPNLVDFQHYNFISPEVILSTKDTYYDVLKAFKEDII
FT                   NLDIRQYNILKFLSKEFTPAKRLYEILILEELFKSNSISISELETSLKASLVDFEKTSF
FT                   TNALLHLSLQIFTINAGRQDYEPLISVNAQEVSLLVADLINKNSFLYKQIIDLIAYNKL
FT                   IYARKYSQNKSHGLAMYAKYTKKEIAHLLNQDYTNGGVNLAGYRAFGSKALLFMTFDEY
FT                   KKFGLYDNKFISQQAFSYYSRAAKTLDDPLEKALAENSYQSYVFARINKHDSYFFLGLV
FT                   SKCLEAKEINASKKLVSYIFELEKPIPKEIWQYFTTIYKNKI"
FT   CDS_pept        258388..259224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="usp"
FT                   /locus_tag="FTF0245"
FT                   /product="universal stress protein"
FT                   /note="Similar to Q8PWX4 Universal stress protein from
FT                   Methanosarcina maizae (323 aa). FASTA: opt: 347 Z-score:
FT                   418.2 E(): 2.1e-15 Smith-Waterman score: 347; 31.849
FT                   identity in 292 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0245"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08261"
FT                   /inference="similar to sequence:UniProtKB:Q8PWX4"
FT                   /protein_id="CAL08261.1"
FT                   /translation="MAYKKVLLAVNVYENADIVINSAVDFAKKNNTQVLKVVTVIDCVA
FT                   PFAPSIVDFQHSIEQEAKEALDKLVTKISGIKVEHEVLVGNPAAEIVEYAEESNCDVIV
FT                   LGSHATHGINLLLGSVANTVLHKAKCDVLTVRVNDDENADSKAHSYKRLLVPTDLENDS
FT                   YVVVDKAKDIAKLYSAKIDTAFVIPNDSISLMTYETDKVETTLDKFAEKNGITGEKSVM
FT                   IGGISNSLLEKAAENKNDLIVVGSHRRGAIGRFFLGSTANSILHQANVDVLVVRLK"
FT   CDS_pept        complement(259303..259518)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0246c"
FT                   /product="Hypothetical protein, pseudogene"
FT                   /note="hypothetical protein, pseudogene; This CDS lacks a
FT                   start codon due to an interruption by an ISFtu1 element at
FT                   the N-terminal end ORF ftt0246c"
FT                   /db_xref="PSEUDO:CAL08262.1"
FT   repeat_region   259520..259531
FT                   /note="ISFtu1 12bp terminal inverted repeat"
FT   repeat_region   259532..259547
FT                   /rpt_type=TANDEM
FT                   /note="16bp Short Sequence Tandem Repeat (SSTR)"
FT   repeat_region   259548..259563
FT                   /rpt_type=TANDEM
FT                   /note="16bp Short Sequence Tandem Repeat (SSTR)"
FT   CDS_pept        join(259584..259910,259910..260368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="isftu1"
FT                   /locus_tag="FTF0247"
FT                   /product="Transposase"
FT                   /note="ISFtu1. Transposase, member of the IS630 Tc-1
FT                   mariner family. Identical to Q93EJ6 Putative transposase
FT                   from Francisella tularensis (118 aa) from aa 144-261.
FT                   Identical to Q93EJ7 putative transposase from Francisella
FT                   tularensis (126 aa) from aa 1-109. Q93EJ6 and Q93EJ7
FT                   previously characterised as two separate ORF's. ORF1
FT                   (identical to Q93EJ7) contains a programmed ribosomal
FT                   frameshifting motif, 5'-AAAAAAAG-3' at aa position 109
FT                   which permits frameshifting to ORF2 (identical to Q93EJ6)
FT                   to produce a single ORF. Alignment of this single ORF with
FT                   additional members of the IS630 family, and also mariner
FT                   elements, show that this transposase shares strongly
FT                   conserved residues, including a fully conserved
FT                   dipeptide,Asp-Glu (DE), and a block consisting of a fully
FT                   conserved Asp and highly conserved Glu, separated by 34 or
FT                   35 residues (D35E). The conserved dipeptide is only present
FT                   if ribosomal frameshifting occurs."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0247"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08263"
FT                   /protein_id="CAL08263.1"
FT                   /translation="MPSYSQDFRDIVINKHEEGMTEFELSKFFNIDKRTVVSWIEFYKR
FT                   TGDYSSKQGVGCGRVASFTDKTLIEQYLIDHPDASALDIKEALAPDIPRSTFYDCLNRL
FT                   GFSFKKKTPKYKQRKEHERLEYIEKLKEIAQNLLFYIDEMGCDNKLSILRGWSLIGEPS
FT                   YGEVLAYQTQRRSIVAGYNYADKKIIALLEYSGYTNTEIFNQWFEEHLCPSLKPKTTIV
FT                   MDNASFHKSSKLIEIANKFDVQILYLPPYSPDLNPIEKV"
FT   repeat_region   260456..260467
FT                   /note="ISFtu1 12bp terminal inverted repeat"
FT   CDS_pept        260538..260909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0248"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0248"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0248"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08264"
FT                   /protein_id="CAL08264.1"
FT                   /translation="MIDSGKYQAFINDWNNDIQAFSFDAIKDKTTTATLTYYRNNDKFF
FT                   KNSQKLYISFTGTQIKVCKAENSFSDDCSVITATLPQYQKGVKVMISSGIIKAYAQCDM
FT                   IYNHHNTHSTANSNIIINI"
FT   CDS_pept        261010..263253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feoB"
FT                   /locus_tag="FTF0249"
FT                   /product="ferrous iron transport protein"
FT                   /note="Similar to Q8ZJH5 Ferrous iron transport protein B
FT                   from Yersinia pestis (771 aa). FASTA: opt: 1928 Z-score:
FT                   2034.7 E(): 1.9e-105 Smith-Waterman score: 2307; 45.396
FT                   identity in 771 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0249"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08265"
FT                   /inference="similar to sequence:UniProtKB:Q8ZJH5"
FT                   /protein_id="CAL08265.1"
FT                   /translation="MKYALVGNPNCGKTTIFNALTGLNQKVGNWSGVTVDKKTGFFNSK
FT                   DKKIEVVDIPGIYSLSVSDANSIDEQIAYSFVVKEKPNAIINVVDASNLNRSLYLTMQL
FT                   IELGLPVILVVNMIDVANKKGLIIHYDRLEKTLGCKVLPVVAAKGIGIKELKETLADRQ
FT                   KISSFDLKSYYSRIVTELAQQITTQKNDDIGSLWLAIELIDGRELQLSQEITASQLDSL
FT                   KSLLQSNTDIDIAKVRYNAVAEIVASITENKKVSRFNFTKALDALCMNKYLGVPIFLLM
FT                   MYLMFLFSITLGGAIQPMFDDLSHAIFVDGLAYYSNMLGLPTAVTGILANGLGTGINTV
FT                   LGFIPQIGFLFIFLSILEDSGYMSRAAFVMDRFMQSIGLSGKAFVPLIVGFGCNVASIM
FT                   AARTLETRKDRLMTLMMSPFMSCGARLAIFSVFASAFFPHNGATVIFLLYLAGIFGAII
FT                   TGYIIKFTFLKGDTAPFILDIPNYHTPSFKTVMIYSWNRLKSFLIRAGKVIVPVAIIVG
FT                   SLNSIYIGNKTTALEYAGKKITPILNPMGINDDNWPATVGLITGTLAKEVVVGTLNTIY
FT                   TQGEDNVIPDKFSLIDSVKESWNTTIDNIKGIDLATLMNPIEASKADANMDNGAMGNMV
FT                   TKFGSLSAAFAYLLFVLLYIPCISVVGAMVTESTRGWAILSVLWSVSIAYVAAVVIYQL
FT                   LNIAEHPSSSIICIALAMAYIIGIVFLMKYLSTKINFVANLTGCSSCSSKKCS"
FT   CDS_pept        264065..266713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppdK"
FT                   /locus_tag="FTF0250"
FT                   /product="phosphoenolpyruvate synthase/pyruvate phosphate
FT                   dikinase"
FT                   /EC_number="2.7.9.1"
FT                   /note="Similar to Q8RB43 Phosphoenolpyruvate
FT                   synthase/pyruvate phosphate dikinase from
FT                   Thermoanaerobacter tengcongensis (875 aa). FASTA: opt: 3545
FT                   Z-score: 4080.1 E(): 0 Smith-Waterman score: 3545; 61.812
FT                   identity in 872 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0250"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08266"
FT                   /inference="similar to sequence:UniProtKB:Q8RB43"
FT                   /protein_id="CAL08266.1"
FT                   /translation="MRGVFMSKFVYAFSEGNKSMRDLLGGKGANLSEMLNSGLPVPDGF
FT                   TVTTEACLKYYDDRQKLSNEVKEQIFAHIKDLEKRTGKTFGGGNNPLLVSVRSGARVSM
FT                   PGMMDTVLNLGLNDTVAQAMVAKTNNEQFVYDSYRRFIMMFADVVMDCEKKPFDKVLED
FT                   KKAKRKVKNDCDLPAQDYKDIVTEYKKIYKDLVGKDFPTDPIEQLLAAVEAVFKSWNAE
FT                   RAIIYREINNISNNWGTAVNVQEMVYGNSGNNSGTGVAFTRNPSTGENELFGEYLINAQ
FT                   GEDVVAGIRTPAHISTLKDKMPEVFNDFVKIAKNLEKVYKDMQDMEFTIEDGKLFMLQT
FT                   RNGKRTAKAALKIAVDMAKEGLITNEETVMMVEPHLLEQLLHPKFDEKALASKRPLGSA
FT                   LGASPGAASGRIYFDVESLLAAKARGEEKTILVRIETSPEDIAGMNACNGILTLRGGMT
FT                   SHAAVVARGMGKCCVSGLESARIDEEKKTITFERGQVFTEGDYLSLDGTKGTVYRGIIK
FT                   TVDPEVTKDFEDFMKFVDSVRKLRVRCNADTYKDASIARAFGAEGIGLCRTEHMFFEED
FT                   RISYVRQMILAKDKKERQRALDKLLPVQQQDFEELFEAMDNLAVTIRFIDPPLHEFLPH
FT                   EVDEIDDLAREFNISYSELEARIEALSEVNPMMGHRGCRLAVTYPEIIEMQTKAIIYAA
FT                   ISSKRMGIEVKLELMIPLVSTLGEFKLLSGIVREVADTILKREKIDIDYKVGVMLETPR
FT                   GAIGAGMLAAAGSEFFSFGTNDLTQMTFGFSRDDANKFIKDYLEKGILSFDPFARLDIK
FT                   GVGKLMQIAKEGVKAVNPNAKMGICGEHGGEPYSVGFCHDLDLDYVSCSPFRVPIARLA
FT                   AAQAKIYADRR"
FT   CDS_pept        267113..268000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvE"
FT                   /locus_tag="FTF0251"
FT                   /product="Branched-chain amino acid aminotransferase
FT                   protein (class IV)"
FT                   /EC_number="2.6.1.42"
FT                   /note="Similar to Q8Y1X0 Probable branched-chain amino acid
FT                   aminotransferase protein from Ralstonia solanacearum (309
FT                   aa). FASTA: opt: 706 Z-score: 903.1 E(): 2.1e-42
FT                   Smith-Waterman score: 706; 39.931 identity in 288 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0251"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08267"
FT                   /inference="similar to sequence:UniProtKB:Q8Y1X0"
FT                   /protein_id="CAL08267.1"
FT                   /translation="MIDKIWKNGEIISYQDAKVGINTHSLHYGSSVFEGIRAYDTPNGI
FT                   GVLKLREHMQRFMYSMNVLGMTCKYTLDELCQAVLDTVKASGKKSCYIRPLAYFAEGGV
FT                   NVLPAKDHPVDITIYCIDMGKYMAADKVDIKVSKYIRIHPRSTVCDAKIGGHYVNSILA
FT                   SRETLGTHYHESLLLDADGFVAEGAAMNVFFVKDNEVITTPLGTILDGITRRLIIQIAK
FT                   DLEYKVTERLFKVDELINADEVFFCGTAAEITPVASIDDNKLKRSDYTITNQIKEVFEK
FT                   LKQGQVYKEALTYI"
FT   CDS_pept        268011..269384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuA"
FT                   /locus_tag="FTF0252"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /note="Similar to Q9C5X5 2-isopropylmalate synthase from
FT                   Arabidopsis thaliana (503 aa). FASTA: opt: 493 Z-score:
FT                   601.2 E(): 1.4e-25 Smith-Waterman score: 635; 31.373
FT                   identity in 408 aa overlap. This CDS is disrupted by the
FT                   insertion of an ISFtu1 element occurring very near the
FT                   C-terminal end. It is not clear whether this insertion
FT                   affects the function of the protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0252"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08268"
FT                   /inference="similar to sequence:UniProtKB:Q9C5X5"
FT                   /protein_id="CAL08268.1"
FT                   /translation="MDKQKIYIFDTTLRDGQQSPGAGMSFEDNIAYADLADKLNIDVLE
FT                   AGFPSASNTDFEIVNTISKRMAERNSNMIIAGLCQLRKNQVEITMDALRPSLAIGKARV
FT                   HMYLPVDPNLAQASLGSKNDNEQNIKNVYELVKLASDEGFEVEFSAEGYSRLGDTFDYV
FT                   TNVFRAAVAAGVKVINCPDTIGGACERENDNYFIKNMAKHAEIIKKEFPDRNIIWSAHC
FT                   HNDLGLALENSMNAVFDGPARQVEGCINGVGERAGNASLEQCVMFINLFGKQKDYHYYN
FT                   DVNIAHFKTISDFIGKRILSRQPHHPITGLNSARHTSGGHTNAILKNPLAYQPFHPESV
FT                   GNEISFIFGPLSGGNHAKKIIEENGYICDDKEKAAIAQQIKDIYHERRKGITDEELIQA
FT                   YKQIKSPIHVSAIDYGKSNGETYVELKGRFFGNTDYRITGRGENSALSALLKGIQEYI"
FT   repeat_region   complement(269382..269393)
FT                   /note="ISFtu1 12bp terminal inverted repeat"
FT   CDS_pept        complement(join(269481..269939,269939..270265))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="isftu1"
FT                   /locus_tag="FTF0253c"
FT                   /product="Transposase"
FT                   /note="ISFtu1. Transposase, member of the IS630 Tc-1
FT                   mariner family. Identical to Q93EJ6 Putative transposase
FT                   from Francisella tularensis (118 aa) from aa 144-261.
FT                   Identical to Q93EJ7 putative transposase from Francisella
FT                   tularensis (126 aa) from aa 1-109. Q93EJ6 and Q93EJ7
FT                   previously characterised as two separate ORF's. ORF1
FT                   (identical to Q93EJ7) contains a programmed ribosomal
FT                   frameshifting motif, 5'-AAAAAAAG-3' at aa position 109
FT                   which permits frameshifting to ORF2 (identical to Q93EJ6)
FT                   to produce a single ORF. Alignment of this single ORF with
FT                   additional members of the IS630 family, and also mariner
FT                   elements, show that this transposase shares strongly
FT                   conserved residues, including a fully conserved
FT                   dipeptide,Asp-Glu (DE), and a block consisting of a fully
FT                   conserved Asp and highly conserved Glu, separated by 34 or
FT                   35 residues (D35E). The conserved dipeptide is only present
FT                   if ribosomal frameshifting occurs."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0253c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08269"
FT                   /protein_id="CAL08269.1"
FT                   /translation="MPSYSQDFRDIVINKHEEGMTEFELSKFFNIDKRTVVSWIEFYKR
FT                   TGDYSSKQGVGCGRVASFTDKTLIEQYLIDHPDASALDIKEALAPDIPRSTFYDCLNRL
FT                   GFSFKKKTPKYKQRKEHERLEYIEKLKEIAQNLLFYIDEMGCDNKLSILRGWSLIGEPS
FT                   YGEVLAYQTQRRSIVAGYNYADKKIIALLEYSGYTNTEIFNQWFEEHLCPSLKPKTTIV
FT                   MDNASFHKSSKLIEIANKFDVQILYLPPYSPDLNPIEKV"
FT   repeat_region   complement(270286..270301)
FT                   /rpt_type=TANDEM
FT                   /note="16bp Short Sequence Tandem Repeat (SSTR)"
FT   repeat_region   complement(270302..270317)
FT                   /rpt_type=TANDEM
FT                   /note="16bp Short Sequence Tandem Repeat (SSTR)"
FT   repeat_region   complement(270318..270329)
FT                   /note="ISFtu1 12bp terminal inverted repeat"
FT   CDS_pept        complement(270408..270779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0254c"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0254c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0254c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08270"
FT                   /protein_id="CAL08270.1"
FT                   /translation="MSSLFLLLESMRFSPVKANSRILELGHKIRFGRPSTVTSHMMMSQ
FT                   FRNKAITRSNQKELEYTINDFILKTRPAEISRFFSDLEGVLMTKIAPLIQYNYKYLGKS
FT                   NELLFFFKLRFSHLCNLLN"
FT   CDS_pept        complement(270772..271713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0255c"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0255c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0255c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08271"
FT                   /protein_id="CAL08271.1"
FT                   /translation="MKNFEVIRKDFLQSIEIYINHSYKSHFLSIHHRHRDTDIRRAALL
FT                   KDYILHCPNLTIMNQLIKHYLEKSRELEEVLLNLKLQYKKTITKAEIKVDASLLRGGNK
FT                   HPSSLWTYVNNVFQQTKNQAPIENNLSIINNPIFDVFLPVQNISKIGNSTASAHVVTHY
FT                   KDKKNEKVNYFVKSLNNNEVENAIAEVIYAQIWNYFIGNRASKSLLLLSKHENKIIGIA
FT                   SKGINDFQEYKSLSGDQKDYPGLIQILFYVCVLIENDFHICNFGTGLFNGKRCYSKIDH
FT                   DYIVSFWDALKYGKFMTEVSHNFQELFKKIYV"
FT   CDS_pept        complement(272050..273018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0256c"
FT                   /product="Lipopolysaccharide protein"
FT                   /note="Similar to Q87T79 Putative lipopolysaccharide A
FT                   protein from Vibrio parahaemolyticus (311 aa). FASTA: opt:
FT                   835 Z-score: 996.3 E(): 1.3e-47 Smith-Waterman score: 910;
FT                   43.671 identity in 316 aa overlap ORF ftt0256c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0256c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08272"
FT                   /inference="similar to sequence:UniProtKB:Q87T79"
FT                   /protein_id="CAL08272.1"
FT                   /translation="MKKLKYYIKNISRTIIPKKFFELSLEHKLKSIAKFDKEYIEYRVN
FT                   YYNRLSKPFMLQNSSNWKNFKRNTPVFDIIDHSLVRKSINSSYFYDFKEFLVYFNKTDS
FT                   FATAFYDLTKIPQQPTFVKSRPIADDNQNSIILKLDKLRHFSLFEDNQKFEDKLNMAVF
FT                   RGACHQPTRQYFIENYYNLPNTNFGDTRKESIGQPYNKGFLSIQDQLKYKYIVSIEGYD
FT                   VATNLKWIMNSNSLCFMNKPKYETWFMEGTLIPNHHYVLLKDDYSDLQEKIDYYNNHPE
FT                   KALKIIKNANEYVNQFKNKQREELISLLVMKKYFGLNKTSH"
FT   CDS_pept        273207..275063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0257"
FT                   /product="Ribonuclease II family protein"
FT                   /EC_number="3.1.-.-"
FT                   /note="Similar to Q8YNW1 Ribonuclease II family protein
FT                   from Anabaena sp. (686 aa). FASTA: opt: 557 Z-score: 649.1
FT                   E(): 2.9e-28 Smith-Waterman score: 763; 28.290 identity in
FT                   661 aa overlap ORF ftt0257"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0257"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08273"
FT                   /inference="similar to sequence:UniProtKB:Q8YNW1"
FT                   /protein_id="CAL08273.1"
FT                   /translation="MQKNSLVIFKSKPAKVINLLDKKIEIETLDGKNIKLPAKSVQLLV
FT                   ESEKDFELESLKELEIAELEMTWELLQEQQQTSVEELCELLFESIGVNQAYTVWLLVSE
FT                   GEYFSFNDDFSINIHSQEQKNAIVRDKQEKLKKEQELNDFIERLNNKTFNEDDRKFLKE
FT                   IEALATLKTNKCRFFKYLNMEESENSAYKLLLDIGYCDEFFNPYLYRYGAELEHNSAEF
FT                   NYNSKSDNQRVDLTHLKAYAIDDEGSNDPDDAISWDSKKNKMWVHIADPSSSISFGDEV
FT                   DLQARARGSNLYVPEQIVMMLPPQATAKLGLGLQEVSPAVSVGFRIDEQGDIHDIEICF
FT                   SNIKVTRYSYEFVEENMHTLELGDIVSYAKYFTDKRLSKGAVELDFPEIKISLDANKNV
FT                   KLTDLPRLNSRTLVRDTMLMAGVAVGQFCIKNNISVSFSTQPEHDLGQDGLENIDSIAD
FT                   MFATRKKLQRGRYSTQPSMHAGMGLEAYVQVTSPLRRYLDLIVHYQLRNFLQHKEMISA
FT                   QEIDNIIAQVDIPIKSNRQTERFSNSHWKLVYLIQNPDLEFQATVIEKLEKSRLMVSIA
FT                   ALAMTKKLSVSGKYDLNDQIKLQNTSVNLVTQEAFFRVIEEN"
FT   CDS_pept        275394..276062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0258"
FT                   /product="Carboxylesterase/phospholipase family protein"
FT                   /EC_number="3.1.1.-"
FT                   /note="Similar to Q83AC9 Carboxylesterase/phospholipase
FT                   family protein from Coxiella burnetii (200 aa). FASTA: opt:
FT                   599 Z-score: 736.0 E(): 4.2e-33 Smith-Waterman score: 599;
FT                   45.813 identity in 203 aa overlap ORF ftt0258"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0258"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08274"
FT                   /inference="similar to sequence:UniProtKB:Q83AC9"
FT                   /protein_id="CAL08274.1"
FT                   /translation="MNYELMEPAKQARFCVIWLHGLGADGHDFVDIVNYFDVSLDEIRF
FT                   IFPHADIIPVTINMGMQMRAWYDIKSLDANSLNRVVDVEGINSSIAKVNKLIDSQVNQG
FT                   IASENIILAGFSQGGIIATYTAITSQRKLGGIMALSTYLPAWDNFKGKITSINKGLPIL
FT                   VCHGTDDQVLPEVLGHDLSDKLKVSGFANEYKHYVGMQHSVCMEEIKDISNFIAKTFKI
FT                   "
FT   CDS_pept        276059..276961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemC"
FT                   /locus_tag="FTF0259"
FT                   /product="hydroxymethylbilane synthase (porphobilinogen
FT                   deaminase)"
FT                   /EC_number="2.5.1.61"
FT                   /note="Similar to HEM3_ECOLI (P06983) Porphobilinogen
FT                   deaminase from E.coli (313 aa). FASTA: opt: 991 Z-score:
FT                   1221.3 E(): 3.9e-60 Smith-Waterman score: 991;
FT                   54.698identity in 298 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0259"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08275"
FT                   /db_xref="GOA:Q14JI3"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JI3"
FT                   /inference="similar to sequence:UniProtKB:HEM3_ECOLI"
FT                   /protein_id="CAL08275.1"
FT                   /translation="MKQITIASRESKLALWQTNFVKNRIQLELNIPCEISTMKTQGDII
FT                   LDQPLNKIGGKALFMKELEVAMLSNKADIAVHSLKDVPYQLPQGFCLAGFMPREDPRDA
FT                   FVSNKYNSIDDLPKGAVVGTSSLRRKAQLLHYRDDLEIRDLRGNIQTRLSKLDNGDYDA
FT                   IILASAGLIRLELVERITQFIPVEISLPAVGQGIVVIEALERDNDLLEKIQKLNCRESS
FT                   RVATAERAFNQELKGGCHVAIGAYAELDNNQITLMAMVASSDGKKILKRKMIGDDPTKL
FT                   GKLLAQEMIALGAYKILES"
FT   CDS_pept        276962..277354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crcB"
FT                   /locus_tag="FTF0260"
FT                   /product="CrcB family protein"
FT                   /note="Similar to CRCB_YERPE (Q8ZDH2) Protein crcB homolog
FT                   from Yersinia pestis (127 aa), FASTA: opt: 292 Z-score:
FT                   354.8 E(): 7.1e-12 Smith-Waterman score: 292; 39.669
FT                   identity in 121 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0260"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08276"
FT                   /db_xref="GOA:Q14JI2"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JI2"
FT                   /inference="similar to sequence:UniProtKB:CRCB_YERPE"
FT                   /protein_id="CAL08276.1"
FT                   /translation="MGLLLLLVGIGGGFGAMARFALTQATASISKQIPLGILLCNIIGS
FT                   LIIGMMAAFLIETKLFNEDVSTYVRFLLVTGFLGGFTTFSSFSLDILNLLQRGEIFIAI
FT                   GYIMVSVLASLIAVILGFYIVMGVYK"
FT   CDS_pept        277351..277758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0261"
FT                   /product="hypothetical membrane protein"
FT                   /note="The predicted signal peptide are in conflict with
FT                   the membrane lipoprotein lipid attachment site ORF ftt0261"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0261"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08277"
FT                   /protein_id="CAL08277.1"
FT                   /translation="MIRKITALFLFCLLIVSCMLFLGGNMIVRDNRFESDLGQHSLQMQ
FT                   QGTTVKQLYDAIKKAVKANPGEFEIKADDYSNQKATLWTFSNKYNQPVTFEAVQRAGQV
FT                   YLSISVGEEGQARVNNDVIYYLQDLVLNNLQ"
FT   CDS_pept        277898..278035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0262"
FT                   /product="hypothetical lipoprotein"
FT                   /note="The predicted signal peptide and the membrane
FT                   lipoprotein lipid attachment site are in conflict with each
FT                   other ORF ftt0262"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0262"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08278"
FT                   /protein_id="CAL08278.1"
FT                   /translation="MQKYSPLILSLLLISCSSNPEITRIGPGIIKSQQQLISKEQLKKR
FT                   "
FT   CDS_pept        278088..278468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0263"
FT                   /product="hypothetical membrane protein"
FT                   /note="ORF ftt0263"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0263"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08279"
FT                   /protein_id="CAL08279.1"
FT                   /translation="MAGAMIGGVIGIIGGGICTIITLGLSAVPCFAGTVGGGMALGAGV
FT                   GAGTGALVGAGGGYIYVSNKDDIIGKYKYEVLEDGKTSPITFEQFPDRNYLAGQKVDIY
FT                   TSKYKGEKTYFIKAIQQDSKED"
FT   CDS_pept        complement(278465..278638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0264c"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Q8Y1X1 Hypothetical protein RSc0566 from
FT                   Ralstonia solancearum (65 aa). FASTA: opt: 160 Z-score:
FT                   236.6 E(): 2.5e-05 Smith-Waterman score: 160; 50.000
FT                   identity in 36 aa overlap ORF ftt0264c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0264c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08280"
FT                   /inference="similar to sequence:UniProtKB:Q8Y1X1"
FT                   /protein_id="CAL08280.1"
FT                   /translation="MKKEQKVIKVRPGERVSCPTKYHENWNLHPRVYIDLKDKKTNSCP
FT                   YCGTTFKVEKES"
FT   CDS_pept        278767..280566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0265"
FT                   /product="ABC transporter, membrane protein"
FT                   /note="Similar to Q83AV7 ABC transporter,permease protein
FT                   from Coxiella burnetii (581 aa). FASTA: opt: 976 Z-score:
FT                   1115.9 E(): 2.9e-54 Smith-Waterman score: 1738; 45.318
FT                   identity in 598 aa overlap ORF ftt0265"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0265"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08281"
FT                   /inference="similar to sequence:UniProtKB:Q83AV7"
FT                   /protein_id="CAL08281.1"
FT                   /translation="MKRLYSTNMSAKVSRTKWDILALSIILLILSIFVWSTSDLGGSID
FT                   YKSQASVLKYSDISLSLWLLPYYTAETTIRMFIGLVISLLITFIFGTWAAKNKRAESII
FT                   IPLVDILQSIPVLGFFAITVTGFLVIFPTSLWGAQAAVIFGIITAQAWNMILSFYQSLK
FT                   TVPKELREAADMYQLSAWQKFWKLEVPFAMPGLVWNTMMSMSGSWFMIVASETIMVNFS
FT                   ASQSIPINLPGIGSFIDAANNAQNFTAVGAAIVTMLVTIILYDQLLFRPLVSWSEKFVI
FT                   GDNPSETHSKSWFLTILQKAYVVKIFTTFLAKCSNKIVNIKFFKKNLDKAYNQKVHRKA
FT                   DKHESVTKRILWNVIIILMILALLYFVYQTVYAKDKDIGIEETFKVFVYGLFTGVRVAV
FT                   LILITSLIWVPIGIWIGLRPKIAQKVQPYAQMAAAFPVNVLYGVFGTLVVMFNLNFNIW
FT                   CILLMALGTQWYILFNVIAGASAIPEELKLAAENMQLKGIIKLKKFLVPAVMPYYVTGA
FT                   ITAAGGSWNASIISEYINWGKDSVIQASGIGDYITKYTNMPGDHTSNVLLGVIVMCILV
FT                   VASNKLFWRRLYNYAENRFSMNM"
FT   CDS_pept        280585..281901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0266"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="Similar to Q83AV8 ABC transporter, ATP-binding
FT                   protein from Coxiella burnetii (432 aa). FASTA: opt: 1556
FT                   Z-score: 1713.5 E(): 1.5e-87 Smith-Waterman score: 1556;
FT                   54.673 identity in 428 aa overlap ORF ftt0266"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0266"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08282"
FT                   /inference="similar to sequence:UniProtKB:Q83AV8"
FT                   /protein_id="CAL08282.1"
FT                   /translation="MTKKIFTVEKVNKEFNIKGGHSLKVLDNINFTLYEGEVVALLGKS
FT                   GSGKSTLLRIIAGLLSPTNGDVLYRGKKVSAPVPDISMVFQSFALMPWLTVLQNVELGL
FT                   EARKISLEERRQRALKAIDMVGLDGFENAYPKELSGGMKQRVGFARALVLEPDVLLMDE
FT                   PFSALDILTAENLREDLLDLWENNDAMKGILYVTHSIEEAVLTADRIIIFGSNPGFIRG
FT                   ELKINIPHPRSSQDPVVADLVDQVYRMMTTAQTKELTERMNKKTAMTIGYRLPDVDISE
FT                   MNGLLDEMAEIKNVEAVDLPQLADDLHLDINDLFPIIEILSILRFAEVSDGDIKMTAMG
FT                   RKFIDSNIDERKFIFGRLFLKYIPLARHVVKVLRERESQSAPRSRFLAELDDYYPMDVA
FT                   EQVFDTFIDWARYAELIYYDANTGVISLDENAAEYIKKM"
FT   CDS_pept        282026..283144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0267"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0267"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0267"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08283"
FT                   /protein_id="CAL08283.1"
FT                   /translation="MLFCLVLDALLLSKQMKNRISKNLYASTIIGQRDKFPNYSMFFGG
FT                   YFEGDAQTWFGSQINRAGGTSDFPATGQNIYMTTVDLYFLANVGEYMTAVFDFLTDDNS
FT                   DFGLRNGFVILGNLDTSPFFVTVGKNRRISVGTYGGGGPWSNGLSEDFLAPGSVTNISL
FT                   NYKTSSINANVTTFGTQNNHLDFSAAIFYANKLTTDLSYGLNFGYIFNLAGADNTSISK
FT                   FLDSIDKGNDSVGTIDIDGTLAYSILGGVLQFQSGWSTTTNKEDFNKNGTSVNTGAWYF
FT                   GLAYGFRLYGRNTNFNFSYSQSYNAANIPMSLSIASPNFGLADSGIKKQIIVSSQRSYF
FT                   DNNVLIGPEYSYQSLYNGEDMNTLTLDLSVYI"
FT   CDS_pept        283238..285124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0268"
FT                   /product="Sodium/hydrogen exchanger (antiporter) family
FT                   protein"
FT                   /note="Similar to Q88MV1 Sodium/hydrogen exchanger family
FT                   protein from Pseudomonas putida (601 aa). FASTA: opt: 1318
FT                   Z-score: 1419.4 E(): 3.6e-71 Smith-Waterman score: 1318;
FT                   37.993 identity in 608 aa overlap ORF ftt0268"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0268"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08284"
FT                   /inference="similar to sequence:UniProtKB:Q88MV1"
FT                   /protein_id="CAL08284.1"
FT                   /translation="MSNNMELFVHSSNYILLASGLILFFAIVSQFLSWRLKLPSILFLI
FT                   LSGIILGPLSEAIFQTGFKLVDGNVIFGEALSPFVSICVAIILFEGSLSLNFSKIKSVS
FT                   SVVILLITVGLAITVVLTALFCYYVVGLNLELSMLIGGITCVSGPTVVPPFMRTVRPKK
FT                   HIANILKWESILVDPIGALVVVFMLAWFVIGGNFANQPNAVSTFIAYMVFVCILGITSG
FT                   FILGYLIGLSFRKHYIPEYLKSFFVLAVIVLGFIISDAIMHGAGLLMVTVAGLVMANMK
FT                   DIKMSDIVSFKENLSIVIISVLFIVLGAEIDFSLFKDYWLDLIEVFLFLQFILRPIVVF
FT                   LCCLGSKTTFAERVVLGIIYPRGIVAASVAALVAVKIIKSHPELYSEANTLVFFVFMII
FT                   VFTVVFQSIVTPYISKALGVTEPEGKGFLIIGGNRFARELAEIFVKNDIEVVITDSSWG
FT                   NVQKCRQLGLNTYYGSPVSIHADWSINLVGIGAMLGLSTSEYVNAVSAMKYKYEFGSNN
FT                   VYVLRTAQKESYKGIGAIETNLANLLFDEGVDFNILIEMLNQGATIRSTNITPNYTLEK
FT                   FFSDNPNAIGLFIIDDNGYAQPFSKNKKIKFESYNLISLRDDKSKDQLCLDV"
FT   CDS_pept        285109..285648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0269"
FT                   /product="carbonic anhydrase, family 3"
FT                   /note="Similar to Q8EKP8 Carbonic anhydrase,family 3 from
FT                   Shewanella oneidensis (182 aa). FASTA: opt: 639 Z-score:
FT                   840.8 E(): 6.1e-39 Smith-Waterman score: 639; 50.000
FT                   identity in 178 aa overlap ORF ftt0269"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0269"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08285"
FT                   /inference="similar to sequence:UniProtKB:Q8EKP8"
FT                   /protein_id="CAL08285.1"
FT                   /translation="MSRCIRSFNGKYPKVADSAYVDESAAVIGDVILKEDSSIWSQVSV
FT                   RGDLLTITIGKGTNIQDCSTLHTTEYPKDSGQGFALTIGDYVTVGHGVVLHGCEIKNNC
FT                   LIGMGSIVLDGAVVEPWVFLGAGSLVPPGKTLESGYMYLGSPAKKVRPISEHERQIIKE
FT                   NAEHYVKVKNRYKAQI"
FT   CDS_pept        285599..286234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lolB"
FT                   /locus_tag="FTF0270"
FT                   /product="lipoprotein releasing system, subunit B, outer
FT                   membrane lipoprotein"
FT                   /note="Similar to Q83AQ2 Outer membrane lipoprotein
FT                   LolB,putative from Coxiella burnetii (210 aa). FASTA: opt:
FT                   395 Z-score: 508.7 E(): 1.9e-20 Smith-Waterman score: 395;
FT                   33.668 identity in 199 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0270"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08286"
FT                   /db_xref="GOA:Q14JH2"
FT                   /db_xref="InterPro:IPR004565"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JH2"
FT                   /inference="similar to sequence:UniProtKB:Q83AQ2"
FT                   /protein_id="CAL08286.1"
FT                   /translation="MLNTMSKLKIDTKRRFSLLIALVLIISLSSCATTQTNVTTKTVFN
FT                   QETTYHNLLKLKKWQANGVIGIIYDNQAESANYTYLQDGDNFSIKLYGPLGIGSIEIKG
FT                   DTNSVLLANSKGQKLTAKDAKTLMLEQLGWYVPVEGLKYWIKAIAIPNIRQTSELNTNN
FT                   LLSKLSQNGWSISYSNYQLVDSKYPLPTKIRMSRDNLTLKIVIKSWQI"
FT   CDS_pept        286222..287049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="FTF0271"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="Similar to ISPE_SHEON (Q8EAR0)
FT                   4-diphosphocytidyl-2-C-methyl-D-erythritol kinase from
FT                   Shewanella oneidensis (284 aa). FASTA: opt: 595 Z-score:
FT                   724.8 E(): 1.8e-32 Smith-Waterman score: 595; 38.351
FT                   identity in 279 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0271"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08287"
FT                   /db_xref="GOA:Q14JH1"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JH1"
FT                   /inference="similar to sequence:UniProtKB:ISPE_SHEON"
FT                   /protein_id="CAL08287.1"
FT                   /translation="MANIKAKKYYSYAKINLFLHILNKRPDGYHNLQTWFTFLDLKDQL
FT                   TFSFNNSREINISSNISIAAKQDNLVYKAIKKFQQSYRVQDIGVDIEIKKNIPMGAGLG
FT                   GGSSNAATTLIALRDYYLPQLSNEEMIPLAAKLGADVPIFVYGKSAWAEGIGEILYHKD
FT                   FSPQYALLIKPDIHISTKEFFTSEDLIKSSVLISKDLGFDKSIMHNDFENVFYAKYPEF
FT                   SQYLKELDSDFRMTGTGSCFYLLSADKNKLEQLARKINKPLDKWLVKTLNYVY"
FT   tRNA            287069..287143
FT                   /gene="tRNA-Gln (TTG)"
FT                   /product="transfer RNA-Gln"
FT   CDS_pept        287238..287558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0272"
FT                   /product="hypothetical membrane protein"
FT                   /note="ORF ftt0272"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0272"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08288"
FT                   /protein_id="CAL08288.1"
FT                   /translation="MFLNILSYLQSLLLLTFVYFLIRQKRVAWLFVTLAYAYPFLSEII
FT                   KLSQAVTVPVDYYLYAIPNALLYLAVAIWGLLTSKSQHLVAIRQRSNYIVNPKDICRKR
FT                   YL"
FT   repeat_region   287518..287529
FT                   /locus_tag="FTF0272"
FT                   /note="ISFtu1 12bp terminal inverted repeat"
FT   repeat_region   287530..287545
FT                   /locus_tag="FTF0272"
FT                   /rpt_type=TANDEM
FT                   /note="16bp Short Sequence Tandem Repeat (SSTR)"
FT   repeat_region   287546..287561
FT                   /rpt_type=TANDEM
FT                   /note="16bp Short Sequence Tandem Repeat (SSTR)"
FT   CDS_pept        join(287582..287908,287908..288366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="isftu1"
FT                   /locus_tag="FTF0273"
FT                   /product="Transposase"
FT                   /note="ISFtu1. Transposase, member of the IS630 Tc-1
FT                   mariner family. Identical to Q93EJ6 Putative transposase
FT                   from Francisella tularensis (118 aa) from aa 144-261.
FT                   Identical to Q93EJ7 putative transposase from Francisella
FT                   tularensis (126 aa) from aa 1-109. Q93EJ6 and Q93EJ7
FT                   previously characterised as two separate ORF's. ORF1
FT                   (identical to Q93EJ7) contains a programmed ribosomal
FT                   frameshifting motif, 5'-AAAAAAAG-3' at aa position 109
FT                   which permits frameshifting to ORF2 (identical to Q93EJ6)
FT                   to produce a single ORF. Alignment of this single ORF with
FT                   additional members of the IS630 family, and also mariner
FT                   elements, show that this transposase shares strongly
FT                   conserved residues, including a fully conserved
FT                   dipeptide,Asp-Glu (DE), and a block consisting of a fully
FT                   conserved Asp and highly conserved Glu, separated by 34 or
FT                   35 residues (D35E). The conserved dipeptide is only present
FT                   if ribosomal frameshifting occurs."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0273"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08289"
FT                   /protein_id="CAL08289.1"
FT                   /translation="MPSYSQDFRDIVINKHEEGMTEFELSKFFNIDKRTVVSWIEFYKR
FT                   TGDYSSKQGVGCGRVASFTDKTLIEQYLIDHPDASALDIKEALAPDIPRSTFYDCLNRL
FT                   GFSFKKKTPKYKQRKEHERLEYIEKLKEIAQNLLFYIDEMGCDNKLSILRGWSLIGEPS
FT                   YGEVLAYQTQRRSIVAGYNYADKKIIALLEYSGYTNTEIFNQWFEEHLCPSLKPKTTIV
FT                   MDNASFHKSSKLIEIANKFDVQILYLPPYSPDLNPIEKV"
FT   repeat_region   288454..288465
FT                   /note="ISFtu1 12bp terminal inverted repeat"
FT   CDS_pept        288480..288698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0274"
FT                   /product="hypothetical membrane protein"
FT                   /note="ORF ftt0274"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0274"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08290"
FT                   /protein_id="CAL08290.1"
FT                   /translation="MYENIINPTPVKNILIALCTALAMPLSFLNPCIHIDSINGAIIPH
FT                   RKAVPMPNIIMVKVFVYNLNNNINAIK"
FT   CDS_pept        complement(288747..289559)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0275c"
FT                   /product="major facilitator superfamily (MFS) transport
FT                   protein, fragment"
FT                   /note="Similar to Q8CN60 Bicyclomycin resistance protein
FT                   TcaB from Staphylococcus epidermidis (400 aa). FASTA: opt:
FT                   373 Z-score: 410.0 E(): 6.1e-15 Smith-Waterman score: 373;
FT                   29.412 identity in 238 aa overlap. Truncation at C-terminal
FT                   according to FASTA hits ORF ftt0275c"
FT                   /db_xref="PSEUDO:CAL08291.1"
FT                   /inference="similar to sequence:UniProtKB:Q8CN60"
FT   CDS_pept        complement(join(289630..290148,290150..290365))
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0276c"
FT                   /product="cyclohexadienyl dehydratase
FT                   precursor,psueodogene"
FT                   /note="Similar to Q89LI3 Probable cyclohexadienyl
FT                   dehydratase precusor from Bradyrhizobium japonicum (260
FT                   aa). FASTA: opt: 349 Z-score: 407.8 E(): 7.3e-15
FT                   Smith-Waterman score: 349; 30.841 identity in 214 aa
FT                   overlap. Contains a frameshift after aa 73 ORF ftt0276c"
FT                   /inference="similar to sequence:UniProtKB:Q89LI3"
FT   CDS_pept        complement(290443..290541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0277c"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="Similar to Q937K9 YbgT protein from Erwinia
FT                   chrysanthemi (38 aa). FASTA: opt: 81 Z-score: 153.9 E(): 1
FT                   Smith-Waterman score: 81; 42.857 identity in 28 aa overlap
FT                   ORF ftt0277c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0277c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08293"
FT                   /inference="similar to sequence:UniProtKB:Q937K9"
FT                   /protein_id="CAL08293.1"
FT                   /translation="MYYLAWIISAGLAVTVGCFVATRLEKKEDQSK"
FT   CDS_pept        complement(290557..291750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydB"
FT                   /locus_tag="FTF0278c"
FT                   /product="cytochrome d terminal oxidase, polypeptide
FT                   subunit II"
FT                   /EC_number="1.10.3.-"
FT                   /note="Similar to AAO69749 (Q8XGM0) Cytochrome d ubiquinol
FT                   oxidase subunit II from Salmonella typhi (379 aa). FASTA:
FT                   opt: 645 Z-score: 711.2 E(): 1e-31 Smith-Waterman score:
FT                   1022; 40.506identity in 395 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0278c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08294"
FT                   /inference="similar to sequence:INSDC:AAO69749"
FT                   /protein_id="CAL08294.1"
FT                   /translation="MLLDVLQIISWLVVGVLIFLVAATVGFDFGVGILAKFVGKDDYEK
FT                   RAIINTVGPTWDGSQVWFVTAGGAIFAIWPQVYATSFSGLYIAILVVLWGLFLRPPAFE
FT                   YRKKIDNPKWRNFWDWMLVLGSIIPIVVMGVAVGNLFLGFPISYDDTARLIYGTVTNGQ
FT                   YQSMWITLLHLLTPFALLFGIFALNMALMHGSAYAKLRTSGILRDRFRKITNATASVYM
FT                   VLFIIAAIWITFIPGYQFTPDASLAHLSDALNHAFTSGKVTTDYSWYYNFNHAHIWMWF
FT                   APVLAFVGAIFVIRFNNQDRDGAAFLASMASLLGAVLTVGFTLFPFIMVSNIGDYMYSL
FT                   TVYNSSSSQTSLIGILCAAVIILPIIFSYTFFVYKKMWANGRRISAEEIKANSHEMY"
FT   CDS_pept        complement(291761..293539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydA"
FT                   /locus_tag="FTF0279c"
FT                   /product="cytochrome d terminal oxidase, polypeptide
FT                   subunit I"
FT                   /EC_number="1.10.3.-"
FT                   /note="Similar to AAP96534 (Q7VKT6) Cytochrome D ubiquinol
FT                   oxidase, subunit I from Haemophilus ducreyi (516 aa).
FT                   FASTA: opt: 1311 Z-score: 1457.7 E(): 2.7e-73
FT                   Smith-Waterman score: 1688; 47.478identity in 575 aa
FT                   overlap Schu S4 seems to have extra sequence in between
FT                   340-420 aa"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0279c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08295"
FT                   /inference="similar to sequence:INSDC:AAP96534"
FT                   /protein_id="CAL08295.1"
FT                   /translation="MSYKEKINMLPTLMSVDLARLQFGLTASFHFLFVPLTLGLTWILF
FT                   TMELMYIRTGKEVYKDMVKFWGKLLGINFALGIITGLTMEFEFGTNWSYYSQSVGDIFG
FT                   TPLAIEGLAAFMLESTFAGLFFFGWDKLTKKQHLLSTFCLAIGSSFSALLILVANGYMQ
FT                   HPVGSEFVASTMRMETVSLLDLFLNHTAQTNFGHVMTAGYTTAAIFVIGISAFYLIRGR
FT                   DIAFAKRSIAIGLGFGLITCIVAIIFGDANGVDAFRVQPLKMAAIEAEWDTSKAPAAFN
FT                   AVALPSQKEQKNNFDVPIPAVLGLIATHSTDTEIPGIKAILYGKKTADGTRDPNLAYYR
FT                   DIKTGQTADVSPEDAAADPSKYEKVPSALVMIKEGGLAYADLLKWRETGHSGDTPDSSY
FT                   TNYNNPTYQKYMGFGKMLVQAAQEKYGVADSATIAKAANDPELVRAVATNMVPDVASVF
FT                   WSFRIMVFIGFFMFTLIVVGLILLARNALTSNAFSRFILRVMIWSIPLPYIACIAGWYV
FT                   TEHGRQPWTVYDQLPTSISSSALTAADVGTSMAIFFLIDTALFAVMVFLMFKYARLGPS
FT                   SLGTGKYYFEQNKKSK"
FT   CDS_pept        complement(293968..295335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajR"
FT                   /locus_tag="FTF0280c"
FT                   /product="major facilitator superfamily (MFS) transport
FT                   protein"
FT                   /note="Similar to AAO89830 (Q83EP3) Major facilitator
FT                   family transporter from Coxiella burnetii (458 aa). FASTA:
FT                   opt: 1379 Z-score: 1410.6 E(): 1.1e-70 Smith-Waterman
FT                   score: 1379; 46.102 identity in 449 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0280c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08296"
FT                   /inference="similar to sequence:INSDC:AAO89830"
FT                   /protein_id="CAL08296.1"
FT                   /translation="MYNNEVKTTINISLIYSFRMIGLFIIFPIFSLYINHLEYATPFLI
FT                   GLALGVYGLSQAMLQIVLSILSDKFGRKPIIFVGLIFFIIGSIVAACSSTIYGIIIGRA
FT                   IQGAGAIGSTLTALVADSTKEENRLKAMSLIGMSIGFSFLVAMMFSSILNSIIGLSGIF
FT                   WLTAVFGGLSIFMLTKIPTPKAPSFHHEAKPVFKLIKDVISHKELLKLNYGIFTLHATL
FT                   TALFIVIPPILTNILNIDADYQWLVYLPVLIISFSIMFPFVMIAEVQRKMKKYFVIAVA
FT                   LLGICLALLVISYKHTFLLSIILTFFFAAFTFLESCLPSWVSKIAPIGSKGTAMGVFSS
FT                   CQFFGIFIGGMIGGITYHHFGIAGVLILCTALSVSWFIISLIMAEPTYLNSKVYRLDKL
FT                   TPNLKVKLDQLLHKQKGIYESIICLEENAIYIKVDKKEFDEKNLLEKINFITANQA"
FT   CDS_pept        295696..296598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoA"
FT                   /locus_tag="FTF0281"
FT                   /product="Cytochrome O ubiquinol oxidase subunit II"
FT                   /EC_number="1.10.3.-"
FT                   /note="Similar to Q87DQ7 Cytochrome O ubiquinol oxidase
FT                   subunit II from Xylella fastidiosa (319 aa). FASTA: opt:
FT                   956 Z-score: 1145.6 E(): 6.4e-56 Smith-Waterman score: 956;
FT                   49.477 identity in 287 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0281"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08297"
FT                   /inference="similar to sequence:UniProtKB:Q87DQ7"
FT                   /protein_id="CAL08297.1"
FT                   /translation="MNWKKYLLILSSVVGVLSLSGCKGGIWNPMGVITAQEKQLLIFAI
FT                   VLMLFVVVPVIILTLWFAWKYRDGANAEYRPTWSHSNKLEIICWGVPFIIILILAIVTW
FT                   KTTHSLSPYKPLESDKKPVEIDVVALNWKWMFIYPEYDIATVNYIEIPKDRPINFKITS
FT                   AAPMNSFFIPELAGQIYAMTGMTTQLHLIATHEGKYRGFSANYTGIGFAEMEFFAKVTD
FT                   QADFDKWVKDVKNGKHQSLTWDYFWSDLFKDSIDNPVAYYSHVDKNLFNDIVMSYMMPN
FT                   YKPGDMACNMSGMHMHHDM"
FT   CDS_pept        296637..298667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoB"
FT                   /locus_tag="FTF0282"
FT                   /product="Cytochrome O ubiquinol oxidase subunit I"
FT                   /EC_number="1.10.3.-"
FT                   /note="Similar to AAO70008 (Q8XG02) Cytochrome o ubiquinol
FT                   oxidase subunit I from Salmonella typhi (663 aa). FASTA:
FT                   opt: 3045 Z-score: 3221.2 E(): 1.6e-171 Smith-Waterman
FT                   score: 3045; 64.361identity in 665 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0282"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08298"
FT                   /inference="similar to sequence:INSDC:AAO70008"
FT                   /protein_id="CAL08298.1"
FT                   /translation="MLEALIGKLNNPHLVFPYLYEPVSQQLIILTMFIGIVVAGVALLG
FT                   GITYFRKWGYLWNEWFTTIDHKKIGTMYTIVALVMMFRGFVDAAMMRTQQALASGDSTG
FT                   YLIPEHFDQIFSAHGVIMIFFVAMPLIFALMNWVIPLQIGARDVAFPYMNSLSFWLFVV
FT                   GAMLINISLLVGDFAHAGWLAYPPFSETTYSPTVGTDYYIWGLQISGIGSLMTGINFFV
FT                   TIIKMRCKGMTLMKMPIFTWASLCSVILVVAAFPVLTVTLGLLTLDRYFGTHFFTVSGG
FT                   GDQMMYVNLIWIWGHPEVYILVLPLFGVFSEVAATFSKKPLFGYTTMVWASIVITILSF
FT                   TVWLHHFFTMGASANVNAFFGIMTMIIAIPTGVKIFNWLFTMYKGRITFATPMMWLIGF
FT                   MIVFSVGGMTGVLLSVPGVDFQMHNSVFLIAHFHNVIIGGVVFGAFSGLTFWFPKIFGF
FT                   KLNERLGKYSLWCWFIGFFVAFMPLYILGTMGMTRRLYHYDAATGYQPLLIVAWVGAMI
FT                   IGLGILLQIIQIFVSIKQRDQNRVGADAWGYGRTLEWGIPSPVPFYNFSHDPVVEKRDA
FT                   YWGHKQKGLNVDNTPVGSAKKYEDIHMPKNTAVGVIIGAFSFVFGFAAVWHIWWLAIVG
FT                   VVGIIGTVLYRSFDYDIDYYVKADQVKEVESRYNQQGELQV"
FT   CDS_pept        298664..299266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoC"
FT                   /locus_tag="FTF0283"
FT                   /product="Cytochrome O ubiquinol oxidase, subunit III"
FT                   /EC_number="1.10.3.-"
FT                   /note="Similar to Q87IH7 Cytochrome o ubiquinol
FT                   oxidase,subunit III from Vibrio parahaemolyticus (200 aa).
FT                   FASTA: opt: 768 Z-score: 931.9 E(): 5.1e-44 Smith-Waterman
FT                   score: 768; 55.276identity in 199 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0283"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08299"
FT                   /inference="similar to sequence:UniProtKB:Q87IH7"
FT                   /protein_id="CAL08299.1"
FT                   /translation="MSTVTAEHNHHHEHHFDGSKNVFGFWIYIMSDCVLFATLFATFAV
FT                   FHKHTFGGPGAQELFSLPYVFVETMLLLISSFTFGLAMLNRNSENINHVIKFLWITFFL
FT                   GLGFIIMEVHEFYELAIEGHTWSSSAFLSSFFTLVGTHGLHVSMGLIWIVSMIFQLKKY
FT                   GMNPMAKTKLTYLSLFWHFLDIVWIFVFSIVYLLGAV"
FT   CDS_pept        299268..299600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoD"
FT                   /locus_tag="FTF0284"
FT                   /product="Cytochrome O ubiquinol oxidase subunit IV"
FT                   /EC_number="1.10.3.-"
FT                   /note="Similar to Q8ZC55 Cytochrome O ubiquinol oxidase
FT                   subunit IV from Yersinia pestis (110 aa). FASTA: opt: 325
FT                   Z-score: 419.7 E(): 1.7e-15 Smith-Waterman score: 325;
FT                   50.505 identity in 99 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0284"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08300"
FT                   /inference="similar to sequence:UniProtKB:Q8ZC55"
FT                   /protein_id="CAL08300.1"
FT                   /translation="MAKEHLYDHDTGAAYGTHKSYIQGFVLSVVITTIAFVLVGFKLLS
FT                   PVALCVTVAVLAVVQLFVQLVFFLHLSTDSKARWNLVSAIFAIIVVVIVVAGTMWIMFD
FT                   LYDMMM"
FT   CDS_pept        299631..300479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoE"
FT                   /locus_tag="FTF0285"
FT                   /product="Protoheme IX farnesyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /note="Similar to CYOE_ECOLI (P18404) Protoheme IX
FT                   farnesyltransferase from Escherichia coli (296 aa). FASTA:
FT                   opt: 828 Z-score: 961.6 E(): 1.1e-45 Smith-Waterman score:
FT                   828; 43.262identity in 282 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0285"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08301"
FT                   /db_xref="GOA:Q14JF9"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JF9"
FT                   /inference="similar to sequence:UniProtKB:CYOE_ECOLI"
FT                   /protein_id="CAL08301.1"
FT                   /translation="MYFKRYLQLAKPGIIFGNLITLTGGFLLATHREIGFEYLPLFVYV
FT                   MIGVALMIAAGCVFNNIYDKDIDSSMTRTQNRPLVTGDISVIQATIYGTILLILSCLVL
FT                   YYLVILLTLWIIIIGFIVYVGIYTVSKRLTIHATVLGGISGAIPPVAGYTAVVNILDYN
FT                   ALALFLILFFWQIPHSYAIAMLYIDDYKKVKLPMLPIVKGIAYTKKIMLFYLALFVVSC
FT                   ALPAVLGSADLFSFIVCMLVALFWMYKSIQSYRTDTDRVFAKTVFKFSIIVITVICLTM
FT                   G"
FT   CDS_pept        complement(300624..301667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxD2"
FT                   /locus_tag="FTF0286c"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="Similar to Q8A014 UDP-3-O-[3-hydroxymyristoyl]
FT                   glucosamine N-acyltransferase from Bacteroides
FT                   thetaiotaomicron (346 aa). FASTA: opt: 687 Z-score: 795.8
FT                   E(): 2e-36 Smith-Waterman score: 687; 33.431 identity in
FT                   341 aa overlap paralog of FTF1571"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0286c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08302"
FT                   /db_xref="GOA:Q14JF8"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR020573"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JF8"
FT                   /inference="similar to sequence:UniProtKB:Q8A014"
FT                   /protein_id="CAL08302.1"
FT                   /translation="MQYTLKQISEHLNAKVINEPSGEVIITGLTYAEQAKENDLTLIDK
FT                   QEHIKLWQNSKATAAIVSKKISKELAQVNDKPLIVVNNADLAMAKILELFSVPYPEQNG
FT                   IHEKAIIDPTAKIGKNVSIGPSAYIGKNVEIGDNTIIYANVCIYNDAKVGTNCIIWPSV
FT                   IIRDRTIIGHFCRLCSNCSIGSDGFGYRPSEDGRTIVRIPHIGNVVIGSFVDIGSNTCI
FT                   NNAKYGSTIIGDYTKIDNLVQIGHNVIIGKGCMICGQAGISGSVTIGDGVIIAGNAGIK
FT                   DHTNIGSDARIGGKAGVMWDVPAGESHMGYPAYKDSELAKQWIAIRKLPETMKKLKAIA
FT                   KSLNIDL"
FT   CDS_pept        complement(301735..302430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0287c"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Q8XIW2 Hypothetical protein CPE2001 from
FT                   Clostridium perfringens (229 aa). FASTA: opt: 806 Z-score:
FT                   994.2 E(): 1.7e-47 Smith-Waterman score: 806; 51.948
FT                   identity in 231 aa overlap ORF ftt0287c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0287c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08303"
FT                   /inference="similar to sequence:UniProtKB:Q8XIW2"
FT                   /protein_id="CAL08303.1"
FT                   /translation="MDRYSKITNVHMYKREIVLLKSRPCAYGKCTFCDYILDNSRNIDE
FT                   INAVNFEVLANVTGEFSILEVINSGNVFELPQATKQRIKEIIKQKNIKLLFVEAHWMYK
FT                   DHLHKIKDIFETDIFIKTGLESFDNDFREKLLNKGFYHDSPAQLSQLFDSVCLLIGVKG
FT                   QTKEIIKRDIEIAKKYFKHTTLNLYVNNTTTIKADEELKSWFLEEYKELFKDPQFEILV
FT                   SNTDFGVGD"
FT   CDS_pept        complement(302430..303281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxY"
FT                   /locus_tag="FTF0288c"
FT                   /product="Pyridoxal/pyridoxine/pyridoxamine kinase"
FT                   /EC_number="2.7.1.35"
FT                   /EC_number="2.7.1.-"
FT                   /note="Similar to Q8D4Q2 Pyridoxal/pyridoxine/pyridoxamine
FT                   kinase from Vibrio vulnificus (290 aa). FASTA: opt: 611
FT                   Z-score: 766.0 E(): 8.9e-35 Smith-Waterman score: 611;
FT                   38.545identity in 275 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0288c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08304"
FT                   /inference="similar to sequence:UniProtKB:Q8D4Q2"
FT                   /protein_id="CAL08304.1"
FT                   /translation="MSLKIPKVLSIQSHVAYGYAGNKAAVFPMQKLGIEVSPIYTVQLS
FT                   NHTQYDFYKGSFFSAEDIQNVIDGMIANGFLAQQNAILSGYIGNLEIAKVIANTVIELK
FT                   KLNSDSLYCCDPVFGDKHDEDENGHIFASADHPNIFLSHLLPLADIITPNLFELSVLSD
FT                   SQICNYDDIITACKKLISKTRNHNQIIIVTSVSFSKDKTGIAIYHHGNFSYLESPKYKV
FT                   QPKVSGSGDITAAMFLSYLLKGKNLDETLKAVTQCLDGIFRTTYQLNTDELALIQAQEY
FT                   IR"
FT   CDS_pept        complement(303288..303722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0289c"
FT                   /product="hypothetical lipoprotein"
FT                   /note="ORF ftt0289c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0289c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08305"
FT                   /protein_id="CAL08305.1"
FT                   /translation="MKKIKLLAAYTLATLTLVSCSNNASLSNDLNSAGDSIVRFVNGTF
FT                   YAEIYNTSLQSVYNATLLALNNSNIYSVKNNTINSKDAEITGTYATDKNFFNKSGQDDF
FT                   AIRLVKGNQDTINLFIKIGKLGDKQASVDLLAKIQTNLGI"
FT   CDS_pept        303868..304824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moxR"
FT                   /locus_tag="FTF0290"
FT                   /product="methanol dehydrogenase regulatory protein"
FT                   /note="Similar to Q87YN6 MoxR protein, putative, from
FT                   Pseudomonas syringae (319 aa). FASTA: opt: 1309 Z-score:
FT                   1518.5 E(): 9.9e-77 Smith-Waterman score: 1309; 61.489
FT                   identity in 309 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0290"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08306"
FT                   /inference="similar to sequence:UniProtKB:Q87YN6"
FT                   /protein_id="CAL08306.1"
FT                   /translation="MSVYNHFQELLEFLNNRVVGQENLNKRLLIALLAGGHLLVEGAPG
FT                   LAKTTAIKTLSESIDCSYHRVQFTPDLLPADLTGTEIYIPQQQSFEFQSGPLFHNLLLA
FT                   DEINRAPVKVQSALLEAMGEKQITVGKKTYPLSNLFMVMATQNPIEQEGTYPLPEAQLD
FT                   RFMLFVKIEYPDPKTEAKILAISRGEALGHKLKHTNIHQETIFKAQKEVLNIQVSQALE
FT                   QYIIELILATRDPTKYNQNIKKWIAFGSSPRGTIALDRAARAHAWLSGNDYVSPSDVHA
FT                   VIYEVLRHRILLTFEADVDGVSSDDVITELLKAVPIP"
FT   CDS_pept        304837..305748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0291"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Q87YN5 Conserved hypothetical protein
FT                   from Pseudomonas syringae (314 aa). FASTA: opt: 561
FT                   Z-score: 693.3 bits: 136.4 E(): 1e-30 Smith-Waterman score:
FT                   561; 30.479 identity in 292 aa overlap ORF ftt0291"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0291"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08307"
FT                   /inference="similar to sequence:UniProtKB:Q87YN5"
FT                   /protein_id="CAL08307.1"
FT                   /translation="MKSYKGVKPDIQELLSYRYQARALKLFANQRVNTTNAGNNISKAK
FT                   GRGMDFDEVRHYQAGDDIRLMHWALTARLGKPYTKVYHEERERSLYFILDQNTTMNFGT
FT                   KECFKSVKAANILALLGFGALDAHDKVGGIIFDDKGYNYYAAKQDKSALVKMFNFVACD
FT                   SKQYQLASDKKLADAIKFLYAKIRSNSVVIVISDFSSFDEQAKQYLKLLSAKNAVINIF
FT                   SYDPIEKELPALDTFYFSDGKRRIALDSASKQQSGIYKNLYQNRYTAIKDFSRKNKTGF
FT                   IEVATNDDLIKTINYGIASYAN"
FT   CDS_pept        305738..306214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0292"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="Similar to Q8D3W9 Conserved hypothetical protein
FT                   from Vibrio vulnificus (156 aa). FASTA: opt: 228 Z-score:
FT                   276.8 E(): 1.5e-07 Smith-Waterman score: 228; 28.481
FT                   identity in 158 aa overlap ORF ftt0292"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0292"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08308"
FT                   /inference="similar to sequence:UniProtKB:Q8D3W9"
FT                   /protein_id="CAL08308.1"
FT                   /translation="MQTNNLLEQLKDIYLPEKVSQWWPLAYGWWLLLTVVILAIIVGLV
FT                   FLHLRRKAKSYKDCIIDDFRETVEKTYQQKPKEVLQDISVYLKRVALQKFPNQPIKTLH
FT                   GQQWLEFLDTKLKQQSFKTTKANMLGNSYKPVELDRVTLNEIMTVAEQWLRRVL"
FT   CDS_pept        306193..307212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0293"
FT                   /product="hypothetical membrane protein"
FT                   /note="Similar to Q88LA6 Von Willebrand factor type A
FT                   domain protein from Pseuodmonas putida (358 aa). FASTA:
FT                   opt: 905 Z-score: 1015.4 E(): 1.1e-48 Smith-Waterman score:
FT                   905; 45.122 identity in 328 aa overlap ORF ftt0293"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0293"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08309"
FT                   /inference="similar to sequence:UniProtKB:Q88LA6"
FT                   /protein_id="CAL08309.1"
FT                   /translation="MVKESSMINIEYPWFFALIILPFLAYLLLPRAKKDKQLALKTPFF
FT                   EELESQIGNAGTRNFKKANYLKYLLGLIWILLIISGSGIQWLGKPVSLPQSGRDLIMAI
FT                   DLSGSMAIQDMKKANGQMESRFDLVMRVANQFIDTRKGDRVGLILFGTRAYLQTPLTFD
FT                   IATVKKMLDDASIALPGPQTAIGDAIGLAVKKLKKYPGDSKALILLTDGENNSGTLQPL
FT                   QAAEIAKQYHIKIYTIGLGGGQMIVETTFGQRLVNTSEDLDTTVLEKIATMTGGKYFRA
FT                   QNSSDLKKVYESIDKLEPIESDKTVVRPVTYLYPWSLGLALILSFIMAIIWLKRRRGY"
FT   CDS_pept        join(307214..308209,308209..308952)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0294"
FT                   /product="TPR (tetratricopeptide repeat) domain protein"
FT                   /note="Similar to Q8ECP1 TPR domain protein from Shewanella
FT                   oneidensis (679 aa). FASTA: opt: 1173 Z-score: 1061.1 E():
FT                   3e-51 Smith-Waterman score: 1179; 32.305 identity in 616 aa
FT                   overlap. Contains a frameshift after aa 332 This protein
FT                   also has a match to Q93EJ8 Hypothetical 27.1 kDa protein
FT                   from Francisella tularensis (231 aa). FASTA: opt: 1485
FT                   Z-score: 1347.0 E(): 3.5e-67 Smith-Waterman score: 1485;
FT                   96.943 identity in 229 aa overlap. This protein was
FT                   originally incorrectly sequenced (Pubmed: 11526142) (direct
FT                   communication with authors). C-terminal contains multiple
FT                   9bp tandem repeats ORF ftt0294"
FT                   /inference="similar to sequence:UniProtKB:Q8ECP1"
FT   CDS_pept        308945..310570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0295"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="Similar to Q8ECP0 Conserved hypothetical protein
FT                   from Shewanella oneidensis (555 aa). FASTA: opt: 529
FT                   Z-score: 628.4 E(): 4.1e-27 Smith-Waterman score: 529;
FT                   24.371 identity in 517 aa overlap ORF ftt0295"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0295"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08311"
FT                   /inference="similar to sequence:UniProtKB:Q8ECP0"
FT                   /protein_id="CAL08311.1"
FT                   /translation="MKTKLFKLISILILSVAIFNLSYANVSASVDRTHLEKGETFELVL
FT                   HLDNFDIQPDLDVLDKDFTVYNTSTSSKTTIVNGQQSSQFEMIVTLMPNKTGKLTIPAI
FT                   KIGNQTTKPINIEVDKELSNKEERNYQDLFAIGSLATDETYVNVPVLYTLRLYYATPIL
FT                   SLQPKAFDIKNSTIKQTNHRKTYQKRINGKMYDVVEESFLIIPNITGTIRIPAIVLEAT
FT                   IPNTFGQLGTRVKYFSTEAKILKVKPIPNDISINDWFPAADVQISDNWSADKNIKEGEL
FT                   LTRTVKIKVKGVLSNDIPKLEFKSSDAFNVYPEKPELQDIEQAGQLTGIATYKIGYMPV
FT                   KQGKATIPAINLKWFDVDNHKSKVASIAAKTFDVQKGNIPSSSFVTNGQPLSSQATQKI
FT                   IKDTFWRDVAIGLFILWLITFVLLIKCKVTKKVAKEVIDKQTNLDQKVSGLKEIKKACN
FT                   KKDNIQLQKAIINWANTHVDKQIFSLLEVAEIFPHLKDILKELNAAIYAVKDFNNYHEL
FT                   LDLIKSTTKVTKTKSSKLVKGLYE"
FT   CDS_pept        310571..311248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcp"
FT                   /locus_tag="FTF0296"
FT                   /product="Pyrrolidone-carboxylate peptidase"
FT                   /EC_number="3.4.19.3"
FT                   /note="Similar to PCP_CLOPE (Q8XKH1)
FT                   Pyrrolidone-carboxylate peptidase from Clostridium
FT                   perfringens (215 aa). FASTA: opt: 710 Z-score: 844.3 E():
FT                   3.9e-39 Smith-Waterman score: 710; 52.020identity in 198 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0296"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08312"
FT                   /inference="similar to sequence:UniProtKB:PCP_CLOPE"
FT                   /protein_id="CAL08312.1"
FT                   /translation="MIMKKILLCIFMFVAFVVSVNAQTILVTGFAPFCGEKINPSWQAV
FT                   KQLPDSIDGAKIIKKQIPVSFKGSVNDLDKLIEKYNPDVIIAVGEAGGRAAVSIERVAI
FT                   NVDDARIADNDNNYQPKNIKISANGENAYFSKLPIYKIQAAIQAQGIPAYISDSAGTYV
FT                   CNHVMYHLLEVLSKKYPNKIAGFIHVPYAPQQVVNKSDMPSMSTDQATQALKIAIQTSI
FT                   TKQ"
FT   CDS_pept        311256..311738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0297"
FT                   /product="hypothetical membrane protein"
FT                   /note="ORF ftt0297"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0297"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08313"
FT                   /protein_id="CAL08313.1"
FT                   /translation="MEKDWKYYLGILLFILSFVPYILVFVIMPFLGLSTSSYLAASSIL
FT                   LISAEAIFLVSVMLLGRAIIDAIKAAIKKVFKSAFTNQKPISYTRHSIGLIMFFASLVY
FT                   PTLLLEMILIFDKINQVGQLNMMLILFSGDIIFIASFFVLGGDFISKLKSLFKYQK"
FT   CDS_pept        311769..312209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holC"
FT                   /locus_tag="FTF0298"
FT                   /product="DNA polymerase III (CHI subunit) protein"
FT                   /EC_number="2.7.7.7"
FT                   /note="Similar to Q8XWQ9 Probable DNA polymerase III (CHI
FT                   subunit) protein from Ralstonia solanacearum (142 aa).
FT                   FASTA: opt: 142 Z-score: 187.9 E(): 0.013 Smith-Waterman
FT                   score: 142; 30.000identity in 120 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0298"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08314"
FT                   /inference="similar to sequence:UniProtKB:Q8XWQ9"
FT                   /protein_id="CAL08314.1"
FT                   /translation="MMKIEFKVLQTQDINQMLEVLITEVVKEYALQKTIAILAPAGIAK
FT                   QLDDKLWQDGQDSFIPHHCAINAREYNQYNNIPILITDNLFITSGYDVLINIMDVAVDP
FT                   QRVKVKELKEFVYQQDSALQASRKKYVYYKKSNLEIITVQDN"
FT   CDS_pept        312341..315100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="valS"
FT                   /locus_tag="FTF0299"
FT                   /product="Valyl-tRNA synthetase"
FT                   /EC_number="6.1.1.9"
FT                   /note="Similar to AAO90342 (Q83DD0) Valyl-tRNA synthetase
FT                   from Coxiella burnetii (920 aa). FASTA: opt: 3470 Z-score:
FT                   4050.7 E(): 0 Smith-Waterman score: 3470; 53.458 identity
FT                   (53.8720ngapped) in 911 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0299"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08315"
FT                   /inference="similar to sequence:INSDC:AAO90342"
FT                   /protein_id="CAL08315.1"
FT                   /translation="MTQEINKNYNPKEIEQANYQNWEASGKFACGNTDSKDTYTIMLPP
FT                   PNVTGTLHMGHGFQMSLMDILIRYNRMSGKDTLWQPGTDHAGIATQMVVERQLNAQGIS
FT                   RHDLGRENFVSKVWEWKELSGGTITSQMRRIGASPDWDRERFTMDKGLSDAVKKCFIKL
FT                   YEDGLAYRGERLVNWDPKLKTAVSDLEVAQVDKQGSLWHFIYPVADSDEKIIIATTRPE
FT                   TMLGDMAVAVHPEDERYTHLVGKMINLPLTDRQIPIIADDYVEKDFGTGCVKITPAHDF
FT                   NDYEMGKRHNLPMLNILTDDATLNTNVPSKYQGLDRFEARKQVVADMEALGLLDKIEPH
FT                   ALKVPTGDRTGEILEPYLTKQWFVKADVLAKPAIEAVEKGDVRFVPDNWKNTYFAWMRD
FT                   IQDWCVSRQLWWGHRIPAWYDEAGNAYVGEDEADVRAKYNLADDIAIKQDEDVFDTWFS
FT                   SALWPFSTLGWPEQTPELAKYYPTSVLVTGFDIIFFWVARMMMFGMYFMNDVPFRDIYI
FT                   TGLIRDSEGQKMSKSKGNVLDPVDLIDGISLDELLKKRTTGLMQPQMKAKIEKATKKEF
FT                   PEGISAYGADAVRFTYAALASTSRDISFDTARVEGYRNFCNKLWNASRFVMMNLDDYKV
FT                   CDNYELGVADKWIWSVLNTATADVHRHLANYRFDLVTNTIYDLVWNNYCDWYVEFAKVA
FT                   LKDDSLSEQQKNGVKYTLTKVLENILALAHPLIPFITESIYQQLKAHLNDAKDTIMDVS
FT                   YPVATQALEAPEAEKAIVWLQNVVTTLRNMRSEVGIKPSLEISLIVKDVADKDREYLAQ
FT                   TEGFIKALARINNIEFNDNPPTSLSQIVEGLELNIPLAGLVDIEAEKARLDKELDKLKD
FT                   EVDRVQKKLSNERFVSNAPEAVVAAEQEKLAKYQELYAKTLEKKEALG"
FT   CDS_pept        315129..315983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0300"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0300"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0300"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08316"
FT                   /protein_id="CAL08316.1"
FT                   /translation="MKLENVLSNLNQVEKNKFINVIDNLIQENNISKQYNQIKQATNNE
FT                   IVALFKESKPYFHRFLLERLSYINPSISILTDILSRDGNSVPRVSWIETLYYKDLERLQ
FT                   QKAKELSIIERDSDSFSEYEEKMHIYYSCLSEAYNNDIRNNQEPKINDDERSILNVLSS
FT                   KLNINNDDKVVIEYMIRPCDKQHSILDYLNELRSLGIIFIKNKEQTIYIADETVEILNE
FT                   IKGKAISDKYLIRVLRSLTDVELSNILKSQNQKIRGIERTNKINNIVHLGLDIRKILSI
FT                   YVQ"
FT   CDS_pept        316056..316925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0301"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0301"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0301"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08317"
FT                   /protein_id="CAL08317.1"
FT                   /translation="MGTTVDARINIIIDSLKNISKIESNILSSAGYDAFLEKINEFFNK
FT                   YKSNDSFFSLIREQFEIEDIEKIDSNKLRQLSITPYDILYIVDNQDVKEIAKYFSLSNR
FT                   GNIRANIIGSFNDATDKLIENYDLLANRDINALSAKGLSLSEAEIGTKFEEATRSMLEQ
FT                   LGLNVDEELKEINTVKDKVDLIISTSDDDVIIGEMKTYKGGGYSSYSSIARQTKSYVKL
FT                   CEQHGKNVTQVLVIAPDFTDDFIEHAELDPDINISILEAQGLYEIYQAYKSKKIQSLVF
FT                   NGFKMAGY"
FT   CDS_pept        317109..317444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0302"
FT                   /product="hypothetical membrane protein"
FT                   /note="ORF ftt0302"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0302"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08318"
FT                   /protein_id="CAL08318.1"
FT                   /translation="MKKVYVLLDYFLKVLFMILFCFVFGVFIGGITVYLLSSKDIYNIL
FT                   QPHGFVWTSIYGAIKISGFGAMIFAVIFALFDTNKKLLVAPMIISIVVLYFIQHLIAAE
FT                   ILYYLSA"
FT   CDS_pept        complement(317441..318598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lldD1"
FT                   /locus_tag="FTF0303c"
FT                   /product="L-lactate dehydrogenase"
FT                   /EC_number="1.1.2.3"
FT                   /note="Similar to Q9JTX1 L-lactate dehydrogenase from
FT                   Neisseria meningitidis (390 aa). FASTA: opt: 1591 Z-score:
FT                   1977.5 E(): 3e-102 Smith-Waterman score: 1591; 60.789
FT                   identity in 380 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0303c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08319"
FT                   /inference="similar to sequence:UniProtKB:Q9JTX1"
FT                   /protein_id="CAL08319.1"
FT                   /translation="MKSNLTKITSLDDMRKVYHRRVPKMFVDYCEAGSWQQQTLKYNQQ
FT                   DFGNYLFRQKVLTDIQNRSLKTKILGQEYKMPLVFAPIGLLGMQHADGEIHAARAAEKF
FT                   GIPFTLSTMSICSTEEVAKHTTKPFWFQLYMMKDRKFMANLIASAKHAGCSALVLTADL
FT                   QMLGDRHADIKNGLTVPPKPTLKNLINLSTKVPWCLNMLKTSNRTFGNIVNHAANKGGF
FT                   ASLGKWTNEQFDLSLNWHDVEWVQKQWNGRMIIKGIMDTQDAIMAQNTGADAIVVSNHG
FT                   GRQLDGAPSSISVLEEIIDAVDRKLEVLIDSGIRTGQDLLKAKALGATAGLIGRPMVYG
FT                   LGAYGEQGAYRVLEIFYQEMDKTMAFCGHTNINNVDKSILIKRNT"
FT   CDS_pept        complement(318625..319278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nfnB"
FT                   /locus_tag="FTF0304c"
FT                   /product="Oxygen-insensitive NAD(P)H nitroreductase"
FT                   /EC_number="1.5.1.34"
FT                   /note="Similar to Q87FT7 Oxygen-insensitive NAD(P)H
FT                   nitroreductase from Vibrio parahaemolyticus (217 aa).
FT                   FASTA: opt: 753 Z-score: 968.9 E(): 4.5e-46 Smith-Waterman
FT                   score: 753; 51.152 identity in 217 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0304c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08320"
FT                   /inference="similar to sequence:UniProtKB:Q87FT7"
FT                   /protein_id="CAL08320.1"
FT                   /translation="MNIVDYAKSRYTTKAYDPTKKLSNEQIQQIKDILRFTPSSVNSQP
FT                   WHFILATSDQAKAKIAKAAENIHPKNVTNIKDCALVIVFCLKTDIDDEYLELLLNQERK
FT                   DGRFPTSEFENMQRDVRRKFALAYKDKPQELQIWTEKQLYIALGNILLGLSALEINATP
FT                   MEGIEPHIIDTEFNLAEKGLKTSVIVTAGYSSEDDFNAKLPKSRLPEEKIFTEV"
FT   CDS_pept        319418..319795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0305"
FT                   /product="MutT/nudix family protein"
FT                   /EC_number="3.6.1.-"
FT                   /note="Similar to Q88NZ1 MutT/nudix family protein from
FT                   Pseuodomonas putida (137 aa). FASTA: opt: 224 Z-score:
FT                   293.2 E(): 1.8e-08 Smith-Waterman score: 224; 34.545
FT                   identity in 110 aa overlap ORF ftt0305"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0305"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08321"
FT                   /inference="similar to sequence:UniProtKB:Q88NZ1"
FT                   /protein_id="CAL08321.1"
FT                   /translation="MIKTSALVCVRDNKILLVRVRDNTVWYFPGGKIDAGESPLQAIIR
FT                   ELNEELNIQMQQTELDYLGEVVTDNHDRTDIVSVHCYAGEITQRIIPAAEISAIKWFDL
FT                   DDTKFMALAVIESIARWFKNP"
FT   CDS_pept        319968..321359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fumC"
FT                   /locus_tag="FTF0306"
FT                   /product="fumarate hydratase, Class II"
FT                   /EC_number="4.2.1.2"
FT                   /note="Similar to Q89XM2 Fumarate hydratase from
FT                   Bradyrhizobium japonicum (554 aa). FASTA: opt: 1943
FT                   Z-score: 2386.7 E(): 4.7e-125 Smith-Waterman score: 1943;
FT                   64.551 identity in 457 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0306"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08322"
FT                   /inference="similar to sequence:UniProtKB:Q89XM2"
FT                   /protein_id="CAL08322.1"
FT                   /translation="MRRVETDSTGQIEVDNDKYWGAQTQRSIEHFSIGSDLMPIEVIKA
FT                   LAIIKKAAAITNHQLGILARTKKEIIIKVADEIIAGELDEHFPLRVLMTGSGTQSNMNV
FT                   NEVISNRAIELLGGKKGSKNPIHPNDDVNMSQSSNDTFPSAMYIATALEINNRLLPALE
FT                   YMQQQLADKAKQWDDIVKIGRTHMQDAVPLTLGQEFSGYAALLENNIQRIKDTLKYVYQ
FT                   LALGGTAVGTGLNAPDGFAEITAKYIATITSLAFVSATNKFEVQGSHDALVAVMGQLKT
FT                   LANSLFKIANDIRLLSCGPRAGFHELLIPENEPGSSIMPGKVNPTQCEAMAMVAAQVIG
FT                   YDVAVGIGGSAGYLEMNVYKPLIIFNIIQSIKIISDSCVNFTKYLLEGMKPNHDKIEFY
FT                   LKNSLMLVTALSPVIGYDKAAKLAHYAEQKNISLAEANQELKFLSKEEFDKVVDPYKMT
FT                   KGGIL"
FT   CDS_pept        321489..322895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="FTF0307"
FT                   /product="Glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /note="Similar to SYE_HAEIN (P43818) Glutamyl-tRNA
FT                   synthetase from Haemophilus influenzae (480 aa). FASTA:
FT                   opt: 1866 Z-score: 2212.2 E(): 2.5e-115 Smith-Waterman
FT                   score: 1866; 59.052 identity in 464 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0307"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08323"
FT                   /db_xref="GOA:Q14JD8"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JD8"
FT                   /inference="similar to sequence:UniProtKB:SYE_HAEIN"
FT                   /protein_id="CAL08323.1"
FT                   /translation="MITTRFAPSPTGFLHVGGVRTALFSWLYAKNNNGKFILRIEDTDL
FT                   ERSTQEAVDAILDGMSWLGLKNDGEIYYQTKRFDRYKEVIQELIADGKAYYCSCSKERL
FT                   EELREYQQANNLKTGYDGKCRDANYIPQQGESYVVRFKNPQDGVVSWDDAVKGRISISN
FT                   HELDDMIIQRADGSPTYNFCVVVDDIDMAITHIIRGDDHVNNTPKQINIYKALNANVPI
FT                   FAHVPMILGPDGAKLSKRHGAVNVMQYREDGYLPQAILNYLVRLGWSHGDQEIFSIEEM
FT                   IKAFNLEHINASPSRFDFEKLKWLNKHYIKESKFDDIQTEVEYHFAKTGLDISNGPDLK
FT                   ELVAVMAEKVDTLVELAEKSSYFYSDDISYDENAVKKHIKASTGEIFVKLLENFEALDA
FT                   QQWQDPDVLHNIVSTTAEQCQVGMGKVGMPLRVAITGSGQSPDIGITLKLLGKNKVVAR
FT                   LTKALEELCK"
FT   CDS_pept        322886..323863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0308"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0308"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0308"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08324"
FT                   /protein_id="CAL08324.1"
FT                   /translation="MQVMKIRKLSLIMSVLLFATAIYANNHFGNNLAGCGLNFDPINLQ
FT                   DTANWKDKLIKNDDQSKLKTIHKSIQFNTTKRNYVISPLDIQLADSLPAVGKWMMVNTS
FT                   SYNKPNLPQEIAATWVYWRGAKDFVINGVAQPQSYTVEPINAVFVLEGFLTAKEANNYL
FT                   INLFAQLGYSNTDSINHSGGYGVYFDGKLYPQLLGTPTNTNDVNVALTFEKDIADFADH
FT                   FRLMGPYILHQNDTKKFIYAISISRESLWFKSSKVNCGNLYISFRQAENTLITSVINEL
FT                   PTVKIYSASLDNYIEADSNFDTSTTGDHTRDSSFVSVFIVNKNN"
FT   repeat_region   complement(323861..323879)
FT                   /note="ISFtu2 19bp terminal inverted repeat"
FT   CDS_pept        complement(323887..324630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="isftu2"
FT                   /locus_tag="FTF0309c"
FT                   /product="Transposase"
FT                   /note="ISFtu2. Transposase, member of the IS5 family.
FT                   Identical to Q8GM03 putative transposase from Francisella
FT                   tularensis (247 aa)."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0309c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08325"
FT                   /protein_id="CAL08325.1"
FT                   /translation="MNYHIKEVFWSIILSFLKSQKGIHTNDEAKLRLFIEAVFYVLRTG
FT                   CQWRMLPFYYGKYRSIHKRFKDWCDKDIFSRLFKSVQNPDLQEVMLDSTIARAHACATG
FT                   YDKDDNQAIGRSVGRITTKIHAMTDALGNPIEILLSEDKTHDSKVAIDLLKNVYNTKVI
FT                   ADRAYHSNEIRQHIQGISSEAVIPCKSNTLNHIPFDSHVYKERHLIENFFSKIKHFRRV
FT                   FSRFDKTILAYIGMIKLACTFIWLR"
FT   repeat_region   complement(324707..324725)
FT                   /note="ISFtu2 19bp terminal inverted repeat. Substitution
FT                   at position 1 of a T with a C"
FT   CDS_pept        324926..326380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0310"
FT                   /product="amino acid permease"
FT                   /note="Similar to Q8XT33 Probable amino-acid permease
FT                   transmembrane protein from Ralstonia solanacearum (543 aa).
FT                   FASTA: opt: 999 Z-score: 1146.0 E(): 5.5e-5 Smith-Waterman
FT                   score: 999; 34.924 identity in 461 aa overlap ORF ftt0310"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0310"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08326"
FT                   /inference="similar to sequence:UniProtKB:Q8XT33"
FT                   /protein_id="CAL08326.1"
FT                   /translation="MFAAYYASKQAGSASVISWLIGAGMVLILSLLLGEVASFRPVRGL
FT                   FGRLLTISHNPDMGFVVAISNWVGLLLTIPSEAQATIQYLSTAYPKIEPYIFTNHNLTY
FT                   LGILCVVVLIFFYGLINYWGVKTLTKFTNFMTIFKVGVPVLIAIVLFYTSYNSHNFVAY
FT                   HNSFNPYGYGAVFSAVVTCGIFYSFYGFGTIATFCSEIKNPKRNIPLALTGCILICLIV
FT                   YLMLQVAFIGALPSSFLAHGWHQLNFTSPLAQLMLLLNLNVFAICLYIDAAISPSGTAT
FT                   VYAGSAGRIFTGMAQDKQMPAFFAKMNEEFNLSRRLLIFGLLICIAIVLFFRSWQQLMI
FT                   VVAVFQLLTCVAIPIAYVKLNKEMKKTSDIFHVPCGRILSGFVYLLVSYLIIQSGLKAV
FT                   LFSLIIHLILFAVYALSYYRSAKGIKKAFASSWSIFFYMILTVIGAYFQGVNELDSISS
FT                   VLVFFIVMLICYCFLLRQKTFANSIL"
FT   tRNA            326575..326650
FT                   /gene="tRNA-Glu (TTC)"
FT                   /product="transfer RNA-Glu"
FT   CDS_pept        complement(326712..327635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0311c"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Q9KKV6 Hypothetical protein VCA0994 from
FT                   Vibrio cholerae (326 aa). FASTA: opt: 558 Z-score: 686.8
FT                   E(): 2.3e-30 Smith-Waterman score: 558; 31.949 identity in
FT                   313 aa overlap ORF ftt0311c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0311c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08327"
FT                   /inference="similar to sequence:UniProtKB:Q9KKV6"
FT                   /protein_id="CAL08327.1"
FT                   /translation="MSAQVSDAVLMVDPEYFALNTQKTDSDDAFRRAVRLNEKAIQALA
FT                   RDEFYEMVNYIRSKDIKVIIMKSPKNAADAVFTNDWLSTHIINGQGYIFIYPMYSESRR
FT                   CEIQPQQLLQTLESELKIKYKLKDFRGDHSEALEGNAALVFDNSTKKVFLSKSPRADEK
FT                   LAKKVADELGYELITFTSYDHKDRPIYQTTQMLSIGEKLIFVCLESIKCDKDRDIVAQA
FT                   LHQSNKTIVDVSQKQVHLRCCNSLEVKNKQGKSYLILSTTADMGFTDQQKQLIDLHCTR
FT                   LLCHVKTIEDVGGGTARCMVAEILKP"
FT   CDS_pept        complement(327717..328217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folA"
FT                   /locus_tag="FTF0312c"
FT                   /product="dihydrofolate reductase type I"
FT                   /EC_number="1.5.1.3"
FT                   /note="Similar to Q9K7B6 Dihydrofolate reductase from
FT                   Bacillus halodurans (163 aa). FASTA: opt: 465 Z-score:
FT                   598.3 E(): 2e-25 Smith-Waterman score: 465; 41.566 identity
FT                   in 166 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0312c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08328"
FT                   /inference="similar to sequence:UniProtKB:Q9K7B6"
FT                   /protein_id="CAL08328.1"
FT                   /translation="MISLIVAYDKNFGIGKENTLAWKLSEDLKNFKKITENNYIVMGRK
FT                   TFESIGRPLPNRKNIILTRDKDYKQDKCLIINSTQDILNFAESKPHYEIFIIGGAQIYK
FT                   EFLKYADRLYITEVDAEMTDLDAFFPQWDKSKYKRIGHKQFKKDDKNEFDFTFSVFEKN
FT                   KNL"
FT   CDS_pept        328449..329168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="FTF0313"
FT                   /product="30S ribosomal protein S2"
FT                   /note="Similar to RS2_SPIPL (P34831) 30S ribosomal protein
FT                   S2 from Spirulina platensis (251 aa). FASTA: opt: 953
FT                   Z-score: 1141.6 E(): 1.1e-55 Smith-Waterman score: 953;
FT                   61.364 identity in 220 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0313"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08329"
FT                   /db_xref="GOA:Q14JD2"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JD2"
FT                   /inference="similar to sequence:UniProtKB:RS2_SPIPL"
FT                   /protein_id="CAL08329.1"
FT                   /translation="MSLMKEMLSVGVHFGHKKAFWNPQMKEYIFGINHGVHIINLEKTV
FT                   PLFQDAVNFVGKTVANGGKILFVGTKRQAQDIVEAEAKRCGMSFVSHRWLGGMLTNYKT
FT                   VRQSIKRLAQLEKMREDGTLESLTKKEMLQNIRTIEKLEKVLGGIKEMGGLPDAIVVID
FT                   SNKEHIAIQEAQKLGIKVVAIVDTNSNPEGIDYIIPGNDDAVKSISFYMKKFADAVIDA
FT                   QGLDRAVEAKADEAAQA"
FT   CDS_pept        329190..330059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="FTF0314"
FT                   /product="protein chain elongation factor EF-Ts"
FT                   /note="Similar to EFTS_YERPE (Q8ZH65) Elongation factor Ts
FT                   (EF-Ts) from Yersinia pestis (285 aa). FASTA: opt: 983
FT                   Z-score: 1096.3 E(): 3.6e-53 Smith-Waterman score: 983;
FT                   57.241 identity in 290 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0314"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08330"
FT                   /db_xref="GOA:Q14JD1"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JD1"
FT                   /inference="similar to sequence:UniProtKB:EFTS_YERPE"
FT                   /protein_id="CAL08330.1"
FT                   /translation="MSNISAKLVKELRERTGAGMMECKKALVAAAGDIEKAAEEMRISG
FT                   QAKADKKASRVAAEGVIEVYAADGRAILLEINSETDFVARDETFKKFAQEAVKAAHAAN
FT                   AKTIEEVLAAKTSNGETVEEVRKSLIAKIGENIQVRRVKTVEAETLGAYIHGSKIGVVA
FT                   ALEGGDEDLAKDVAMHVAAANPMVVSGDQVPADVVAKEKEIFTAQAKESGKPAEIIEKM
FT                   IVGRIRKFLDEVALLGQDFVKDPAIKVEKLVKDKGAKVVNFIRLDVGEGIEKKEEDFAA
FT                   EVMSQIKG"
FT   CDS_pept        330063..330812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="FTF0315"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.-"
FT                   /note="Similar to PYRH_RALSO (Q8XZI9) Uridylate kinase
FT                   (Uridine monophosphate kinase) from Ralstonia solanacearum
FT                   (236 aa). FASTA: opt: 684 Z-score: 830.3 E(): 2.4e-38
FT                   Smith-Waterman score: 684; 46.809 identity in 235 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0315"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08331"
FT                   /db_xref="GOA:Q14JD0"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JD0"
FT                   /inference="similar to sequence:UniProtKB:PYRH_RALSO"
FT                   /protein_id="CAL08331.1"
FT                   /translation="MSNDSSECSQKLPKLKRILLKLSGESLSADQGFGINVESAQPIIN
FT                   QIKTLTNFGVELALVVGGGNILRGGRANFGNKIRRATADSMGMIATMINALALRDMLIS
FT                   EGVDAEVFSAKGVDGLLKVASAHEFNQELAKGRVLIFAGGTGNPFVTTDTTASLRAVEI
FT                   GADALLKATTVNGVYDKDPNKYSDAKRFDKVTFSEVVSKELNVMDLGAFTQCRDFGIPI
FT                   YVFDLTQPNALVDAVLDSKYGTWVTLD"
FT   CDS_pept        330841..331398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /locus_tag="FTF0316"
FT                   /product="ribosome recycling factor"
FT                   /note="Similar to RRF_NEIMA (Q9JR52) Ribosome recycling
FT                   factor (Ribosome releasing factor) from Neisseria
FT                   meningitidis (185 aa). FASTA: opt: 739 Z-score: 855.6 E():
FT                   9.1e-40 Smith-Waterman score: 739; 57.838 identity in 185
FT                   aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0316"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08332"
FT                   /db_xref="GOA:Q14JC9"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JC9"
FT                   /inference="similar to sequence:UniProtKB:RRF_NEIMA"
FT                   /protein_id="CAL08332.1"
FT                   /translation="MINDILKDAENRMKKSLEVLADDLAKIRTGRAQPDLLAHVTIDYY
FT                   GVETPITQAANITVLDARTLGITPWEKGLSSKIEKAILTSDLGLNPTNLGDSLRVPMPA
FT                   LNEERRKELVKLVKSETEAGRVSIRNIRRDANGDIKELLKEKEITEDQAKKAEDDIQKI
FT                   TDKMIAQADALAAKKEQDLMAV"
FT   CDS_pept        331431..332204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppS"
FT                   /locus_tag="FTF0317"
FT                   /product="undecaprenyl pyrophosphate synthetase"
FT                   /EC_number="2.5.1.31"
FT                   /note="Similar to Q9KPV6 Undecaprenyl diphosphate synthase
FT                   from Vibrio cholerae (256 aa). FASTA: opt: 842 Z-score:
FT                   1070.2 E(): 1e-51 Smith-Waterman score: 842; 49.398
FT                   identity in 249 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0317"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08333"
FT                   /inference="similar to sequence:UniProtKB:Q9KPV6"
FT                   /protein_id="CAL08333.1"
FT                   /translation="MFILSYHLANLIFFIIFMTSAKENILRHLAIIMDGNGRWAKSRLK
FT                   PRIFGHRNSVSSVDATIEYCVENNIEMLTLFAFGRDNWLRPAQEVSDLMDLFYKTLKDK
FT                   TPKLHDNNIVVTVVGDRSRLSNKLIGMIEYSESLTKSNTGLKLRLAVDYAGRWDIVEAT
FT                   RAIAREVDIGKLSVDEIDQNSFAKYLVGGNMPVDLLIRTSGEVRLSDFMLWQLAYAEMY
FT                   FTDIMWPDFSKQELTRAVEYFYSRQRRFGKSGEQI"
FT   CDS_pept        332218..333012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA"
FT                   /locus_tag="FTF0318"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /EC_number="2.7.7.41"
FT                   /note="Similar to Q88MH5 Phosphatidate cytidylyltransferase
FT                   from Pseudomonas putida (271 aa). FASTA: 398 opt: 534
FT                   Z-score: 626.6 E(): 5.2e-27 Smith-Waterman score: 536;
FT                   35.926 identity in 270 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0318"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08334"
FT                   /inference="similar to sequence:UniProtKB:Q88MH5"
FT                   /protein_id="CAL08334.1"
FT                   /translation="MKERIVTGIVLVAVVFGFLFFASDYLFGVGVFLVTLVSAYEWLKL
FT                   AKIDQQSIFKNLIIFTIVVFVVAQFFIYLQYIFPIFWLYAIYKLASYERQKIDAIATNE
FT                   MLVMGVFTISPFAASLYILHTNGVAWIFMFILVIAAADSGAYFTGKAIGKRKMLPRLSP
FT                   NKTIEGLLGGLICAVIVAVIFLVYMNLSFGQYIYMVIVSALIALLSVVGDVFESMMKRI
FT                   AGVKDSGNILPGHGGVLDRLDGYMPTLPIFVLLGYLAGVFVF"
FT   CDS_pept        333022..333468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="FTF0319"
FT                   /product="dUTP pyrophosphatase (Deoxyuridine
FT                   5'-triphosphate nucleotidohydrolase)"
FT                   /EC_number="3.6.1.23"
FT                   /note="Similar to Q82UM1 DUTPase from Nitrosomonas europaea
FT                   (149 aa). FASTA: opt: 576 Z-score: 790.2 E(): 4e-36
FT                   Smith-Waterman score: 576; 58.219 identity in 146 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0319"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08335"
FT                   /db_xref="GOA:Q14JC6"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JC6"
FT                   /inference="similar to sequence:UniProtKB:Q82UM1"
FT                   /protein_id="CAL08335.1"
FT                   /translation="MKVELKILNKELIKELPGYATEGSAAIDLRACISESIYLKSGECK
FT                   LVATGIAINIANPNYAAMILPRSGLGHKKGLVLGNGTGLIDSDYQGELMVSCFNRSQET
FT                   IEIEPLMRFAQLVIVPVVQANFEIVEDFSQQSVRATGGFGHTGV"
FT   CDS_pept        333472..334068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgsA"
FT                   /locus_tag="FTF0320"
FT                   /product="phosphatidylglycerophosphate synthetase"
FT                   /EC_number="2.7.8.5"
FT                   /note="Similar to Q8XFD0 Phosphotidylglycerophosphate
FT                   synthetase from Salmonella typhi (182 aa). FASTA: opt: 575
FT                   Z-score: 728.4 E(): 1.1e-32 Smith-Waterman score: 618;
FT                   50.000identity in 188 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0320"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08336"
FT                   /inference="similar to sequence:UniProtKB:Q8XFD0"
FT                   /protein_id="CAL08336.1"
FT                   /translation="MFFNIPNILTFGRLILIPFIVICYYFEFPHHHGITATLFLLGAAT
FT                   DWLDGYLARKWKQTSKLGAFLDPVADKLIVATALCLFIEMYPYWWATIPAIVMICREIV
FT                   VSALREWMAELGQRSVVKVGVWGKVKTAAQMAALFIFLIKPAIDFRHSIDYTSFNTWFI
FT                   FLGFLMLYVAVILTIYSMCNYLYVAFKSVFGASDN"
FT   CDS_pept        334203..334577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="FTF0321"
FT                   /product="30S ribosomal protein S12"
FT                   /note="Similar to RS12_VIBVU (Q8DCR0) 30S ribosomal protein
FT                   S12 from Vibrio vulnificus (124 aa). FASTA: opt: 718
FT                   Z-score: 969.7 E(): 4e-46 Smith-Waterman score: 718; 87.097
FT                   identity in 124 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0321"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08337"
FT                   /db_xref="GOA:Q14JC4"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JC4"
FT                   /inference="similar to sequence:UniProtKB:RS12_VIBVU"
FT                   /protein_id="CAL08337.1"
FT                   /translation="MATINQLVNNPRKRSVVKSKVPALKACPQRRGVCTRVYTTTPKKP
FT                   NSALRKVARVRLTSRFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDT
FT                   SGVNNRKHGRSKYGTKRPKS"
FT   CDS_pept        334616..335089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="FTF0322"
FT                   /product="30S ribosomal protein S7"
FT                   /note="Similar to Q88QN9 Ribosomal protein S7 from
FT                   Pseudomonas putida (156 aa). FASTA: opt: 710 Z-score: 898.4
FT                   E(): 3.8e-42 Smith-Waterman score: 710; 65.605 identity in
FT                   157 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0322"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08338"
FT                   /db_xref="GOA:Q14JC3"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JC3"
FT                   /inference="similar to sequence:UniProtKB:Q88QN9"
FT                   /protein_id="CAL08338.1"
FT                   /translation="MSRRNRAPKRDILPDPKYKSQVVAKFVNHIMLSGKKSIAEKIVYG
FT                   AFDKIKAKDASANEVEVFEKALESVSPMVEVKSRRVGGATYQVPVEVRPERRQTLGMRW
FT                   IIDAARKRKENTMGDRVAAEILEAVEGRGAAVKKREDTHKMAEANKAFAHFRW"
FT   CDS_pept        335104..337218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="FTF0323"
FT                   /product="elongation factor G (EF-G)"
FT                   /note="Similar to many EFG_VIBPA (Q87L45) Elongation factor
FT                   G (EF-G) from Vibrio parahaemolyticus (699 aa). FASTA: 2731
FT                   opt: 3547 Z-score: 4015.6 E(): 8.9e-216 Smith-Waterman
FT                   score: 3547; 76.714 identity in 700 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0323"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08339"
FT                   /db_xref="GOA:Q14JC2"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JC2"
FT                   /inference="similar to sequence:UniProtKB:EFG_VIBPA"
FT                   /protein_id="CAL08339.1"
FT                   /translation="MPRNTALEKYRNIGICAHVDAGKTTTTERILFYTGLSHKIGEVHD
FT                   GAATMDWMEQEQERGITITSAATTTFWSGMDQQFEKHRINIIDTPGHVDFTIEVERSLR
FT                   VLDGAVVVFCGSSGVEPQSETVWRQANKYGVPRIVFVNKMDRSGADFERVCAQIKTRLK
FT                   ANVVPVQLNIGAEEDFKGVIDLIRMKAIMWNEEDMGLTYELVDIPADLQDRAEELRMEM
FT                   IEAAAEASEELMEKYLEGGELSEDEIHQGLRARVLNNEIVLAFCGSAFKNKGVQAVLDG
FT                   VVRYLPAPNQVPAIKCETEDGEPASRPSSDDAPFAALAFKLATDPFVGNLTFIRVYSGV
FT                   LKSGDAVYNPVKGKKERVGRIVQMHANKRDEIKEVRAGDIAACIGLKDVTTGDTLCDQE
FT                   DVVILEKMDFPEPVISVAVEPKSKADQEKMSIALGKLAAEDPSFRVKTDEESGQTIISG
FT                   MGELHLDIVVDRMRREFKVEANVGNPQVAYRETIRSKVEQEAKFVRQSGGRGQYGHVFV
FT                   RFEPLDEVDENGEAKVFKFVDEVVGGVVPKEYIGSVAKGIEEQLNNGVLAGYPMIGVKA
FT                   TLYDGSYHDVDSSEMAFKIAGSMALKEGAKKANACILEPIMKVEVVTPEDYLGDVMGDL
FT                   NRRRGIIEGMDENPSGRVINALVPLAEMFGYATNVRSISQGRASFSMEFKKYAEVPNNI
FT                   ADEIIKSHNS"
FT   CDS_pept        337239..337556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="FTF0324"
FT                   /product="30S ribosomal protein S10"
FT                   /note="Similar to RS10_VIBPA (Q87T14) 30S ribosomal protein
FT                   S10 from Vibrio parahaemolyticus (103 aa). FASTA: opt: 587
FT                   Z-score: 781.4 E(): 1.2e-35 Smith-Waterman score: 587;
FT                   88.235 identity in 102 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0324"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08340"
FT                   /db_xref="GOA:Q14JC1"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JC1"
FT                   /inference="similar to sequence:UniProtKB:RS10_VIBPA"
FT                   /protein_id="CAL08340.1"
FT                   /translation="MAINNQRIRIRLKAFDHKLIDISTQEIVDTAKKTGAQVKGPIPLP
FT                   VRKERFTILISPHVNKKARDQYEIRTHKRLIDIVEPTDKTVDALMKLDLASGVDVQISL
FT                   S"
FT   CDS_pept        337660..338295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="FTF0325"
FT                   /product="50S ribosomal protein L3"
FT                   /note="Similar to Q9CL32 RpL3 from Pasteurella multocida
FT                   (209 aa). FASTA: 972 opt: 974 Z-score: 1212.0 E(): 1.3e-59
FT                   Smith-Waterman score: 974; 71.154identity in 208 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0325"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08341"
FT                   /db_xref="GOA:Q14JC0"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JC0"
FT                   /inference="similar to sequence:UniProtKB:Q9CL32"
FT                   /protein_id="CAL08341.1"
FT                   /translation="MSLGLVGRKCGMTRIFTEDGVSIPVTVVQVEPNKVTQVKTVEKDG
FT                   YNAIQVTTGFKKRSNVNKPMAGHYAKASVEPGRGLWEFTVDAAAEYQVGSSFDATMFEA
FT                   GQKVDVRGVSKGKGFQGGVKRHNFATQDATHGNSLSHRVHGSTGQNQTPGRVFKNKKMA
FT                   GHLGNENVTIQSLEVVRVDAENGLLLLKGGIPGSVGGDIIVTPAVKSW"
FT   CDS_pept        338325..338948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="FTF0326"
FT                   /product="50S ribosomal protein L4"
FT                   /note="Similar to Q9KNY5 Ribosomal protein L4 from Vibrio
FT                   cholerae (200 aa). FASTA: 600 opt: 770 Z-score: 947.8 E():
FT                   6.7e-45 Smith-Waterman score: 770; 59.709 identity in 206
FT                   aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0326"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08342"
FT                   /db_xref="GOA:Q14JB9"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JB9"
FT                   /inference="similar to sequence:UniProtKB:Q9KNY5"
FT                   /protein_id="CAL08342.1"
FT                   /translation="MDLNIKSLAGQEAGSLGVAEGVFAADYNEALIHQVVVAYMAGARQ
FT                   GTKAQKTRSEVSGGGAKPWRQKGTGRARAGTIRSPIFRKGGVTFAAKPKSYKQKVNRKM
FT                   YSGAVKSILSELLRSGRMTIVEELKLETPKTREFKSVIDSLGVKDVLFVVGVEEFSENL
FT                   YLSSRNLKNVAVCDSVEINPVSLVCFENVVLTKKAIKEIEEKLV"
FT   CDS_pept        338945..339244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="FTF0327"
FT                   /product="50S ribosomal protein L23"
FT                   /note="Similar to RL23_YERPE (P11254) 50S ribosomal protein
FT                   L23 from Yersinia pestis (100 aa). FASTA: opt: 308 Z-score:
FT                   433.3 E(): 3e-16 Smith-Waterman score: 308; 50.515 identity
FT                   in 97 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0327"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08343"
FT                   /db_xref="GOA:Q14JB8"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JB8"
FT                   /inference="similar to sequence:UniProtKB:RL23_YERPE"
FT                   /protein_id="CAL08343.1"
FT                   /translation="MSSQEKLLKTVIRPHVSDKTYGLSDANSTIVFEVARFANKQDVKN
FT                   AVEKLFEVKVESVNILNVKGKARRFGRVEGGTKAWKKAYVKLAEGHDINFVGAE"
FT   CDS_pept        339266..340090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="FTF0328"
FT                   /product="50S ribosomal protein L2"
FT                   /note="Similar to Q8EK65 Ribosomal protein L2 from
FT                   Shewanella oneidensis (274 aa). FASTA: opt: 1376 Z-score:
FT                   1684.6 E(): 6.1e-86 Smith-Waterman score: 1376; 70.221
FT                   identity in 272 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0328"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08344"
FT                   /db_xref="GOA:Q14JB7"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JB7"
FT                   /inference="similar to sequence:UniProtKB:Q8EK65"
FT                   /protein_id="CAL08344.1"
FT                   /translation="MIEIKKAKPTSPGRRHVVSVKNTELHTGKPFKGLVEVKKSKAGRN
FT                   NTGRITVRHQGGGHKQHYRIVDFKRNKDDITAKVERIEYDPNRSANIALVLYADGERRY
FT                   IVAPKGLKKDMSVISGEKVDVAVGNCMPLRNIPLGTVIHNIEMKPKKGAQMIRSAGTFA
FT                   QLVGKDNAYAIIRLRSGEMRRVLLDCRAVIGVVSNSEHNLKSLGKAGAKRWRGIRPTVR
FT                   GVAMNPVDHPHGGGEGRTSGGRHPVTPWGIPTKGYKTRRNKRSNKLIVQKRK"
FT   CDS_pept        340105..340383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="FTF0329"
FT                   /product="30S ribosomal protein S19"
FT                   /note="Similar to RS19_VIBCH (Q9KNY8) 30S ribosomal protein
FT                   S19 from Vibrio cholerae (92 aa). FASTA: opt: 511 Z-score:
FT                   724.8 E(): 1.8e-32 Smith-Waterman score: 511; 81.522
FT                   identity in 92 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0329"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08345"
FT                   /db_xref="GOA:Q14JB6"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JB6"
FT                   /inference="similar to sequence:UniProtKB:RS19_VIBCH"
FT                   /protein_id="CAL08345.1"
FT                   /translation="MPRSLKKGPFVDHHLLKKVFEAQESNSKKPIKTWSRRSMIVPDMI
FT                   GLTIAVHNGQQHVPVLMTEEMVGHKLGEFVVTRNYRGHAADKKAKKK"
FT   CDS_pept        340399..340734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="FTF0330"
FT                   /product="50S ribosomal protein L22"
FT                   /note="Similar to RL22_COXBU (O85387) 50S ribosomal protein
FT                   L22 from Coxiella burnetii (115 aa). FASTA: opt: 514
FT                   Z-score: 723.4 E(): 2.1e-32 Smith-Waterman score: 514;
FT                   71.171 identity in 111 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0330"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08346"
FT                   /db_xref="GOA:Q14JB5"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JB5"
FT                   /inference="similar to sequence:UniProtKB:RL22_COXBU"
FT                   /protein_id="CAL08346.1"
FT                   /translation="MEVQAKLKFARISAQKCRLVADQIRGLPVEQAINLLTFSNKKAAV
FT                   LIKGVLNSAVANAEHNDGMDVDSLVVSTIFVDEGPTMKRFEARAKGRGNRILKRTSHIT
FT                   VKVAEKK"
FT   CDS_pept        340749..341417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="FTF0331"
FT                   /product="30S ribosomal protein S3"
FT                   /note="Similar to RS3_PSEAE (Q9HWE1) 30S ribosomal protein
FT                   S3 from Pseudomonas aeruginosa (228 aa). FASTA: opt: 1019
FT                   Z-score: 1207.3 E(): 2.3e-59 Smith-Waterman score: 1019;
FT                   71.296 identity in 216 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0331"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08347"
FT                   /db_xref="GOA:Q14JB4"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JB4"
FT                   /inference="similar to sequence:UniProtKB:RS3_PSEAE"
FT                   /protein_id="CAL08347.1"
FT                   /translation="MGQKVNPNGIRLGYIRDWRSTWYADSSRYATKLNEDIKVREFLHK
FT                   KLAAAAVSKIQIERPAQNAKITIHTARSGIVIGKKGEDVEKLRAEVHKLMGIPVQINIE
FT                   EVRKPEIDAKLVAESVAQQLEKRVMFRRAMKKAMQAAMKSGAKGIKIMVSGRLGGAEIA
FT                   RSEWARDGRVPLQTFRADVDYATAEALTTYGVIGVKVWIYKGEILPGQIAEKKNNKKRS
FT                   "
FT   CDS_pept        341421..341834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="FTF0332"
FT                   /product="50S ribosomal protein L16"
FT                   /note="Similar to Q9HWE2 50S ribosomal protein L16 from
FT                   Pseudomonas aeruginosa (137 aa). FASTA: opt: 752 Z-score:
FT                   937.5 E(): 2.5e-44 Smith-Waterman score: 752; 78.832
FT                   identity in 137 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0332"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08348"
FT                   /db_xref="GOA:Q14JB3"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JB3"
FT                   /inference="similar to sequence:UniProtKB:Q9HWE2"
FT                   /protein_id="CAL08348.1"
FT                   /translation="MLQPKRTKFRKQQKLRNRGLAHRGNKVSFGEFGLQATSRGRITAR
FT                   QIEAGRRAISRHIKRGGKIWIRIFPDKPITQKPLEVRMGKGKGSVEYWVAQIQPGRVLY
FT                   EITGVKEELAREAFARAAAKMPVQTTFVEKQVM"
FT   CDS_pept        341834..342034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="FTF0333"
FT                   /product="50S ribosomal protein L29"
FT                   /note="Similar to RL29_VIBCH (Q9KNZ2) 50S ribosomal protein
FT                   L29 from Vibrio cholerae (63 aa). FASTA: opt: 190 Z-score:
FT                   279.3 E(): 1.2e-07 Smith-Waterman score: 190; 45.614
FT                   identity in 57 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0333"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08349"
FT                   /db_xref="GOA:Q14JB2"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JB2"
FT                   /inference="similar to sequence:UniProtKB:RL29_VIBCH"
FT                   /protein_id="CAL08349.1"
FT                   /translation="MKRKDTLKDYRGKSIDQLQEAKIELLQQLFSLRMQKGTGQLKKNH
FT                   LFKSAKRDIARINTIISEKNK"
FT   CDS_pept        342047..342298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="FTF0334"
FT                   /product="30S ribosomal protein S17"
FT                   /note="Similar to Q8EK60 Ribosomal protein S17 from
FT                   Shewanella oneidensis (82 aa). FASTA: opt: 353 Z-score:
FT                   506.3 E(): 2.6e-20 Smith-Waterman score: 353; 58.025
FT                   identity in 81 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0334"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08350"
FT                   /db_xref="GOA:Q14JB1"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JB1"
FT                   /inference="similar to sequence:UniProtKB:Q8EK60"
FT                   /protein_id="CAL08350.1"
FT                   /translation="MSDKIRLLEGKVSSVAMDKTVVVRAERYVKHPLYGKFVKKTTKYY
FT                   VHDENNECKEGDVIKFKETRPYSKTKKWCLVDIIHREK"
FT   CDS_pept        342390..342758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="FTF0335"
FT                   /product="50S ribosomal protein L14"
FT                   /note="Similar to Q8EK59 Ribosomal protein L14 from
FT                   Shewanella oneidensis (122 aa). FASTA: opt: 643 Z-score:
FT                   859.5 E(): 5.6e-40 Smith-Waterman score: 643; 82.787
FT                   identity in 122 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0335"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08351"
FT                   /db_xref="GOA:Q14JB0"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JB0"
FT                   /inference="similar to sequence:UniProtKB:Q8EK59"
FT                   /protein_id="CAL08351.1"
FT                   /translation="MIQMQTELQVADNSGAKRVECIKVLGGSHRRYASIGDVIKVTVKE
FT                   ASPRGKAKKGSVYNAVVVRTAKGVRRKDGSKVRFDGNAAVLLNANGQPIGTRIFGPVTR
FT                   ELRTEKFMKIVSLAPEVL"
FT   CDS_pept        342780..343097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="FTF0336"
FT                   /product="50S ribosomal protein L24"
FT                   /note="Similar to Q8EK58 Ribosomal protein L24 from
FT                   Shewanella oneidensis (104 aa). FASTA: opt: 416 Z-score:
FT                   549.0 E(): 1.1e-22 Smith-Waterman score: 416; 62.376
FT                   identity in 101 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0336"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08352"
FT                   /db_xref="GOA:Q14JA9"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JA9"
FT                   /inference="similar to sequence:UniProtKB:Q8EK58"
FT                   /protein_id="CAL08352.1"
FT                   /translation="MNRLKKGDDVIVIAGKDKGRRGVVKSFAKGGSLVLVEGINIVKKH
FT                   IKPNPNRGIEDGVVEKELPVDASNVAIFNPATEKADRVGYKFVDEKKVRYFKSNGELVD
FT                   L"
FT   CDS_pept        343109..343648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="FTF0337"
FT                   /product="50S ribosomal protein L5"
FT                   /note="Similar to Q9HWE7 50S ribosomal protein L5 from
FT                   Pseudomonas aeruginosa (179 aa). FASTA: opt: 878 Z-score:
FT                   1121.2 E(): 1.5e-54 Smith-Waterman score: 878; 70.391
FT                   identity in 179 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0337"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08353"
FT                   /db_xref="GOA:Q14JA8"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JA8"
FT                   /inference="similar to sequence:UniProtKB:Q9HWE7"
FT                   /protein_id="CAL08353.1"
FT                   /translation="MARLKDYYQKELVAKLKTELGLDNIMEVPTIKKITLNMGVGDAAK
FT                   DKKIMTFALNDLTAIAGQKPVVTKSKKSIAGFKIRDGWPIGAKVTLRGDRMYEFLDRLI
FT                   TIAIPRIRDFRGLSAKSFDGRGNYSLGMREQISFPEIDYDKVDSIRGLDISITTTAKND
FT                   DQGRALLKAFGFPFKS"
FT   CDS_pept        343667..343972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="FTF0338"
FT                   /product="30S ribosomal protein S14"
FT                   /note="Similar to Q889V8 Ribosomal protein S14 Pseudomonas
FT                   syringae (101 aa). FASTA: opt: 462 Z-score: 627.5 E():
FT                   4.6e-27 Smith-Waterman score: 462; 68.317 identity in 101
FT                   aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0338"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08354"
FT                   /db_xref="GOA:Q14JA7"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JA7"
FT                   /inference="similar to sequence:UniProtKB:Q889V8"
FT                   /protein_id="CAL08354.1"
FT                   /translation="MAKKSMIQRELKREKLVAKYAQKRAEFKAIILDINSTEEQIWEAQ
FT                   IKLQKLPVNSSASRVQRRCKVTGRPHAVYRKFGLCRNKLREYAMAGDVPGLKKASW"
FT   CDS_pept        343989..344387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="FTF0339"
FT                   /product="30S ribosomal protein S8"
FT                   /note="Similar to RS8_PASMU (Q9CL44) 30S ribosomal protein
FT                   S8 from Pasteurella multocida (130 aa). FASTA: opt: 499
FT                   Z-score: 669.3 E(): 2.2e-29 Smith-Waterman score: 499;
FT                   60.606 identity in 132 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0339"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08355"
FT                   /db_xref="GOA:Q14JA6"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JA6"
FT                   /inference="similar to sequence:UniProtKB:RS8_PASMU"
FT                   /protein_id="CAL08355.1"
FT                   /translation="MSMQDPIADMFTRIRNGLSAEKEFVSVPFSKIKMEIANFLVNEGY
FT                   IKSCSKGTTSMGHPSIEVELKYHAGAPVIEMIKRVSRPSLRIYKSHADLPKVYGGYGVA
FT                   IVSTSKGLVSDRKARDLGVGGEIIGYVA"
FT   CDS_pept        344406..344942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="FTF0340"
FT                   /product="50S ribosomal protein L6"
FT                   /note="Similar to Q9K1I3 50S ribosomal protein L6 from
FT                   Neisseria meningitidis (177 aa). FASTA: opt: 670 Z-score:
FT                   805.6 E(): 5.6e-37 Smith-Waterman score: 670; 56.180
FT                   identity in 178 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0340"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08356"
FT                   /db_xref="GOA:Q14JA5"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JA5"
FT                   /inference="similar to sequence:UniProtKB:Q9K1I3"
FT                   /protein_id="CAL08356.1"
FT                   /translation="MSRIGKKPVVIPSGVTINVAAGNKVEVKGAKATLSKTFSTDVTFS
FT                   VADNVATITPNNNSKNAVAQSGTARAILSNMVEGVSKGFERKLKIIGVGYRAKAQGNEL
FT                   NLTLGFSHPVVYKLPQGITAETPAPTEIILKGADKELLGKVASEIREYRKPEPYKGKGV
FT                   RYEDEYVAKKEAKKK"
FT   CDS_pept        344965..345318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="FTF0341"
FT                   /product="50S ribosomal protein L18"
FT                   /note="Similar to Q8XGP4 50S ribosomal subunit protein L18
FT                   from Salmonella typhi (117 aa). FASTA: opt: 495 Z-score:
FT                   676.3 E(): 8.8e-30 Smith-Waterman score: 495; 64.957
FT                   identity in 117 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0341"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08357"
FT                   /db_xref="GOA:Q14JA4"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JA4"
FT                   /inference="similar to sequence:UniProtKB:Q8XGP4"
FT                   /protein_id="CAL08357.1"
FT                   /translation="MDKKTARLSRSKRTRIKLRELGHTRLCVYRTPRHVYAQVISGDGS
FT                   TVLVAASTVEKDVKAKCKYTGNVESAAIVGEIIADRCKEKGISQVAFDRSGYKYHGRVK
FT                   ALVEAAREHGLQF"
FT   CDS_pept        345346..345846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="FTF0342"
FT                   /product="30S ribosomal protein S5"
FT                   /note="Similar to AAP96679 (Q7VKF0) from Haemophilus
FT                   ducreyi (166 aa). FASTA: opt: 732 Z-score: 923.1 E():
FT                   1.6e-43 Smith-Waterman score: 732; 69.277identity in 166 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0342"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08358"
FT                   /db_xref="GOA:Q14JA3"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JA3"
FT                   /inference="similar to sequence:INSDC:AAP96679"
FT                   /protein_id="CAL08358.1"
FT                   /translation="MSNEVKKNEELIEKLVSVKRHSKTVKGGRIMSFAALTVVGDGKGR
FT                   IGVGRGKSREVPAAIQKAMENAKKNMVSVNLNNDTLWYPVMSNHGASKVFMQPASAGTG
FT                   IIAGGAMRSVFEAVGVHNVLAKTYGSTNPANVVRATIAGLAKIKSPDEIAEKRGLSVEE
FT                   IQG"
FT   CDS_pept        345853..346038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="FTF0343"
FT                   /product="50S ribosomal protein L30"
FT                   /note="Similar to Q9JQT4 (Q9JQT4) 50S ribosomal protein L30
FT                   from Neisseria meningitidis (61 aa). FASTA: opt: 259
FT                   Z-score: 408.8 E(): 7e-15 Smith-Waterman score: 259; 68.333
FT                   identity in 60 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0343"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08359"
FT                   /db_xref="GOA:Q14JA2"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JA2"
FT                   /inference="similar to sequence:UniProtKB:Q9JQT4"
FT                   /protein_id="CAL08359.1"
FT                   /translation="MTQAKTFKVTLVKSLIGRKENHIASARGLGLRKINHTVEVLDTPE
FT                   NRGMANKIYYMVKIEG"
FT   CDS_pept        346045..346476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="FTF0344"
FT                   /product="50S ribosomal protein L15"
FT                   /note="Similar to Q87SZ4 Ribosomal protein L15 from Vibrio
FT                   parahaemolyticus (144 aa). FASTA: opt: 614 Z-score: 753.9
FT                   E(): 4.2e-34 Smith-Waterman score: 614; 67.133 identity in
FT                   143 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0344"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08360"
FT                   /db_xref="GOA:Q14JA1"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14JA1"
FT                   /inference="similar to sequence:UniProtKB:Q87SZ4"
FT                   /protein_id="CAL08360.1"
FT                   /translation="MKLNTLAPAAGSKSAPKRLGRGIGSGLGKTSGKGHKGQKARSGGY
FT                   HKVGFEGGQMPLQRRLPKFGFTSASKGYVAEIRLHELNNVVADEVTLDTLKDFGLIRKD
FT                   IKTVKVIASGEIQKAVSLKGIACTKGAKEAIEKAGGKVE"
FT   CDS_pept        346487..347812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="FTF0345"
FT                   /product="preprotein translocase, subunit Y, membrane
FT                   protein"
FT                   /note="Similar to SECY_ECOLI (P03844) Preprotein
FT                   translocase secY subunit from Escherichia coli (443 aa).
FT                   FASTA: opt: 1706 Z-score: 1921.6 E(): 3.8e-99
FT                   Smith-Waterman score: 1706; 59.497 identity in 437 aa
FT                   overlap Together with SecE and SecG forming an integral
FT                   membrane complex."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0345"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08361"
FT                   /inference="similar to sequence:UniProtKB:SECY_ECOLI"
FT                   /protein_id="CAL08361.1"
FT                   /translation="MSKYNSASGTTGELKSRLIFVVIAILVFRLGVYIPIPNIDPTKLV
FT                   EIISNQHSSTGGLMSMFNMFSGGALTQMSIFALGVMPYISASIIFQMLSAVYPKFIELK
FT                   KEGESGQKKITQYTRYLTLALAIVQSFGIVAFVLHQDGLVTTNNMALFYLTTIVSVTTG
FT                   SMFLMWLGEQITERGVGNGISLLIFSGIVANLPFEISNTLSQANQHVISYLSVWVLLIL
FT                   LLLVIAFVVFMESAQRKITVNYAKRQQGRKMFAAQTSHLPLKLNMAGVIPAIFASSILM
FT                   VPGVLLGWLSNYNSLSWLADVAEMLQPGSIVYTVVFAATIIFFCFFYTSLVLNPKETAD
FT                   NLKKSGAYISGVRPGEQTAKYIDAVMTRLTLVGSLYITAICLLPIFVVKFFAQGLSFTF
FT                   GGTSLLIVVVVMMDFMAQVRSHMMSTQYDSLLKKANLSGKRK"
FT   CDS_pept        347836..347949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="FTF0346"
FT                   /product="50S ribosomal protein L36"
FT                   /note="Similar to AAP96675 (Q7VKF4) 50S ribosomal protein
FT                   L36 from Haemophilus ducreyi (37 aa). FASTA: opt: 231
FT                   Z-score: 329.3 E(): 1.9e-10 Smith-Waterman score: 231;
FT                   86.486 identity in 37 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0346"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08362"
FT                   /db_xref="GOA:Q14J99"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14J99"
FT                   /inference="similar to sequence:INSDC:AAP96675"
FT                   /protein_id="CAL08362.1"
FT                   /translation="MKVRASVKKMCRNCKVIKRNRVVRVICTDPRHKQRQG"
FT   CDS_pept        348066..348422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="FTF0347"
FT                   /product="30S ribosomal protein S13"
FT                   /note="Similar to RS13_PSESM (Q889U9) 30S ribosomal protein
FT                   S13 from Pseudomonas syringae (118 aa). FASTA: opt: 622
FT                   Z-score: 785.6 E(): 7.2e-36 Smith-Waterman score: 622;
FT                   78.632 identity in 117 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0347"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08363"
FT                   /db_xref="GOA:Q14J98"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14J98"
FT                   /inference="similar to sequence:UniProtKB:RS13_PSESM"
FT                   /protein_id="CAL08363.1"
FT                   /translation="MARIAGVNIPVHKHTVIGLTSIYGIGKTRAQQICQTCNVDPTVKI
FT                   KDLSEEQVESLRTEVAKFTVEGDLRREVSMDIKRLMDLGCFRGRRHRRSLPVRGQRTKT
FT                   NARTRKGPRKPIKA"
FT   CDS_pept        348462..348851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="FTF0348"
FT                   /product="30S ribosomal protein S11"
FT                   /note="Similar to RS11_PSEAE (Q9HWF8) 30S ribosomal protein
FT                   S11 from Pseudomonas aeruginosa (129 aa). FASTA: opt: 678
FT                   Z-score: 871.9 E(): 1.1e-40 Smith-Waterman score: 678;
FT                   79.070 identity in 129 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0348"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08364"
FT                   /db_xref="GOA:Q14J97"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14J97"
FT                   /inference="similar to sequence:UniProtKB:RS11_PSEAE"
FT                   /protein_id="CAL08364.1"
FT                   /translation="MAKSVRSSKKKVKRVVTDAVAHIYSSFNNTIVTITDRQGNALSWA
FT                   TSGGSGFRGSRKSTPFAAQVAAERAADMALEYGVKNVDVLVKGPGSGRDSAVRALNAKN
FT                   LKVTSITDVTPLPHNGCRPPKKRRV"
FT   CDS_pept        348873..349493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="FTF0349"
FT                   /product="30S ribosomal protein S4"
FT                   /note="Similar to RS4_PSEAE (O52759) 30S ribosomal protein
FT                   S4 from Pseudomonas aeruginosa (206 aa). FASTA: opt: 981
FT                   Z-score: 1232.6 E(): 9.2e-61 Smith-Waterman score: 981;
FT                   71.845 identity in 206 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0349"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08365"
FT                   /db_xref="GOA:Q14J96"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14J96"
FT                   /inference="similar to sequence:UniProtKB:RS4_PSEAE"
FT                   /protein_id="CAL08365.1"
FT                   /translation="MARYLGPKCKLSRREGTDLFLKSGVKANDEKCKMNTAPGQHGARR
FT                   ARLSDYGLQLREKQKVRRMYGILEGQFKKYYVEASRRKGNTGATLLELLESRLDNVVYR
FT                   MGFAATRAEARQLVVHKGIMVNGHTCNVPSAQVKAGDVVAVREKAKKQLRIQNAVELAK
FT                   HRKELSWIDVNTDSLEGTMKSSPDRSELSADINEQLIIELYSK"
FT   CDS_pept        349551..350522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA1"
FT                   /locus_tag="FTF0350"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="Similar to Q88QL1 (Q88QL1) DNA-directed RNA
FT                   polymerase, alpha subunit from Pseudomonas putida (333 aa).
FT                   FASTA: opt: 812 Z-score: 957.0 E(): 2.1e-45 Smith-Waterman
FT                   score: 812; 45.033 identity in 302 aa overlap paralog of
FT                   FTF1442c, rpoA2"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0350"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08366"
FT                   /db_xref="GOA:Q14J95"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14J95"
FT                   /inference="similar to sequence:UniProtKB:Q88QL1"
FT                   /protein_id="CAL08366.1"
FT                   /translation="MSNNNSKLEFVPNIQLKEDLGAFSYKVQLSPVEKGMAHILGNSIR
FT                   RVLLSSLSGASIIKVNIANVLHEYSTLEDVKEDVVEIVSNLKKVAIKLDTGIDRLDLEL
FT                   SVNKSGVVSAGDFKTTQGVEIINKDQPIATLTNQRAFSLTATVSVGRNVGILSAIPTEL
FT                   ERVGDIAVDADFNPIKRVAFEVFDNGDSETLEVFVKTNGTIEPLAAVTKALEYFCEQIS
FT                   VFVSLRVPSNGKTGDVLIDSNIDPILLKPIDDLELTVRSSNCLRAENIKYLGDLVQYSE
FT                   SQLMKIPNLGKKSLNEIKQILIDNNLSLGVQIDNFRELVEGK"
FT   CDS_pept        350567..351004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="FTF0351"
FT                   /product="50S ribosomal protein L17"
FT                   /note="Similar to Q8DS37 50S ribosomal protein L17 from
FT                   Streptococcus mutans (128 aa). FASTA: opt: 342 Z-score:
FT                   447.1 E(): 5.2e-17 Smith-Waterman score: 342; 50.000
FT                   identity in 128 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0351"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08367"
FT                   /db_xref="GOA:Q14J94"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14J94"
FT                   /inference="similar to sequence:UniProtKB:Q8DS37"
FT                   /protein_id="CAL08367.1"
FT                   /translation="MRHRKQGRKFGRTSSHRKAMFKNMSASLINHELIKTTLPKAKELR
FT                   AIVEPLVTLAKREHKLRQELDTNSNEFKAQSVALRRQAFDFLRNKAAVTKLFEEFGARY
FT                   AERAGGYTRILKCGYRFGDKAPMAFIELVDRPQVEEAADEE"
FT   repeat_region   351094..351105
FT                   /note="ISFtu1 12bp terminal inverted repeat"
FT   repeat_region   351106..351121
FT                   /rpt_type=TANDEM
FT                   /note="16bp Short Sequence Tandem Repeat (SSTR)"
FT   repeat_region   351122..351137
FT                   /rpt_type=TANDEM
FT                   /note="16bp Short Sequence Tandem Repeat (SSTR)"
FT   CDS_pept        join(351158..351484,351484..351942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="isftu1"
FT                   /locus_tag="FTF0352"
FT                   /product="Transposase"
FT                   /note="ISFtu1. Transposase, member of the IS630 Tc-1
FT                   mariner family. Identical to Q93EJ6 Putative transposase
FT                   from Francisella tularensis (118 aa) from aa 144-261.
FT                   Identical to Q93EJ7 putative transposase from Francisella
FT                   tularensis (126 aa) from aa 1-109. Q93EJ6 and Q93EJ7
FT                   previously characterised as two separate ORF's. ORF1
FT                   (identical to Q93EJ7) contains a programmed ribosomal
FT                   frameshifting motif, 5'-AAAAAAAG-3' at aa position 109
FT                   which permits frameshifting to ORF2 (identical to Q93EJ6)
FT                   to produce a single ORF. Alignment of this single ORF with
FT                   additional members of the IS630 family, and also mariner
FT                   elements, show that this transposase shares strongly
FT                   conserved residues, including a fully conserved
FT                   dipeptide,Asp-Glu (DE), and a block consisting of a fully
FT                   conserved Asp and highly conserved Glu, separated by 34 or
FT                   35 residues (D35E). The conserved dipeptide is only present
FT                   if ribosomal frameshifting occurs."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0352"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08368"
FT                   /protein_id="CAL08368.1"
FT                   /translation="MPSYSQDFRDIVINKHEEGMTEFELSKFFNIDKRTVVSWIEFYKR
FT                   TGDYSSKQGVGCGRVASFTDKTLIEQYLIDHPDASALDIKEALAPDIPRSTFYDCLNRL
FT                   GFSFKKKTPKYKQRKEHERLEYIEKLKEIAQNLLFYIDEMGCDNKLSILRGWSLIGEPS
FT                   YGEVLAYQTQRRSIVAGYNYADKKIIALLEYSGYTNTEIFNQWFEEHLCPSLKPKTTIV
FT                   MDNASFHKSSKLIEIANKFDVQILYLPPYSPDLNPIEKV"
FT   repeat_region   352030..352041
FT                   /note="ISFtu1 12bp terminal inverted repeat"
FT   CDS_pept        complement(352040..352501)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="isftu2"
FT                   /locus_tag="FTF0353c"
FT                   /product="Transposase, fragment"
FT                   /note="ISFtu2, fragment. Transposase, member of the IS5
FT                   family. Identical to Q8GM03 putative transposase from
FT                   Francisella tularensis (247 aa) over 156 aa. Only the
FT                   carboxy terminal is present and that is disrupted by the
FT                   insertion of ISFtu1 element resulting in 7 carboxyl aa
FT                   missing."
FT   CDS_pept        352871..353866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0354"
FT                   /product="hypothetical protein"
FT                   /note="Duplicate of FTF0378 and FTF1263 ORF ftt0354"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0354"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08370"
FT                   /protein_id="CAL08370.1"
FT                   /translation="MYLNKVHYIWMGSLIPDKYINNIFYLLSQSDHYINIWTDRPEETR
FT                   LKFLDKIGGYSHLQRNKITNRLEFKQIFELENWCQINLSNYLTLIQMKTLLETFMFEYP
FT                   NYSDRYNKYSLEVLYKLGNLATLSDILRLVILYKEGGIYIDCDNTFKGQHIKYNIKYSK
FT                   NPNQYNICANCKFSLYSFHNIAGNSVLVANSGAQGCVEILKLSLDTIYKQQTGRELIDN
FT                   IEKMKRILFTEKSYLKNVFDYFMSNSYIEKDKDLRRHGKDPNGYKLQILKDYGGVNQSM
FT                   YHCGYPYAYLAMQIGPEVLKEFERNKAFSKRITEISIFHTITINSDQAWL"
FT   repeat_region   complement(354059..354070)
FT                   /note="ISFtu1 12bp terminal inverted repeat"
FT   CDS_pept        complement(join(354158..354616,354616..354942))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="isftu1"
FT                   /locus_tag="FTF0355c"
FT                   /product="Transposase"
FT                   /note="ISFtu1. Transposase, member of the IS630 Tc-1
FT                   mariner family. Identical to Q93EJ6 Putative transposase
FT                   from Francisella tularensis (118 aa) from aa 144-261.
FT                   Identical to Q93EJ7 putative transposase from Francisella
FT                   tularensis (126 aa) from aa 1-109. Q93EJ6 and Q93EJ7
FT                   previously characterised as two separate ORF's. ORF1
FT                   (identical to Q93EJ7) contains a programmed ribosomal
FT                   frameshifting motif, 5'-AAAAAAAG-3' at aa position 109
FT                   which permits frameshifting to ORF2 (identical to Q93EJ6)
FT                   to produce a single ORF. Alignment of this single ORF with
FT                   additional members of the IS630 family, and also mariner
FT                   elements, show that this transposase shares strongly
FT                   conserved residues, including a fully conserved
FT                   dipeptide,Asp-Glu (DE), and a block consisting of a fully
FT                   conserved Asp and highly conserved Glu, separated by 34 or
FT                   35 residues (D35E). The conserved dipeptide is only present
FT                   if ribosomal frameshifting occurs."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0355c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08371"
FT                   /protein_id="CAL08371.1"
FT                   /translation="MPSYSQDFRDIVINKHEEGMTEFELSKFFNIDKRTVVSWIEFYKR
FT                   TGDYSSKQGVGCGRVASFTDKTLIEQYLIDHPDASALDIKEALAPDIPRSTFYDCLNRL
FT                   GFSFKKKTPKYKQRKEHERLEYIEKLKEIAQNLLFYIDEMGCDNKLSILRGWSLIGEPS
FT                   YGEVLAYQTQRRSIVAGYNYADKKIIALLEYSGYTNTEIFNQWFEEHLCPSLKPKTTIV
FT                   MDNASFHKSSKLIEIANKFDVQILYLPPYSPDLNPIEKV"
FT   repeat_region   complement(354979..354994)
FT                   /rpt_type=TANDEM
FT                   /note="16bp Short Sequence Tandem Repeat (SSTR)"
FT   repeat_region   complement(354995..355006)
FT                   /note="ISFtu1 12bp terminal inverted repeat"
FT   CDS_pept        355104..356990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpG"
FT                   /locus_tag="FTF0356"
FT                   /product="Chaperone Hsp90, heat shock protein HtpG"
FT                   /note="Similar to AAO89866 (Q83EL0) Heat shock protein HtpG
FT                   from Coxiella burnetii (633 aa). FASTA: opt: 2277 Z-score:
FT                   2422.9 bits: 458.5 E(): 4.6e-127 Smith-Waterman score:
FT                   2277; 54.792 identity in 626 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0356"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08372"
FT                   /db_xref="GOA:Q14J90"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR019805"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14J90"
FT                   /inference="similar to sequence:INSDC:AAO89866"
FT                   /protein_id="CAL08372.1"
FT                   /translation="MSEKKYTFETEVDKLLHLVIHSLYSNREIFLRELVSNSSDAIEKL
FT                   RYESISNAALNEDDTDYAIRIDFDKDAKTITVSDNGIGMTEEEVIENLGTIAKSGTKKF
FT                   LESLTGDKSKDNELIGQFGVGFYSSFIVADKVTVRTRKAGQDKSQATKWVSDAQNGFTV
FT                   ETITKEKRGTEVILHIKKEHLDLLEYHVLKGLVNKYSDCINTSIQMKKVEYDKDGKQTV
FT                   KDEYETVNNTKAIWLRSKDEVTDEEYQEFYKYISHDFADALMWIHNKVEGNLEYNSLLY
FT                   IPQNKPFDFWNRDKDYGLSLYVRRVFIMENKELLPPYLRFVKGVIDSADLPLNVSREIL
FT                   QHNKVIDKIKKAITTKILSELKKLASKDKEKYQKFWDSFGQVLKEGVSDDYSNKEKIAG
FT                   LLRFATTQSGDSKQTVSLADYISRMKEGQDTIYYITSDSYKAAANNPQLEAFKKKGIEV
FT                   ILMTDRIDEWMMSTLTEFDGKHMKSIIKGDIDLDRFETPENKEKFEKEAKDFEKVLKEI
FT                   KEVLKDKVEDVRLSKRLTDSPSCVVVNDYGMSLHMQKMMEEAGQSFMPGMGMKPILELN
FT                   AEHNLVQKLKNEADTEIFADLSELLLLQAMFVEGAKIEDPMAFVKLVNKYIR"
FT   repeat_region   complement(357215..357226)
FT                   /note="ISFtu1 12bp terminal inverted repeat"
FT   CDS_pept        complement(join(357314..357772,357772..358098))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="isftu1"
FT                   /locus_tag="FTF0357c"
FT                   /product="Transposase"
FT                   /note="ISFtu1. Transposase, member of the IS630 Tc-1
FT                   mariner family. Identical to Q93EJ6 Putative transposase
FT                   from Francisella tularensis (118 aa) from aa 144-261.
FT                   Identical to Q93EJ7 putative transposase from Francisella
FT                   tularensis (126 aa) from aa 1-109. Q93EJ6 and Q93EJ7
FT                   previously characterised as two separate ORF's. ORF1
FT                   (identical to Q93EJ7) contains a programmed ribosomal
FT                   frameshifting motif, 5'-AAAAAAAG-3' at aa position 109
FT                   which permits frameshifting to ORF2 (identical to Q93EJ6)
FT                   to produce a single ORF. Alignment of this single ORF with
FT                   additional members of the IS630 family, and also mariner
FT                   elements, show that this transposase shares strongly
FT                   conserved residues, including a fully conserved
FT                   dipeptide,Asp-Glu (DE), and a block consisting of a fully
FT                   conserved Asp and highly conserved Glu, separated by 34 or
FT                   35 residues (D35E). The conserved dipeptide is only present
FT                   if ribosomal frameshifting occurs."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0357c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08373"
FT                   /protein_id="CAL08373.1"
FT                   /translation="MPSYSQDFRDIVINKHEEGMTEFELSKFFNIDKRTVVSWIEFYKR
FT                   TGDYSSKQGVGCGRVASFTDKTLIEQYLIDHPDASALDIKEALAPDIPRSTFYDCLNRL
FT                   GFSFKKKTPKYKQRKEHERLEYIEKLKEIAQNLLFYIDEMGCDNKLSILRGWSLIGEPS
FT                   YGEVLAYQTQRRSIVAGYNYADKKIIALLEYSGYTNTEIFNQWFEEHLCPSLKPKTTIV
FT                   MDNASFHKSSKLIEIANKFDVQILYLPPYSPDLNPIEKV"
FT   repeat_region   complement(358119..358134)
FT                   /rpt_type=TANDEM
FT                   /note="16bp Short Sequence Tandem Repeat (SSTR)"
FT   repeat_region   complement(358135..358150)
FT                   /rpt_type=TANDEM
FT                   /note="16bp Short Sequence Tandem Repeat (SSTR)"
FT   repeat_region   complement(358151..358162)
FT                   /note="ISFtu1 12bp terminal inverted repeat"
FT   CDS_pept        join(358162..358203,358207..358449,358452..358499,
FT                   358503..359309)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0358"
FT                   /product="conserved hypothetical protein, psuedogene"
FT                   /note="Similar to Q9I5X7 Hypothetical protein PA0559 from
FT                   Pseudomonas aeruginosa (392 aa). FASTA: opt: 1403 Z-score:
FT                   1598.9 E(): 3.3e-81 Smith-Waterman score: 1403;
FT                   54.090identity in 379 aa overlap. This CDS contains no
FT                   start codon due to an insertion of an ISFtu1 element as
FT                   well as a frameshift and two in-frame stop codons. ORF
FT                   ftt0358"
FT                   /inference="similar to sequence:UniProtKB:Q9I5X7"
FT   CDS_pept        359366..359836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0359"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0359"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0359"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08375"
FT                   /protein_id="CAL08375.1"
FT                   /translation="MKIPAEKEFAIKKAILKAIEHGYSPAQLADSFGVSKSLIYKYRRA
FT                   LRDQGFIRKNENDMYVITQNKFSIKPRIPESGKLDLDNDIKDQPQPNLQASNQELEQPI
FT                   IDEPKPDVSRTEIKLQEKLQQIREIQLQQQQNAANQDKGLFKKIIGKFKKII"
FT   CDS_pept        359973..360797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0360"
FT                   /product="Short-chain dehydrogenase/reductase"
FT                   /EC_number="1.-.-.-"
FT                   /note="Similar to Q82V84 Short-chain
FT                   dehydrogenase/reductase (SDR) superfamily from Nitrosomonas
FT                   europaea (279 aa). FASTA: opt: 829 Z-score: 982.8 E():
FT                   7.5e-47 Smith-Waterman score: 829; 49.632 identity in 272
FT                   aa overlap ORF ftt0360"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0360"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08376"
FT                   /inference="similar to sequence:UniProtKB:Q82V84"
FT                   /protein_id="CAL08376.1"
FT                   /translation="MVNNSKTILITGCSHGGIGYATAVHLKNLGHRVFASARQQKDVEA
FT                   LSQEGFETYLIDVTNYEYIDNALADILNKTGGSLDVIFNNAGYGQAGALEDIDTKFLKQ
FT                   QFETNVFGLHNLTYKALKIMRKQGYGKIIQHSSVLGLVAMKYRGAYNASKYAIEGLTDT
FT                   MRLELRDSNIFITSLNTGPITSKFRENSIKTITNVNYDSSVHKQQYEKILARQHKKVPF
FT                   NEPAISVAKVVEKIINCDKPKPRYYITKATWIMASLKRILPTNILDNFLNRY"
FT   CDS_pept        complement(360819..362168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0361c"
FT                   /product="amino acid transporter"
FT                   /note="Similar to Q8Z506 Putative amino acid transporter
FT                   from Salmonella typhi (473 aa). FASTA: opt: 717 Z-score:
FT                   754.8 E(): 3.8e-34 Smith-Waterman score: 755; 29.783
FT                   identity in 460 aa overlap ORF ftt0361c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0361c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08377"
FT                   /inference="similar to sequence:UniProtKB:Q8Z506"
FT                   /protein_id="CAL08377.1"
FT                   /translation="MDINSNQDQVLGFKDVTIMAVTANFGIRWIPVAACLGASAIFFWI
FT                   LGAVMFFLPLVIIAVQLSRKHPDEGGIYSWTVRALGQKAGFMVAWLYWVNTIFYYPAVL
FT                   IFLATKFAYFIGRPDLVDNHYYITIVVLVAFWLVTVISFYGLKANKYLVDIGGVLGSFL
FT                   PAIAIIVLGFIAYLIVGKSATDFSLANMIPHDNIWHNLSTLTIIMFAMAGIEIIPTFAN
FT                   SVKDAKKNLYYGLMFSAFILLGLYILGTIALNLVASPDTINSSSGLMEAFEIIGHRFGW
FT                   EWFPRLMAFLLTFAELAAVSIWLLAPVVMFFKCTPRGILPEWLHKTNKYDSPKNALVFM
FT                   GILVTVIVLLTNFLPSVNLMYQALILMATVLYFIPYLYLVVAYIKLMDSTYKYLLGFLV
FT                   FISTSLGIIFSFQPSSDLTGGYDIFIYEFELILGPVIFIFIGWLLYKFKR"
FT   CDS_pept        complement(362427..363299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0362c"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0362c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0362c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08378"
FT                   /protein_id="CAL08378.1"
FT                   /translation="MKKILLGFTLLSGVVFASDELKLKIKLHTNTQEQNILMPPNRYIS
FT                   DNISCPQGKSWIQELGQNVFTANVPLISTYDPESFGLLWPALSLHKRVGDTSLYFVVQQ
FT                   KIDRELTTGPEDNITVKYHALIADGINTGVGKPNNKVLKGKFNLRDSEGNSLIGDYRDM
FT                   EVSAHDNLWSGPENDDVLREMITSYTSKDNSVIISELLISDDTQNADFIDPINSDIKNI
FT                   LTVHVLLNEKDFESFVTDMGSYQITQDNSFLENYLVNQNGVEAIRDGLAIYKNTIAYVR
FT                   SVAENKKVK"
FT   repeat_region   363403..363414
FT                   /note="ISFtu1 12bp terminal inverted repeat"
FT   repeat_region   363415..363430
FT                   /rpt_type=TANDEM
FT                   /note="16bp Short Sequence Tandem Repeat (SSTR)"
FT   repeat_region   363431..363446
FT                   /rpt_type=TANDEM
FT                   /note="16bp Short Sequence Tandem Repeat (SSTR)"
FT   CDS_pept        join(363467..363793,363793..364251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="isftu1"
FT                   /locus_tag="FTF0363"
FT                   /product="Transposase"
FT                   /note="ISFtu1. Transposase, member of the IS630 Tc-1
FT                   mariner family. Identical to Q93EJ6 Putative transposase
FT                   from Francisella tularensis (118 aa) from aa 144-261.
FT                   Identical to Q93EJ7 putative transposase from Francisella
FT                   tularensis (126 aa) from aa 1-109. Q93EJ6 and Q93EJ7
FT                   previously characterised as two separate ORF's. ORF1
FT                   (identical to Q93EJ7) contains a programmed ribosomal
FT                   frameshifting motif, 5'-AAAAAAAG-3' at aa position 109
FT                   which permits frameshifting to ORF2 (identical to Q93EJ6)
FT                   to produce a single ORF. Alignment of this single ORF with
FT                   additional members of the IS630 family, and also mariner
FT                   elements, show that this transposase shares strongly
FT                   conserved residues, including a fully conserved
FT                   dipeptide,Asp-Glu (DE), and a block consisting of a fully
FT                   conserved Asp and highly conserved Glu, separated by 34 or
FT                   35 residues (D35E). The conserved dipeptide is only present
FT                   if ribosomal frameshifting occurs."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0363"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08379"
FT                   /protein_id="CAL08379.1"
FT                   /translation="MPSYSQDFRDIVINKHEEGMTEFELSKFFNIDKRTVVSWIEFYKR
FT                   TGDYSSKQGVGCGRVASFTDKTLIEQYLIDHPDASALDIKEALAPDIPRSTFYDCLNRL
FT                   GFSFKKKTPKYKQRKEHERLEYIEKLKEIAQNLLFYIDEMGCDNKLSILRGWSLIGEPS
FT                   YGEVLAYQTQRRSIVAGYNYADKKIIALLEYSGYTNTEIFNQWFEEHLCPSLKPKTTIV
FT                   MDNASFHKSSKLIEIANKFDVQILYLPPYSPDLNPIEKV"
FT   repeat_region   364339..364350
FT                   /note="ISFtu1 12bp terminal inverted repeat"
FT   CDS_pept        complement(364375..364824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0364c"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0364c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0364c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08380"
FT                   /protein_id="CAL08380.1"
FT                   /translation="MKKIIIVIASMLIALTANATGDCSNKSFNDIKSKARQMEQAWDSA
FT                   DVEKVVSFYADDFIYMSGGKPYTTKNAVLKHYVDGFAANSSGKRDMGKLKLNYQYCRNL
FT                   DQNYQLVILKFIWTSSDGKVASGHDLLVWHKDSKGDYEIIVDFPQ"
FT   CDS_pept        365305..366036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="poxF"
FT                   /locus_tag="FTF0365"
FT                   /product="phenol hydroxylase"
FT                   /EC_number="1.14.13.7"
FT                   /note="Similar to Q8PFB8 Phenol hydroxylase from
FT                   Xanthomonas axonopodis (365 aa). FASTA: opt: 567 Z-score:
FT                   717.5 E(): 4.5e-32 Smith-Waterman score: 567; 38.211
FT                   identity in 246 aa overlap The protein seems to be shorter
FT                   (<115 aa) than the matching proteins."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0365"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08381"
FT                   /inference="similar to sequence:UniProtKB:Q8PFB8"
FT                   /protein_id="CAL08381.1"
FT                   /translation="MALEKFELELVSFKDITDKVRHFVFKRTDGKPLDFIAGQFITFLL
FT                   TDEDGNIKRRSYSLGSLPADNMLLEIGMTYVEGGIATDTFFNMKVGDTAAAMGPAGRLV
FT                   LKKDEEIRKLILVGTGTGIVPYRAMFPELLEKADNTEIHILLGVQYRKDALYQDDFIKF
FT                   AKKHHNIHFKLCLSRETQDLRDYEISGYVQNQFDKIGLDPEKDVVYVCGNPNMIDESYE
FT                   MLTQAGFNAKNVRREKYISSN"
FT   CDS_pept        366158..366373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="FTF0366"
FT                   /product="50S ribosomal protein L31"
FT                   /note="Similar to RL31_PASMU (Q9CLR7) 50S ribosomal protein
FT                   L31 from Pasteurella multocida (70 aa). FASTA: opt: 332
FT                   Z-score: 479.7 E(): 7.9e-19 Smith-Waterman score: 332;
FT                   67.692 identity in 65 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0366"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08382"
FT                   /db_xref="GOA:Q14J81"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14J81"
FT                   /inference="similar to sequence:UniProtKB:RL31_PASMU"
FT                   /protein_id="CAL08382.1"
FT                   /translation="MRQEIHPKYTEVTVTCSCGNTFVTRSTAGKKEMNIDICSECHPFY
FT                   TGKQRIVDTAGRVDKFKKRFGGMKKI"
FT   CDS_pept        complement(366584..368089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshA"
FT                   /locus_tag="FTF0367c"
FT                   /product="Glutamate--cysteine ligase"
FT                   /EC_number="6.3.2.2"
FT                   /note="Similar to Q88AR1 Glutamate--cysteine ligase from
FT                   Pseudomonas syringae (529 aa). FASTA: opt: 1113 Z-score:
FT                   1281.1 E(): 1.8e-63 Smith-Waterman score: 1113; 39.250
FT                   identity in 507 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0367c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08383"
FT                   /inference="similar to sequence:UniProtKB:Q88AR1"
FT                   /protein_id="CAL08383.1"
FT                   /translation="MYDFKKINNLRGIERETLRVTDCGNLATSNHPDGLGHKLTNNSIT
FT                   VDFSENLLELITKPHDSIDKAIGELYQLSAFTLDNMHSDEIILNTSMPLSANDNDIQEA
FT                   DFGSSNSGRMKRVYRKGLSARYGKIMQIISGIHYNFSFDKDLISNIATNKQVSISDIYF
FT                   DVLNNYFEFMWLLPYLFGASPICAKTSVKNKPDYLSVLDDKFYVGEYATSLRMSDLGYT
FT                   SPAQKDLAISYDNVKAYVKDLIQATDDTFADYKRIGLYNSQGQRIQLNDGILQIENEYY
FT                   SAIRPKQIAKRGERPACALYNRGVEYVEVRVLDVDPFEPVGISKDTALFVEVMLMTCLD
FT                   KDAKKYHKDIIKQAKQNLTAVAIQGRNPQLKLKKLDDDSEILLKDYALELFDEIEAVAK
FT                   KMPKEYLDAVEIQKRKVLDISQTPSAKIIELARQHGYKKFILDISRRVSQQFRSYELPA
FT                   AIVAKLKDQAGQSVAAEKELVANDKISLDEYINRYYKSSKGCC"
FT   CDS_pept        complement(368142..369686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mviN"
FT                   /locus_tag="FTF0368c"
FT                   /product="virulence factor MviN"
FT                   /note="Similar to AAO89943 (Q83ED5) Integral membrane
FT                   protein MviN from Coxiella burnetii (515 aa). FASTA: opt:
FT                   836 Z-score: 887.1 E(): 1.6e-41 Smith-Waterman score: 836;
FT                   30.452 identity in 509 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0368c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08384"
FT                   /inference="similar to sequence:INSDC:AAO89943"
FT                   /protein_id="CAL08384.1"
FT                   /translation="MQKFFSNSLIVSIFLFLSKLLGFVRDLLLASFFGSGAALQAFLVA
FT                   FRFPEFIRKVTSSGTLTQIINPYLNGSINQRNNKFIITILYFIALFLLIVTFLAIVFSN
FT                   IWVGIYAYGFVDETSVLVLVKSMFVIMIPYVLFNGVMGVISAILNSYSKYVVSSLLPIV
FT                   LNVVMIIGVDISPRFNVPIYSVAYAVLLAGIIQVSIGGYSLIKLIGKISFSRDIFLVKD
FT                   SRAKIFLRKLPSAFLGTAILQINGLVETFFASFLLSGSLAWLYYADRVNQFLYGVFGTA
FT                   IATVMIPYLIDCKRDKQQFFKTLAAIIRFTLLVTIPAIVGLFVLAKPIVISLFYYGKFS
FT                   LNDVDFTYLAMLGYLMSLFCFVVVRVIVSALYAQNKTTIVFYISLVSLITTICLDIFIV
FT                   HFFSGDKYAFVYLALASSSVALLNLFIQLLWVLCDFSFKLFIVTYLPFMTIVKIIIAST
FT                   TMVLVLKLFNLSDSYWITLSMFGRLKSIALIVFIGVCVYLVTILLLVGIKPLKTLE"
FT   CDS_pept        complement(369709..370770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0369c"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0369c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0369c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08385"
FT                   /protein_id="CAL08385.1"
FT                   /translation="MKAKFIIAFLSILFFSSSYATLEQCYKDGVNQDYEKVLESCKPYL
FT                   KTDARATGLLAEANIQLDSSDKLALEDALWAVNFYQKNGAPKDPEGARSYSYLVYLIGE
FT                   LYFFGSDDIKVDQKKGIEYIIKSANLGYDIAQNQLGNLYVRVGKVPGPNFAKAYKWYKL
FT                   AIANGSLDARNAYLMNNERSFIENYPYCISIGRALIGDTYLNGLAGLPKSPDFAIQWYQ
FT                   KAYELDHISPVETGLARAYMAKGDKKLAYKYAREAIQQPYAPAFVVIADLTDNKVAKYA
FT                   YLAEAVELYKNPALKFWSQFNEYCMPDISDNGLKQAQRNLAKIKLSKQELELATKEQQS
FT                   LRNSWQQNAVTSK"
FT   CDS_pept        complement(370853..371263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjeE"
FT                   /locus_tag="FTF0370c"
FT                   /product="Nucleotide-binding protein, yjeE"
FT                   /note="Similar to Q8Z189 Hypothetical protein yjeE from
FT                   Salmonella typhi (153 aa). FASTA: opt: 517 Z-score: 623.3
FT                   E(): 7.9e-27 Smith-Waterman score: 517; 56.489 identity in
FT                   131 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0370c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08386"
FT                   /inference="similar to sequence:UniProtKB:Q8Z189"
FT                   /protein_id="CAL08386.1"
FT                   /translation="MKSILVNDEEQMYQLAKEYSQQLKPGQIIYLYGDLGAGKTTFVKG
FT                   ILNALGYTGNVKSPTYTLVESYEFDKFDIYHFDLYRLADPEELEWIGARDYFNQKDICF
FT                   IEWPEKGKGFLPLNTTKVHIKYLAQGRQVDFY"
FT   CDS_pept        complement(371241..372422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folC"
FT                   /locus_tag="FTF0371c"
FT                   /product="FolC Bifunctional protein"
FT                   /EC_number="6.3.2.12"
FT                   /EC_number="6.3.2.17"
FT                   /note="Similar to Q8ECR5 FolC bifunctional protein from
FT                   Shewanella oneidensis (431 aa). FASTA: opt: 507 Z-score:
FT                   630.2 E(): 3.3e-27 Smith-Waterman score: 627; 32.274
FT                   identity in 409 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0371c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08387"
FT                   /inference="similar to sequence:UniProtKB:Q8ECR5"
FT                   /protein_id="CAL08387.1"
FT                   /translation="MSVEIKIAKLMAKPDALYCDLLDLSLILSRFNFAKKFKVITIAGT
FT                   NGKGTTVAMLEELLVTNNKNVLSHTSPHVFKFNERISLNKQPICDSVLLEILERLEELA
FT                   PEYRLSYYQIAFLCLCIYSQRVELDYLILEVGIGGRLDAANIIDADITAITNIDFDHCE
FT                   ILGDTLDKIGFEKAGISRPQVPLFLGSQMPQSVYEYAQTIGAVIYQNSYEYSSRQCFTH
FT                   SYNIAMGIAEYLFYRMQISYIPNLEDIRARARFATLKNDSLNNSYVVVDVAHNPASVRH
FT                   LFELLESKFAGKNIRYEAIFGILATKDIREVLNIAKQHVYKWDVIDLKYLDSRAADLEK
FT                   IKQEFKLQQIIRVDYNKDLSSVYLAKKDTLMVVFGSFVLAGEFIRHYEKYTSK"
FT   CDS_pept        complement(372437..373345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accD"
FT                   /locus_tag="FTF0372c"
FT                   /product="Acetyl-CoA carboxylase beta subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="Similar to Q8XFJ5 Acetyl-CoA carboxylase beta
FT                   subunit from Salmonella typhi (304 aa). FASTA: opt: 1197
FT                   Z-score: 1430.2 E(): 9.1e-72 Smith-Waterman score: 1197;
FT                   62.116 identity in 293 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0372c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08388"
FT                   /inference="similar to sequence:UniProtKB:Q8XFJ5"
FT                   /protein_id="CAL08388.1"
FT                   /translation="MEMSWLTRVIGRSLGLEAQKKDMPSGVWSQCPNCGVTLYSEELHN
FT                   NKSVCPSCNYHYRISARNRLNLFFDRDSMQEHFANVSPVDMLKFKDTKTYKDRLAQAQK
FT                   KTEEQDALVVMEGTVKGFPVVAAAFNFMFLGGSMGSVVGEKFVRGVKLAIEKKVPFICF
FT                   TASGGARMQESLFSLMQMAKTSAALQKLAEAKLPYLVVLTDPTTGGVSASLAMLGDIHI
FT                   AEPKALIGFAGPRVIEQTVREKLPEGFQRSEFLVEKGMVDMIVDRRNLRGEVAKLIDKL
FT                   MPNLTKINYSQPLEYKSEQQA"
FT   CDS_pept        complement(373381..373803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndk"
FT                   /locus_tag="FTF0373c"
FT                   /product="nucleoside diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /note="Similar to Q83C71 Nucleoside diphosphate kinase from
FT                   Coxiella burnetii (144 aa). FASTA: opt: 694 Z-score: 908.5
FT                   E(): 1e-42 Smith-Waterman score: 694; 77.698 identity in
FT                   139 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0373c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08389"
FT                   /db_xref="GOA:Q14J74"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14J74"
FT                   /inference="similar to sequence:UniProtKB:Q83C71"
FT                   /protein_id="CAL08389.1"
FT                   /translation="MTKQRTLSIIKPDAVEKNVIGEIYSRFEKAGLRIIAAKMKHLSKA
FT                   EAERFYAVHKDRPFFSALVEFMISGPVMIQVLEGENAIAKNRELMGATNPKEAKAGTIR
FT                   ADFADSIDANAVHGSDAEDTAAQEIRYFFSDTEIFG"
FT   CDS_pept        complement(373876..375516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="FTF0374c"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="Similar to PYRG_PSEAE (Q9HXZ4) CTP
FT                   synthase,(UTP--ammonia ligase), from Pseudomonas aeruginosa
FT                   (542 aa). FASTA: opt: 2341 Z-score: 2789.8 E(): 1.7e-147
FT                   Smith-Waterman score: 2341; 64.259 identity in 540 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0374c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08390"
FT                   /db_xref="GOA:Q14J73"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14J73"
FT                   /inference="similar to sequence:UniProtKB:PYRG_PSEAE"
FT                   /protein_id="CAL08390.1"
FT                   /translation="MNSNTKIIFVTGGVVSSLGKGVTAASLATLLESRGLNVTMMKLDP
FT                   YINVDPGTMSPLQHGEVFVTEDGAETDLDLGHYERFIRNKMTQANNFTTGKVYQSVLRR
FT                   ERKGDYLGATIQVIPHITDEIKRRICSGIADDVDVAIVEIGGTVGDIESQPFLEAIRQL
FT                   RIELGRNRTLFVHLTLLPYIKVAGEIKTKPTQHSVKELRGIGIQADVLVCRCEKKFDDS
FT                   EKRKIALFTNVDQDCIFTAEDVDTIYEVPLKYNQQGFDAKLVELLNLNAKEADLSEWQN
FT                   VVNTIRDVKGEVTIAMVGKYVSLTEAYKSLNEALYNAGYKKGVKVKIKFVDSEDVNENN
FT                   VESYFKDVAAILVPGGFGSRGVEGKIISIKYARENQIPFLGICLGMQLAVIEYARNILG
FT                   IKDAHSSELEPTTANPVIGLITEWQAEDGTVHQRTHSSDLGGTMRLGGYKCVLKQGSRA
FT                   REIYQADEVVERHRHRYEVNSNYVERLEEAGLIFSGRSEDNKLMELIEIPQHKWFIACQ
FT                   AHPEFTSTPRYGHKLFESYIQAAIENSNN"
FT   CDS_pept        join(375832..376680,376684..377196)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0375"
FT                   /product="S-transferase"
FT                   /note="Similar to YFCC_ECOLI (P39263) Hypothetical protein
FT                   yfcC from E. coli (506 aa). FASTA: opt: 1158 Z-score:
FT                   1316.5 E(): 1.8e-65 Smith-Waterman score: 1398; 42.656
FT                   identity in 497 aa overlap. Contains an in-frame stop aa
FT                   after codon 283 and an internal in-frame deletion according
FT                   to FASTA hits ORF ftt0375"
FT                   /inference="similar to sequence:UniProtKB:YFCC_ECOLI"
FT   CDS_pept        complement(377434..378492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0376c"
FT                   /product="hypothetical membrane protein"
FT                   /note="Weak hits at position aa 250-350 to many cytochrome
FT                   oxidase subunit I eg:(Q85L50). ORF ftt0376c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0376c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08392"
FT                   /protein_id="CAL08392.1"
FT                   /translation="MIEPYYFINSRIYSLNVTQQDGYKAHLNFYRCLFMCDFDAEIKTS
FT                   PIYVDIIRNFVFSMFINIDYPAFSYFLSPDELGKSDDDTSYQKSYKVTVSGDGITELNI
FT                   RNVEYDYHDFIIKNESELSLNLLGAKKVNLINDATIYLNVVSSEKLILDLSKDINRMII
FT                   RDSSIEKLDFNSCEFETVPSFDDKSSIKHSVDIDLATFNNLLKVEKGGSLEFSRLTEFF
FT                   NRNNAYMEAQQLHRHYLLAKAKESKSCGLKVWVWFYNLINGCGTSLAKPVIWILLLFIF
FT                   NLFIVLLGSDLLGFDITYYAINTTIPIFKLASNHIELSNGILLVLNISSILATLLWFLI
FT                   ALQIRKLLRLKE"
FT   repeat_region   378795..378806
FT                   /note="ISFtu1 12bp terminal inverted repeat"
FT   repeat_region   378807..378822
FT                   /rpt_type=TANDEM
FT                   /note="16bp Short Sequence Tandem Repeat (SSTR)"
FT   repeat_region   378823..378838
FT                   /rpt_type=TANDEM
FT                   /note="16bp Short Sequence Tandem Repeat (SSTR)"
FT   CDS_pept        join(378859..379188,379188..379643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="isftu1"
FT                   /locus_tag="FTF0377"
FT                   /product="Transposase"
FT                   /note="ISFtu1. Transposase, member of the IS630 Tc-1
FT                   mariner family. Identical to Q93EJ6 Putative transposase
FT                   from Francisella tularensis (118 aa) from aa 144-261.
FT                   Identical to Q93EJ7 putative transposase from Francisella
FT                   tularensis (126 aa) from aa 1-109. Q93EJ6 and Q93EJ7
FT                   previously characterised as two separate ORF's. ORF1
FT                   (identical to Q93EJ7) contains a programmed ribosomal
FT                   frameshifting motif, 5'-AAAAAAAG-3' at aa position 109
FT                   which permits frameshifting to ORF2 (identical to Q93EJ6)
FT                   to produce a single ORF. Alignment of this single ORF with
FT                   additional members of the IS630 family, and also mariner
FT                   elements, show that this transposase shares strongly
FT                   conserved residues, including a fully conserved
FT                   dipeptide,Asp-Glu (DE), and a block consisting of a fully
FT                   conserved Asp and highly conserved Glu, separated by 34 or
FT                   35 residues (D35E). The conserved dipeptide is only present
FT                   if ribosomal frameshifting occurs."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0377"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08393"
FT                   /protein_id="CAL08393.1"
FT                   /translation="MPSYSQDFRDIVINKHEEGMTEFELSKFFNIDKRTVVSWIEFYKR
FT                   TGDYSSKQGVGCGRVASFTDKTLIEQYLIDHPDASALDIKEALAPDIPRSTFYDCLNRL
FT                   GFSFKKKTPKYKQRKEHERLEYIEKLKEIAQNLLFYIDEMGCDNKLSILRGWSLIGEPS
FT                   YGEVLAYQTQRRSIVAGYNYADKKIIALLEYSGYTNTEIFNQWFEEHLCPSLKPKTTIV
FT                   MDNASFHKSSKLIEIANKFDVQILYLPPYSPDLNPIEKV"
FT   repeat_region   379731..379742
FT                   /note="ISFtu1 12bp terminal inverted repeat"
FT   CDS_pept        complement(379935..380930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0378c"
FT                   /product="hypothetical protein"
FT                   /note="Duplicate of FTF0354 and FTF1263 ORF ftt0378c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0378c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08394"
FT                   /protein_id="CAL08394.1"
FT                   /translation="MYLNKVHYIWMGSLIPDKYINNIFYLLSQSDHYINIWTDRPEETR
FT                   LKFLDKIGGYSHLQRNKITNRLEFKQIFELENWCQINLSNYLTLIQMKTLLETFMFEYP
FT                   NYSDRYNKYSLEVLYKLGNLATLSDILRLVILYKEGGIYIDCDNTFKGQHIKYNIKYSK
FT                   NPNQYNICANCKFSLYSFHNIAGNSVLVANSGAQGCVEILKLSLDTIYKQQTGRELIDN
FT                   IEKMKRILFTEKSYLKNVFDYFMSNSYIEKDKDLRRHGKDPNGYKLQILKDYGGVNQSM
FT                   YHCGYPYAYLAMQIGPEVLKEFERNKAFSKRITEISIFHTITINSDQAWL"
FT   CDS_pept        381300..381773
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="isftu2"
FT                   /locus_tag="FTF0379"
FT                   /product="Transposase, fragment"
FT                   /note="ISFtu2, fragment. Transposase, member of the IS5
FT                   family. Identical to Q8GM03 putative transposase from
FT                   Francisella tularensis (247 aa) in 157 aa overlap."
FT   repeat_region   381781..381799
FT                   /note="ISFtu2 19bp terminal inverted repeat"
FT   repeat_region   complement(381812..381827)
FT                   /note="ISFtu1 16bp terminal inverted repeat"
FT   repeat_region   complement(381828..381839)
FT                   /note="ISFtu1 12bp terminal inverted repeat"
FT   CDS_pept        complement(381967..383316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gdh"
FT                   /locus_tag="FTF0380c"
FT                   /product="NAD(P)-specific glutamate dehydrogenase"
FT                   /EC_number="1.4.1.4"
FT                   /note="Similar to DHE2_CLOSY (P24295) NAD-specific
FT                   glutamate dehydrogenase from Clostridium symbiosum (449
FT                   aa.) FASTA: opt: 1920 Z-score: 2196.8 E(): 1.8e-114
FT                   Smith-Waterman score: 1920; 60.899 identity in 445 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0380c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08396"
FT                   /inference="similar to sequence:UniProtKB:DHE2_CLOSY"
FT                   /protein_id="CAL08396.1"
FT                   /translation="MNAQKYIDSVIAQVEKRDGHEKEFIQAVKEVFSTLKPALEHNPKY
FT                   IEENILARMVEPERGISFRVPWVDKDGNIQVNRGYRYQFNGAIGPFKGGIRFHPSVYSG
FT                   IIKFLGFEQVFKNSLTTLPMGGGKGGADFDPKGKTDAEIMNFCQSFMIELQRHIGPDID
FT                   VPAGDIGVGGKEIGYMYGQYRRIRACFENGVLTGKSLESGGSLIRPEATGYGAVFFLDE
FT                   MLKHDGETLQGKTVVTSGYGNVAWGVCKKVAQLGGKVVTISGSKGFVHDPEGITTDEKI
FT                   EFLLKIRNGEKTMQDYSKEFNASWHAGQKPWGIKADIAIPAATQNEIDVEDAQKLIDSG
FT                   VKYVVEASNMPTTNEAIEFLMKKGIILAPGKAANAGGVAVSGLEMSQNSARLSWSAEEV
FT                   ESKLQQIMANIFHACKFASSKYNLGYNLVAGANLAGFEKVAEAMIQQGRY"
FT   repeat_region   383560..383578
FT                   /note="ISFtu2 19bp terminal inverted repeat"
FT   CDS_pept        383655..384398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="isftu2"
FT                   /locus_tag="FTF0381"
FT                   /product="Transposase"
FT                   /note="ISFtu2. Transposase, member of the IS5 family.
FT                   Identical to Q8GM03 putative transposase from Francisella
FT                   tularensis (247 aa)."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0381"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08397"
FT                   /protein_id="CAL08397.1"
FT                   /translation="MNYHIKEVFWSIILSFLKSQKGIHTNDEAKLRLFIEAVFYVLRTG
FT                   CQWRMLPFYYGKYRSIHKRFKDWCDKDIFSRLFKSVQNPDLQEVMLDSTIARAHACATG
FT                   YDKDDNQAIGRSVGRITTKIHAMTDALGNPIEILLSEDKTHDSKVAIDLLKNVYNTKVI
FT                   ADRAYHSNEIRQHIQGISSEAVIPCKSNTLNHIPFDSHVYKERHLIENFFSKIKHFRRV
FT                   FSRFDKTILAYIGMIKLACTFIWLR"
FT   repeat_region   384406..384424
FT                   /note="ISFtu2 19bp terminal inverted repeat"
FT   CDS_pept        384523..384627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0382"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0382"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0382"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08398"
FT                   /protein_id="CAL08398.1"
FT                   /translation="MKKIIAIVLVSCVLASCVSTYQPLHADQQSQQKA"
FT   CDS_pept        385638..385973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0383"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0383"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0383"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08399"
FT                   /protein_id="CAL08399.1"
FT                   /translation="MANQYSGNFEQIVKNRFKCSAREILLKCQREGLSYQDAEKVLGFK
FT                   HVTIRKWAKRFDIKLPPRFRSHDEHLEQRREIAYVNQCKLNKINKRNVFSRCWINMNLY
FT                   SVIKAKS"
FT   CDS_pept        complement(385946..386797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psd"
FT                   /locus_tag="FTF0384c"
FT                   /product="phosphatidylserine decarboxylase proenzyme"
FT                   /EC_number="4.1.1.65"
FT                   /note="Similar to PSD_VIBVU (Q8DCV8) Phosphatidylserine
FT                   decarboxylase proenzyme from Vibrio vulnificus (285 aa).
FT                   FASTA: opt: 797 Z-score: 972.5 E(): 2.8e-46 Smith-Waterman
FT                   score: 797; 45.221 identity in 272 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0384c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08400"
FT                   /db_xref="GOA:Q14J65"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033178"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14J65"
FT                   /inference="similar to sequence:UniProtKB:PSD_VIBVU"
FT                   /protein_id="CAL08400.1"
FT                   /translation="MRDNLFIYLQYLLPHTLTSRLVSKLADSENKIIKNHLIKLAIKKF
FT                   NINLVEAKETDISKYKSFNDFFIRELKDDLRPISNDKNVISSPADGVLSQFGTITDNSL
FT                   IQAKGKLFSLESLIASSSTTSFTKFATIYLSPKDYHRVHMPIDGKLTKMVYIPGKLFSV
FT                   NKITTSKVDNLFAKNERLICYFDTIIGEIAVIFVGALLVAGIETVWHGKIAPNYYKDIQ
FT                   TWDYNSAKFNIKFNKGDILGWFNFGSTVIILTSGNNVSFKFEENKNNIKIQVNQDLALI
FT                   TE"
FT   CDS_pept        386897..387877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0385"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0385"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0385"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08401"
FT                   /protein_id="CAL08401.1"
FT                   /translation="MRNTIKIVILLSLGMLLQNCATSDVENDFSYENLTDTISGSPFRN
FT                   RKYDYARVKVSEEPALKIPTGLNGEKIKPALKLPDGDNNYARSQVNEAQKQMLPPNYAD
FT                   KFDMEKIISDQISKVSISIVYDDTGSLKLVFREPLSITINLLDNYFKEHPDSYVITTEK
FT                   DEILSGHLITVKDIKKDLIFVILARKVDELSSLVKVNVVFTSDGKTLAPNHIDEGVRIL
FT                   SDIRKDLNNTELKNDNNIEIAKQAEANLAASEANPKNGKSSLGGLLGSKKSSFGFGSYD
FT                   RKIDNSLEQQKTNTNQEQQQDYTQMTAPADDKVYDSQAQPQVLNT"
FT   CDS_pept        387886..388929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadM"
FT                   /locus_tag="FTF0386"
FT                   /product="Nicotinamide-nucleotide adenylyltransferase"
FT                   /EC_number="2.7.7.1"
FT                   /EC_number="3.6.1.-"
FT                   /note="Similar to NADM_SYNY3 (Q55928) Bifunctional NMN
FT                   adenylyltransferase/NUDIX hydrolase from Synechocytis sp.
FT                   (339 aa). FASTA: opt: 766 Z-score: 937.1 E(): 2.6e-44
FT                   Smith-Waterman score: 766; 37.168 identity in 339 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0386"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08402"
FT                   /inference="similar to sequence:UniProtKB:NADM_SYNY3"
FT                   /protein_id="CAL08402.1"
FT                   /translation="MYDISVFIGRFQPFHKGHLHNIIIALQNSKKVIINIGSCFNTPNI
FT                   KNPFSFEQRKQMIESDLQVAGIDLDTVVIEPLADYFYQEQKWQDELRKNVYKHAKNNNS
FT                   IAIVGHIKDSSSYYIRSFPEWDYIGVDNYKNFNATEFRQKFYNGIISKQYMCSNDPKLG
FT                   TYNFLTKFMDTQVYQDLVAENNYVIEYKRLWLKAPFKPNFVTVDALVIVNDHILMVQRK
FT                   AHPGKDLWALPGGFLECDETIAQAIIRELFEETNINLTHEQLAIAKRCEKVFDYPDRSV
FT                   RGRTISHVGLFVFDQWPSLPEINAADDAKDVKWISLGSNIKNICDRMLEDHYQIITILL
FT                   EECGKKL"
FT   CDS_pept        388943..390310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="FTF0387"
FT                   /product="UDP-N-acetylglucosamine
FT                   pyrophosphorylase/glucosamine-1-phosphate
FT                   N-acetyltransferase"
FT                   /EC_number="2.7.7.23"
FT                   /EC_number="2.3.1.57"
FT                   /note="Similar to Q9KNH7 UDP-N-acetylglucosamine
FT                   pyrophosphorylase from Vibrio cholerae (453 aa). FASTA:
FT                   opt: 1597 Z-score: 1863.6 E(): 6.5e-96 Smith-Waterman
FT                   score: 1597; 53.201 identity in 453 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0387"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08403"
FT                   /db_xref="GOA:Q14J62"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14J62"
FT                   /inference="similar to sequence:UniProtKB:Q9KNH7"
FT                   /protein_id="CAL08403.1"
FT                   /translation="MGLSVVILAAGKGSRMNSNKPKVLQTLAAKTLIEHVVSSVEKLNP
FT                   DNIVVVTGHLKEQVEDALQGRNITFVYQQQQLGTGHAVLQALPYLKEQKVLILYGDVPL
FT                   ISTEVLENLVDTTNDDDLGVLTAFVENPQGLGRIVRDKFGAVTEIVEEKDANDIQRQIK
FT                   EINTGIYCVHKNLLQKWLPEIKANNVQKEYYLTDIITFAKADHVSINVTHPINEFEILG
FT                   VNDRTQLASLERVWQRNVAEKIMAKGVSIADPNRFDVRGNLDVGKDCWIDINVIIKGNV
FT                   KLGNNVVIGANCILKNCIIEDNVRIKSNSMVDGSIIREGAIVGPFARVRPECDVKEGAV
FT                   IGNFVEAKKTILGKGSKASHLTYLGDSEIGANCNIGAGVITCNYDGVNKHKTVIGDYAF
FT                   IGSDSQLIAPVNIGQGATVGAGSTIVKDVPADNLVISRARQRHIDTWQRSVKKTDK"
FT   CDS_pept        390331..392169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="FTF0388"
FT                   /product="Glucosamine--fructose-6-phosphate
FT                   aminotransferase"
FT                   /EC_number="2.6.1.16"
FT                   /note="Similar to AAP96623
FT                   Glucosamine--fructose-6-phosphate aminotransferase
FT                   (isomerizing) from Pseudomonas putida (610 aa). FASTA: opt:
FT                   2168 Z-score: 2578.6 E(): 9.7e-136 Smith-Waterman score:
FT                   2168; 53.257identity in 614 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0388"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08404"
FT                   /inference="similar to sequence:INSDC:AAP96623"
FT                   /protein_id="CAL08404.1"
FT                   /translation="MCGIVGANSTRNVTNILIEGLKKLEYRGYDSAGLAIIDDKNNIDI
FT                   CKEVGKVIELEKSVHNLANFKGDIGIAHTRWATHGKPSKNNSHPHASESFCIVHNGVIE
FT                   NFAELKKVLINDGYKFKSDTDTEVIAHLLQKEWRDNFSIVDNIKYIMAMLKGAYAVAII
FT                   SQKFSDKIVAVRSGSPLVIGVGIDENFISSDALSLLPVTNKFSYLDEGDIAIISKDNVE
FT                   VFDNNGAAKNLEVEEYNYSSSSASKDGYKHYMLKEIYEQPEAVSNTILASLADGEISLD
FT                   SFDKRAKELFEKTKHICIVACGTSYNAGMTAKYWIEKYAKVPCSVEIASEIRYRDNVVV
FT                   DGSLFVSISQSGETADTLESLRKSKKQNYVGSMCICNVPNSSLVRESDIAFMTKAGVEI
FT                   GVASTKAFTTQLVALAIFTLVIAKLKNSLTDQQIAKYTEELKNIRALVMGALKLDTEID
FT                   QISEYFSDKEHTIFLGRGLYYPIAIEGALKLKEISYIHAEAYPSGELKHGPLALVDKNM
FT                   PIVAVVPNDELLDKTLSNLQEVHARGGKLILFVDKAVKERVNFDNSIVLELDAGHDFSA
FT                   PVVFTIPLQLLSYHVAIIKGTDVDQPRNLAKSVTVE"
FT   CDS_pept        392253..392777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0389"
FT                   /product="Acetyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="Similar to Q9RWR2 Acetyltransferase, putative, from
FT                   Deinococcus radiodurans (188 aa). FASTA: opt: 188 Z-score:
FT                   245.7 E(): 8.5e-06 Smith-Waterman score: 188; 28.105
FT                   identity in 153 aa overlap ORF ftt0389"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0389"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08405"
FT                   /inference="similar to sequence:UniProtKB:Q9RWR2"
FT                   /protein_id="CAL08405.1"
FT                   /translation="MDMNFNKSLYYCDISLQIMTQNDFDRLYSVAKDPEIWTQHNDKSR
FT                   SELDGFRKYFDGGLNNPQNCYLIFYKKDLVGSTRYYEYDSNAKSIKIGYTFYAKKYWGT
FT                   DLNGKVKKLMVDYAFKFVDDVFFDVWDKNFRSQKAVAKLGAKFYCHNIAQQKFIFRLTN
FT                   KDWQSSNSLIK"
FT   CDS_pept        complement(392770..392967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsU1"
FT                   /locus_tag="FTF0390c"
FT                   /product="30S ribosomal protein S21"
FT                   /note="Similar to RS21_VIBCH (Q9KUJ9) 30S ribosomal protein
FT                   S21 from Vibrio cholera (71 aa). FASTA: opt: 212 Z-score:
FT                   304.1 E(): 4.8e-09 Smith-Waterman score: 212; 55.224
FT                   identity in 67 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0390c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08406"
FT                   /db_xref="GOA:Q14J59"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14J59"
FT                   /inference="similar to sequence:UniProtKB:RS21_VIBCH"
FT                   /protein_id="CAL08406.1"
FT                   /translation="MLSIKVDERKPFDISLRNFKRACEKAGIKQELRDRQHYVKPTEKR
FT                   KIAKRQAVKRARISQRRAFI"
FT   CDS_pept        complement(392967..393170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspC"
FT                   /locus_tag="FTF0391c"
FT                   /product="cold shock protein"
FT                   /note="Similar to Q8D6M5 Cold shock protein from Vibrio
FT                   vulnificus (70 aa). FASTA: opt: 272 Z-score: 403.6 E():
FT                   1.4e-14 Smith-Waterman score: 272; 58.571 identity in 70 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0391c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08407"
FT                   /inference="similar to sequence:UniProtKB:Q8D6M5"
FT                   /protein_id="CAL08407.1"
FT                   /translation="MNNKSQGTVKFFNEQKGFGFITPENGGKDVFVHISKLNGETLAEG
FT                   QQVTFETQEGRKGPEAINIEVL"
FT   CDS_pept        complement(393418..393747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0392c"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Q8TT97 Hypothetical protein MA0540 from
FT                   Methanosarcina mazei (95 aa). FASTA: opt: 151 Z-score:
FT                   197.5 E(): 0.0038 Smith-Waterman score: 151; 35.789
FT                   identity in 95 aa overlap ORF ftt0392c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0392c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08408"
FT                   /inference="similar to sequence:UniProtKB:Q8TT97"
FT                   /protein_id="CAL08408.1"
FT                   /translation="MQIKQAQQTIAELFKDIIHPRLASFIALSEEVGELANEIMKKEIY
FT                   EETNDNQKIKAELTDVFVSLLELANVYNIDLETEFIEKIQTLEPRVQQWNKAKALLKAK
FT                   RTKLD"
FT   CDS_pept        393874..394644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="FTF0393"
FT                   /product="methionine aminopeptidase"
FT                   /EC_number="3.4.11.18"
FT                   /note="Similar to Q886P4 Methionine aminopeptidase,type I
FT                   from Pseudomonas syringae (260 aa). FASTA: opt: 1243
FT                   Z-score: 1568.2 E(): 1.9e-79 Smith-Waterman score: 1243;
FT                   70.120 identity in 251 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0393"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08409"
FT                   /inference="similar to sequence:UniProtKB:Q886P4"
FT                   /protein_id="CAL08409.1"
FT                   /translation="MSQIIIKTPQEIEKMRVAGRLAAEVLEMITPFVKEGVTTAELDKI
FT                   CHEYIVKEQDAYPAPLNYHGFPKSICASINHVVCHGIPADKKLKNGDILNIDITVKKDG
FT                   YHGDTSKMFMIGEPSVMAKKLVEVTHECLWKGIEVVKPGNHFGDIGAAIEKHAKKFGYS
FT                   IVDAFCGHGIGANFHEPPHVMHHGKAGTGAMFEEGMIFTIEPMINIGKRAVSVLKDGWT
FT                   AVTKDRSLSAQWEHTILVTKDGYEVLTLREEEKN"
FT   CDS_pept        394646..395494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0394"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0394"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0394"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08410"
FT                   /protein_id="CAL08410.1"
FT                   /translation="MPKQVTQKLVNQKCDLLRSQNEEITVSKVRKLIGEGVSIIDLVEK
FT                   VTLYKEDKKQALEVAEQEILEPNQPVRDELLEIIRASLKQFDVDRDDIAFSLRSDIMQY
FT                   IQQQISNNISKLKHKQAELSNKNDSLEISNISLDRRYKELLEKYNQIKEEAYSLKQNYN
FT                   SKSMKFLEKETTEKMLLAWEDFKGIKEQLVSLKMYSKVAAYDKSGVIVIKFPATDFLTQ
FT                   ECRAGVSRYLKAKTVFDYSIQAWVLSGFRDILKTLDFLQRNKFVFSKELETIAYLRRQK
FT                   S"
FT   CDS_pept        395540..396253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0395"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Q9L5J1 hypothetical protein from
FT                   Salmonella typhi (259 aa). FASTA: opt: 585 Z-score: 707.5
FT                   E(): 1.6e-31 Smith-Waterman score: 680; 46.743 identity in
FT                   261 aa overlap ORF ftt0395"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0395"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08411"
FT                   /inference="similar to sequence:UniProtKB:Q9L5J1"
FT                   /protein_id="CAL08411.1"
FT                   /translation="MAKFLNMSATNYYLEEMIKNASDRLILISPYLKLNDRIKELLEDK
FT                   NRLKIDVRIVYGKSELQPAEISWLNELTFVRTSFCKNLHAKCYMNETSCIITSLNLYEF
FT                   SQINNNEMGVYISRDDDSEMYRETYDEAQRIIRISEEVRISLQKIDKSKQDNVVDKGAN
FT                   QVESEAVKLTSSKLASKYKIKTADLMEKLVLLEFVIKDKNGEYHLTEKGILVGGEAKKG
FT                   RYGDYIIWPESLVIE"
FT   CDS_pept        396386..398611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parC"
FT                   /locus_tag="FTF0396"
FT                   /product="DNA topoisomerase IV subunit A"
FT                   /EC_number="5.99.1.-"
FT                   /note="Similar to Q8ZI43 DNA topoisomerase IV subunit A
FT                   from Yersinia pestis (757 aa). FASTA: opt: 2399 Z-score:
FT                   2652.6 E(): 7.4e-140 Smith-Waterman score: 2454; 51.436
FT                   identity in 731 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0396"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08412"
FT                   /inference="similar to sequence:UniProtKB:Q8ZI43"
FT                   /protein_id="CAL08412.1"
FT                   /translation="MDLFSSLESTRSVAEFSEQAYLNYSMYVILDRALPHISDGLKPVQ
FT                   RRIIYAMSEIGLSHLSKYKKSARTVGDVLGKYHPHGDSACYEAMVLMAQDFSYRYPFID
FT                   GQGNWGSIDDPKSFAAMRYTESRLSKYAVLLLDELKKGTVDWAKNFDGTMDEPKLLPAQ
FT                   VPNILLNGAMGIAVGMSTYIPPHNITEIINACLQLLSKPNSTIEEILEIVEAPDYPGGA
FT                   NIISSKEEIADVYKSGNGSIRQQAVYEYDNHSNVVITKLPHQVSSAAVMEQIANELKQQ
FT                   KITWIKNIQDESDDKEPVKIVLYSATIKKNIKKIMGHLLATTDLEKSFRVNMNMIGLDN
FT                   RPQVKNLLDILNEWLEYRKHTLRRRLQTSLDKVLDRLHILEGLLIAFLNIDEVIDIIRN
FT                   YDDSSGELQTRFTLSEIQAEAILNIRLRKLAKIEEIEIKKEQKELQKERELLEGYLNSE
FT                   VKFRNLMKKEFKQILTDFGDSRRSKIIVAEKAQALEEKDLMPSEKVTIILSKAGWIRCA
FT                   KGENIDPAGLSYKPEDKPFLVTTGNSNIKLVFFSKLGKAYSMYIDKLPSARGYGEHITT
FT                   YIPLDKQDQIISMAFVNAARYFLIASESGKAFVIPAEDLITNKVTGKNIFDADDVFKFI
FT                   PYDKDLKMLAVSSQGRAIIRDFASFALLKKGKGKSIIRLDKKDKLKFIELFRANQELTL
FT                   NAGKRFIRIDSKNIETYYSYKPSGGGVLLPQGFRKITKIDIENIESE"
FT   CDS_pept        398611..399297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtn"
FT                   /locus_tag="FTF0397"
FT                   /product="5'-methylthioadenosine\S-adenosylhomocysteine
FT                   nucleosidase"
FT                   /EC_number="3.2.2.16"
FT                   /EC_number="3.2.2.9"
FT                   /note="Similar to Q9PJ10
FT                   5'-methylthioadenosine\S-adenosylhomocysteine nucleosidase
FT                   from Campylobacter jejuni (229 aa). FASTA: opt: 756
FT                   Z-score: 944.6 E(): 1e-44 Smith-Waterman score: 756; 53.982
FT                   identity in 226 aa overlap."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0397"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08413"
FT                   /inference="similar to sequence:UniProtKB:Q9PJ10"
FT                   /protein_id="CAL08413.1"
FT                   /translation="MRKIAILGAMEIEILPILAKLDNYETIEYANNKYYLANYQDKELV
FT                   IAYSKIGKVFSSLTATIMIERFGVEALLFSGVAGGLQDLKVGDMIAATATVQHDVDITA
FT                   FGYPYGKIPISEVEIKTSAKLLKQAQNVANELGLNLHTGVIATGDQFVHCAERKDFVIK
FT                   EFDAKAIEMEGASVNLICNEMGVPSLILRSISDTADGDAPENFDEFAKMAAKRSANFIM
FT                   QILSNI"
FT   CDS_pept        complement(399284..399883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0398c"
FT                   /product="hypothetical membrane protein"
FT                   /note="ORF ftt0398c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0398c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08414"
FT                   /protein_id="CAL08414.1"
FT                   /translation="MFNNYNLLTTNLFVVYLILRIFTFLPKRLLLLAILILLCFNFISI
FT                   TSDNQTIFYFVTGFINYFSFSSFILLIFIIATTFASKRITIFPYTSIAFLLIIFIFYGS
FT                   FFIVSYSLYDIGYSAYLVLACVFAYGLILLVISNRFILFNIIIVIATVAYFSGILQGNI
FT                   WDYLLDPILLVICIIEISRALITTKNKQHKDKIIYY"
FT   CDS_pept        complement(399876..400994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0399c"
FT                   /product="BNR/Asp-box repeat protein"
FT                   /note="Similar to Q885D8 BNR/Asp-box repeat protein from
FT                   Pseudomonas syringae (432 aa). FASTA: opt: 536 Z-score:
FT                   654.4 E(): 1.5e-28 Smith-Waterman score: 536; 31.922
FT                   identity in 307 aa overlap ORF ftt0399c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0399c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08415"
FT                   /inference="similar to sequence:UniProtKB:Q885D8"
FT                   /protein_id="CAL08415.1"
FT                   /translation="MKHKLKLVLLFAFIYLILLLVFYYYHIQHNYSFSISTPRNDSITK
FT                   NLDIKTIANLKYFKYNHASSMTTIDNKLFITWYSSDQETAPNTKIVVAVAEKVAGKWHF
FT                   NEIKPVMNRQEFQSIFKKHIHHLGNPIIYSQAKRLWLVFTSSSGGWVTSSLNIMYSDDL
FT                   GKTWSQPKTILSSNILNFSTLTRGAAIELDNNRFAIPVYKEFNNLNGRWFVFNKDGELI
FT                   FVSEMTNDGVNLQPTVVPLSKTHALALYRQMHSPIKRIYTNETSDSGLSWSKVKPTQLD
FT                   NPDSGIAAIKIQNGILLAYNNATDSRADLSLAFKADNSQQWRNIYTFPNKIKGELSYPT
FT                   FTPYQDNIILAFSDKTKGTIRIVEIKGENSNV"
FT   CDS_pept        401193..403169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slt"
FT                   /locus_tag="FTF0400"
FT                   /product="soluble lytic murein transglycosylase"
FT                   /EC_number="3.2.1.-"
FT                   /note="Similar to Q88L07 Soluble lytic
FT                   transglycosylase,putative from Pseudomonas putida (657 aa).
FT                   FASTA: opt: 596 Z-score: 646.0 E(): 3.9e-28 Smith-Waterman
FT                   score: 819; 27.822 identity in 629 aa overlap."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0400"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08416"
FT                   /inference="similar to sequence:UniProtKB:Q88L07"
FT                   /protein_id="CAL08416.1"
FT                   /translation="MINKKFITSCLLILSSTIGYSLTTQQVEYSQKAIDALAKKDYKSY
FT                   YYYKSKLKDTSIYPYLQYKEISTDPDIFQQTTIDEYFKQDNNSYWQNRLSDDLAQYYAQ
FT                   KQEWKLFDKYYKGDLSISGKCWSMQAEYESGDKNKALNEYGQLWQNRVYMPAACNPMQK
FT                   YWDNSDYKPSSYLTTKAYTLAFANKFDDSLWLLNTYVKDNKDYLNYITAWKQATKDPRK
FT                   LDSFINRFHNYNHFDKVFVDISRDLIRKDVESYAKVWNNLKNKRYLSTKVKQQTISAIA
FT                   VSFARSQSPQAQQWLSKVDKNYLDTTAWEWLLRVDLYNENFKDYIQTYNQLPKNSQQDQ
FT                   AWRYWLAYSYQQTGQKAKAEDIFESLTKTPLDYYSFLAADKLGKPYNFGNDVATALTNS
FT                   ETKKLLTEDTTVQAIDLYQIGQYKDSTSIWQWAIRNKLRDKQIDEIKQLARLAEDKQMY
FT                   YAAIFNMSVIGSYNSIDMLFPKAFINIVNQNAQKFAIDKDLVLSIMRKESLFDISAGSS
FT                   AGAKGLMQVTEPTAKFIAQKYKLSLVGDSSQGMTSQIFIPENNIKLGTANLYFLEKLFD
FT                   KNPVLGIAAYNAGPGNVAKWLNENEVPAAIWIENIPFGETRHYVRKVLMYMIVYNNFVF
FT                   KDKKDHISNFLGYKISDKQSFRK"
FT   CDS_pept        403459..404181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0401"
FT                   /product="hypothetical protein"
FT                   /note="Partial homology to carboxy terminus of Q9CLV4a
FT                   Hypothetical protein PM1097 from Pasteurella multocida (417
FT                   aa). FASTA: opt: 269 Z-score: 330.3 E(): 1.7e-10
FT                   Smith-Waterman score: 269; 26.050identity in 238 aa overlap
FT                   ORF ftt0401"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0401"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08417"
FT                   /protein_id="CAL08417.1"
FT                   /translation="MFIIVISTFIIWIDDIVKLGQVRTSLARSEKYAYENIKKYVKDPY
FT                   MGCNKFTVVKKLKSVPIYAGKYSFLTGISLENLNILCEKINAKVYIIRRNGEHLISSDV
FT                   VAYVSSSKPLSQEIFDEVVKNFIFSQERSYSEDSLFGLTILSEISAKAFFNNDPGTVIK
FT                   VIDSLTDILDCLFEIKPSQNVIYKNLYVKEIAIEEIIKSSFENIRSYGSSNILVAKRLQ
FT                   KSLAHIAKQLQNDEKNLF"
FT   CDS_pept        404538..408017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaE"
FT                   /locus_tag="FTF0402"
FT                   /product="DNA polymerase III alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="Similar to DP3A_SALTY (P14567) DNA polymerase III
FT                   alpha subunit from Salmonella typhimurium (1160 aa). FASTA:
FT                   opt: 3099 Z-score: 3288.3 E(): 2.6e-175 Smith-Waterman
FT                   score: 3099; 44.781identity in 1121 aa overlap."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0402"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08418"
FT                   /inference="similar to sequence:UniProtKB:DP3A_SALTY"
FT                   /protein_id="CAL08418.1"
FT                   /translation="MISHLRVHTGYSVVDSTVRLGDLFARAKDKNIVAVALTDVCNLFA
FT                   AVKFYKQALASGIKPIFGVELKVDTEFGICDLVLLAENNQGYQNIVKLVSKAYQEADRF
FT                   GSIPLIPKSWLSEVKLESVICLNGGQQGELGKAILAKDYIKADEIIKQNIEIFGTNNYI
FT                   IEIHKLEYENEGLYNEKALEYASKYNLIAVATNLTVFMEADDYDIHEIRACINEKTTIL
FT                   DESRKSKFTKEQYLKSADEMYETFSALPVLVDNTLAIAKRCNVTFELGKPCLPTVNIPA
FT                   GLTEKEYFSKLCYQGLDKRLEKILENRSADKHEHIIKVYKDRLQREIDIICDMGFPGYF
FT                   LIVEDFIRWSKENDIPVGPGRGSGAGSLVAYSLLITDIDPLPYGLLFERFLNPERVSMP
FT                   DFDIDFCIQGRDRVIKYVEQKYGKESVAQIITYGTMAAKGVVRDVVRVMGQSFGFGDRI
FT                   AKLIPETPGTTFKKILHEGETLYEEVQADEDVAEIIEKAQKLEGLPRSLGKHAAGIVIS
FT                   PTKISDFAPVYCENKGGDIVTQFDKGDVEDVGLVKFDFLGLKNLTIINNTVKSINAKRP
FT                   ADQKPLDIADIPLDDQKTFKLLQAGNTTGIFQLESQGMRQIVKDLGTSNFEEIIALVAL
FT                   YRPGPMENIPTFIDRKHSRKQITYLHPLLEGVLKETYGIPVYQEQVMQMAQKLAGYTLG
FT                   GADLLRRAMGKKKPEEMEKQRKIFKEGAAKHHNIDTKLADEIFDQMEAFAGYGFNKSHA
FT                   AAYALIAYQTAWLKAHYPDEYMAALMSGDMGNTDQLVKFILDCKNMSITVLAPNVNKSV
FT                   YDCIAVSKGTILLGLGAIKGLGGEAIKSILTERDIAGEFSSIFDLCRRVDLRKVNKKAL
FT                   EALCYAGAIKDISKNRATAFNSIEKAIKNAGYVNEMNAAGQDDLFGFTEQESDTDAELE
FT                   RECIVEEWNLKELLINEKKALGMYFSGHIIDEESHWRNHVSFSDLEKIQQPNMDGNSVR
FT                   IIASMITPPARRKTKTGRVLYIINIDDEFDRADCLISEEVFASVKDSIEVDDIVVVEGK
FT                   VSRDVQRECNKLSVDKVQPISQYIDENFSKVELTLRSQNINPTNLKKVLSNLKENIAST
FT                   NIQKQNILEITVSLGDVDGKFDYLQKPFSIYKFVNDVSKLIAEGSTVSLSGV"
FT   CDS_pept        408093..408728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def1"
FT                   /locus_tag="FTF0403"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="Similar to DEF_LEPIN (Q93LE9) Peptide deformylase
FT                   from Leptospira interrogans (178 aa). FASTA: opt: 312
FT                   Z-score: 399.2 E(): 2.4e-14 Smith-Waterman score: 312;
FT                   35.758 identity in 165 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0403"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08419"
FT                   /inference="similar to sequence:UniProtKB:DEF_LEPIN"
FT                   /protein_id="CAL08419.1"
FT                   /translation="MMVVNIKMQQMKSQFIQYNDSNNKVLYQKCKPVADIQNAEIQNII
FT                   TEMHEKMQGNGIGLAANQIGYPYQIFMIEFDSSNARYPFSFDSVPYQVFINPKITKASK
FT                   QRVSFWHGCLSALGEKRGKLATYKEIEYEAYNQHGEKITGKLDSIAAIIFQHEFNHLLG
FT                   SVYVDFDTEYIDNEELQAKFASGELKPYQECGEEVPLLLEKYQIGKNI"
FT   rRNA            complement(408791..408905)
FT                   /gene="5S rRNA"
FT                   /product="5S ribosomal RNA"
FT                   /note="uncertain boundries"
FT   CDS_pept        409432..410694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lolC"
FT                   /locus_tag="FTF0404"
FT                   /product="lipoprotein releasing system, subunit C,putative
FT                   membrane protein"
FT                   /note="Similar to Q83CV1 Putative lipoprotein ABC
FT                   transporter,permease protein from Coxiella burnetii (414
FT                   aa). FASTA: opt: 1273 Z-score: 1436.4 E(): 4.1e-72
FT                   Smith-Waterman score: 1273; 48.104 identity in 422 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0404"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08420"
FT                   /inference="similar to sequence:UniProtKB:Q83CV1"
FT                   /protein_id="CAL08420.1"
FT                   /translation="MFKSLPLFIGLRYIRAKKRNRFISIISAISFLGISLGVAVLITVM
FT                   SVMNGFDQQIKSKILMMVPPLKVYQLGGEVTDWPNLAKEVEKSTPSVTAVAPIVESQGL
FT                   LSANSGSSTTAFVQIQGIEPKYQTKVLPIAEHIVDGKLSSLDDNQGYNIVLGSVLADNL
FT                   GVKVGDKVTLIVPKISLTPAGMIPRIKQFRVSGIFSVSYQYDAYYAMINIKDAQKVFET
FT                   GNSVSSLQLSVKNIYDAPLVKDKLNDGAIPPYYFTRDWTDENKSFFDALKMEKTMMFFI
FT                   LLLIITVAVFNLLSSLVMVVTDKRSDIAILRTMGMSSRQIITVFIYQGFIIGLIGTVIG
FT                   VLLGILLSTYATEIVNFIQNLTGKQFLSASVYLINYIPSELMWSDVIKVTLVSMFLSFL
FT                   ATLYPAWSASKVQPVEALRYE"
FT   CDS_pept        410687..411382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lolD"
FT                   /locus_tag="FTF0405"
FT                   /product="lipoprotein releasing system, subunit D, ABC
FT                   transporter, ATP-binding protein"
FT                   /note="Similar to LOLD_NEIMA (P57030) Lipoprotein releasing
FT                   system ATP-binding transport protein from Neisseria
FT                   meningitidis (231 aa). FASTA: opt: 791 Z-score: 892.8 E():
FT                   7e-42 Smith-Waterman score: 791; 51.770 identity in 226 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0405"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08421"
FT                   /db_xref="GOA:Q14J44"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011924"
FT                   /db_xref="InterPro:IPR015854"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14J44"
FT                   /inference="similar to sequence:UniProtKB:LOLD_NEIMA"
FT                   /protein_id="CAL08421.1"
FT                   /translation="MNDVVLSCKNVSKKYTEFKTDIAILKDVNLEIKKGEKVAILGLSG
FT                   SGKTTLLNVLGGLDKCSAGEVYLMGERFDNQSVNKRAKMRNKHLGFIYQLHHLLPEFTA
FT                   IENVMIPLAITKKYTKKESIKLANEILKKVGLDHRADHKPAELSGGERQRVAIARALVT
FT                   NPNCILADEPTGNLDSQRSESIFALMQQLSDDFGTSFVIVTHDEKLASRMNKIYRLVDG
FT                   ELELVINSN"
FT   CDS_pept        411499..413640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cadA"
FT                   /locus_tag="FTF0406"
FT                   /product="lysine decarboxylase, inducable"
FT                   /EC_number="4.1.1.18"
FT                   /note="Similar to DCLY_ECOLI (P23892) Lysine decarboxylase,
FT                   inducible from E. coli (715 aa) FASTA: opt: 2608 Z-score:
FT                   3095.0 E(): 1.7e-164 Smith-Waterman score: 2608; 53.912
FT                   identity in 703 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0406"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08422"
FT                   /inference="similar to sequence:UniProtKB:DCLY_ECOLI"
FT                   /protein_id="CAL08422.1"
FT                   /translation="MKTVVFVYKDTLKSYKEKFLLKIEKDLKNHHEYYTLKLDDLSEVV
FT                   EILEENSRICCIVLDRASFNIEAFHNIAHLNTKLPIFVASDYSQSIKLNLRDFNLNINF
FT                   LQYDALAGEDSDFIHKTITNYFNYILPPLTYELFKYSKSFNSAFCTPGHQGGYGFQRSA
FT                   VGALFYDFYGENIFKTDLSISMKELGSLLDHSEAHKDAEEYISKVFKSDRSLIVTNGTS
FT                   TANKIVGMYSVADGDTILVDRNCHKSVTHLMMMVDVNPIYLKPTRNAYGIIGGIPKKEF
FT                   KRETIQEKIDNSNIADKWPEYAVVTNSTYDGILYNTDTIHRELDVKKLHFDSAWIPYAI
FT                   FHPIYKHKSAMQIEPRPEHIIFETQSTHKLLAAFSQSSMLHIKGDYNEEVLNEAFMLHT
FT                   STSPFYPIVASVETAAAMMEGEQGYNLIDKTINLAIDFRRELIKLRSEANGWFFDVWQP
FT                   DNISNKEAWLLRNGDKWHGFKNVDGDFLSLDPIKITILTPGIKDNDVQDWGVPADVVAK
FT                   FLDEHDIVVEKSGPYSLLFIFSLGTTKAKSVRLISVLNKFKQMYDENTLVEKMLPTLYA
FT                   EDPKFYEDMRIQEVSERLHQYMKEANLPNLMYHAFNVLPEQQLNPHRAFQKLLKGKVKK
FT                   VPLVELYEHTSAVMILPYPPGIPVIFPGEKITEESKVILDFLLMLEKIGSMLPGFDTDI
FT                   HGPERAKDGKLYIKVIDDK"
FT   CDS_pept        413732..414808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvT"
FT                   /locus_tag="FTF0407"
FT                   /product="glycine cleavage complex protein T
FT                   (aminomethyltransferase)"
FT                   /EC_number="2.1.2.10"
FT                   /note="Similar to GCST_PSEAE (Q9HTX5) Probable
FT                   aminomethyltransferase from Pseudomonas aeruginosa (360
FT                   aa). FASTA: opt: 1204 Z-score: 1494.5 E(): 2.4e-75
FT                   Smith-Waterman score: 1204; 51.532 identity in 359 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0407"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08423"
FT                   /db_xref="GOA:Q14J42"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR022903"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14J42"
FT                   /inference="similar to sequence:UniProtKB:GCST_PSEAE"
FT                   /protein_id="CAL08423.1"
FT                   /translation="MLKTPLYESHMAANAKMVDFSGWSMPINYGSQIQEHNNVREDCGI
FT                   FDVSHMLAVDIQGSEAEKFLRYLLANDVAKLQENKAQYGCMLNHDAGIVDDLITYKVTD
FT                   EHFRIVVNAGNRESDVAWFNQNAQNFDVAITPQTDLAIVAVQGPKAVAVIKRVVTKEIA
FT                   TEIEALLPFSFKFFSKWMVARTGYTGEDGFEVILPATQVKKFWDSLLENGAQPAGLGAR
FT                   DTLRLEAGMHLYGADMDTSTTPLERGLGWSVDLSDEHRDFIGKKAYFAKKAQGVDTKWV
FT                   GVVLKTKGVLRAGQEIDFDNGEKGYITSGSFSPTLKVAIGLAYVPKQADNPVVNIRGKE
FT                   LEVELVKPKFVKNGKSLI"
FT   CDS_pept        414864..415247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvH1"
FT                   /locus_tag="FTF0408"
FT                   /product="glycine cleavage system H protein"
FT                   /note="Similar to Q8FE66 Glycine cleavage system H protein
FT                   from E coli (130 aa). FASTA: opt: 526 Z-score: 699.9 E():
FT                   4.3e-31 Smith-Waterman score: 526; 60.938 identity in 128
FT                   aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0408"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08424"
FT                   /inference="similar to sequence:UniProtKB:Q8FE66"
FT                   /protein_id="CAL08424.1"
FT                   /translation="MSNIPKELKYTKSHEWVKIDGDEVTVGITAHAQSLLGDLVYVELP
FT                   EIGKEFAAGDDSCVVESVKAASDVYAPVDGEVIEINEALVDDPSRVNHTPYKDGWLFKL
FT                   KISDESQLADLLTADAYAKTLED"
FT   CDS_pept        415311..416678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvP1"
FT                   /locus_tag="FTF0409"
FT                   /product="glycine cleavage system P protein, subunit 1"
FT                   /EC_number="1.4.4.2"
FT                   /note="Similar to Q82WQ4 Putative glycine cleavage system
FT                   P-protein from Nitrosomonas europaea (453 aa). FASTA: opt:
FT                   1718 Z-score: 2097.5 E(): 6.1e-109 Smith-Waterman score:
FT                   1718; 55.310identity in 452 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0409"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08425"
FT                   /db_xref="GOA:Q14J40"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="InterPro:IPR023010"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14J40"
FT                   /inference="similar to sequence:UniProtKB:Q82WQ4"
FT                   /protein_id="CAL08425.1"
FT                   /translation="MSFIPHKLEQIKKMLDTIGASSVDQLFDEIPRHLRADTLKIKDGI
FT                   NEIQLANLMRKRANKNHHNINYIGAGAYSHHIPAAIWDIVARGEFYTAYTPYQAEASQG
FT                   GLQVIYEFQTMMAGLTGMDASNASMYDGATALAESVLMAIRSNKKAKSQKVLIAEALHP
FT                   TYLRVLETITKHQGIEFDIVNLDSKNGKTDVTKLEDFANTNYAAVVIQSPNFLGQLADV
FT                   DGITNWAHKHGALVIAVTNPMSLAILKSPAEWGDNGADIVCGEGQPMGVPLASGGPYFG
FT                   FMTCKMAHVRQMPGRIVGRTVDLDGNEGFCLTLQAREQHIRRAKATSNICTNQGLMVTA
FT                   ATIYMSLLGAEGLERVASISHENTQTLATELAKINGVSIRFNSAFFNEVVIDLPVNAET
FT                   FVTEMEKEAIDAGYFLGEYHSDLANSIMVCATEIHTSEDIKEYIEATKKVLARIGG"
FT   CDS_pept        416684..418129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvP2"
FT                   /locus_tag="FTF0410"
FT                   /product="glycine cleavage system P protein, subunit 2"
FT                   /EC_number="1.4.4.2"
FT                   /note="Similar to Q83B09 Putative glycine cleavage system P
FT                   protein, subunit 2 from Coxiella burnetii (491 aa). FASTA:
FT                   opt: 2055 Z-score: 2482.9 E(): 2.1e-130 Smith-Waterman
FT                   score: 2055; 63.071identity in 482 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0410"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08426"
FT                   /inference="similar to sequence:UniProtKB:Q83B09"
FT                   /protein_id="CAL08426.1"
FT                   /translation="MVIFEKTRGKNSPSVMPSKKGDVSNIPTDMLRTKKPILPEQAELD
FT                   VVRHYTQLSRKNFCIDTNFYPLGSCTMKYNPRAAHKYASLAGFLERHPYASAQSVQGTL
FT                   ECLYDLQNLIKELTGMTGVSLAPMAGAQGEFAGVAMIKAYHHKRSDFERDEIIVPDAAH
FT                   GTNPATAKVCGLKVIEIPTKKDGDIDIEALDKVLGPKTAGIMLTNPSTVGVFERNIAVI
FT                   AKKVHEAGGLLYYDGANLNAIMGKACPGDMGFDVLHMNLHKTFATPHGGGGPGAGPVAV
FT                   NDKLKEFLPVPMVGKKDDKFVWLEEKDVSNTIGRLSAFNGNIGVLIRAYIYGAMLGGNG
FT                   LTEASEIATLNANYMMARLKEEGFTIAYPDRRASHEFIVTLKPEFLNYGVTATDFAKCL
FT                   IDKGVHAPTMYFPLLVPECLLIEPTETENVDSMEKFIQAMVEIRDIAKKDPQYLKGAPY
FT                   NLPARRLDDVKATKELDIVWQPK"
FT   CDS_pept        complement(418249..419094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE2"
FT                   /locus_tag="FTF0411c"
FT                   /product="Shikimate 5-dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="Similar to Q8FQC7 Putative shikimate 5-dehydrogenase
FT                   from Corynebacterium efficiens(269 aa). FASTA: opt: 283
FT                   Z-score: 321.7 E(): 4.6e-10 Smith-Waterman score: 287;
FT                   28.077 identity in 260 aa overlap."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0411c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08427"
FT                   /inference="similar to sequence:UniProtKB:Q8FQC7"
FT                   /protein_id="CAL08427.1"
FT                   /translation="MSDLFKIPLNTKTKLLFSTSGSNSSIQRHNTAIQKLDFNLCYFTF
FT                   SGEISAQIYTDAIRAPFVNGGTVTAHNGLKSKVIPFLDYVEPLAKQTLAVNTIINKDGK
FT                   LYGYNTDCYGLHTALTKGIKESKQDIKTAIIYGNGGVSGVAFKVLQDLGIKVTIVGRNA
FT                   DKVAQKRKELGIENIPHFEAPYDLVIDATPISSSPELEQNTQFIDLVKHAKIVFCHAMP
FT                   EKDNKKNYLLEYCNQNGIFYISGEDMYIAQLIKQYKLYFENLDSQRKITEEDIIEAWGL
FT                   "
FT   CDS_pept        complement(419120..422332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pulB"
FT                   /locus_tag="FTF0412c"
FT                   /product="pullulonase"
FT                   /EC_number="3.2.1.41"
FT                   /note="Similar to Q8XK16 Pullulanase from Clostridium
FT                   perfringens (1064 aa). FASTA: opt: 3419 Z-score: 3958.4
FT                   E(): 1.4e-212 Smith-Waterman score: 3419; 48.369identity in
FT                   1042 aa overlap Other FASTA hits have lower scores due to
FT                   generally being smaller in size. Q8XK16 is an electronic
FT                   annotation"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0412c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08428"
FT                   /inference="similar to sequence:UniProtKB:Q8XK16"
FT                   /protein_id="CAL08428.1"
FT                   /translation="MQATNQNIWIQDKFGNFTHLNATHQVYLDFETNSIRFRIQADGFL
FT                   HGYVIANFNNWQKLEEYKLTWTTDNDDGSLWLTKDVFNISTLNAGTNQYSFILVSLAGE
FT                   EFKVSINDHDLIPLSFNWQVAKGTLEIKASENYVVSGFNLELIAITKSITGYQNIVDVE
FT                   WQVSPQNSKITLTNGKLLIDPSVSNLTEVKVSCFAKNNPDLKAERIFTVIKEKRKGSLV
FT                   HLIKKDQQYKGENFDWDLWNFNKNKPAYSVSLSHRSDFGLYGLCQKKNVIARKRIWDIN
FT                   WHNDWAEQTSCFKISKKHQNYYIVHGDATIYRSLEDVINKTNPRIIHAVMNEASQIIAY
FT                   LSDIPRIGTSFELWVNSKKVENVGLIVKHRSKQLIFTGLPPINPHDLVEIRANNTFSAA
FT                   KVLMGEYLNNFYYPNNIGVSFSDELISLRIWSPTAIKVEVLIYNEDLDNNKKQPDVVHE
FT                   LTAERSYGTHHIEICRKNYENKYYIYRLYFEDLDNKGQRCIKTTYAVDPYAYGVGLNGR
FT                   KGFLVDLNNPKVTPEQWQQSHNPNCLNREDAIIYEAHLRDFTISPESGVSEELRGKYLG
FT                   AVENNTYYIDSATNQKVSTGIDSLVELGVTHIHLLPIFDFSSVDEEKNNEKDNRNWGYD
FT                   PQNYNAPDGSYSINPYDPLQRIRGARNMILGFHQKGIGVIMDMVYNHMTETSNLDKIIP
FT                   KYYFRTDALGNFTNGSGCGNELASEKPMVSKFIQDSVIHWVKNYKIDGIRFDLMELIDI
FT                   NTIKNIVSKVKQINPNVIIYGEPWKGGDSPLINGTHRGTQRNQQFSIFNDYFRDAIRGN
FT                   NNPGNGFINGDPHNPSNIGNVIEGLRGSIYSLTAMPGESVNYIDAHDNYTLWDQVEKSQ
FT                   SHDIPQGYYRKNLPENIFEHRFVRQNALALGIILTAQGIPFIHGGSEFLRTKQGDHNSY
FT                   KSGDNINAFHWSDKLRYKAFFDYIAGLIRIRKEHPAFRMRDRETIEKHLNMTTAHHDSK
FT                   SGVIISHFKNNANGDSWQDIIVIYNATSIDGYDVNALMPIPAGKIWHIVANHEKAGVDT
FT                   IQTVNSSELPGLKSYSLMIIHS"
FT   CDS_pept        complement(422366..424288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgB"
FT                   /locus_tag="FTF0413c"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /EC_number="2.4.1.18"
FT                   /note="Similar to Q8XPA2 Amylase from Clostridium
FT                   perfringens (674 aa). FASTA: opt: 2904 Z-score: 3529.1 E():
FT                   1.1e-188 Smith-Waterman score: 2904; 62.128 identity in 639
FT                   aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0413c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08429"
FT                   /db_xref="GOA:Q14J36"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14J36"
FT                   /inference="similar to sequence:UniProtKB:Q8XPA2"
FT                   /protein_id="CAL08429.1"
FT                   /translation="MKNKNSEQNTHSTIGEQDIHYFHEGKHIYAYEFMGAHKACEEGIE
FT                   GIRFTTWAPNAKSICVIGDFNYWQVEDKNYMEPITDAGLWSVFIPNAKNGDKYKFVVTN
FT                   KDTNHYVYKSDPYAFFSELRPNTASIITTETQYTWSDDKWLEKRAKTNYYDNPMNVYEL
FT                   HLASWKTKNGKFLTYDELSETLPQYIKEMGYTHVEFMPLHEHPLDASWGYQPTGFYSVN
FT                   SRHGDIIGLKRLVDKLHNNDIGVILDWVPGHFCKDQHGLIYFDGSPCYEYQEPTKAINK
FT                   GWGTHNFDLGRNEVKCFLISNAMYWINEFHIDGLRVDAVSNILYLNYDREDGQWIPNIY
FT                   GGHENLEGIAFLKELNGVLKHTCKGVITIAEESSSWPDISTPVEKGGLGFDFKWNMGWM
FT                   NDTLRYISLDPVYRKYHHNLITFSMVYHYSEKFILSISHDEVVHGKKSLINKMWGDLWN
FT                   KYAGLRLYMSYMIGHPGKKLIFMGSEFVQFVEWREYEQLQWQVVDQYESHKQTLHFFKK
FT                   LNDFYHNETALWQCDYNHHGFRWIDADNSQQSILSFIRSSKDNKQKLIFICNFTPVTYY
FT                   DYHLGVPDAGSYKEVFNSDNLEFGGSGQVMATEIFSSLQSSHGFEQRITIKIPPMATLV
FT                   LKLIK"
FT   CDS_pept        424590..426224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgm"
FT                   /locus_tag="FTF0414"
FT                   /product="Phosphoglucomutase"
FT                   /EC_number="5.4.2.2"
FT                   /note="Similar to Q985P1 Phosphoglucomutase from Rhizobium
FT                   loti (542 aa). FASTA: opt: 2295 Z-score: 2680.5 E():
FT                   2.1e-141 Smith-Waterman score: 2295; 61.694 identity in 543
FT                   aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0414"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08430"
FT                   /inference="similar to sequence:UniProtKB:Q985P1"
FT                   /protein_id="CAL08430.1"
FT                   /translation="MAIQTVSTKPFANQKPGTSGLRNKVIAFQQPRYLENFVQSIFNSL
FT                   DDIEGKTLVVGGDGRYYNDVAIQIIVRMAAANGFAKIIVGQNGIFSTPAVSCVIRKYEA
FT                   FGGIVLSASHNPGGPKGDFGIKYNVSNGGPAPEKITDRIFSETKKINQYFISDAAKESV
FT                   DLDKLGTYKIENTTVEVINSVIDYAELMQQIFDFDKVRELFAKGFKVRFDSMCAVSGPY
FT                   AKYIFETLLKAPAGTVVNAQPLEDFGGFHPDPNPVNAEDLVKHMRSGKYDFGAASDGDA
FT                   DRNMIVGKQIDVSPSDSLAIMAANAHLIPVYSKGIKGVARSMPTSTAVDRVAESLRLPC
FT                   FETPTGWKFFGNLLDAEKITLCGEESYGTGSNHIREKDGVWAVLFWLNLVAVTGKQVDQ
FT                   LVEEHWQKFGRNFYSRHDYEAIDTAIANSIIDSLRERLSSLVGAQLNDEKVAKADDFSY
FT                   IDPIDGLVSNHQGIRIIFEDGSRIVFRLSGTGTQGATLRIYLEKYESDSSKFSIPTQQA
FT                   LASLIEIAEDLTNIKSLTGMTEPTVVT"
FT   CDS_pept        join(426258..427394,427390..427527)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgC"
FT                   /locus_tag="FTF0415"
FT                   /product="Glucose-1-phosphate
FT                   adenylyltransferase,pseudogene"
FT                   /EC_number="2.7.7.27"
FT                   /note="Similar to GLGC_ECOLI (P00584) Glucose-1-phosphate
FT                   adenylyltransferase from E coli (430 aa). FASTA: opt: 1820
FT                   Z-score: 2287.0 E(): 1.7e-119 Smith-Waterman score: 1820;
FT                   59.198identity in 424 aa overlap"
FT                   /inference="similar to sequence:UniProtKB:GLGC_ECOLI"
FT   CDS_pept        427540..429009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgA"
FT                   /locus_tag="FTF0416"
FT                   /product="glycogen synthase"
FT                   /EC_number="2.4.1.21"
FT                   /note="Similar to GLGA_YERPE (Q8ZA78) Glycogen synthase
FT                   from Yersinia pestis (476 aa). FASTA: opt: 1689 Z-score:
FT                   2081.4 E(): 4.8e-108 Smith-Waterman score: 1689; 54.321
FT                   identity in 486 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0416"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08432"
FT                   /db_xref="GOA:Q14J34"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14J34"
FT                   /inference="similar to sequence:UniProtKB:GLGA_YERPE"
FT                   /protein_id="CAL08432.1"
FT                   /translation="MRVLHVCSELYPILKTGGLADVTAALPPALAGFGVDSRVLVPGFP
FT                   AFINAIKDKQLLINIPSRFGAEEINIFLAKISNTKIDIYVIDAPSLFARPGNPYADSSN
FT                   QAYADNYLRFALLGWVAARISEGLDAKWKPEIVHSHDWHAGLVPAYIKASELASGKKAV
FT                   KTVFTVHNLAYQGLFPMSVFAELDLPGIFLSMNGLEFYGQVSFMKAGLYFADKITTVSP
FT                   TYAKEIQIYEQGCGLEGLLADRHNDLYGVLNGVDPQIWNPKKDSLIATNYSSTTVATGK
FT                   AKCKLALQQMMGLAEKEDALLFGIVTRLTEQKGLNLLIEAIGEITSRGGQIVLLGSGDK
FT                   ALEEVFLAAAKKYSKSIAVQIGYDEEQAHRIIAGSDVIMVPSRFEPCGLTQLYGLTYGT
FT                   LPLVHKVGGLADTVIDSSLENLADGTATGFVFDEFSVESLTLAIRRAFALYNRKTDWKK
FT                   VRKTAMQQQVTWDSSAEKIYQIYKNLVRENN"
FT   CDS_pept        429114..431387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malP"
FT                   /locus_tag="FTF0417"
FT                   /product="maltodextrin phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /note="Similar to Q8DN49 Maltodextrin phosphorylase from
FT                   Streptococcus pneumoniae (752 aa). FASTA: opt: 2938
FT                   Z-score: 3443.0 E(): 6.9e-184 Smith-Waterman score: 2938;
FT                   59.569 identity in 742 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0417"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08433"
FT                   /inference="similar to sequence:UniProtKB:Q8DN49"
FT                   /protein_id="CAL08433.1"
FT                   /translation="MNEKNQIKLHLEKILNCDVSAANDQDLYYALLTYAKDQTAKLPEQ
FT                   DYKKKIYYISSEFLIGKMLISNLINLGVYNEVCQILKESGKDIVQIEEFEPEPSLGNGG
FT                   LGRLAACFLDSIASLGIPGTGISLNYHYGLFKQKFKNHCQNEKPNPWIEKLGWLNKKDT
FT                   SYKVDFNDFSVESQLYEIDVVGYQNNFVNKLCLFDITSVDASVIEDNITFDKTAIEKNL
FT                   TLFLYPDDSDEAGHLLRIFQQYFMVSNAVSLIFSDITKKGYSLANLPEHAVVQINDTHP
FT                   TLVIPELIRQLVANGIDIDKAIELVSKTAAYTNHTILAEALEKWPLRYLEKVLSKEIID
FT                   IIKYLDKKVKQQYKQADLAIIDANNCVHMAHICIHYSFSVNGVAALHTDILKKAELKHF
FT                   NEIYPNKFNNKTNGITFRRWLLQANPELTNYLKSLIGDSFVQDSKQLEKLLVYHNDKNV
FT                   LAKLDEIKKTKKAQFIEFASYYSGVELLENGIFDVQIKRIHEYKRQQMNALYIIHKYLE
FT                   IKSGLYPKPERPINFIFGGKAAPAYIIAKDVIHLILCLQELINNDADVNQYIRVLFVEN
FT                   YNVSIAEKLIPAADISEQISLASKEASGTGNMKFMLNGAITLGTMDGANVEIADLVGSA
FT                   NIYTFGKDSNTIIDLYKTSGYKAIEYYNNPVIKNAVDFITSPTMLAIGDKNKLTRLFNE
FT                   LINKDWFMTLIDFVEYIKVKDKMLRDYENREDWLRMSLVNTAMSGFFSSDRTIGQYNKY
FT                   IWKI"
FT   CDS_pept        431431..432894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malA"
FT                   /locus_tag="FTF0418"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /note="Similar to Q8XHY6 4-alpha-glucanotransferase from
FT                   Clostridium perfringens (497 aa). FASTA: opt: 1343 Z-score:
FT                   1590.1 E(): 1.1e-80 Smith-Waterman score: 1343; 41.344
FT                   identity in 491 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0418"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08434"
FT                   /inference="similar to sequence:UniProtKB:Q8XHY6"
FT                   /protein_id="CAL08434.1"
FT                   /translation="MRKAGLLLAISSLPSWFGIGDLGKSAYEFVDILKQASIRIWQVLP
FT                   LTTLGFGNSPYQSSSSFAGDEIYISLEKLADYGLLEESSLKKLNANSKKVEYELVRNFK
FT                   DNYLEEAFSNFQSSKDKFEQEYSDFITQNSWVKNYAIFKAFRKVNNNQAWNFWPAEYKN
FT                   WVKEKAIELDQFQQEIDYQIFLQFIFYKQWFELREYANKNNIEIMGDLPIYLGFDSADV
FT                   WEHQEVFLLDEDQNPSFVAGVPPDFFSETGQLWGNPLYDWDKLKETNFNFWIDRLNGNF
FT                   KLFDIVRIDHFRAFDTYWKIPASEKTAINGEWVEAPGYDFFDTVYKRIPDANIIAEDLG
FT                   DLRDEVFELRDHYNLKGMKVFPFHFDLKTARFIDDANIIAYSGTHDNNTLKGWYFDELN
FT                   RYQRKLLKRYFKANDKNIFSKIIKYLLSCEAEYVILPVQDVLELDGTARLNTPGTVGAP
FT                   NWEWKLVDFNLLKSKTNRLAKQVSKSINH"
FT   CDS_pept        432968..433876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="FTF0419"
FT                   /product="Glycyl-tRNA synthetase alpha chain"
FT                   /EC_number="6.1.1.14"
FT                   /note="Similar to SYGA_COXBU (P94616) Glycyl-tRNA
FT                   synthetase alpha chain from Coxiella burnetii (319 aa).
FT                   FASTA opt: 1545 Z-score: 1938.6 E(): 4.3e-100
FT                   Smith-Waterman score: 1545; 73.720 identity in 293 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0419"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08435"
FT                   /inference="similar to sequence:UniProtKB:SYGA_COXBU"
FT                   /protein_id="CAL08435.1"
FT                   /translation="MKILISMLTFQEIILKLHHYWASKGCAIVQPLDMEVGAGTFHPAT
FT                   TLRAIGPEPWTAAYVQPSRRPTDGRYGENPNRTQHYYQYQVVMKPSPDDIQELYLGSLR
FT                   ELGIDPLENDIRFVEDNWESPTLGAWGLGWEVWSNGMEITQFTYFQQVGGLECKPVMGE
FT                   ITYGLERLAMYIQNVDSMYDILWANTQNGPLYYRDVFLQNEVEMSTYNFEEANVEELFK
FT                   QFDLLEKEGYRLVEKNLPIPAYEFVLKASHTFNLLDARHAISVTERQGYILRVRKLALE
FT                   VAKEYYSAREKSGFPAFKKDN"
FT   CDS_pept        434087..435526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="FTF0420"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate
FT                   ligase"
FT                   /EC_number="6.3.2.13"
FT                   /note="Similar to MURE_NEIMB (Q9K0Y9)
FT                   UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-
FT                   diaminopimelate ligase from Neisseria meningitidis (492
FT                   aa). FASTA: opt: 1037 Z-score: 1223.7, E(): 2.9e-60
FT                   Smith-Waterman score: 1037; 40.795 identity in 478 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0420"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08436"
FT                   /inference="similar to sequence:UniProtKB:MURE_NEIMB"
FT                   /protein_id="CAL08436.1"
FT                   /translation="MKRINQILKFLDIKTLSQNNFQIESLYLDSRKCDKKSVFVALKGL
FT                   STDGNKYIDSVLAKGVSLVLTDSHEFEDQKRVFYIQNLKEKLSTLAKWFYDYEKPQNII
FT                   GITGTNGKTSISSYIAQFLDLSAQKTLLLGTNGNGIYPDLRESTHTTLDILSLYKTISY
FT                   YKNYQNLVMEVSSHSLDQKRVEGLDFDVAIFSNLSHDHLDYHKTMDNYFEAKAKLFQFK
FT                   RLKKAIINIDDEYGQRLCNMTQVPVITVSLKSEYADVYIKPKSIEGIKTKFEMFFNGRF
FT                   VGEYTTKLIGDFNLMNLGLSFASLDGVLDWDCILDLGNIKPVKGRMEVIELDNDIKIVI
FT                   DYAHTPDALEKALQTLNSYNPNNLWCIFGCGGNRDTSKRPIMAQIAEEYASKIVITEDN
FT                   NRFESIENIFSDIRKGFKYPQKHIFITSREQAIRFSIENANQGDIILLASKGHECYLDK
FT                   NGAKEYFDEREIIKNMPEHSL"
FT   CDS_pept        join(435608..435838,435838..435963)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0421"
FT                   /product="outer membrane lipoprotein, pseudogene"
FT                   /note="Similar to Q8ZRH1 Putative outer membrane
FT                   lipoprotein from Salmonella typhimurium (119 aa). FASTA:
FT                   opt: 327 Z-score: 429.7 bits: 84.9 E(): 4.4e-16
FT                   Smith-Waterman score: 327; 43.860 identity in 114 aa
FT                   overlap ORF ftt0421"
FT                   /inference="similar to sequence:UniProtKB:Q8ZRH1"
FT   CDS_pept        436318..437676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="FTF0422"
FT                   /product="UDP-N--acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate-D-alanyl-D-alanyl
FT                   ligase"
FT                   /note="Similar to Q87SG8
FT                   UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate
FT                   -D-alanyl-D-alanyl ligase from Vibrio parahaemolyticus (454
FT                   aa). FASTA: opt: 870 Z-score: 1005.8 E(): 3.9e-48
FT                   Smith-Waterman score: 870; 35.011 identity in 457 aa
FT                   overlap deleted EC_number 6.3.2.15"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0422"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08438"
FT                   /inference="similar to sequence:UniProtKB:Q87SG8"
FT                   /protein_id="CAL08438.1"
FT                   /translation="MIKSLKQLAIQAGLEYLGEDVSIQTVAINSNEVRQDCLFVAIVAN
FT                   RDGHEFIPSAIANGAKAILVSKKQGLDIPQVVCGNTIKGLRALAKEYRKSLTMPIISLT
FT                   GSCGKTSVKEMIVTLLGERKVHFTQGNLNNYLGVPMTILETPHDVDFAVIEAGTNVGGE
FT                   IKAAADIIQPNIAMITNVGACHLENLKTLDGVMIEKGELLKALPRDGFCIVNLDDERIP
FT                   NYAKLLECKKISCSMTNPKADILVLDYRATSNSYAFKIRIFSQEYDYQLPNIGKHNLFN
FT                   SVLAIASVVAVGLEPKDFLQNTQNIKNYKGRFSTEKLSDKLTLIDDTYNASAGAVQAAI
FT                   EDLAEFDGKKILAISSMRELGDEAENYHRKMGQWLKKANLDKIFLFGEKNLIDYVLAEY
FT                   SNQNAKYYESKDELNNDLAKILDEYKSQSTKLTVKGARSFKMEEVVKFVKENL"
FT   CDS_pept        437685..437864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0423"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0423"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0423"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08439"
FT                   /protein_id="CAL08439.1"
FT                   /translation="MKRLFAILVFVLLVSVSFGKDIIKYPLIESNVLCDSVRPFCGDNC
FT                   SNMPFYPTLCKPTE"
FT   CDS_pept        437995..438504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0424"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0424"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0424"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08440"
FT                   /protein_id="CAL08440.1"
FT                   /translation="MPCKVSEDGKTANCRCKVFTGPNYVNIDGIMNLGVYYKTVAVCGK
FT                   DGSKCKNLFTCLPDGSGDCKGVEAPVCKYIANQNTQDDSISFIPGADLISTYGFDMNKD
FT                   YDIAKPGEGVKCQNIDVAGCMTQPCKYEKGSKEYATCSCPITNMKTMMLSQKGVSCDLP
FT                   KGYVWE"
FT   CDS_pept        complement(438560..439654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asd"
FT                   /locus_tag="FTF0425c"
FT                   /product="aspartate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0425c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08441"
FT                   /protein_id="CAL08441.1"
FT                   /translation="MLKVGFIGWRGMVGSVLMSRMIESKDFDCILPTFFSTSQVGQLPT
FT                   GFMQQYGALQDAYSIDQLSSMDILLSCQGGEYTKEIHHKLREAGWQGFWIDAASTLRLD
FT                   KDSTLVLDPLNHDQIINAIDNGKKDFIGSNCTVSLMSLAIAGLLKEDLVEWVNSSTYQA
FT                   ISGAGAAAMQELLQQTSLLSKIDNRDEDILIREKILRELSKDSSKIPQQKTVQTLAYNL
FT                   LPWIDVGMPSGQTKEEYKAATELNKILDTKKTIPVDGICVRVPSLRSHSQALTVKLRQK
FT                   LTIEEIKQKISQGNEWVKVIDNNKEDTLKYLTPQANSGTLDIAIGRIKSSLLADDIFHC
FT                   FTVGDQLLWGAAEPLRRVLNIIKI"
FT   CDS_pept        join(439717..440574,440696..442006,442028..442165)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrA"
FT                   /locus_tag="FTF0426"
FT                   /product="bifunctional aspartokinase/homoserine
FT                   dehydrogenase I (pseudogene)"
FT                   /EC_number="1.1.1.3"
FT                   /EC_number="2.7.2.4"
FT                   /note="Similar to Q8A541 Aspartokinase/homoserine
FT                   dehydrogenase from Bacteriodes thetaiotamicron (811 aa).
FT                   FASTA: opt: 1065 Z-score: 1231.9 E(): 1e-60 Smith-Waterman
FT                   score: 1346; 32.025 identity in 815 aa overlap"
FT                   /inference="similar to sequence:UniProtKB:Q8A541"
FT   CDS_pept        join(442171..442668,442652..442948)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="FTF0427"
FT                   /product="homoserine kinase (pseudogene)"
FT                   /EC_number="2.7.1.39"
FT                   /note="Similar to Q8PLH7 Homoserine kinase from Xanthomonas
FT                   axonopodis (306 aa). FASTA: opt: 458 Z-score: 540.1 E():
FT                   3.1e-22 Smith-Waterman score: 563; 36.246 identity in 309
FT                   aa overlap"
FT                   /inference="similar to sequence:UniProtKB:Q8PLH7"
FT   CDS_pept        442964..444250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrC1"
FT                   /locus_tag="FTF0428"
FT                   /product="threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /note="Similar to Q9PBC1 Threonine synthase from Xylella
FT                   fastidiosa (430 aa). FASTA: opt: 1211 Z-score: 1454.3 E():
FT                   4.1e-73 Smith-Waterman score: 1211; 46.472 identity in 411
FT                   aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0428"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08444"
FT                   /inference="similar to sequence:UniProtKB:Q9PBC1"
FT                   /protein_id="CAL08444.1"
FT                   /translation="MNFISTRDKNIKVSLSEAMQSGLAPDGGLFVLERFPTVNWQSFAK
FT                   DISYAKFAANTLREFFKGDQLEDSLDKICNNAFTFEVPVRRLDKTTSVLELFHGPTLSF
FT                   KDFGARFLANCLSSIDSEKPFTILVATSGDTGSAVAAAFHGKSNIRVIVMFPKGKISKR
FT                   QEKQITCWGDNIQAVEVEGVFDDCQSLVKEAFKTPWWTERTKLNTSNSINIGRLLPQST
FT                   YYAYTSWQHYLQTGEKANYIVPSGNIGNITAAFWAKQMGFPIGEISMSLNANDTVVDYL
FT                   ETGKFNPKASVETLANAMDVGNPNNFERLLYLLGNYENFKANVKAICVSDFEIIEEIKQ
FT                   VYRQYHEVVCPHTATGFVAKNQLDSNKDYIIVATAHPAKFESVIEPILDIQVPPTPALQ
FT                   KLLDKEQNKVVINKSMDELCEVYTKAFEA"
FT   CDS_pept        complement(444351..444581)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ebgA"
FT                   /locus_tag="FTF0429c"
FT                   /product="Beta-galactosidase I, fragment"
FT                   /note="Similar to Q8FA02 Beta-galactosidase I from
FT                   Leptospira interrogans (658 aa). FASTA: opt: 260 Z-score:
FT                   363.2 E(): 2.4e-12 Smith-Waterman score: 260; 50.000
FT                   39dentity in 76 aa overlap"
FT                   /db_xref="PSEUDO:CAL08445.1"
FT                   /inference="similar to sequence:UniProtKB:Q8FA02"
FT   CDS_pept        444891..445325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speH"
FT                   /locus_tag="FTF0430"
FT                   /product="S-adenosylmethionine decarboxylase"
FT                   /EC_number="4.1.1.50"
FT                   /note="Similar to SPEH_METJA (Q57763) S-adenosylmethionine
FT                   decarboxylase proenzyme from Methanococcus jannaschii (124
FT                   aa). FASTA: opt: 355 Z-score: 487.2, E(): 3e-19
FT                   Smith-Waterman score: 355; 44.737 identity in 114 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0430"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08446"
FT                   /inference="similar to sequence:UniProtKB:SPEH_METJA"
FT                   /protein_id="CAL08446.1"
FT                   /translation="MGSGKWPEHNNQICDNLHQDHFIQESVRYAGNHLIVDFWGASKLD
FT                   CLETMEVAMREAVEKAKATLLHIHLHHFTPNGGISGVAVLAESHISVHTWPEYGFAAFD
FT                   IFMCGDSKPNKAIEVLESYFKPKTNNVSKFRRGEVVEVVN"
FT   CDS_pept        445325..446194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speE"
FT                   /locus_tag="FTF0431"
FT                   /product="spermidine synthase"
FT                   /EC_number="2.5.1.16"
FT                   /note="Similar to SPEE_ECOLI (P09158) Spermidine synthase
FT                   from E coli (287 aa). FASTA: opt: 1117 Z-score: 1364.5 E():
FT                   4.1e-68 Smith-Waterman score: 1117; 55.357 identity in 280
FT                   aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0431"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08447"
FT                   /inference="similar to sequence:UniProtKB:SPEE_ECOLI"
FT                   /protein_id="CAL08447.1"
FT                   /translation="MIANINNKKIFHETLYHSYHQSIAISEILYEHKTDYQHLVIFNNP
FT                   IFGNVMVLDGIVQTTEKDEFIYHEMLVHVPVIAHGNVKNILIIGGGDGGMLREALSHKA
FT                   VESVTLVEIDQAVIDMCQEYFPGHSKGAFDHPKAKIVIQDGCEFVKNPPRKYDLIICDS
FT                   TDPIGPGEVLFTSKFYKDCKEAINPGGIMVTQNGVIYFQIDELKKTLERFEPLYKDVSF
FT                   YTAAVPTYVGGSMAFGWGTDELSYRNHDIQVIAQRFLKSGIKTKYYNPAIHIAAFALPQ
FT                   YVIDTLKK"
FT   CDS_pept        446220..447629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speA"
FT                   /locus_tag="FTF0432"
FT                   /product="putative arginine decarboxylase"
FT                   /EC_number="4.1.1.19"
FT                   /note="Similar to Q8A2B1 Putative arginine decarboxylase
FT                   from Bacteroides thetaiotamicron (630 aa). FASTA: opt: 571
FT                   Z-score: 678.2 E(): 6.9e-30 Smith-Waterman score: 689;
FT                   28.755 identity in 546 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0432"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08448"
FT                   /inference="similar to sequence:UniProtKB:Q8A2B1"
FT                   /protein_id="CAL08448.1"
FT                   /translation="MNKNLFLTANLSEYFSYNSLGQLCINYADGYRKTIPIVDFLQQAN
FT                   FQGATYPLVLYFEHILKNQLDKLYTSFGKAIDDFSYTCKYSLAYPIKVNPEQKIIKAIY
FT                   DYHQHNQVSLDYEVGTKSEFLAVLSTAAKTQKIICNGFKDLSFYKIAQLAAKIGYKIII
FT                   VIENISEINIIQDLLDNNVNIKFDFGIRTKPFDNCIHTQKFGLSLSQINECINFLKTNQ
FT                   LQQKLLLLHSHIGSQIKSTDKVVANIQRLMRIYSELKSDFVNLEYIDFGGGLAVNYDEY
FT                   DRPSYDFDSYAKNIIKNCKYYAEYYNCDMPSIVTESGRAITAESSLLITKPLIKQHESD
FT                   IENEILHQQWLDREVSLGELQSYLPQNQKNTQQAWLNFSIFQSLPDHWGIDQKFPILPL
FT                   EFFNSYVTSEVKLYDISCDVDGVVKSTSEYIEIATDNIEYIVFMCVGAYQGMLSAKHNM
FT                   LGNISAVNIYR"
FT   CDS_pept        447679..447867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0433"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0433"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0433"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08449"
FT                   /protein_id="CAL08449.1"
FT                   /translation="MLDQYGYNSLRIQSNLKRYYYYHQEEINQEEEEFLDNLFIDNPYM
FT                   GEITSQQGGINYAIMAG"
FT   CDS_pept        447848..448834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0434"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Q8KCB6 Hypothetical protein CT1508 from
FT                   Chlorobium tepidum (347 aa). FASTA: opt: 742 Z-score: 939.4
FT                   E(): 2e-44 Smith-Waterman score: 837; 38.484 identity in
FT                   343 aa overlap PAD_porph is a possible virulence factor for
FT                   P. gingivalis: PMID: 10377098 ORF ftt0434"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0434"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08450"
FT                   /inference="similar to sequence:UniProtKB:Q8KCB6"
FT                   /protein_id="CAL08450.1"
FT                   /translation="MLLWPAEWEEHSATWMIWPARIDMWPNITKAYEIYAKVANTIAKY
FT                   EPVNMVVNQHQLDIAKKYLGKNMTLISEAVDDSWARDIMPIFSFKADKLIANNFDFNCW
FT                   GNKFSPFDNDRRLKNDIAKQQKWQVNSSKMILEGGAVHSNGQGVLLTTKECLLNLNRNP
FT                   NMQKEQIESELISILGVKKILWLPYGVAGDFDTDGRVDNVACFANKNTIIIQSCYDEND
FT                   ENFARHQANMTYLDKYASEFNIVEIPQPRAQYFAGERLALSYLNFYIVNNAIIMPAFGD
FT                   PNDVIAFEILQKCFKDRSIEQLNIIDLVIGGGGIHCITMQQPAIKEI"
FT   CDS_pept        448836..449696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0435"
FT                   /product="Carbon-nitrogen hydrolase family protein"
FT                   /EC_number="3.5.-.-"
FT                   /note="Similar to Q87NU4 Putative carbon-nitrogen hydrolase
FT                   from Vibrio parahaemolyticus (288 aa). FASTA: opt: 1139
FT                   Z-score: 1419.0 E(): 3.8e-71 Smith-Waterman score: 1139;
FT                   57.971 identity in 276 aa overlap. Possible candidate for
FT                   citrulline ureidase ORF ftt0435"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0435"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08451"
FT                   /inference="similar to sequence:UniProtKB:Q87NU4"
FT                   /protein_id="CAL08451.1"
FT                   /translation="MANIKVAVVQLSFNDNEAENLAKLESKIIQAAKNGAKIILTPELP
FT                   SYLYFCKKQNSKYFDLAKTIDESPIVKLYKLLAHKYNIVLPASFFERDGNACYNSIAMI
FT                   DADGSIMGVYRKAHIPDGIGYQEKYYFSPGSAGFKVWDTKYAKVGVGICWDQWFPEAAR
FT                   VMALKGAEILLYPTAIGSEPHLPDYDSKDHWQRVMQGHAAANMLPVLASNRYATEANDD
FT                   ITATYYGSSFITDHTGDKIAEADRSGDDILYATFDFAELQQQRFYWGLFRDRRPELYDE
FT                   IVRKY"
FT   CDS_pept        complement(449713..450429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxH"
FT                   /locus_tag="FTF0436c"
FT                   /product="UDP-2,3-diacylglucosamine hydrolase"
FT                   /EC_number="3.6.1.-"
FT                   /note="Similar to Q87YP9 UDP-2,3-diacylglucosamine
FT                   hydrolase from Pseudomonas syringae (248 aa). FASTA: 374
FT                   opt: 569 Z-score: 703.6 bits: 137.6 E(): 2.7e-31
FT                   Smith-Waterman score: 569; 38.528 identity (40.0900ngapped)
FT                   in 231 aa overlap (7-229:2-231)"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0436c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08452"
FT                   /inference="similar to sequence:UniProtKB:Q87YP9"
FT                   /protein_id="CAL08452.1"
FT                   /translation="MAHNKDIYLISDLHLNANHAEMADLFKKFLDSITSTQNQLFILGD
FT                   FFDYWIGDNHRDDFYHKITNWLKEASDQGLEIFFMYGNRDFLIGRKFAKQSGVTLIKDP
FT                   YYIDISKQKILFSHGDLFCTDDKSYQIYRKWIAYNPILRFIFRRLPLFIREYTARNVRK
FT                   ASYVKNRKNPNVDVTTKGIEKYRKDYDIIIHGHTHKMAVHIADNYTRYVLGDWFKDGNY
FT                   IKISKNGEIMQVRALN"
FT   CDS_pept        complement(450419..451045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="FTF0437c"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="Similar to PYRE_ECOLI (P00495) Orotate
FT                   phosphoribosyltransferase from E.coli (212 aa). FASTA: opt:
FT                   693, Z-score: 862.6, E(): 3.7e-40 Smith-Waterman score:
FT                   693; 49.275 identity in 207 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0437c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08453"
FT                   /inference="similar to sequence:UniProtKB:PYRE_ECOLI"
FT                   /protein_id="CAL08453.1"
FT                   /translation="MFIEFALKNQVLKFGEFTLKSGRISPYFFNAGLFNTGAQLATLAD
FT                   YYAQLIIKSDVKYDILFGPAYKGIPLVAAISTVLALKYNIDMPYAFDRKEAKDHGEGGV
FT                   FVGADMTNKKVLLIDDVMTAGTAFYESYNKLKIINAKIAGVVLSIDRQEKAKDSDISAT
FT                   KKISQDFNIPVLAVTNFESIFEYVKENLDETMIDKFKQYRQKYGS"
FT   CDS_pept        451205..452575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mpl"
FT                   /locus_tag="FTF0438"
FT                   /product="UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-me
FT                   so-diaminopimelate ligase"
FT                   /EC_number="6.3.2.-"
FT                   /note="Similar to MPL_ECOLI (P37773)
FT                   UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-
FT                   diamino pimelate ligase (murein peptide ligase) from E coli
FT                   (457 aa). FASTA: opt: 1392, Z-score: 1656.5, E():
FT                   2.3e-84,Smith-Waterman score: 1392; 47.912 identity in 455
FT                   aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0438"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08454"
FT                   /inference="similar to sequence:UniProtKB:MPL_ECOLI"
FT                   /protein_id="CAL08454.1"
FT                   /translation="MSKHIHILGICGTFMGSLAVLAKQKGYKVTGSDLNVYPPMSTYLE
FT                   SQGIEILQGFDCDQLDTNPDEIIIGNIMKRGMPIIEKILAEKLNYFSGPEWLYQNILKY
FT                   KKVIAIAGTHGKTTTTTMTIKILEQAGLNPSFLVGGVSSDFGVSSRYTDSEYFVIEADE
FT                   YDTAFFDKRSKLIHYDPSIFVINNIEFDHADIFKDIDAIFWQFHQLLRKMPSTAKIIYN
FT                   AKDDNVQKIISMGCWSELVKVNSDLGISITKHTLDYSKFELCDINGNSVEVSWGLIGEH
FT                   NALNAMSAYAVAKQLNISDEMVKDALESFRGVKRRLEVLSHQDNVTLYDDFAHHPTSIK
FT                   LTLEAVRNKAKDAYVVALIDPRSNTMRQGDNKDNLPMSIIEADRVLLYNHNLLKWDAKE
FT                   VLKNSNNVDFIADVDDFVDCVDKLLTKHQDRNIQLVMMSNGSFDGLREKLVKLLEIK"
FT   CDS_pept        452572..453228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjfH"
FT                   /locus_tag="FTF0439"
FT                   /product="tRNA/rRNA methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="Similar to YJFH_ECOLI (P39290) hypothetical
FT                   tRNA/rRNA methyltransferase yjfH from E. coli (243 aa).
FT                   FASTA: opt: 556, Z-score: 695.5, E(): 7.5e-31
FT                   Smith-Waterman score: 556; 43.128 identity in 211 aa
FT                   overlap. This CDS is disrupted by the insertion of an
FT                   ISFtu1 element close to the C-terminal. It is not clear
FT                   whether this insertion affects the function of the protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0439"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08455"
FT                   /inference="similar to sequence:UniProtKB:YJFH_ECOLI"
FT                   /protein_id="CAL08455.1"
FT                   /translation="MSSLIYGIHAVDSLVEANQAKEILVFKKSNANHKIEGIISKAESK
FT                   GLKVTFIDSFKQLPGRVRKDANHQNIFAVEINDFKTYSENDIEFLVPQDKNAFILILDN
FT                   VQDPHNFGACIRSAHSAGIDFIIIPKDNSAPVNATVKKVACGAAEHTKIGVVTNLARAI
FT                   EKLKQLGVWIIGLAGEADDSLYSMNLVDSVAIVAGAEGSGMRQRTKAIVNPRVFC"
FT   repeat_region   complement(453203..453214)
FT                   /note="ISFtu1 12bp terminal inverted repeat"
FT   CDS_pept        complement(join(453302..453760,453760..454086))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="isftu1"
FT                   /locus_tag="FTF0440c"
FT                   /product="Transposase"
FT                   /note="ISFtu1. Transposase, member of the IS630 Tc-1
FT                   mariner family. Identical to Q93EJ6 Putative transposase
FT                   from Francisella tularensis (118 aa) from aa 144-261.
FT                   Identical to Q93EJ7 putative transposase from Francisella
FT                   tularensis (126 aa) from aa 1-109. Q93EJ6 and Q93EJ7
FT                   previously characterised as two separate ORF's. ORF1
FT                   (identical to Q93EJ7) contains a programmed ribosomal
FT                   frameshifting motif, 5'-AAAAAAAG-3' at aa position 109
FT                   which permits frameshifting to ORF2 (identical to Q93EJ6)
FT                   to produce a single ORF. Alignment of this single ORF with
FT                   additional members of the IS630 family, and also mariner
FT                   elements, show that this transposase shares strongly
FT                   conserved residues, including a fully conserved
FT                   dipeptide,Asp-Glu (DE), and a block consisting of a fully
FT                   conserved Asp and highly conserved Glu, separated by 34 or
FT                   35 residues (D35E). The conserved dipeptide is only present
FT                   if ribosomal frameshifting occurs."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0440c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08456"
FT                   /protein_id="CAL08456.1"
FT                   /translation="MPSYSQDFRDIVINKHEEGMTEFELSKFFNIDKRTVVSWIEFYKR
FT                   TGDYSSKQGVGCGRVASFTDKTLIEQYLIDHPDASALDIKEALAPDIPRSTFYDCLNRL
FT                   GFSFKKKTPKYKQRKEHERLEYIEKLKEIAQNLLFYIDEMGCDNKLSILRGWSLIGEPS
FT                   YGEVLAYQTQRRSIVAGYNYADKKIIALLEYSGYTNTEIFNQWFEEHLCPSLKPKTTIV
FT                   MDNASFHKSSKLIEIANKFDVQILYLPPYSPDLNPIEKV"
FT   repeat_region   complement(454107..454122)
FT                   /rpt_type=TANDEM
FT                   /note="16bp Short Sequence Tandem Repeat (SSTR)"
FT   repeat_region   complement(454123..454138)
FT                   /rpt_type=TANDEM
FT                   /note="16bp Short Sequence Tandem Repeat (SSTR)"
FT   repeat_region   complement(454139..454150)
FT                   /note="ISFtu1 12bp terminal inverted repeat"
FT   CDS_pept        complement(join(454287..454559,454559..454927))
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0441c"
FT                   /product="NADH dehydrogenase subunit, pseudogene"
FT                   /note="Similar to Q8M6V4 NADH dehydrogenase subunit 5
FT                   (Fragment) from Prioneris autothisbe (291 aa). FASTA: opt:
FT                   168 Z-score: 205.5 E(): 0.0013 Smith-Waterman score: 172;
FT                   28.241identity in 216 aa overlap. Contains a frameshift
FT                   after aa 123 and a possible deletion on C-terminal ORF
FT                   ftt0441c"
FT                   /inference="similar to sequence:UniProtKB:Q8M6V4"
FT   CDS_pept        complement(454957..456150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0442c"
FT                   /product="major facilitator superfamily (MFS) transport
FT                   protein"
FT                   /note="Similar to Q8EU72 Bicyclomycin resistance protein
FT                   from Oceanobacillus iheyensis (412 aa). FASTA: opt: 614
FT                   Z-score: 668.2 E(): 2.5e-29 Smith-Waterman score: 614;
FT                   30.179identity in 391 aa overlap ORF ftt0442c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0442c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08458"
FT                   /inference="similar to sequence:UniProtKB:Q8EU72"
FT                   /protein_id="CAL08458.1"
FT                   /translation="MIKQDSKLFILTLGLLAMLPPFAVNTYAPAIPNIAEHFGIHPNDV
FT                   IFTFTTYFIGFSIGMLFWGSFSDKFGRKLSLILGMFLYAASTLLCAHSQSFSQLAVFRL
FT                   IQGLTDSSGTVIALAIARDCYSGKKLTNIISTLAIIMLISPIISPMIGTRLIVSTQSWK
FT                   SSFYFLFGFGIVLVILCSKLPETHAKEQREKSIKKLFIAYFYHLRNLPFTIYTICSGLL
FT                   FAAFFSYIGASSIIYLNVYDTGYTLYMLYFALTTIGVILANLTLKQLSESVELEVFTRL
FT                   GLGISLLSVFVMIIYSHTQFKHGYIFMLLMLITCYGLSLSSTSLLSQSLQLISNHFGAA
FT                   TAVNNFFKFSLAGFANFVMSFSVGSMLVSNLPLQQLTIILITIILLCITKYYKKAKS"
FT   CDS_pept        456422..457465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0443"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="Similar to Q83C03 Conserved domain protein from
FT                   Coxiella burnetii (377 aa). FASTA: opt: 359 Z-score: 409.9
FT                   E(): 6.1e-15 Smith-Waterman score: 380; 27.350 identity in
FT                   351 aa overlap ORF ftt0443"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0443"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08459"
FT                   /inference="similar to sequence:UniProtKB:Q83C03"
FT                   /protein_id="CAL08459.1"
FT                   /translation="MQFAFLNSNKYAAINAFKACIAIVIAYLVGSFLGRIFGIERMYLW
FT                   MSVTVMVVMSTQPNLGGAVDKALMRFLGTVIGAVIAIIIVACVKNYIHEFLLILPFIFL
FT                   AVYFAGATKYSYAGTLAGITLIIIMFNQQPGVQVAIYRAVEISLGIIISLIVNRFILPI
FT                   RAETRLKESYSKTIAQIHDFFNILFIERNESHDKLRENIFHEFPKHLALIKELKYEKTA
FT                   KQVQEFEKISLYIRRLYRYMIVMYEYIEFFLDKPTIAKLDKEPAFIEFKKYIMKSLDSV
FT                   SNDIKKTKRISYKELLRFERHILPLLNEVEVLNYKDESFIFYIKMFLDALKKLALEHNY
FT                   ILKISKH"
FT   CDS_pept        457536..458774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tet"
FT                   /locus_tag="FTF0444"
FT                   /product="multidrug transporter (tetracycline resistance
FT                   protein)"
FT                   /note="Similar to Q83CB9 Multidrug transporter, putative
FT                   from Coxiella burnetii (412 aa). FASTA: opt: 558 Z-score:
FT                   638.9 E(): 1.1e-27 Smith-Waterman score: 558;
FT                   25.854identity in 410 aa overlap. Similar to tetA and tetC
FT                   which are situated on a plasmid in E. coli"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0444"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08460"
FT                   /inference="similar to sequence:UniProtKB:Q83CB9"
FT                   /protein_id="CAL08460.1"
FT                   /translation="MRSTMKLRTKNILIPVLITTIIIDIMGAGLVFPIMPSLFFGQSCI
FT                   TFGDPGSNFQNWYYSIALACWPLGLMIGCPIIGELSDKYGRKIILIVALSTTCVSYILS
FT                   AYAIYSHHYLLFVASRFVCGLAGGAFEIAQAAVIDISTEEDKSKNLGYITMAASLGFVV
FT                   GPIVTSFVSVMNISHTLPFIFAAVLSLLNIIFIVIIMTKDLPKNPGLVIQLATIYKTIS
FT                   FLLSDKRVRLIGVVYLLVQCAWGFYGQGIALFLNLTYSYTVSQTGAFYALMGLSTALAS
FT                   IIIQPVIFARLSNQVAFVRAAVVCGIGFIFVAILTNQIAQWLLTIVLSSSQLICYTALL
FT                   AMISGAVTDKEQGKAMGAAGAGFGLAWFLNDIMMGHLASISPSSPISFGGGMYFIAAII
FT                   FVFSIKILRERVQ"
FT   CDS_pept        join(458808..460451,460451..460648)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uup"
FT                   /locus_tag="FTF0445"
FT                   /product="ABC transporter, ATP-binding, pseudogene"
FT                   /note="Similar to Q9HZI7 Probable ATP-binding component of
FT                   ABC transporter from Pseudomonas aeruginosa (640 aa).
FT                   FASTA: opt: 1264 Z-score: 1173.6 E(): 1.8e-57
FT                   Smith-Waterman score: 1355; 38.629 identity in 642 aa
FT                   overlap. Contains an in-frame stop codon after aa 389 and a
FT                   frameshift after aa 584. Frameshift occurs at a
FT                   heptanucleotide sequence and so could be part of a
FT                   programmed translational frameshift"
FT                   /inference="similar to sequence:UniProtKB:Q9HZI7"
FT   CDS_pept        460705..462147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0446"
FT                   /product="Proton-dependent oligopeptide transport (POT)
FT                   family protein"
FT                   /note="Similar to Q83RB7 Putative transport protein from
FT                   Shigella flexneri (500 aa). FASTA: opt: 567 Z-score: 573.2
FT                   E(): 4.9e-24 Smith-Waterman score: 578; 26.122 identity in
FT                   490 aa overlap ORF ftt0446"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0446"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08462"
FT                   /inference="similar to sequence:UniProtKB:Q83RB7"
FT                   /protein_id="CAL08462.1"
FT                   /translation="MFSINMTTKDMNLRDLREEKKVLAITSLAEFAERYGYYIIQSLLI
FT                   FYLIDKFQIFQDLSASLVGTTLSMVYISAILGGFVAEKYLGYYRAGLLGSLFMLGGFFI
FT                   LAYSTSQSMLYLGLIFVSVSTGLIKSNMSAFIGRFYDKSSLTDSKRDFGFNIFYLGINL
FT                   GSFGVLFIASWLKDNYGYGAPFYSSMVVSIFMLCLLLIGFRLLNKHIIEFKLTLSMLIK
FT                   VALLLTVYIVVLFYIFKQPLIANFSIIIALTISVIILFLSIKKSSYQKVLVAGIFFLLL
FT                   IVYWGLYFQIFISVLLFTQYSVDNALLNPSQFLSVESVSVLFFAGILGKFGVYLDNKQT
FT                   KIGDIDKFNIAFILLIVTFLIILIAIIISPQGVKVSAYGIIFAYIVLGISELSLSAIGL
FT                   SMITKISPKGFVALYMGIWLVTLGVGGKLGGFIASFFYISDNNLGLAKANMCDGLDTFI
FT                   AIAVLASLATLLLRKFVNKYSS"
FT   CDS_pept        complement(462291..463631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0447c"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="Similar to Q83DW3 Hypothetical protein from Coxiella
FT                   burnetii (497 aa). FASTA: opt: 334 Z-score: 356.6 E():
FT                   5.7e-12 Smith-Waterman score: 336; 24.129 identity in 402
FT                   aa overlap ORF ftt0447c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0447c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08463"
FT                   /inference="similar to sequence:UniProtKB:Q83DW3"
FT                   /protein_id="CAL08463.1"
FT                   /translation="MLSNSKKTIICGFSFFCIWIFGTLALYSKYSLYVDVLENIKWSHH
FT                   LSIVYDKHPIMGSLLIKLVLYVTSNLMLAGLICSCICMLIAIVFLYKLLKLYFNQNTTL
FT                   FLIILALLSSIFGDYSFVQFNQNVILLPFWIMTCYYFVLVTKHNLLKDWILLAIVAALG
FT                   MYSKFEIGLLILIISCFLIGSINKKNFAKLVVSLIIFIILITPLIINLFYSHFAPIKYA
FT                   IGEVNSSTTGYITIILNLLYAQLFNLSSLGYIAVPLAFIILLVLRKQIYFEKNKTLLGK
FT                   LTSPLVVCGLYPLIFFFILQTYATHLEYGWLMCIMLLTLAALFYLFEVNIKDKVFDKII
FT                   LVFILIEIAIFISYNAFTYFSPQLTTRNFGNKIAVKAEQFVKNNLNHDINYVIGDSPSY
FT                   NQMSLSVGALLESKPYVFLKFNDHNIPYDQEILAVFADCDEQKTLIS"
FT   CDS_pept        complement(463652..465298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnS"
FT                   /locus_tag="FTF0448c"
FT                   /product="Glutaminyl-tRNA synthetase"
FT                   /EC_number="6.1.1.18"
FT                   /note="Similar to Q87YQ1 Glutaminyl-tRNA synthetase from
FT                   Pseudomonas syringae (pv. tomato) (569 aa). FASTA: opt:
FT                   2160 Z-score: 2562.5 E(): 7.7e-135 Smith-Waterman score:
FT                   2160; 57.064 identity in 545 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0448c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08464"
FT                   /inference="similar to sequence:UniProtKB:Q87YQ1"
FT                   /protein_id="CAL08464.1"
FT                   /translation="MTSEIKVNKTNFIKNIIKKDLETNKVSSILTRFPPEPNGYLHIGH
FT                   AKSICLNFGIAQEFDGKCNLRFDDTNPDKEDIEYINAIQEDVEWLGFKWENQPRFASEY
FT                   FDKMYELAILLIKKGKAYVCDLSAEEIRAYRGTLKEPGKNSPYRERSITENLELFEEMK
FT                   NGKFAEGSKTLRAKIDMSSGNINLRDPALYRIKFSHHPKTGDKWCIYPMYTFAHPLEDA
FT                   IEEITHSLCTLEFQDQRPFYDWVIEETEFSIKPQQIEFSRLNLNYTITSKRKLKYLVDN
FT                   KLVNGWDDPRMPTIKGYRRRGYTPESIRNFCEMIGISKQDSVIDVSVLEDAVRDDLNKS
FT                   VLRKNVVLDPIRVSIKDMPNHHLDVPNHPQDPEFGRREITISSQIFIERDDFVFKLEKD
FT                   MKKLSPNGRVRLLNGYVIECQEVITDTSGEVIELKCSYLPETLGGKKPNDGIKPNGIIH
FT                   WVDANNCLDAEVRIYDRLFNDENPANADRIEDVLNPDSLQVIKNAKVERSLESVKAEER
FT                   FQFNRVGYFIADLKDCSNDTLVFNHIATLRN"
FT   CDS_pept        465443..467035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pckA"
FT                   /locus_tag="FTF0449"
FT                   /product="phosphoenolpyruvate carboxykinase"
FT                   /EC_number="4.1.1.49"
FT                   /note="Similar to PPCK_ANASU (O09460) Phosphoenolpyruvate
FT                   carboxykinase [ATP] from Anaerobiospirillum
FT                   succiniciproducens (532 aa). FASTA: opt: 1020 Z-score:
FT                   1238.3 bits: 238.8 E(): 4.4e-61 Smith-Waterman score: 1020;
FT                   34.961 identity in 512 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0449"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08465"
FT                   /inference="similar to sequence:UniProtKB:PPCK_ANASU"
FT                   /protein_id="CAL08465.1"
FT                   /translation="MLMDPSTIDEYKYLYTCENVHKNLSLQELAKYAHNSDGFICYDNK
FT                   TLVVDSGEIKGRLPDDKYIVETKYAKKNIWWSENGSDNKRLKRKNWKLIKQRLCQEVAT
FT                   KDLFVVDGFYNHDERYTIAVRLITTQASAAYFFKLISITPSEKELQSFEPQWVIMHSPQ
FT                   TQIEDYQDLDLNSSKVIATNLKQRESILVGTMYLAEINKVLLSIMSYYLLLNDIGVFYC
FT                   AVSVDAEANSTIFFGLSGSGKTTLALDQNKSLVANEAIAWTEMRGVYSLESGLTIKSAS
FT                   FKKDDPRIKQALAGDLLIENPNFDDSHNIIFGEKNSSQSNTYVTFPRENFVNVINTDNP
FT                   NTIIFLVKDAKGVLPRVAKLSKGQAIYYFLSGYTSTSIGVEAGVTEPKPEFTSCYAQPF
FT                   LLLKPTRYASILRQRLKHSNAKIYMINVGWIEGDYKTGRRVPVEETKLIVNYLLTKPEN
FT                   VSFKFTRQKYFNFKALTSINDNGQELQLTNNWSDSAEYKKEYKSLARAFIKNYEQFEND
FT                   DFALKYKKFEPII"
FT   CDS_pept        467110..468207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="FTF0450"
FT                   /product="Phospho-N-acetylmuramoyl-pentapeptidetransferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="Similar to Q8E9P5
FT                   Phospho-N-acetylmuramoyl-pentapeptide transferase from
FT                   Shewanella oneidensis (360 aa). FASTA: opt: 1387 Z-score:
FT                   1555.7 E(): 9.2e-79 Smith-Waterman score: 1387; 56.164
FT                   identity in 365 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0450"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08466"
FT                   /db_xref="GOA:Q14J06"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14J06"
FT                   /inference="similar to sequence:UniProtKB:Q8E9P5"
FT                   /protein_id="CAL08466.1"
FT                   /translation="MLIYLFEWLSHYFKGLEVFSSYISVRIIMISITSLLITLALGRPM
FT                   ISWLQKMQIGQIVRDDGPQSHFSKRNTPTMGGVLILSSVIISCLLWGDLTSIYLWILIL
FT                   VVIFFGAIGFFDDYLKLVLKHPKGLRAKYKFALQSIFSIVLAIVLFYLLSKNGQMSLSI
FT                   PFSKSLYIPIGIVIFVVLAFFIINGSSNAVNLTDGLDGLAIVPVVLVAAGLGIYAYIET
FT                   NSTLANYLLFNYLGNPGLAEVAVFCAAVCGSGLAFLWFNSHPAEVFMGDVGSLTLGAVL
FT                   GVIAVMVRQELIFFIMGLLFVVEALSVMLQVGSYKLRNGKRIFRMAPIHHHFELKGWPE
FT                   TKVVIRFWIISLILFLIGLAAIKVR"
FT   CDS_pept        468207..469457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="FTF0451"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /EC_number="6.3.2.9"
FT                   /note="Similar to MURD_CHLCV (Q821S1)
FT                   UDP-N-acetylmuramoylalanine--D-glutamate ligase from
FT                   Chlamydophila caviae (419 aa) FASTA: opt: 516 Z-score:
FT                   615.2 E(): 2.2e-26 Smith-Waterman score: 549; 28.000
FT                   identity in 425 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0451"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08467"
FT                   /db_xref="GOA:Q14J05"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14J05"
FT                   /inference="similar to sequence:UniProtKB:MURD_CHLCV"
FT                   /protein_id="CAL08467.1"
FT                   /translation="MFSFYFNDNKITKLLMVGYGSTGKSVCDFLANFIDITVDISQNDD
FT                   EFVNYDLNSYDLITVSPGIPLNKSPYRALTKFKDKIVSDIDIFYQYIKDTKAKTIAVTG
FT                   SNGKSTVVTMTDFVLKDLGYKSILVGNIGTPALNKIGEKFDYCVVEVSSFQINLFNCVR
FT                   FDLGCIINVSPDHLDRYQNFEQYKQSKLNLAKFSNDFFVYDVHNGIKYAGEYQIIRGAI
FT                   YRNSTKLLDIVETKLFGEHNLENIIVVLNILDRLGLDINQAIDSIKKFKGLEHRCKIVK
FT                   KVNSTTYINDSKGTNVGATIAALNSITNSKNIILLLGGVAKGGDFSLMIKSLDKYVKYV
FT                   YIYGADKEYIESYIKGYCKYQLCNNMKQAFELSSQKANSNEIVLLSPACASFDEFSGYA
FT                   QRGEVFQNLVAQLEQKS"
FT   CDS_pept        469467..470672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="FTF0452"
FT                   /product="cell division protein FtsW"
FT                   /note="Similar to Q9KPG6 Cell division protein FtsW from
FT                   Vibrio cholerae (398 aa). FASTA: opt: 1114 Z-score: 1237.3
FT                   E(): 5e-61 Smith-Waterman score: 1114; 44.892 identity in
FT                   372 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0452"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08468"
FT                   /inference="similar to sequence:UniProtKB:Q9KPG6"
FT                   /protein_id="CAL08468.1"
FT                   /translation="MLYRLKLLLSGKNSKKERVRAKLEIDISIVFIMLGLLTFGWVMVT
FT                   SASMIVALDDYNNPYFYSIRQGFFAIIAIFLFLLALLVPTKNYEKNYNAFFFVMLIVLV
FT                   AVLVPGIGKSVNGARRWIPLLIINIQVAELAKLLAIIFFSGYIAENLKKMANFKEGILR
FT                   PITLLGCIAILLLMQPDFGSTVVISICVMGMLFVAGNKVRWYGLLLGTMVMMSAMLVII
FT                   SPYRMHRITGFLHPWENANGSGYQLVQALIGFGRGGWFGDGLGNGIQKQFFLPEARTDF
FT                   ITSVIAEELGVVGLMVLLAVYLFIVFRAMSIAKMAFELNRYYQAFLAYGVGFWIAFQVF
FT                   VNIGVNTGLLPTKGLTLPLISYGGSSLLIMCYTLGVLVRVDFENKLLADTINPRYIYKK
FT                   VK"
FT   CDS_pept        complement(470680..471486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0453c"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Q83DW2 Hypothetical protein from Coxiella
FT                   burnetii (273 aa). FASTA: opt: 554 Z-score: 648.8 E():
FT                   3e-28 Smith-Waterman score: 554; 37.407identity in 270 aa
FT                   overlap ORF ftt0453c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0453c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08469"
FT                   /inference="similar to sequence:UniProtKB:Q83DW2"
FT                   /protein_id="CAL08469.1"
FT                   /translation="MVKKIIICADDFGMSDNINSAIINLLEKKVINATSCMPNMPAFKL
FT                   GIAQLKKIYNDFSHVGIHLNLTEGNAFTNPKSITRNGKFLSLSKLLVKSKLRAINYDDV
FT                   YNELKAQINNFIEDWGALPDFIDGHQHVHHFPIIRKAVINLYKDFNMYTKQTYIRSTYK
FT                   MDKSDFKSLIIYRSGAKKFYNMLIKNNIKHNSSFAGVYSLESDNQDFRKVILEAYAKIK
FT                   DGGIIMCHPAADIDIKDPISQSRIKEFAYFNSKQALQDQKYHNIVL"
FT   CDS_pept        471585..472541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfdH"
FT                   /locus_tag="FTF0454"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /EC_number="2.4.1.-"
FT                   /note="Similar to Q83DW4 Glycosyl transferase, group 2
FT                   family protein from Coxiella burnetii (324 aa). FASTA: opt:
FT                   896 Z-score: 1055.7 E(): 6.5e-51 Smith-Waterman score: 896;
FT                   43.189identity in 301 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0454"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08470"
FT                   /inference="similar to sequence:UniProtKB:Q83DW4"
FT                   /protein_id="CAL08470.1"
FT                   /translation="MMTSRNVDNPRIYAVIPVYNEEVLIESFLRELAAKLSQISINYKI
FT                   VVVDDGSLDNSKKIIQSLVDQLNIKFISFSRNFGQEAAITAGLEASRDADAAIIMDCDF
FT                   QHPIEVIDQFYSKWCEGYSNVYGVRTRDDQSATRSFLSETFFKLSNKLMGVKIPANAGY
FT                   FRLLDKQCIKAFNSLPENSRFIRGLFAWIGFNSYAIPFEVADRKDGTASRWGYKKLFKL
FT                   AFTGIFSFSSVPLRLISVLGIVVSIFALAYGFYIFVQSLFFNVNVTGWPTIVVSIMFFS
FT                   GVQLISLGVLGEYISRIFDEAKKRPRYIIDEDESRNI"
FT   CDS_pept        complement(472933..474696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0455c"
FT                   /product="Dolichyl-phosphate-mannose-protein
FT                   mannosyltransferase family protein"
FT                   /EC_number="2.4.1.109"
FT                   /note="Similar to Q8XQM9 Probable transmembrane protein
FT                   from Ralstonia solanacearum (551 aa). FASTA: opt: 683
FT                   Z-score: 749.4 E(): 7.6e-34 Smith-Waterman score: 683;
FT                   29.174 identity in 545 aa overlap ORF ftt0455c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0455c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08471"
FT                   /inference="similar to sequence:UniProtKB:Q8XQM9"
FT                   /protein_id="CAL08471.1"
FT                   /translation="MNKSKNSYYFDIFILLIIYIVYFFVFLGWRHLSIPDEGRYPEIAR
FT                   EMLSSGNWVTPTINGVPFLDKPPLYYWLEATSMHFFDITPWAIRLPQALFGILGCISIY
FT                   VFGRYFYSRFAGVLASFILAANVLYFFEAHYANMDLIVATLLWIAFFLCLTSLKQTKTK
FT                   NKRLLMYAAYFVSALAFLTKGLMAIVFPCMTIFVWMLITNNWYRLKELYVPTGAVLFVV
FT                   IVTPWLVLAQQQNPDFLYFFFYFQQFYRFVGHGFNNAIGPWFYFVIILAVFLPFSILLL
FT                   NRLFKGAKIIWQNRKQDSTTLLIALWCLLILIFFSIPSSKIVSYILPIFAPLSLLMALS
FT                   LEKIIKNNDNVVMFKKMHLIASIIFLVAAVAVIIFSLTQKVLLNTDAPLVYTTLVAVSA
FT                   LIVAFSVKFSFKDQIRKAITLIIFALMLLNVLGQLIIPYFDLRTSEPLVDKVLKDSNSG
FT                   TIFVYYNRPQPKHFILKEELKQKGYEEDLPILLNNNIYIVYNWNTYKPEIDNWSREFYY
FT                   GINQYKQAHNGQWPKYLITYPEFTELLNNNKDIIIFTPEKQLEKLKQTYPNINFEIKGR
FT                   YNKNVVVSVVK"
FT   CDS_pept        complement(474788..475081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0456c"
FT                   /product="UPF0269 family protein"
FT                   /note="Similar to Y941_COXBU Hypothetical UPF0269 protein
FT                   CBU0941 from Coxiella burnetii (90 aa). FASTA: opt: 346
FT                   Z-score: 470.4 E(): 2.6e-18 Smith-Waterman score: 346;
FT                   55.422 identity in 83 aa overlap ORF ftt0456c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0456c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08472"
FT                   /inference="similar to sequence:UniProtKB:Y941_COXBU"
FT                   /protein_id="CAL08472.1"
FT                   /translation="MYLRLKEYKYMTKVFCKKYHQELDAIPFQPLPGELGKKIHNEISN
FT                   KAWQAWLAHQTILINEYRLNLIEPKAKEFLKEEMHKFLFEGKEEKPEQFSEI"
FT   CDS_pept        complement(475072..475386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yccK"
FT                   /locus_tag="FTF0457c"
FT                   /product="anaerobic sulfite reductase subunit"
FT                   /EC_number="1.8.1.2"
FT                   /note="Similar to Q9CNM6 Hypothetical protein PM0401 from
FT                   Pasteurella multocida (109 aa). initn: 382 init1: 382 opt:
FT                   382 Z-score: 511.4 bits: 99.7 E(): 1.4e-20 Smith-Waterman
FT                   score: 382; 58.586identity (58.58639ngapped) in 99 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0457c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08473"
FT                   /inference="similar to sequence:UniProtKB:Q9CNM6"
FT                   /protein_id="CAL08473.1"
FT                   /translation="MDNYNTDEHGFLLDFASWDMDFCNLAAAQENISLTQEHIFIIEFL
FT                   RHFYQQTSKSPAIRELVKALKEKYGEKIGNSLYLQTLFPVSPAVQAAKLAGLPKPKRCI
FT                   "
FT   CDS_pept        475472..476104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspA"
FT                   /locus_tag="FTF0458"
FT                   /product="stringent starvation protein A, regulator of
FT                   transcription"
FT                   /note="Similar to SSPA_HAESO (P31784) Stringent starvation
FT                   protein A homolog from Haemophilus somnus (212 aa). FASTA:
FT                   opt: 377 Z-score: 473.8 E(): 1.7e-18 Smith-Waterman score:
FT                   377; 35.106 identity in 188 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0458"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08474"
FT                   /inference="similar to sequence:UniProtKB:SSPA_HAESO"
FT                   /protein_id="CAL08474.1"
FT                   /translation="MMKVTLYTTKYCPYSLRARIALAEKKMSTDIVEAGDLEPAMIKKI
FT                   TPNGVFPVLMEKDYSINNRKALLIYIDERFPAPSLLPNVVNERIKIRLSLDKIDNEWYP
FT                   VLDQIRKHRSDQKMLESMFKDLKESLLAMEKAFTGSEFFISSGFTLADCYIAALIICLE
FT                   AEGFIIDDEYGAIYEYKKRLFARDSVKKANIKGGAGESLLKTLRTHR"
FT   CDS_pept        476116..477135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sohB"
FT                   /locus_tag="FTF0459"
FT                   /product="peptidase family S49 protein"
FT                   /EC_number="3.4.-.-"
FT                   /note="Similar to many Q8ED37 SohB protein,peptidase U7
FT                   family from Shewanella oneidensis (342 aa). FASTA: opt: 961
FT                   Z-score: 1093.4 E(): 5.2e-53 Smith-Waterman score: 961;
FT                   49.355 identity in 310 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0459"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08475"
FT                   /inference="similar to sequence:UniProtKB:Q8ED37"
FT                   /protein_id="CAL08475.1"
FT                   /translation="MWYQSFIGFVFFALSTVLVVAAIVIVIGSFFSLLSKAKQEAANLA
FT                   KGRLEINEVATEYKHTKQQLLESLLEKKEYKKFLKEQKKLDKQDDKPKQKIFVINFKGD
FT                   IDASQVENLRNEVSAILAVANTEDEIIVRIDSPGGVVNGYGFAAAQLERIRQAGINLTV
FT                   CIDQVAASGGYMMSAVAHKIIAAPFAIVGSIGVVGTIPNIRELLEKNGINVEMHTSGEY
FT                   KRTLTTVGVNTEEGRNKFKQDLESIHQLFKKHILVYRPSLDIDKVATGEYWFGKDALEL
FT                   GLVDKIQTYDDYLIDLLKKQHNVYEVSYVIKKEKGFLRSKFSMLKRAITNLLHARKII"
FT   CDS_pept        477143..478054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="FTF0460"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="Similar to Q8D3A6 HolB protein from Wigglesworthia
FT                   glossinidia brevipalpis (329 aa). FASTA: opt: 315 Z-score:
FT                   378.8 E(): 3.3e-13 Smith-Waterman score: 315; 27.304
FT                   identity in 293 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0460"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08476"
FT                   /inference="similar to sequence:UniProtKB:Q8D3A6"
FT                   /protein_id="CAL08476.1"
FT                   /translation="MLSLTTHQQLIDNFLEQKAKQTLRHAFIFRVEDAVLLDSFINSLC
FT                   QLLLGEKILSYDDSPYINIAAIENDEIKVAEIKKIIKNCELTAHNNLAKIIIIQGLDLL
FT                   NESAANALLKTLEEPTQNTFFLMFTRNYSDVLATVKSRSLVYDIKFTQKDKYNYLSYTF
FT                   DMSKDAIEKSLQMTRNDINIIAKIKLEQHFWQLRNNLMKVLANQVNLNVFLKEVNPHFK
FT                   DTLYWLTSMIIDVYCYKLDEQNQGIANYDKLAIIKYLAAKFDADCIYKLYSKALEAQSY
FT                   FVKFKNVDKELILENLILEIIK"
FT   CDS_pept        478065..478343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhbY"
FT                   /locus_tag="FTF0461"
FT                   /product="RNA-binding protein"
FT                   /note="Similar to Q87LZ3 Putative RNA-binding protein
FT                   containing KH domain from Vibrio parahaemolyticus (98 aa).
FT                   FASTA: opt: 289 Z-score: 405.9 E(): 1e-14 Smith-Waterman
FT                   score: 289; 52.222 identity in 90 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0461"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08477"
FT                   /inference="similar to sequence:UniProtKB:Q87LZ3"
FT                   /protein_id="CAL08477.1"
FT                   /translation="MDVKQQQKLKAQAHSLKPVVLMGEKGLTENVILEIDLALASHQLI
FT                   KVKVGRLPKEEKQQIASEITQATRSELVQIIGNILVLYRRNPNKEKI"
FT   CDS_pept        478351..479325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="FTF0462"
FT                   /product="Delta-aminolevulinic acid dehydratase"
FT                   /EC_number="4.2.1.24"
FT                   /note="Similar to Q9ZNC9 Delta-aminolevulinic acid
FT                   dehydratase from Clostridium perfringens (321 aa). FASTA:
FT                   opt: 1246 Z-score: 1549.1 E(): 2.2e-78 Smith-Waterman
FT                   score: 1246; 57.812identity in 320 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0462"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08478"
FT                   /inference="similar to sequence:UniProtKB:Q9ZNC9"
FT                   /protein_id="CAL08478.1"
FT                   /translation="MSFPISRPRRLRVTQAFRDIVAETTLSLDDLMYPIFVVHGQGVKK
FT                   EISSMPNQYHWSVDMLDELVDQVVKAGIRSLMIFGVPKIKDLVSSENYDPNGITQQAIR
FT                   KIKQLAPELVIATDVCMCSFTPHGHCGILDEHDYVDNDQTLEILQKTAVSHAQAGADIV
FT                   APSGMMDGMIIAMRQALDEASFENVSIMSYSVKYASAYYGPFRSACSSSLKGDRKTYQM
FT                   DYRNKKEAICEALADIEQGADFIMVKPALSYLDIVNELSHIIDLPIAAYHVSGEYAMIK
FT                   AAASAGLVDEKAITIETLISMKRAGAKVILTYTALDVANWLKV"
FT   CDS_pept        479329..479796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yibK"
FT                   /locus_tag="FTF0463"
FT                   /product="tRNA/rRNA methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="Similar to Q8E8X2 RNA methyltransferase, TrmH
FT                   family, group 2 from Shewanella oneidensis (154 aa). FASTA:
FT                   opt: 569 Z-score: 759.8 E(): 2e-34 Smith-Waterman score:
FT                   569; 57.616 identity in 151 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0463"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08479"
FT                   /inference="similar to sequence:UniProtKB:Q8E8X2"
FT                   /protein_id="CAL08479.1"
FT                   /translation="MISIALYEPEIPPNTGNIIRLCANVGAKLHLIEPFGFKLEDKQLR
FT                   RAGLDYHEFADLKIYKNFAEFYQQNKDKQIWACTTKAKQYYHKVDFSCDDILLFGPETR
FT                   GLPADVLELLKQTQLKIPMHKNSRSLNLSNSVAVILYGALNNIGFEKLGLL"
FT   CDS_pept        479914..480978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ansB"
FT                   /locus_tag="FTF0464"
FT                   /product="Periplasmic L-asparaginase II precursor"
FT                   /EC_number="3.5.1.1"
FT                   /note="Similar to ASG2_HAEIN (P43843) Probable
FT                   L-asparaginase periplasmic [Precursor] from Haemophilus
FT                   influenzae (349 aa). FASTA: opt: 897 Z-score: 1034.7 E():
FT                   9.6e-50 Smith-Waterman score: 897; 43.966 identity in 348
FT                   aa overlap. No signal peptide predicted"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0464"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08480"
FT                   /inference="similar to sequence:UniProtKB:ASG2_HAEIN"
FT                   /protein_id="CAL08480.1"
FT                   /translation="MQSIFKKTIIVIVIFLSSYLVALAALPNVYIVATGGTIAGVAKSS
FT                   TAAVYKAGSLSINDILEKEPAFGKLANIKSEQFYNIDSVDMTMAMRIKLAEYVQKLIDD
FT                   PNVNAVIITHGTDNMVQTAFFLNQVLDVKKPVILVGAMRAFTSLSSDALMNLYDALVTA
FT                   VNKQSIGKGVLVVMNEEILTANDVAKTNTTNVDAFKAPNYGKLGTVIINDVDYYQSPRV
FT                   VGNILSVDDLQKITALPKVEVIYESADISLEFLDSVLTIKGLEGIVLAGLGDGNIPSNQ
FT                   GDFLKKARAKCIVVVRSSYVGSGKVTHNYNNLDDKFDLVSSATLSPEKARIFLQLCLIK
FT                   THDIKKIQKLFDRF"
FT   CDS_pept        481702..481890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0465"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0465"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0465"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08481"
FT                   /protein_id="CAL08481.1"
FT                   /translation="MVLVLTSTGALMNGTSKGTTYNGRIVIDCAITGMPGPYIGTVSMS
FT                   ISSGGNNYSGSIPLTIS"
FT   CDS_pept        complement(481942..483687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="FTF0466c"
FT                   /product="Arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="Similar to SYR_SALTY (P74871) Arginyl-tRNA
FT                   synthetase from Salmonella typhimurium (577 aa). FASTA:
FT                   opt: 1159 Z-score: 1408.5 E(): 1.5e-70 Smith-Waterman
FT                   score: 1159; 34.841 identity in 597 aa overlap."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0466c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08482"
FT                   /db_xref="GOA:Q14IZ0"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14IZ0"
FT                   /inference="similar to sequence:UniProtKB:SYR_SALTY"
FT                   /protein_id="CAL08482.1"
FT                   /translation="MNIENYLSETLAKVFQKLGYAESFAKVVTSTREDVRHFQCNGAMP
FT                   LAKFAKKPPLAIAEEIVEHIDAEDIFAKLEVAKPGFINITLAPKFLADTTNRFLNSNKF
FT                   GVQNNLPNRKVVLDFGGPNVAKPMHVGHIRSALLGDALQRIHRFCGDTVVSDVHLGDWG
FT                   TQMGMLIEEIKLQSPQLVYFDENYTGEYPTESPVTVQELAEIYPRASKRCKSDINEMEK
FT                   ARLATFELQQGRRGYVALWQHFVRISIDAVKKDFDSLDVHFDLWLGESDANKFIDEMIS
FT                   YFQANNFIYEDEGAWVIDTNKDGVPPLIVIKKDGGVMYGTTDLATLWQRSKDLDPDEII
FT                   YVVDKRQSLHFKQVFSVAERTKVVSEKCKLKHVAFGTVNGKDGRPFKTREGGVMHLADL
FT                   ISQAKEYAKNRMPDENDDSIINQIAMATIKFGDLINNYANDYFFDLEKFAQHEGKTGPY
FT                   LLYTVVRAKSILRKIFGDNYDIKSLAKDYKVVNAHNEYEEKLQLQLIQFPIAVQRAYEN
FT                   SQPHHICEYAYSLANSFNKFYVNCPINNLDDESLKKARIALCMATVKAMTIASDLIGIS
FT                   IPERM"
FT   CDS_pept        483813..486419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ostA1"
FT                   /locus_tag="FTF0467"
FT                   /product="organic solvent tolerance protein"
FT                   /note="Similar to OSTA_XYLFT (Q87AI9) Organic solvent
FT                   tolerance protein from Xylella fastidiosa (792 aa). FASTA:
FT                   opt: 700 Z-score: 808.7 E(): 3.7e-37 Smith-Waterman score:
FT                   775; 26.572 identity in 636 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0467"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08483"
FT                   /db_xref="GOA:Q14IY9"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14IY9"
FT                   /inference="similar to sequence:UniProtKB:OSTA_XYLFT"
FT                   /protein_id="CAL08483.1"
FT                   /translation="MLKGIHKYLLMCFGTVLFTVQANAARIMSNNPIKEDWQCKVVDGE
FT                   WSCKRAKKPKSVFDKKLTKTEKEKALADDLAWVKKPSYFVGGYYSNDNQFTKALCESKK
FT                   TDLSYEKSEFDNYGTLIASGNVQVLQCDQELYGNNAIINLNSNNSAIRSLVMAGDVIVK
FT                   QPSTGIVIRTTELDADMNNGTYSTGEAYFRLAREMPKTRIYDKEHFSGYLRGYAKTFKK
FT                   ESSGDIVLSDGYITSGDPYDNAWKITGNNIDIDTNTHMAYVKNGYFEIQDIPVMYIPYF
FT                   SHPIDDRRRSGFLYPGFVQNANSGIGISVPYYFNLAPNYDLMLQSVIWSQRGIIENGTF
FT                   RYMTKYFQGQFEGSLVPYDFKEGKMRGSFTLSTTGQYENINTNFKYEYVSDQNYYNDFS
FT                   AGNVNLVTKTLLDREFDLTYTNDYVDSGLTVLDYGVVNPLLTVDNTPYAKLPEVKLNLT
FT                   SDGYTPDYLTLSAQTLNTFFYKTAGPANTNPGAPQGTNVNAFRAYESPKIAFNFNKTWG
FT                   YLNPSLEVPIRYYQLKNSPTDTIQFANSSVTSVLPIFNIDAGAYFDKDYTNENGTYTST
FT                   LHPRLFYTYIPYQDQTNIPLFDTSLQNEQYMQMFQVNRFTGYDRINNANQLTYAIEAST
FT                   TNQDNGTTLASAKIGQMAYFADRKVNLCQGNSACPNPGLMDPFSTDTFSPIMSSFEFQV
FT                   MKNIYLSAQVNYRVNQQNVDYQVYQLSYKDENENIFNVSYNNIANNWNSLTQQQIAEGA
FT                   KPQPQETITLSTVLNITDHWGIAALWNYNFQQKQIANIFAGLQYNAKSWAVRALWQKTA
FT                   YTNQDPNNPTLLGPLVNTYMFEFELKGLGGIGNTSDISSRLQQINGYQVGEWGNGI"
FT   CDS_pept        486401..487822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="surA"
FT                   /locus_tag="FTF0468"
FT                   /product="Peptidyl-prolyl cis-trans isomerase (PPIase)"
FT                   /EC_number="5.2.1.8"
FT                   /note="Similar to Q8ZIK4 Survival protein SurA
FT                   (Peptidyl-prolyl cis-trans isomerase) from Yersinia pestis
FT                   (434 aa). FASTA: opt: 532 Z-score: 586.9 E(): 8.4e-25
FT                   Smith-Waterman score: 532; 25.176 identity in 425 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0468"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08484"
FT                   /inference="similar to sequence:UniProtKB:Q8ZIK4"
FT                   /protein_id="CAL08484.1"
FT                   /translation="MGKRYIMKKLITIFLLMLMLNNAYSDISSSMFQNAFNSGIDATSP
FT                   VSMNVSDKKYLVNKTVAIVNSRPITSFELDQELAKLEAMQPNSAFNTDPLKRQALQDLI
FT                   SQSVLLQLAERNNIMISNQQLDSAIQDIAAKNGVSVESLKLNVEAAGMSFDSYKKRIRD
FT                   QLMISQLQQQAIAQQVYVSPEEIQKYIKKHQKEFDREMSPVKLYTLKNLIVALPDSKKA
FT                   RQKKIDLFKKLALAVNDGSIDFSEIVKQFSQAPNAVSGGIVSQQVKFDSIPDIYKEYIK
FT                   ELKNHQVSQPFIVNHTLQMIYIYNIDEKAPILSKKVTKYYVYAIEIKLDGGMNEDGAKS
FT                   SLERAKLAIESGQEFTKVALKYNQDYDHPNGNFKWVSELDSPPSLPPAAFAQLKQLKEN
FT                   ELSEPFQADGRTWMIIKYTKTKEYDAAEQLKEQKALEAIFSEKAQEIYKTWLTSMKDDA
FT                   YIEILEDDLKTPELY"
FT   CDS_pept        487824..488612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="FTF0469"
FT                   /product="dimethyladenosine transferase , kasugamycin
FT                   resistance"
FT                   /EC_number="2.1.1.-"
FT                   /note="Similar to KSGA_XYLFT (Q87C85) Dimethyladenosine
FT                   transferase from Xylella fastidiosa (strain Temecula1 /
FT                   ATCC 700964) (265 aa). FASTA: opt: 686 Z-score: 828.3 E():
FT                   3e-38 Smith-Waterman score: 686; 43.411 identity in 258 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0469"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08485"
FT                   /db_xref="GOA:Q14IY7"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14IY7"
FT                   /inference="similar to sequence:UniProtKB:KSGA_XYLFT"
FT                   /protein_id="CAL08485.1"
FT                   /translation="MQYKTKAKKSLGQNFLQDENIIRKIVQLANIKKHDIVVEIGPGLG
FT                   ALTRYLLSSSNNVSVVEFDASVIDTLIANCQKYGTPHIYNQDFLKFDISSLENSSNQKI
FT                   KLIGNLPYNISSPILFKVIKDSDKIVDAHFMLQKEVVERIVSLPNSKSSGRLSVILQYH
FT                   FDCSMILKIPPEVFYPQPKVDSAILRLKPKNSKELLKNYNFFEEIVKQSFAQRRKTLHN
FT                   NLKSILKERKIDPSTLPVDTNLRAENLSVGDFVSLANFLS"
FT   CDS_pept        488624..489451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaH"
FT                   /locus_tag="FTF0470"
FT                   /product="Bis(5'-nucleosyl)-tetraphosphatase"
FT                   /EC_number="3.6.1.41"
FT                   /note="Similar to APAH_VIBPA
FT                   Bis(5'-nucleosyl)-tetraphosphatase, symmetrical from Vibrio
FT                   parahaemolyticus (268 aa). FASTA: opt: 754 Z-score: 947.4
FT                   E(): 7.1e-45 Smith-Waterman score: 754; 42.963 identity in
FT                   270 aa overlap."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0470"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08486"
FT                   /inference="similar to sequence:UniProtKB:APAH_VIBPA"
FT                   /protein_id="CAL08486.1"
FT                   /translation="MATYVIGDVQGCYDELQLLLQKINFDIQKDKLIFAGDIINKGPKS
FT                   LETVNFIMSLGDSAQVILGNHEILFLAVSYNYLPSNNKNTFNDVIKAENLKEIQDWLCN
FT                   QNLLIRIGDVFITHAGIPHIWSPKKAMKRANEVEFVLKNQTTRRLLLANLFSNEGDKWD
FT                   KELEGIERWLCILNYFTRMRSIEKNGRLNLKFSSTIDQIPENFKPWFKLKHKKFTDKYK
FT                   IIFGHWAAIKGETKDNNVIALDTGCVFGGKLTCYCIETEKKYAVKALKSYKDI"
FT   CDS_pept        489455..489892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroD"
FT                   /locus_tag="FTF0471"
FT                   /product="3-dehydroquinate dehydratase, type II"
FT                   /EC_number="4.2.1.10"
FT                   /note="Similar to many Q8EJF5 3-dehydroquinate dehydratase,
FT                   type II from Shewanella oneidensis (146 aa). FASTA: opt:
FT                   499 Z-score: 662.4 E(): 5.3e-29 Smith-Waterman score: 499;
FT                   55.797 identity in 138 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0471"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08487"
FT                   /db_xref="GOA:Q14IY5"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14IY5"
FT                   /inference="similar to sequence:UniProtKB:Q8EJF5"
FT                   /protein_id="CAL08487.1"
FT                   /translation="MDVLVINGPNLNLLGTRQPQFYGHKTLADINNDLLKIAKENNINI
FT                   DFYQSNHEGQIIDKIQQTAAKIIIINPAAFTHTSVAIRDAFLAINKPFIEIHLSNIYNR
FT                   EEFRTKSFLSDIAYGCIFGFGPNGYTLALIEAINYINMKGE"
FT   CDS_pept        489897..490370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accB"
FT                   /locus_tag="FTF0472"
FT                   /product="Acetyl-CoA carboxylase, biotin carboxyl carrier
FT                   protein subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="Similar to BCCP_PSEAE (P37799) Biotin carboxyl
FT                   carrier protein of acetyl-CoA carboxylase from Pseudomonas
FT                   aeruginosa (156 aa). FASTA: opt: 466 Z-score: 537.8 E():
FT                   4.6e-22 Smith-Waterman score: 466; 48.148 identity in 162
FT                   aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0472"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08488"
FT                   /inference="similar to sequence:UniProtKB:BCCP_PSEAE"
FT                   /protein_id="CAL08488.1"
FT                   /translation="MDLLKAIDRVAEILNSSDIKEIRIKDGGSSIFMTKNNTAAITSVV
FT                   FAAPVASNVASAAPAVATAATSAAAPKVNLAEEISGEEIKSPMVGTFYGASSPDAAPYV
FT                   KEGQEVKKGDVLCIIEAMKIMNKIEAERAGKIVKIIAKDGEPVQFDQPLFIIE"
FT   CDS_pept        490435..491790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="FTF0473"
FT                   /product="Acetyl-CoA carboxylase, biotin carboxylase
FT                   subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="Similar to Q9KV62 Acetyl-CoA carboxylase, biotin
FT                   carboxylase subunit from Vibrio cholerae (447 aa). FASTA:
FT                   opt: 2119 Z-score: 2505.5 E(): 1.2e-131 Smith-Waterman
FT                   score: 2119; 70.270 identity in 444 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0473"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08489"
FT                   /inference="similar to sequence:UniProtKB:Q9KV62"
FT                   /protein_id="CAL08489.1"
FT                   /translation="MIKKVLIANRGEIALRILRACRELGIKTVAVYSTADANLMHVKLA
FT                   DEAVCIGPPAPNLSYLNIQAIITAAEITNADAIHPGYGFLSENAKFAKAVEESGFIFIG
FT                   PRAESIEIMGDKVEAIRYMKKAGVPCVPGSGGPLGSDEKKNLEIAEKIGYPVIIKAAGG
FT                   GGGRGMSIVRKKEDLISAISLTKSEARIAFNNDMVYMEKFLENPRHIEIQVFGDGEGNA
FT                   VYLFERDCSTQRRHQKVIEEAPAIGLSDEERKRIGEQCVSACKILKYRGAGTFEFLYEN
FT                   GEFYFIEMNTRIQVEHPVTESITSTDLIKEQIRVAKGEGLSWKQEDIAIVGHAIECRIN
FT                   AEDPERMIPSPGKIDMYHPPAGPRVRVDSHIYSGYVVPPNYDSMIAKVIVRGHNRETAL
FT                   QKMRAALEEMVINGIKTNIPLHQEILNNEDFIKGGTNIHFLEKFLEQKNKAK"
FT   CDS_pept        491884..492564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0474"
FT                   /product="hypothetical membrane protein"
FT                   /note="ORF ftt0474"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0474"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08490"
FT                   /protein_id="CAL08490.1"
FT                   /translation="MHNFQSFLKSVRDSRELKRETIADAINLSVETIQLIEEADNNSLL
FT                   LNSSSVLKNQIRRYCEYLEIPEKKIVSILNKIDILYYKKSRYGKLKFFDYINRLAILVI
FT                   AITIIVLVTKHIRENVDTVTPENSKSTIIYTPINYDINNSEQQQSTVSSNTNNTKTTDD
FT                   INSTASHIDTTKASQLTAATATNAPTIDTSAVASKTLVAHPPTTANINNVVIDDQTAAR
FT                   QQSE"
FT   CDS_pept        492590..493708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msc"
FT                   /locus_tag="FTF0475"
FT                   /product="mechanosensitive ion channel protein"
FT                   /note="Similar to Q87G16 (Q87G16) Putative membrane protein
FT                   from Vibrio parahaemolyticus (365 aa). FASTA: opt: 362
FT                   Z-score: 432.0 E(): 3.6e-16 Smith-Waterman score: 412;
FT                   29.167 identity in 384 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0475"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08491"
FT                   /inference="similar to sequence:UniProtKB:Q87G16"
FT                   /protein_id="CAL08491.1"
FT                   /translation="MNLLNNILLRVENYSTTYILLIDFVICLVLSVIISLLGSLLVIKH
FT                   KDTIRYSFVKSFKLTLYLVIWSYFIKTCVDLPVIVHLPDYKEVIVSYSDKIFDFCIYLA
FT                   IIISLFRFLYKSKNIAIEKKKAETKDGYDDFRDINAIFKALELGAIVVSVILILAAFRA
FT                   PLTALGAFSGVALAGLTLSQSTLLTNLFGGLFVVFNRKYSEGDIISSEINSTIKFSGTI
FT                   KKIGTLTTRVDNSETAPMHIPNSVFLNTCITTTSRRTHRRIVQFITIDYKHIDKIPVIK
FT                   QKLLEILKSHPNIDQNKTLAVSLASGGTNISGKLEGSFGSSGINIQIYAMVNKVFFSDF
FT                   INVQDEIFINIAKELNDLDIEFAINPVTLHKY"
FT   CDS_pept        complement(493713..494636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="poxA"
FT                   /locus_tag="FTF0476c"
FT                   /product="Lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="Similar to Q83AR3 (Q83AR3) Lysyl-tRNA
FT                   synthetase-related protein from Coxiella burnetii (321 aa).
FT                   FASTA: opt: 727 Z-score: 890.9 E(): 9.9e-42 Smith-Waterman
FT                   score: 727; 42.088 identity in 297 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0476c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08492"
FT                   /inference="similar to sequence:UniProtKB:Q83AR3"
FT                   /protein_id="CAL08492.1"
FT                   /translation="MSLENIKKRAEYLAKIRNFFKDLDVLEVDTPLAYDYAVTDPFIDV
FT                   FSINTVAGKKYIQSSPEYAMKRLLAAGSGSIYQICKAFRDEPCGKLHNHEFTMIEWYRV
FT                   GIDYYQLMQEMQKLFTMLKANLEFIYLSYQEVFEKYYNINPHDICLAELQAIVKENVGE
FT                   IQGLRNPTIADCLDILFSYKIEKNLNQQNTIYFIYDYTIHQSALARKVRDKNSQLVAAR
FT                   FEVFCNGIELANGYYELIDKKEQSKRFENDLATRKQQQKALLDIDTKLLECLENIPECS
FT                   GVALGFDRLLMSLEGISNIKNLTILD"
FT   CDS_pept        complement(494633..495415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="birA"
FT                   /locus_tag="FTF0477c"
FT                   /product="Bifunctional protein, biotin-[acetylCoA
FT                   carboxylase] holoenzyme synthetase; transcriptional
FT                   repressor of biotin synthesis (BirA family)"
FT                   /EC_number="6.3.4.15"
FT                   /note="Similar to Q83CV0 BirA bifunctional protein from
FT                   Coxiella burnetii (323 aa). FASTA: opt: 375 Z-score: 457.7
FT                   E(): 1.3e-17 Smith-Waterman score: 375; 31.004 identity in
FT                   229 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0477c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08493"
FT                   /inference="similar to sequence:UniProtKB:Q83CV0"
FT                   /protein_id="CAL08493.1"
FT                   /translation="MKNHRLIITQLNKYIDDIKVEYFPTIDSTNDYFLATNFTHKYHFC
FT                   YVDKQTKGRGRRGDKWISEDKDNIYSTLAFHCDFAITADSLKSVKIALGVLAAIKKYIP
FT                   KNLQQYLKIKLPNDIYFQDQKLAGILIETKNIKKDSFDIIIGVGINVNMTNTDENIDRE
FT                   WTSLSNINNKQLNSSRIIVDLVKSIIDSFDMNDATALAQLISYDYILDKRITFNYADQS
FT                   YQGIAKGISEDLKLKIIDENNNYCEFELANINKIRVIK"
FT   CDS_pept        complement(495412..497154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recJ"
FT                   /locus_tag="FTF0478c"
FT                   /product="Single-stranded-DNA-specific exonuclease"
FT                   /EC_number="3.1.-.-"
FT                   /note="Similar to RECJ_HAEIN (P45112)
FT                   single-stranded-DNA-specific exonuclease from Haemophilus
FT                   influenzae (575 aa). FASTA: opt: 869 Z-score: 996.6 E():
FT                   1.3e-47 Smith-Waterman score: 902; 32.028identity in 562 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0478c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08494"
FT                   /inference="similar to sequence:UniProtKB:RECJ_HAEIN"
FT                   /protein_id="CAL08494.1"
FT                   /translation="MLIKQKKIDNNIFSTLLAKGYDSFTAKIISARVRKIENLELILNG
FT                   SIKDLSSPFLFKDIEKAVERLYKALQNNEIIGLETDHDCDGQTSHAILYEALTKIFGHP
FT                   KEKIRSYIGHRLQEGYGLSESLMNRILTDKIRPSLIITADNGSTDEPRIAILKKNGIDT
FT                   IITDHHAIPPEGTPKSAIAVLNPTQQGCNYPDKAIAGCMVAWLFMAALRRKYLQNNKMI
FT                   SQSYGLSNLLDFVAIGTVADCVSMATSHNNRIVTKFGIEQLKNNQRLCWDFVDKDKLSS
FT                   EYIGFNIAPILNSDGRVSDALGSVSFLLEEDEHKIEDIFDNLKQQNNQRKEIQKKLTQE
FT                   AIVQAYQLNQQKNSLCILLEDGHSGIHGISASRIKEMFGKAVIIFSQTQHDSTLISGSA
FT                   RSIDNIHIKTILDNIAVKEPQLIIKYGGHKGAAGLTIKKSDFDKLYQLFESEITDIITK
FT                   QNIILEPIIEYDFELDEHHFELETLDKIDALEPFGRKFEKPLFCNQFMLENLRLVGKDK
FT                   NHAQLVLRYKNISSIKAIWFNATDNKILEQLIIGDCIKACYELQKEEFLGQINLSLNIK
FT                   TIEK"
FT   CDS_pept        complement(497148..498254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="perM"
FT                   /locus_tag="FTF0479c"
FT                   /product="PerM family protein"
FT                   /note="Similar to Q9I4W6 Hypothetical protein PA1007 from
FT                   Pseudomonas aeruginosa (357 aa). FASTA: opt: 1016 Z-score:
FT                   1092.5 E(): 5.8e-53 Smith-Waterman score: 1016; 40.698
FT                   identity in 344 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0479c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08495"
FT                   /inference="similar to sequence:UniProtKB:Q9I4W6"
FT                   /protein_id="CAL08495.1"
FT                   /translation="MILKTIKDWYQNRYQNNEPIVFVGLMLFFYLVLTFLGDYIAPILA
FT                   ALVIAYLLDTLVNILQKFTKLKRIVLVYIVYILFLIALLSLIFVLLPIIINQLIDFVKQ
FT                   ASHILSSLKTSLEELSIKYPTILTEDRINSIVSWFDSIDWKKISSNVGSFILQNTATTL
FT                   PVLFSVLIYLFLVPLMVFYFLKDKEKMINWFKSFLPEENGALYYVWNDLKPKLADYVRG
FT                   KAIELIIVSTLTYIGFAYFNLNYAVLLAVGVGLSVIIPYVGMVIITIPVIMVGILQFGL
FT                   NGTFVSMLIVFFVIQALDGNLLVPLLFSEVLDMHPVGVVSAILIFGGIWGLWGIFFAIP
FT                   LGLLFISGVNMFRNHLNGKKTQADINLC"
FT   CDS_pept        complement(498356..499765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xasA"
FT                   /locus_tag="FTF0480c"
FT                   /product="Glutamate:gamma-aminobutyric acid antiporter
FT                   family protein (APC family protein)"
FT                   /note="Similar to Q8YBJ1 Glutamate:gamma-aminobutyrate
FT                   antiporter from Brucella melitensis (510 aa). FASTA: opt:
FT                   983 Z-score: 1079.5 E(): 3.1e-52 Smith-Waterman score: 983;
FT                   34.698 identity in 464 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0480c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08496"
FT                   /inference="similar to sequence:UniProtKB:Q8YBJ1"
FT                   /protein_id="CAL08496.1"
FT                   /translation="MEQIISSKKFGLIRLIMINIIAVDSLRNISITAQAGWIVITFYIL
FT                   AGIFFLIPCALLTAEMSTGSSQENGGIYIWVKKAFGKRLGFLVIWLQWVYNLVWFPSIC
FT                   GFFAGVIAYVIAPLTGQDANHLVANPWYMISMSLVMFWSATAINLFGIKTSSTVSTLGA
FT                   IIGTLLPMFIIIIIAIIWSMSHTAEIVAPKISDFIPSGNNISSWALFITVMFSLFGLEM
FT                   SAIHAANVKNAKKNFPRALLISGSVILGSLILSNIAVILVSSQLQIGDVDIVTGLMVSF
FT                   HYFFSQINMPWMTYIIAVTLIFGAFTTTSAWIMGLSRAFMVVSNDNILPQIFGRTNKND
FT                   APDTMLITQALVFTVFCFSYIFMPSVNEAYWYLSDLTAQLAVIAYILMFITAVKLKISS
FT                   PLEEDQYEICKGSFGTILMALLGCFGCLVAIIVGFIPIDNMAMSVFNFDMMLIVGIVIT
FT                   LIIPAVITIKK"
FT   CDS_pept        499849..501030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potF"
FT                   /locus_tag="FTF0481"
FT                   /product="Putrescine-binding periplasmic protein"
FT                   /note="Similar to Q92RX4 Probable putrescine-binding
FT                   periplasmic protein from Rhizobium meliloti (364 aa).
FT                   FASTA: opt: 847 Z-score: 993.2 E(): 2e-47 Smith-Waterman
FT                   score: 847; 35.714 identity in 350 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0481"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08497"
FT                   /inference="similar to sequence:UniProtKB:Q92RX4"
FT                   /protein_id="CAL08497.1"
FT                   /translation="MKRKVFIIGLLVSLFNLAYSKDESYICDNKILKSPITATQTRTQL
FT                   NFTNWADYISPDIVPCFLDLSNTRVKYIYTSDDNMTRAKIMTGSSGFDLIEQGALYLNS
FT                   EIASNALVKLDKSKLPNLKYRNKVIYDKVSQINDPGNNYAVVYSYGTTGLVYNKQEIEQ
FT                   RLGKGVVPNSWKYVFDKKYLKQIAPCGVSLLDEPEQIFGNYFFYHGIDPNTNSKAEYEK
FT                   AALDIIKNVRPYIKYFDSNKYQNDFTAGNLCLVMGYSGDVVRSVERAKSVNPDVTLAYV
FT                   IPKEGTNIWFDMLMIPKGAKDLDKAYALMNYIIDPYVSAQNSNYLYQPNAVTQNKKYLD
FT                   DIFDDTNIRPTDEMIKKMYVLNIHDAKMQSFISRMWMNVKYGIEFTPKYYKPQ"
FT   CDS_pept        complement(501283..502098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0482c"
FT                   /product="hypothetical lipoprotein"
FT                   /note="ORF ftt0482c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0482c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08498"
FT                   /protein_id="CAL08498.1"
FT                   /translation="MTAKKKLLIGTAILSSAAILGSCGKSETATELRIVDQCNTANDLC
FT                   KFELTDALVSRYTNLLGKTIERIESQTPLQAIQGTITWNTPAGATLATNTDVVTQLGSG
FT                   CQNDSCTANANPTAFNLQVGSNSISVSGTITVNGKTVNLASTVPPVTVDTIQVADSHVF
FT                   QSGTLPAGLTIGDLVTNLNINARDAHGTFSEQNGTLKITCETGYEWIDDQDPPFGSFTT
FT                   ASTSRSVAMSSWLRETNSWINGAQPNFSLTQNGVSNTVSYTWIAGCWQK"
FT   CDS_pept        complement(502317..503204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0483c"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to AAP95905 (AAP95905) Hypothetical protein
FT                   from Haemophilus ducreyi 35000HP (342 aa). FASTA: opt: 686
FT                   Z-score: 815.5 E(): 1.6e-37 Smith-Waterman score: 686;
FT                   40.678 identity in 295 aa overlap ORF ftt0483c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0483c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08499"
FT                   /inference="similar to sequence:INSDC:AAP95905"
FT                   /protein_id="CAL08499.1"
FT                   /translation="MQAKVITNFGGNIFVKLTTGEKVSALQRSHLKGELTVGDNVELEY
FT                   TNATYVITKLLDRKNLISRPNQYQRKNKNIAANIDSAVIIITHSPAPVEHYIDRYLAAL
FT                   HNSDIEPIIVINKIDDQSKNDRQHLQCIIDIYKNIGYKIFYISAKNNIGIDSLLEELKD
FT                   KTSIFIGQSGVGKSETLSTILGEKITATTEVSDSTKKGRHTTTCSTLYEINGSTNIIDS
FT                   PGIREFGLWHISQEELFDGFLDFKKYKGMCQFRNCSHEEGSKGCEIVRQVSLGNINPVR
FT                   FKNYHRILAEIKNN"
FT   CDS_pept        503358..504077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0484"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0484"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0484"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08500"
FT                   /protein_id="CAL08500.1"
FT                   /translation="MKKSKILVSIAIAVFGAAGTSFAAEADKSSSIDKLLPEGYWVQFD
FT                   EDNDAGRGMPNGIIHTYFAKNDKYGKKGTLQMEIVVPLMYVDSSGKPTKPRATCYNCSN
FT                   GSYNGFNYRGENAPLEGFVFAGNMQPEAGTAVANQKSDIYKNGGVINPNDGKVYASEAQ
FT                   VQDGGTTMFAKAAYLVWGKELGSKSAHWKRITKADYEKVKADCGVTADGQYTNSDVKVT
FT                   ATCTNYPVAQFGVKSPV"
FT   CDS_pept        504145..504807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0485"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0485"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0485"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08501"
FT                   /protein_id="CAL08501.1"
FT                   /translation="MLRNLIVIIVAVFVFSFAYTEEDWQGLYATGYWLQRDSVTKTNIA
FT                   VIHAYDNQNGNLNAEVYVPLSNVDDGIIHEPIIYCEKCGKGDAYGNLYDYSSGKDKYQG
FT                   LEFVWNAKKTDNGNLAKGKGPLYTDGAVLNPHDGKYYHVKARTVEYGKKIYVRAYWGFL
FT                   GKSEHWQRISADQAQKIKNLCGLTADNVYTYEDKNGKVNNKELFKECATRNFVKDPL"
FT   CDS_pept        504815..506617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutL"
FT                   /locus_tag="FTF0486"
FT                   /product="DNA mismatch repair protein"
FT                   /note="Similar to MUTL_RICPR (Q9ZC88) DNA mismatch repair
FT                   protein mutL from Rickettsia prowazekii (595 aa). FASTA:
FT                   opt: 1236 Z-score: 1435.6 E(): 4.5e-72 Smith-Waterman
FT                   score: 1236; 37.291 identity in 598 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0486"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08502"
FT                   /inference="similar to sequence:UniProtKB:MUTL_RICPR"
FT                   /protein_id="CAL08502.1"
FT                   /translation="MQPQQHDYRQIKILPESLANQIAAGEVIERPSSVVKELIENAIDA
FT                   GATQIIIEIQEGGKSLIRIRDNGKGIAQQDLKLALAPHATSKVYTLDELEAVASMGFRG
FT                   EALASIASVAKLKIISKHQNSQDAWQINNQTREVMPVAHVTGTTIEVSELFYNTPARRK
FT                   FLKKDNTEFLHIYDLLKKYMLCYFGIAFKLIHNGKEVKDLLMAEEVQLKYNRVLDLYSR
FT                   EFIENAIYVDKQVGDAHLWGWVASPRFNRARADMQSFYINGRIIKDKIVSHAIKNAYKD
FT                   VMYGNRYPAFLLYLDIDYCEVDVNVHPAKSEVRFRNQKFIYDFLFGNINKAITTSADIK
FT                   VSSHQQVISQERQTSNNNPLNIGNMSLDISIDDEKEESSNTSLLDKYFNNQNSQENEIR
FT                   ISQQSKSNGLGQAICQIHGIYILSQVEDGVVLVDMHAAHERILYEEMKKTWHANADKFK
FT                   QNLLMPLTCQLSSSIVAAVDENVEVFKKLGFEISVVADDAILVRSTPIYVKDKDIQTLI
FT                   TNIATELISSSKTKSVEFYLNHILATVSCHAAVRANDKLSIPEMNHLLRQMETVENSGQ
FT                   CNHGRPTWVKLNFAQLDSFFLRGR"
FT   CDS_pept        506974..507708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0487"
FT                   /product="hypothetical membrane protein"
FT                   /note="Similar to Q83AI9 Membrane protein,putative from
FT                   Coxiella burnetii (401 aa). FASTA: 306 opt: 370 Z-score:
FT                   417.4 E(): 2.3e-15 Smith-Waterman score: 370; 30.342
FT                   identity in 234 aa overlap ORF ftt0487"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0487"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08503"
FT                   /inference="similar to sequence:UniProtKB:Q83AI9"
FT                   /protein_id="CAL08503.1"
FT                   /translation="MVDICGFIIPTYRLVMLIGSLLATLCSFKIIPKRNVKNTKISFLR
FT                   NWQEVISFLNQNKTLYWCYLAQIGMTCLYMIAPVFISPYAKNILKASSLEFGLIEVAFS
FT                   VGFIVGNVLLPYMIEKISPKQTLVFSMTISALMYLLLGLNESIFFASIYYLVAGIFISA
FT                   WVVIVTIAQKNTPITLQGKIQGICYGFSGLVVMFIYLIFFAINYLYPLPSNKWFYILAM
FT                   LALSTLWSISKGLKILNLKNKV"
FT   CDS_pept        complement(507715..508848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0488c"
FT                   /product="major facilitator superfamily (MFS) transport
FT                   protein"
FT                   /note="Similar to Q83BM0 Major facilitator family
FT                   transporter from Coxiella burnetii (428 aa). FASTA: opt:
FT                   319 Z-score: E(): 3.7e-11 Smith-Waterman score: 319; 21.951
FT                   identity in 369 aa overlap ORF ftt0488c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0488c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08504"
FT                   /inference="similar to sequence:UniProtKB:Q83BM0"
FT                   /protein_id="CAL08504.1"
FT                   /translation="MPCFFTMVSAFLQIPYGYLIDSKGFEKILPFCIFAVLIGSLVYWL
FT                   CDNHIFIGISRLIIGAGCASSYILVIFIATTYFKKTIIPLLISLGEISVGLGDYFAGNV
FT                   YLYTFKYLGWHMSNIITIIMISLLFFYSMFLIRKIYKIKFALPTLTANRIKVPFKEIIH
FT                   HIIKLAQKPTNIAIFIYSFLTWGIIMTFAGYWGKSYYINMHNYSKEYALSIQEIYWISF
FT                   LIAVLIVGTCTNVIQQAKKYIIILTLIGFIAHLIFIIPILFSYSMIIVITILCGISGSG
FT                   IALGFFIIQYLNSQDKGLIISLNNLFVVLGAMVGQVIFSYLISFDFNKIFKLPNNINPY
FT                   FYSGIIMLLICSILALLAVIFIIRGVSVYQKNEYNNP"
FT   CDS_pept        complement(508990..509940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxB"
FT                   /locus_tag="FTF0489c"
FT                   /product="thioredoxin reductase"
FT                   /EC_number="1.8.1.9"
FT                   /note="Similar to Q8ZGC9 Thioredoxin reductase from
FT                   Yersinia pestis (320 aa). FASTA: opt: 1525 Z-score: 1798.2
FT                   E(): 2.9e-92 Smith-Waterman score: 1525; 70.927 identity in
FT                   313 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0489c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08505"
FT                   /inference="similar to sequence:UniProtKB:Q8ZGC9"
FT                   /protein_id="CAL08505.1"
FT                   /translation="MANHHKLIILGSGPAGYTAAIYAARANLKPVIITGMQPGGQLTTT
FT                   TDVYNWPGEPDGIMGPELMEKLQKQAERFDTQIVYDTINAVDLQNKPFKLVGEVEQYTC
FT                   DTLIIATGATAKYLGLESEEKFMGKGVSACATCDGFFYKNKDVAVVGGGNTAVEEALFL
FT                   SNIAKSVTLIHRRDTLRSEKILIDKLMEKAQHGNINIIWNTTLEEVLGDDMGVNALRIK
FT                   NIKTNEESQMGVAGVFIAIGHTPNTSIFAGQLEMENGYIKVKSGLAGDATQTNIKGVFA
FT                   AGDVADHVYKQAVTSAGTGCMAALDAEKYLDNLDQ"
FT   CDS_pept        complement(510032..511249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0490c"
FT                   /product="Phospholipase D family protein."
FT                   /EC_number="3.1.1.-"
FT                   /note="Similar Q888K0 Phospholipase D family protein from
FT                   Pseudomonas syringae (pv. tomato) (422 aa). FASTA: opt: 440
FT                   Z-score: 514.4 E(): 9.2e-21 Smith-Waterman score: 440;
FT                   25.840 identity in 387 aa overlap ORF ftt0490c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0490c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08506"
FT                   /protein_id="CAL08506.1"
FT                   /translation="MRILFTILAFFGYSYGLAHGITKTIVHNYPENISKSFQISNNNYA
FT                   PLQISKLIQSAKKNIDIEVFYIDIKKDSVLDKMIIQPLAAKANQGIKVRILVDDKFYSQ
FT                   YSNNKASCDYLNSIKNITCKPTKEFQEAVMHSKMISIDGKSFYIGSHNFDWITFELNHE
FT                   LGVIVKNDKINAAKLEKSFNDDWNFTNKSKKLTDNNLNTYSLHDQGNQAIVTVTPDIDK
FT                   KGYPKSNLKTFISLIKSAKSSIVIQAMIVSGIDPYMNDKNWDEFTKALSDANKRNVYVK
FT                   IMFSNWMFTKSSYKDSNDWLQKLIHQSNQNHLKIKYTSLPHTKQCVPFSEVDHAKYAIF
FT                   DGTIAWVSTSNIQKSYFYAAKNYSYIADDKDLSRQLTDVFEQLWDSKYAHTYSQPVGII
FT                   STPSCT"
FT   CDS_pept        complement(511292..511966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gph"
FT                   /locus_tag="FTF0491c"
FT                   /product="phosphoglycolate phosphatase"
FT                   /EC_number="3.1.3.18"
FT                   /note="Similar to Q82SZ4 Phosphoglycolate phosphatase from
FT                   Nitrosomonas europaea (240 aa). FASTA: opt: 432 Z-score:
FT                   532.2 E(): 9.4e-22 Smith-Waterman score: 432; 33.486
FT                   identity in 218 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0491c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08507"
FT                   /inference="similar to sequence:UniProtKB:Q82SZ4"
FT                   /protein_id="CAL08507.1"
FT                   /translation="MISYTMIKNIFFDLDGTLVNTVGDLTVATNTMRKHFGLNPVSEDV
FT                   LANIIGKGYPTTVRKVLALDFDDKDYIESIADEGVKIVSQTYKTLNSANSKVYPNIFKT
FT                   LDFLKQQNIKMAVVTNKHEEDAIQSLTHLGLVDYFEVIVGGDSTASYKPYPEPLLFAMN
FT                   KLNAKPEESLMVGDSINDFLCAQGANIKIVIVSYGYHNGIDLKSLESFAYIDDFSTIKN
FT                   LI"
FT   CDS_pept        complement(512007..512933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysR"
FT                   /locus_tag="FTF0492c"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="Similar to Q87J66 Transcriptional regulator, LysR
FT                   family from Vibrio parahaemolyticus (311 aa). FASTA: opt:
FT                   675 Z-score: 768.6 E(): 6.4e-35 Smith-Waterman score: 675;
FT                   33.115 identity in 305 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0492c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08508"
FT                   /inference="similar to sequence:UniProtKB:Q87J66"
FT                   /protein_id="CAL08508.1"
FT                   /translation="MKMLYELKLFVAVINYGNLSAAGREFYLSPASISNKINALEEYYQ
FT                   TKLLIRTTRKIEPTKAGEKLYTTAIKLLEQLENLQEDIQNNENSAEGVIKITIPFDLGK
FT                   QIILPILDEFKEKNPNIQYDINLSDDVMSYNQFPFDIAIRYGNLPDSNFIAKKLVDNYR
FT                   MLCASPEYLKKMDISNTDDINILQNCDFITLKINSNTIKKWYLIDQENNKHEVNIKPSY
FT                   IVNNGYISRQMCLNGNGISEKSYWDVKQDLKSGKLVQVLPNYRVTLNKKDKPDNMISLL
FT                   YPSDQFQPYRIRMLSKFIVDSFSKFKS"
FT   CDS_pept        join(513046..513684,513684..514217)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0493"
FT                   /product="major facilitator superfamily (MFS) transport
FT                   protein, pseudogene"
FT                   /note="Similar to Q8A342 Putative transmembrane efflux
FT                   protein from Bacteroides thetaiotaomicron (380 aa). FASTA:
FT                   opt: 990 Z-score: 985.6 E(): 5.3e-47 Smith-Waterman score:
FT                   990; 42.487 identity in 386 aa overlap. Contains a
FT                   frameshift after aa 213 ORF ftt0493"
FT                   /db_xref="PSEUDO:CAL08509.1"
FT                   /inference="similar to sequence:UniProtKB:Q8A342"
FT   CDS_pept        complement(514232..514954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cutC"
FT                   /locus_tag="FTF0494c"
FT                   /product="CutC family protein"
FT                   /note="Similar Q9CNA6 Hypothetical protein PM0526 from
FT                   Pasteurella multocida (244 aa). FASTA: opt: 521 Z-score:
FT                   651.2 E(): 2.2e-28 Smith-Waterman score: 521; 40.175
FT                   identity in 229 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0494c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08510"
FT                   /protein_id="CAL08510.1"
FT                   /translation="MTNLEICVDNYQSIINAQKAGDDRLELCSALGVEGLTPSPSLVKF
FT                   AKENFTGSLQAMVRHRAGDFYYDEIDQQIMLDDLKAMLELDVNGIVIGALTRENKIDKN
FT                   FLEPFIKLTKKAGKELTFHRAIDLTTDIYTATQEIIDLGFDRILTSGTATNAIVGLETI
FT                   KSLQQQFGNQIQIMPGGGINSTNVKEILETTKVTSIHCSASKKILRDIDSLAFPVSALE
FT                   IKVSQADKIIAIKSKLNN"
FT   CDS_pept        515287..515790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0495"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Q9K0Q8 Hypothetical protein NMB0526 from
FT                   Neisseria meningitidis (serogroup B) (172 aa). FASTA: opt:
FT                   455 Z-score: 573.9 E(): 4.5e-24 Smith-Waterman score: 455;
FT                   42.353 identity in 170 aa overlap ORF ftt0495"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0495"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08511"
FT                   /inference="similar to sequence:UniProtKB:Q9K0Q8"
FT                   /protein_id="CAL08511.1"
FT                   /translation="MSQLFIVYLGGSAPKANIELHDVQFVIADNIEGTYEQLRQNWFGT
FT                   VKDLHLDSYKAVKGADGYQISIQDKPQNSDKKLYFVNLGGYDASKLNELHEFALFVAAD
FT                   NTEAKEKAKQSLLKNSLHQHKDNLMEVDDCLELSKVDGKYIHLTPSDKEYDLKPYWFGY
FT                   RVIG"
FT   CDS_pept        515796..516560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0496"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Q935B8 Hypothetical protein HCM2.0044c
FT                   from Salmonella typhi (251 aa). FASTA: opt: 242 Z-score:
FT                   297.7 E(): 1.1e-08 Smith-Waterman score: 296; 28.000
FT                   identity in 250 aa overlap ORF ftt0496"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0496"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08512"
FT                   /inference="similar to sequence:UniProtKB:Q935B8"
FT                   /protein_id="CAL08512.1"
FT                   /translation="MILYQYRGNIHDNSKQDKKFFIDLITNGSIKFTNPIDFNDPFDCY
FT                   PNSWGNEIHQGELPHAVVDSCNYMLQKALSQIVGVTCFTPHNDRMLMWSHYASQHKGIC
FT                   IGFDTDILIKECDKNSHGSPVIHSLKKVIYTDERPCERDADKFIKKSTEWGYENEYRLI
FT                   SCAVKGTPQWGPGVWEIPEKSIKEVIFGARIPQEIQKELVRKIKQFRSDIKLKKAVLDS
FT                   YTYKIIIEDLDLQPDIAPMTGSLIGPNGNIDF"
FT   CDS_pept        complement(join(516566..517363,517365..517475))
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0497c"
FT                   /product="Asparaginase 2 family protein, pseudogene"
FT                   /EC_number="3.5.1.1"
FT                   /note="Similar to ASGX_PYRAB (Q9V262) Putative
FT                   L-asparaginase from Pyrococcus abyssi (305 aa). FASTA: opt:
FT                   407 Z-score: 472.8 E(): 1.8e-18 Smith-Waterman score: 431;
FT                   34.483 identity in 290 aa overlap. Contains a frameshift
FT                   after aa 37 ORF ftt0497c"
FT                   /db_xref="PSEUDO:CAL08513.1"
FT                   /inference="similar to sequence:UniProtKB:ASGX_PYRAB"
FT   CDS_pept        complement(517479..518924)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0498c"
FT                   /product="Di-/tripeptide transporter, proton-dependent
FT                   oligopeptide transport (POT) family protein, pseudogene"
FT                   /note="Similar to AAO80296 (Q838K6)Di-/tripeptide
FT                   transporter from Enterococcus faecalis (493 aa). FASTA:
FT                   opt: 907 Z-score: 1018.4 E(): 7.1e-49 Smith-Waterman score:
FT                   907; 34.623 identity in 491 aa overlap. Contains 2 in-frame
FT                   stop codons after aa 379 and 420 ORF ftt0498c"
FT                   /inference="similar to sequence:INSDC:AAO80296"
FT   CDS_pept        519151..519873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0499"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Q8ZA05 Hypothetical protein YPO4021 from
FT                   Yersinia pestis (414 aa). FASTA: opt: 230 Z-score: 284.7
FT                   E(): 5.7e-08 Smith-Waterman score: 230; 24.779 identity in
FT                   226 aa overlap ORF ftt0499"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0499"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08515"
FT                   /inference="similar to sequence:UniProtKB:Q8ZA05"
FT                   /protein_id="CAL08515.1"
FT                   /translation="MFKTTVKKVLIVNPGPSAEYTITELFKNDVEIFVIITLDPIVILK
FT                   LIEKVLTKIKNVISSEDNFDISYLESLSFDYIICGQEDSIVIYDRLMNKLLTQYANSLN
FT                   TSLVRKDKYLTHEVLKAKGLNYIKQKQISYDDYAEVEIDYPCFIKPLDGSASIGAQRLN
FT                   SDINKENYMQQRLVSPMSRVYDKFIISELIQGKEYFVDTFSINGKHYISSIQKYDKLIF
FT                   KGTPIPISSELEKDPAIL"
FT   CDS_pept        520103..520363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0500"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0500"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0500"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08516"
FT                   /protein_id="CAL08516.1"
FT                   /translation="MFAKTLCLYNFTNNPLIDLNTLKSTFSSIKVVNQLKPIGYVRNHD
FT                   SNLSIIDIVAFMVLQNDNFEKLEKDAQQILKCDIETGYTIV"
FT   CDS_pept        complement(520495..521535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0501c"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="Similar to Q9I0I7 Hypothetical protein PA2651 from
FT                   Pseudomonas aeruginosa (352 aa). FASTA: opt: 382 Z-score:
FT                   397.1 E(): 3.2e-14 Smith-Waterman score: 382; 26.686
FT                   identity in 341 aa overlap ORF ftt0501c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0501c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08517"
FT                   /inference="similar to sequence:UniProtKB:Q9I0I7"
FT                   /protein_id="CAL08517.1"
FT                   /translation="MLLFKMTSYTNIKKLSIICLVGALIGWVLYPFIYPILFAGLLAII
FT                   LAPLQLYLEQHIGRHKSSFIIVIAILLCIFIPLLIVLSYVITEIISYLQHSESLSQTFS
FT                   QLSKSIANIPYIGSTLQEHFDNLLNMVNQDKDMIISNLGKILPTIRYIGFTSVSLLTDF
FT                   LITLLLVYQFLVSSTSLEKFLKKIILKDFHDSDSFISAAIATTRRVSLAIFLTAMLVGT
FT                   MMTITFSMVDIPSPILFGFIAAIASMVPFMVGIIYILIGASVFVIYGATKAIIILIIGF
FT                   SLNIFTDNIMQPKIINKQVKLSFVASLIGIMGGIHAFGFIGIFLGPVIFNVAFVGIEKL
FT                   MNNQEY"
FT   CDS_pept        complement(521919..522344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0502c"
FT                   /product="hypothetical membrane protein"
FT                   /note="ORF ftt0502c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0502c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08518"
FT                   /protein_id="CAL08518.1"
FT                   /translation="MFKKTFSFFVVCVLLLNINLAYSSSSENKITDIKMHSDSVPKVCN
FT                   QISTTLITPITAVGIAVGTVLMIPVGLIGGMAGGTIMSPMMFDSGGLSKNPIIQPIQIT
FT                   GAALLGIILGAGVGSIELPVQTASSLTKSAQSNCYML"
FT   CDS_pept        complement(522456..523328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucD"
FT                   /locus_tag="FTF0503c"
FT                   /product="Succinyl-CoA synthetase, alpha subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="Similar to Q9JUS9 Putative succinyl-CoA synthetase
FT                   alpha from Neisseria meningitidis (serogroup A) (296 aa).
FT                   FASTA: opt: 1574 Z-score: 1817.5 E(): 2.4e-93
FT                   Smith-Waterman score: 1574; 81.661identity in 289 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0503c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08519"
FT                   /inference="similar to sequence:UniProtKB:Q9JUS9"
FT                   /protein_id="CAL08519.1"
FT                   /translation="MSVLVDKNTKVLVQGFTGKNGTFHSEQAIAYGTNIVGGVTPGKGG
FT                   TTHLDRPVFNTMAEAVAATGADASVIYVPAPFVKDSAIEAIDSGVKLVVIITEGVPTLD
FT                   MLVVKEYLKDKDVRVIGPNCPGIITPGECKIGIMPGHIHMKGKVGIISRSGTLTYEAVA
FT                   QTTKLGFGQSTCIGIGGDPIPGMNQIEALKLLENDPQTEAIILIGEIGGTAEEEAAEYI
FT                   KHNVTKPVIGYIAGVTAPPGKRMGHAGAIISGGKGTAEEKFAAFEAAGIAYTRSPAEIG
FT                   KKLKEVTGW"
FT   CDS_pept        complement(523360..524523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucC"
FT                   /locus_tag="FTF0504c"
FT                   /product="Succinyl-CoA synthetase beta chain"
FT                   /EC_number="6.2.1.5"
FT                   /note="Similar to SUCC_NEIMA (Q9JUT0) Succinyl-CoA
FT                   synthetase beta chain from Neisseria meningitidis
FT                   (serogroup A) (388 aa). FASTA: opt: 1995 Z-score: 2360.6
FT                   E(): 1.4e-123 Smith-Waterman score: 1995; 79.793 identity
FT                   in 386 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0504c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08520"
FT                   /db_xref="GOA:Q14IV5"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14IV5"
FT                   /inference="similar to sequence:UniProtKB:SUCC_NEIMA"
FT                   /protein_id="CAL08520.1"
FT                   /translation="MNLHEYQAKDLLESYGLKVQKGIVAHNPNEAAQAFDQLGGKFAVV
FT                   KAQVHAGGRGKAGGVKVVKSSQEAREVAESLIGKNLVTFQTDAEGQPVNSVGVFEDVYP
FT                   VTRELYLGAVVDRSSRKVTFMASTEGGVDIEEVAHNSPEKILKVEVDPLVGLQPFQARE
FT                   VAFKLGLEGKQINDFVKTMLGAYKAFIECDFALFEINPLAVRENGEIVCVDGKINLDSN
FT                   ALYRHPKLLALRDKSQENAKELKASEHELNYVALEGNIGCMVNGAGLAMATMDIIQLYG
FT                   GKPANFLDVGGGATKERVIEAFKLILDDENVKAILINIFGGIVRCDMIAEAIIEAVKEV
FT                   NVTVPVVVRLEGNNAEKGAKILADSGLKLIPADGLADAADKVVKSLG"
FT   CDS_pept        524693..526606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0505"
FT                   /product="hypothetical membrane protein"
FT                   /note="ORF ftt0505"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0505"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08521"
FT                   /protein_id="CAL08521.1"
FT                   /translation="MFDYIFNKIKATVFSKITPAQLLLTAILAFVFGFVPGIAYSPLLF
FT                   IGVLFLVIILRINIGVFVFIAIIAKALSYILQGISFAVGTFLLDGFTQPLFKTLVNTPI
FT                   VAYAGFDYYLVTGAFVVAIVLGVIFGVIIAKFYKKIVAKMAAIQFGTELYNKITKNFFV
FT                   KIAGWIFLGKNIAKVNWVEMQNRKFRQPFRLTGVILVALIIAVLIYSPKLLETSLVSNI
FT                   IKQQLTKANGATVDYQSLNLDLTDAKLEITGLGAADPNDLNKDRFYAQSVSASINISNL
FT                   LTRQITLKNVVVTGVALDKQRTTKAKLYIDTKPLTSEQSKISSEAIKQQAIETVGKVGE
FT                   KLQQVDLQKLKENSQQAKDIANGIKQVAEFLSNFRSSDTESGLVSQEITPKAEAKVYGY
FT                   ANVKNEDLRDKYPSFVIQNIDIKDYKDAGIIYNANITNISTNPALLGLPTTIAIKSTNN
FT                   NDFDANIVISNKQNVDNTVKFNLQNITGNNVKGLTIQDVGLDAESLAVSGQGTWQFSGI
FT                   RNITFNIPLQLKFNNVAVSFKQLRQNVSDLTLGGVISGDLNKPNLSVDASSLKNLLNVD
FT                   TVKNVANQVAKQTGIDKKAQQVINSAKINGKSIKDLNANDLKNINKKDVQNLASQFGIT
FT                   IN"
FT   CDS_pept        complement(526614..526928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0506c"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0506c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0506c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08522"
FT                   /protein_id="CAL08522.1"
FT                   /translation="MPTPKYSSSIDIIADNSNQPLSEEYINIYNTNSTVKSQIIKLPAN
FT                   YEGTEYILINSHFYQDQYIYKADQLRNNVIVRCGETTEVKIKYYKEIPSNRRSDARGFR
FT                   "
FT   CDS_pept        527587..528354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0507"
FT                   /product="conserved hypothetical lipoprotein"
FT                   /note="Similar to Q9X610 BcfH from Salmonella typhimurium
FT                   (269 aa). FASTA: opt: 305 Z-score: 371.4 E(): 8.5e-13
FT                   Smith-Waterman score: 305; 31.122 identity in 196 aa
FT                   overlap ORF ftt0507"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0507"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08523"
FT                   /inference="similar to sequence:UniProtKB:Q9X610"
FT                   /protein_id="CAL08523.1"
FT                   /translation="MKKLLVTLGISSVLILSSCANHQNIQAQEASVNHKTSNDYAKIIA
FT                   IPDIVKDLLSDPSTPTVGPQDANKAVVVFFDYGCGKCAEISKEINKLMKENPNVKFIFK
FT                   AYPSVKRDAKVANYASLVANEAYLQGGSELFLAYNKAIFAQRETNGELTDQDVDNVVKR
FT                   LGIKVNDTKLKQKAAAEELDTRKLGKLIGFQGPHSFVILPTNLASMNANDLGNNVDKVY
FT                   VISDKQTNAITDNYQQAAKWVATNIQAQLNNIK"
FT   CDS_pept        complement(528361..529344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dusA"
FT                   /locus_tag="FTF0508c"
FT                   /product="RNA dihydrouridine synthase A"
FT                   /EC_number="1.-.-.-"
FT                   /note="Similar to Y926_SYNY3 (P72872) Hypothetical protein
FT                   sll0926 from Synechocystis sp. (strain PCC 6803) (334 aa).
FT                   FASTA: opt: 1129 Z-score: 1337.0 E(): 1.4e-66
FT                   Smith-Waterman score: 1129; 51.911 identity in 314 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0508c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08524"
FT                   /inference="similar to sequence:UniProtKB:Y926_SYNY3"
FT                   /protein_id="CAL08524.1"
FT                   /translation="MKITTRKICIAPMLDWTDRHYRYMMRLITRHTMLYTEMVTLNAIL
FT                   HGNKEFLLKYNPQENPVTLQLGGCVPKDFISCGKLAEELGYNEININVGCPSERVKKGN
FT                   FGLSLMAEPELVADCVKAMKDNLNIPISVKCRIGYDHNDSYEELYNFVDKQVQAGIDYL
FT                   CIHARKGWLSGLSPKENRTIPELKYDVVYSIKKDFPNLELGINGGITTIQEIQQHLKYV
FT                   DSVMIGREAYHNPMLFKDFDNIFYNQPTTNISALEIAYKMAEYIKDQMDNDPYIKLNNI
FT                   TKHTLNLFNGLPNAKVYRRYLSENATKKEANVDTFLTALEVFENKL"
FT   CDS_pept        complement(529378..530178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0509c"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Q8DBN3 Conserved hypothetical protein
FT                   from Vibrio vulnificus (184 aa). FASTA: opt: 275 Z-score:
FT                   356.8 E(): 5.5e-12 Smith-Waterman score: 275; 30.208
FT                   identity in 192 aa overlap ORF ftt0509c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0509c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08525"
FT                   /inference="similar to sequence:UniProtKB:Q8DBN3"
FT                   /protein_id="CAL08525.1"
FT                   /translation="MKKKNILFLILIVVVITASFLLGKKSGFNKAESIHESELRILEQS
FT                   KLSQTPEDSLNCRPEVNPNKDNYVIGYGSLMNKDSRQITVPNATYAAPILVSGFERLWA
FT                   SRGEKSRATFLLAVPNKGYAMNAIYYKADAKDISATDLREASYCRVKIPRKDIVPLGIK
FT                   SLPKGDFWMYVKDFKDAEFPNKDYPILQTYADTFMTGCLQTQAEFNLTEFGKLCFDTTY
FT                   NWDLANWLYDRSNPRYSRYSQYTEKYRPQIDKIIRRLTFDDDPL"
FT   CDS_pept        530354..532771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="FTF0510"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="Similar to GYRB_SALTY (Q60008) DNA gyrase subunit B
FT                   from Salmonella typhimurium (803 aa). FASTA: opt: 3370
FT                   Z-score: 3873.3 E(): 7.5e-208 Smith-Waterman score: 3370;
FT                   63.321 identity in 807 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0510"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08526"
FT                   /inference="similar to sequence:UniProtKB:GYRB_SALTY"
FT                   /protein_id="CAL08526.1"
FT                   /translation="MLMSENKAYDSSSIKVLKGLDAVRKRPGMYIGDTDDGSGLHHMVF
FT                   EVVDNAIDEALAGYCDDIKVIINKDGSVSVSDNGRGIPTDIHKEEGRSAAEVILTVLHA
FT                   GGKFDDNSYKVSGGLHGVGVSVVNALSEQLKLTIYRNGIEHYQEYVHGVPQFPLKEVGS
FT                   TDKTGTLITFKPSKETFSFVDFDYDILMKRIRELSFLNSGVKIELIDKINNRSEIFKYD
FT                   GGIVAFVKYLNNSKKPIHENVIAVNGIKDDIQVELALQWNDSYKESIFCFTNNIPQRDG
FT                   GTHLSGLKAAVTRTMNNYIESEGLNKKLKVTLTGEDTREGLAAVLSVKVPDPKFSSQTK
FT                   DKLVSSDVKSAVESLVNEKLQEFLLENPKEAKIICEKILDSAKAREAARKARDMTRRKG
FT                   ALDIAGLPGKLADCQEKDPALSEIYLVEGDSAGGSAKQARDRKTQAILPLKGKILNVEK
FT                   ARFDKMLGSQEVATLIKALGCGIGAEDYNPDKTRYHKIILMTDADVDGSHIRTLLLTFF
FT                   YRQMPELVERGYLYIAQPPLYKVKKGKQETYLKDEDALAEYLGNIGLEGACIYLSNGNV
FT                   ISGQVLANYYELYQKSQKVIKKYTKTYPEKLLRVMAYGTKYVDESADISEWWQKIVENC
FT                   NQKALAYERFKLIETKDIGEDGKENISYGVNHYINGYDTDYIVKSSFFSTKDYEDLVTY
FT                   GDVLSDISFEGAYVERGAKKEYVDDFESAIDWLLKEARKGNDVQRYKGLGEMNPGQLWE
FT                   TTMDPDNRVLLQVSIKDAVEADALFTTLMGDEVEPRRNFIESNALNVVNLDV"
FT   CDS_pept        532901..533764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0511"
FT                   /product="Pyridoxine/pyridoxal 5-phosphate biosynthesis
FT                   protein"
FT                   /note="pyridoxine/pyridoxal 5-phosphate biosynthesis
FT                   protein. Aa 1-239 identical to O69190 Hypothetical 25.4 kDa
FT                   protein (Fragment) Francisella tularensis strain Ebina (239
FT                   aa). Similar to Y594_CLOAB Hypothetical protein CAC0594
FT                   from Clostridium acetobutylicum (291 aa). FASTA: opt: 1335
FT                   Z-score: 1543.6 E(): 4.3e-78 Smith-Waterman score: 1335;
FT                   72.222identity in 288 aa overlap ORF ftt0511"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0511"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08527"
FT                   /db_xref="GOA:Q14IU8"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14IU8"
FT                   /protein_id="CAL08527.1"
FT                   /translation="MSDINIKIGLAEMLKGGVIMDVVNAEQAEIAQQAGAVAVMALERV
FT                   PADIRKDGGIARMSDPKLIKEIMSVVSIPVMAKARIGHFVEAQILESLGVDFIDESEVL
FT                   TPADELNHIDKDSFKVPFVCGCTNLGEALRRIGEGAALIRTKGEAGTGNIVEAVRQLRQ
FT                   VNKDINYIKNADKSELMAIAKNLQAPYDLVTYVHKNGKLPVPNFSAGGVATPADAALMM
FT                   QLGAESVFVGSGIFKSADPLKRARAIVSAVTYYNDAKILAEVSEDLGEPMTGINCDFEK
FT                   FSQRGW"
FT   CDS_pept        533758..534306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0512"
FT                   /product="SNO glutamine amidotransferase family protein"
FT                   /note="Similar to Q9KGN5 Amidotransferase from Bacillus
FT                   halodurans (196 aa). FASTA: opt: 513 Z-score: 656.5 E():
FT                   1.1e-28 Smith-Waterman score: 513; 46.196 identity in 184
FT                   aa overlap ORF ftt0512"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0512"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08528"
FT                   /db_xref="GOA:Q14IU7"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14IU7"
FT                   /inference="similar to sequence:UniProtKB:Q9KGN5"
FT                   /protein_id="CAL08528.1"
FT                   /translation="MVIMTQKVGVLAIQGGYQKHADMFKSLGVEVKLVKFNNDFDSIDR
FT                   LVIPGGESTTLLNLLNKHQIFDKLYNFCSSKPVFGTCAGSIILSKGEGYLNLLDLEVQR
FT                   NAYGRQVDSFVADISFNDKNITGVFIRAPKFIVVGNQVDILSKYQNSPVLLRQANILVS
FT                   SFHPELTQDPTIHEYFLAM"
FT   repeat_region   complement(534311..534322)
FT                   /note="ISFtu1 12bp terminal inverted repeat"
FT   CDS_pept        complement(join(534410..534868,534868..535194))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="isftu1"
FT                   /locus_tag="FTF0513c"
FT                   /product="Transposase"
FT                   /note="ISFtu1. Transposase, member of the IS630 Tc-1
FT                   mariner family. Identical to Q93EJ6 Putative transposase
FT                   from Francisella tularensis (118 aa) from aa 144-261.
FT                   Identical to Q93EJ7 putative transposase from Francisella
FT                   tularensis (126 aa) from aa 1-109. Q93EJ6 and Q93EJ7
FT                   previously characterised as two separate ORF's. ORF1
FT                   (identical to Q93EJ7) contains a programmed ribosomal
FT                   frameshifting motif, 5'-AAAAAAAG-3' at aa position 109
FT                   which permits frameshifting to ORF2 (identical to Q93EJ6)
FT                   to produce a single ORF. Alignment of this single ORF with
FT                   additional members of the IS630 family, and also mariner
FT                   elements, show that this transposase shares strongly
FT                   conserved residues, including a fully conserved
FT                   dipeptide,Asp-Glu (DE), and a block consisting of a fully
FT                   conserved Asp and highly conserved Glu, separated by 34 or
FT                   35 residues (D35E). The conserved dipeptide is only present
FT                   if ribosomal frameshifting occurs."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0513c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08529"
FT                   /protein_id="CAL08529.1"
FT                   /translation="MPSYSQDFRDIVINKHEEGMTEFELSKFFNIDKRTVVSWIEFYKR
FT                   TGDYSSKQGVGCGRVASFTDKTLIEQYLIDHPDASALDIKEALAPDIPRSTFYDCLNRL
FT                   GFSFKKKTPKYKQRKEHERLEYIEKLKEIAQNLLFYIDEMGCDNKLSILRGWSLIGEPS
FT                   YGEVLAYQTQRRSIVAGYNYADKKIIALLEYSGYTNTEIFNQWFEEHLCPSLKPKTTIV
FT                   MDNASFHKSSKLIEIANKFDVQILYLPPYSPDLNPIEKV"
FT   repeat_region   complement(535215..535230)
FT                   /rpt_type=TANDEM
FT                   /note="16bp Short Sequence Tandem Repeat (SSTR)"
FT   repeat_region   complement(535231..535246)
FT                   /rpt_type=TANDEM
FT                   /note="16bp Short Sequence Tandem Repeat (SSTR)"
FT   repeat_region   complement(535247..535258)
FT                   /note="ISFtu1 12bp terminal inverted repeat"
FT   CDS_pept        join(535262..535789,535789..536388)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lldD2"
FT                   /locus_tag="FTF0514"
FT                   /product="L-lactate dehydrogenase, pseudogene"
FT                   /EC_number="1.1.2.3"
FT                   /note="Similar to Q9KKW6 L-lactate dehydrogenase from
FT                   Vibrio cholerae (378 aa). FASTA: opt: 927 Z-score: 1134.7
FT                   E(): 2.6e-55 Smith-Waterman score: 999; 43.005 identity in
FT                   386 aa overlap. Contains a frameshift after aa 179"
FT                   /db_xref="PSEUDO:CAL08530.1"
FT                   /inference="similar to sequence:UniProtKB:Q9KKW6"
FT   CDS_pept        536411..536587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0515"
FT                   /product="hypothetical membrane protein"
FT                   /note="ORF ftt0515"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0515"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08531"
FT                   /protein_id="CAL08531.1"
FT                   /translation="MQIITVSEYLRTRLSELGIKDIIGVAGDYNLNGVEIVINYVLVML
FT                   LMIMLRLMGLVKK"
FT   CDS_pept        join(536726..537646,537646..537701,537705..538524,
FT                   538524..539852)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0516"
FT                   /product="Oxidoreductase, pseudogene"
FT                   /EC_number="1.-.-.-"
FT                   /note="Similar to Q8D5V2 Fe-S oxidoreductase from Vibrio
FT                   vulnificus (946 aa). FASTA: opt: 1932 Z-score: 2064.4 E():
FT                   3.9e-107 Smith-Waterman score: 2293; 36.670 identity in
FT                   1039 aa overlap. Contains a ~40 aa insertion,a frameshift
FT                   at a heptanucleotide sequence after aa 307 and so could be
FT                   part of a programmed translational frameshift, an in-frame
FT                   stop codon after aa 326 and a 2nd frame shift after aa 600
FT                   ORF ftt0516"
FT                   /inference="similar to sequence:UniProtKB:Q8D5V2"
FT   CDS_pept        join(539870..540419,540418..541028)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0517"
FT                   /product="Iron-containing alcohol dehydrogenase,pseudogene"
FT                   /EC_number="1.1.1.-"
FT                   /note="Similar to Q8YNJ9 NADH-dependent butanol
FT                   dehydrogenase from Anabaena sp. (384 aa). FASTA: opt: 1347
FT                   Z-score: 1668.9 E(): 4.6e-85 Smith-Waterman score: 1347;
FT                   52.468 identity in 385 aa overlap. contains a frameshift
FT                   after aa 175. Frameshift occurs at a heptanucleotide
FT                   sequence and so could be part of a programmed translational
FT                   frameshift ORF ftt0517"
FT                   /db_xref="PSEUDO:CAL08533.1"
FT                   /inference="similar to sequence:UniProtKB:Q8YNJ9"
FT   CDS_pept        541265..542110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prmA"
FT                   /locus_tag="FTF0518"
FT                   /product="50S ribosomal protein L11, methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="Similar to Q9CLW2 PrmA (Ribosomal protein L11
FT                   methyltransferase) from Pasteurella multocida (293 aa).
FT                   FASTA: opt: 572 Z-score: 685.5 E(): 2.7e-30 Smith-Waterman
FT                   score: 580; 33.677 identity in 291 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0518"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08534"
FT                   /inference="similar to sequence:UniProtKB:Q9CLW2"
FT                   /protein_id="CAL08534.1"
FT                   /translation="MQQWHQLEFRLKSKYFDRIENYLFDNDAGSVTRIDKSDDIISITV
FT                   LYENHHDIDTIIANIKQKFENIIESEISYEIIKDQQWEAAWLYDYEPIEIGNNIVVYPN
FT                   WRQPPQDNKHTYIIVDPSIAFGCGNHETTKMCLEWLEQHVSKDTTVLDYGCGTGVLAIG
FT                   AVKLGAKYAEGIDIDPNSIESSIKNAQENDVTDKTHFSDNPPTQQFDLVVANIFSNVLI
FT                   SLVGNITTSLKKGGRLALSGIIENQVDEVQQEFKKYAITFNQPKQMGQWFLLDGIKNGL
FT                   "
FT   CDS_pept        542100..543083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0519"
FT                   /product="Nif3 family protein"
FT                   /note="Similar to Q9KGG5 Transcriptional regulator involved
FT                   in nitrogen regulation, NifR3/Smm1 family from Bacillus
FT                   halodurans (334 aa). FASTA: opt: 1134 Z-score: 1336.1 E():
FT                   1.6e-66 Smith-Waterman score: 1134; 52.484 identity in 322
FT                   aa overlap ORF ftt0519"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0519"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08535"
FT                   /inference="similar to sequence:UniProtKB:Q9KGG5"
FT                   /protein_id="CAL08535.1"
FT                   /translation="MDFKIADIEIENNVVLAPMAGFCDSAFRTICKEHGAGLIYTEMVS
FT                   NKAVVEHNWETMEMLYMENSEKPLGIQIFGTDINSFVGATKYIAENTECDFLDINMGCP
FT                   MPKVAKKLQAGAALLKDVNRIHEILTAVVKAVHKPVTVKMRIGWDEQNINAIEVAKACQ
FT                   DAGVSAIAIHGRTREQMYTGKANWDIIRDVRKAVDTVVIGNGDVFCPHSAKAMMEHTGV
FT                   DAVMVGRASRGNPWIFRQIAEYLNTGELIPPPTPVERVDVLEEHLRRLIKLKTAKVAVK
FT                   EIRTHASFYLQDLPNSKEFRMKLNQLEHEQEIFKVLEEYKKSLYKF"
FT   CDS_pept        543313..543906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0520"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0520"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0520"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08536"
FT                   /protein_id="CAL08536.1"
FT                   /translation="MDQEVKLTSSSRGTGRALADLIVWKSAEDKKKNKTAFMVLEFKAE
FT                   NLELKVEDCYQGYNYATWSRADLFAVSNGKETQVYKVVDTELPLSLKPLGEILNANIIN
FT                   NAKKLKEELEKTVEFKGDEFAKVLNKCHNIIRNNDKLSPEAAFDEISKVLFIKIMYERN
FT                   INQNQMFSLDEFKRLRENFREIHKGTSQENDSFI"
FT   CDS_pept        543907..544314
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0521"
FT                   /product="conserved hypothetical protein, fragment"
FT                   /note="Similar to Q8KDY9 Hypothetical protein CT0905 from
FT                   (173 aa). opt: 268 Z-score: 346.0 E(): 2e-11 Smith-Waterman
FT                   score: 268; 54.795 identity in 73 aa overlap. Contains no
FT                   start codon due to a deletion at N-terminal ORF ftt0521"
FT                   /inference="similar to sequence:UniProtKB:Q8KDY9"
FT   CDS_pept        544433..545410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0522"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Q8EGY1 Type I restriction-modification
FT                   system, M subunit, putative from Shewanella oneidensis (684
FT                   aa). FASTA: opt: 278 Z-score: 287.3 E(): 4.1e-08
FT                   Smith-Waterman score: 291; 31.081 identity in 222 aa
FT                   overlap ORF ftt0522"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0522"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08538"
FT                   /inference="similar to sequence:UniProtKB:Q8EGY1"
FT                   /protein_id="CAL08538.1"
FT                   /translation="MARVSKMNMIMHGDGHNGIHHNDGLLNVNGIFRNRFDVILTNPPF
FT                   GTNLGKDNSKVSEEDKYTDEKMITHYKKIYGDVYEEELKQVTDNFGKPIRSLYKTGEIS
FT                   VATEVLFVERCLDLLKAGGRMGIVLPEGVLNSSNLQKAREYFESRAKILLIVSLPQDLF
FT                   VSSGATVKTSLVFLKKFTVEEQEQYETVKTQAEKEAEQKYQPQLLEIQQKIDFEKSIKQ
FT                   HITKLRKALKTKTAKNKENLQLTLDETIVEHTEYKKKVKQYKAQLKELEAKQQEEAKQL
FT                   IKQKFDYEIPIAEIEKAGVSTIGAEIDNQLPELLKEFKEYYKRK"
FT   CDS_pept        545535..546761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0523"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Q89Z57 Type I restriction enzyme EcoAI
FT                   specificity protein from Bacteroides thetaiotamicron (474
FT                   aa). FASTA: opt: 208 Z-score: 239.0 E(): 2e-05
FT                   Smith-Waterman score: 246; 24.363 identity in 353 aa
FT                   overlap ORF ftt0523"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0523"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08539"
FT                   /inference="similar to sequence:UniProtKB:Q89Z57"
FT                   /protein_id="CAL08539.1"
FT                   /translation="MVELNNFLSKANIEWVKIQDKESYPILGVRGQGQGVYINRIANGK
FT                   ELTMKKYQKSEPYHLFFCKVRTVKGQWGVVYPEYANSYASSNMQYLKIDLDKILPEYLE
FT                   MLLKLKKITDIWDKNAIGADGRHFPLKILLTLQIPLPPIEIQKQIVQAYEDKINLANQL
FT                   EQRAEKLEAKIEKYLYAKLGIEQAQEQKQDKKGLLKFVRFEQLQRWDTDFFKQKEGYSS
FT                   KYETVSYEDLFVSLNNGIAARNYASDGIRYLKVSDIKDNYINNDKPFYVNKYKESDLIE
FT                   KGTLLITRKGTVGNSYYLDKDGSFVASSEIFIIKLNDKVNGNYLSEINLSSFVKKQYRE
FT                   KSTGTIMPSLSQPKLKSILIPLPPLKIQNHIAVRIQKLKDYIKALEQQAEQNRENALRN
FT                   FEVEIFSKE"
FT   CDS_pept        547003..547389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0524"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Q8KBB0 Hypothetical protein CT1879 from
FT                   Chlorobium tepidum (193 aa). FASTA: opt: 467 Z-score: 629.2
FT                   E(): 3.7e-27 Smith-Waterman score: 467; 60.656 identity in
FT                   122 aa overlap ORF ftt0524"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0524"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08540"
FT                   /inference="similar to sequence:UniProtKB:Q8KBB0"
FT                   /protein_id="CAL08540.1"
FT                   /translation="MKRILPYNPKLKDRAKELRKAGILSEILLWQELKSRKFLNLDFDR
FT                   QKVIGNYIVDFYCDDLRLVIEIDGSSHDDKQEYDSIRDLYLLGLDLKVLHIQDIDVKKN
FT                   LDGMIRYLVDYCEKLGANNTPPSA"
FT   CDS_pept        547436..548092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0525"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to RA50_THEVO DNA double-strand break repair
FT                   rad50 ATPase from Thermoplasma volcanicum (895 aa). FASTA:
FT                   opt: 188 Z-score: 215.6 E(): 0.0004 Smith-Waterman score:
FT                   188; 25.926 identity in 216 aa overlap. Similarity to N
FT                   terminal domain ORF ftt0525"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0525"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08541"
FT                   /inference="similar to sequence:UniProtKB:RA50_THEVO"
FT                   /protein_id="CAL08541.1"
FT                   /translation="MKITRLKIKGYKNLDIDIKHESDIMAFIGLNGSGKSNVLEALSFI
FT                   FREIYKNKQEDILKKVCKNIPFEFEIYFKTQNSEDSTYRFIGKKGNFTFSNSSFDDEPY
FT                   GIDERAFVDAVPKKVVTIYSGEEKRFWTKFYKPIFDDFIKHINSSKIIPRQDMVFISRK
FT                   HWGISLLSLLLSDLEDNQNFIKEVLKIEKINKIKIEFNKKDIKAGKLAKLKNLLN"
FT   CDS_pept        548098..548304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0526"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0526"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0526"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08542"
FT                   /protein_id="CAL08542.1"
FT                   /translation="MKEGYSLEELRRILEVYPSNEVFEYFYNALLSEMITDIQIFFNDD
FT                   NLTIGDLSEGEKSFYYLKQPLSL"
FT   CDS_pept        548325..549128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0527"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0527"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0527"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08543"
FT                   /protein_id="CAL08543.1"
FT                   /translation="MLDEPDSHIHLDNKKHIIDILEQYKDNRQFIVTTHSPTLTKCIKD
FT                   LDNDNENRVYVLDNGKNISTAKTKQIEHLVGDFWNSQEQTVFLSSHKNMVLLAEGKHDK
FT                   EHIINAWKHYKNDYPTLDFDVFSMDCAENISPLLTGLRTSEFQDRKKYVGIFDNDEAGI
FT                   NACNHTQVKYLKNKQSKKCKNKFFAITYSKPENYKEKHWTVENLLPLNKYESIYKKAIE
FT                   THSFEAKKIDDISHDIQKRVKGMLADESKNYSKQDLIEFKKYLIF"
FT   CDS_pept        549125..549502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0528"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0528"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0528"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08544"
FT                   /protein_id="CAL08544.1"
FT                   /translation="MNEMNNIGKQPQPQDISNKEDHIKQKVKEKNEAFRIGNLITEITD
FT                   AKTYEESFIPIYGSYKNKVIEAKYDLNSKKVVYNDLVGSPSAMANQAVWDMGAPKTSTR
FT                   NGLTFWKYEKGRDLKDLHEKI"
FT   CDS_pept        complement(join(549522..550190,550190..550570))
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinP"
FT                   /locus_tag="FTF0529c"
FT                   /product="DNA polymerase IV, devoid of proofreading,damage
FT                   inducible protein P, pseudogene"
FT                   /EC_number="2.7.7.7"
FT                   /note="Similar to Q87Y22 DNA polymerase IV from pseudomonas
FT                   syringae (353 aa). FASTA: opt: 1041 Z-score: 1243.0 E():
FT                   2.4e-61 Smith-Waterman score: 1041; 49.153 identity in 354
FT                   aa overlap. Contains a frameshift after aa 128"
FT                   /db_xref="PSEUDO:CAL08545.1"
FT                   /inference="similar to sequence:UniProtKB:Q87Y22"
FT   CDS_pept        complement(550577..551179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0530c"
FT                   /product="DJ-1/PfpI family protein"
FT                   /note="Similar to Q97FB4 Intracellular protease/amidase
FT                   related enzyme from Clostridium acetobutylicum (201 aa).
FT                   FASTA: opt: 703 Z-score: 884.5 E(): 2.2e-41 Smith-Waterman
FT                   score: 703; 51.531 identity in 196 aa overlap ORF ftt0530c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0530c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08546"
FT                   /inference="similar to sequence:UniProtKB:Q97FB4"
FT                   /protein_id="CAL08546.1"
FT                   /translation="MLEIVTILYDDFETLDVFGPIEVLGSFKDIFKINYYSINGGIVSS
FT                   SQAVEINTKDFSQVISKEYVLFVPGGIATRQLINDKNLITKLTKLAIDAKYIFTVCTGS
FT                   SLFSKTNLLNGKKATSNKKALNWTKSIAPDVIWVDKAKWVKDGNIYTSSGVSAGIDMSL
FT                   GFIADLLGYQVAKQKSIEIEYSWQEDPNIDEFADFYK"
FT   CDS_pept        join(551290..551484,551484..553184)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0531"
FT                   /product="ABC transporter, ATP-binding protein,pseudogene"
FT                   /note="Similar to Q8DCS3 ATPase component of ABC
FT                   transporter with duplicated ATPase domains from Vibrio
FT                   vulnificus (640 aa). FASTA: opt: 1907 Z-score: 1707.3 E():
FT                   3.3e-87 Smith-Waterman score: 1907; 46.468 identity in 637
FT                   aa overlap. Contains a frameshift after aa 65 ORF ftt0531"
FT                   /db_xref="PSEUDO:CAL08547.1"
FT                   /inference="similar to sequence:UniProtKB:Q8DCS3"
FT   CDS_pept        complement(553181..554413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grxC"
FT                   /locus_tag="FTF0532c"
FT                   /product="Biofunctional protein, glutaredoxin 3
FT                   protein/Ribonucleoside-diphosphate reductase, beta subunit"
FT                   /EC_number="1.20.4.1"
FT                   /EC_number="1.17.4.1"
FT                   /note="Similar to (glutaredoxin 3) Q8ZJM8 Glutaredoxin 3
FT                   from Yersinia pestis (82 aa). FASTA: opt: 181 Z-score:
FT                   263.7 E(): 8.5e-07 Smith-Waterman score: 181; 40.260
FT                   identity in 77 aa overlap,(ribonucleoside-diphosphate
FT                   reductase) Q8QYZ8 Ribonucleoside-diphosphate reductase,beta
FT                   subunit-like protein from Rana tigrina ranavirus (387 aa).
FT                   FASTA: opt: 1124 Z-score: 1382.6 E(): 4.1e-69
FT                   Smith-Waterman score: 1124; 51.703 identity in 323 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0532c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08548"
FT                   /inference="similar to sequence:UniProtKB:Q8ZJM8"
FT                   /protein_id="CAL08548.1"
FT                   /translation="MVEVRIYTKTNCPFCDLAKSWFGANDIPFTQISLDDDVKRAEFYA
FT                   EVNKNILLVEEHIRTVPQIFVGDVHIGGYDNLMARAGEVIARVKGSSLTTFSKTYKPFN
FT                   YPWAVDLTVKHEKAHWIEDEIDLSEDVTDWKNGKITKVEKEYITNILRLFTQSDVAVGQ
FT                   NYYDQFIPLFKNNEIRNMLGSFAAREGIHQRAYALLNDTLGLPDSEYHAFLEYKAMTDK
FT                   IDFMMDADPTTRRGLGLCLAKTVFNEGVALFASFAMLLNFQRFGKMKGMGKVVEWSIRD
FT                   ESMHVEGNAALFRIYCQENPYIVDNEFKKEIYLMASKAVELEDRFIELAYELGTIEGLK
FT                   ADEVKQYIRHITDRRLNQLGLKEIYNIEKNPLTWLEWILNGADHTNFFENRVTEYEVAG
FT                   LTGSWDEAYSA"
FT   CDS_pept        complement(554420..554680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grxA"
FT                   /locus_tag="FTF0533c"
FT                   /product="Glutaredoxin 1"
FT                   /note="Similar to GLR1_ECOLI (P00277) Glutaredoxin 1 from
FT                   Escherichia coli (85 aa). FASTA: opt: 191 Z-score: 274.9
FT                   E(): 2e-07 Smith-Waterman score: 191; 40.000identity in 80
FT                   aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0533c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08549"
FT                   /inference="similar to sequence:UniProtKB:GLR1_ECOLI"
FT                   /protein_id="CAL08549.1"
FT                   /translation="MKVKIYTRNGCPYCVWAKQWFEENNIAFDETIIDDYAQRSKFYDE
FT                   MNQSGKVIFPISTVPQIFIDDEHIGGFTELKANADKILNKK"
FT   CDS_pept        complement(554684..556456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdA"
FT                   /locus_tag="FTF0534c"
FT                   /product="Ribonucleoside-diphosphate reductase, alpha
FT                   subunit"
FT                   /EC_number="1.17.4.1"
FT                   /note="Similar to Q8QZ05 Ribonucleoside-diphosphate
FT                   reductase, alpha subunit-like protein from rana tigrina
FT                   ranavirus (565 aa). FASTA: opt: 2019 Z-score: 2446.6 E():
FT                   2.2e-128 Smith-Waterman score: 2026; 54.435 identity in 575
FT                   aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0534c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08550"
FT                   /inference="similar to sequence:UniProtKB:Q8QZ05"
FT                   /protein_id="CAL08550.1"
FT                   /translation="MSNQSYLGINIDLSRDRELSEQAQQLLTNYYCLQNEPSPQYAFAR
FT                   AAVAYSFGDMNLAHRIYDAAAKGWFMFASPVLSNAPLPGVKVKSLPISCFLSYVPDSLE
FT                   GLIEHSSELRWLSVKGGGVGGHWSSVRAVSDKAPGPIPFMHTVDADMVAYRQGKTRKGS
FT                   YAAYMDISHPDIIEFLGIRVPTGDVNRKCLNLHHAVNLTDDFMQAVANDQDWKLIDPDD
FT                   KTVRDVIKARKIWETILETRYRTGEPYLNFIDTANRALPKSQKDLGLTIKGSNLCNEIH
FT                   LVTDEKRTAVCCLSSVNLERYDEWKDTSLIKDLIRFLDNVLQFFIDHAGDEISKARYSA
FT                   SRERSLGLGAMGFHSYLQLHRVPFESQRAKEINEEIFKRIKEQALEETLILGAEKGEAP
FT                   DMAGTGRRNAHLLAIAPNANSSLILNTSPSIEPWKANAFTSRTRVGSHLNKNKYLEQEL
FT                   EKIGKNTEEVWSDIITNGGSVQQLDFLSKELKEVFKTAIEMDQDWLVYLGGERQKYLCQ
FT                   GQSLNVFFPAGASRGYLHKVHFNAWKYGCKGLYYLRTETSNRAENISKKVEKKRLVEFS
FT                   EIKQSENECIACEG"
FT   CDS_pept        complement(556660..557619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdh"
FT                   /locus_tag="FTF0535c"
FT                   /product="lactate dehydrogenase"
FT                   /EC_number="1.1.1.37"
FT                   /note="malate dehydrogenase. Identical to Q8G942 Malate
FT                   dehydrogenase from Francisella tularensis ssp. tularensis"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0535c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08551"
FT                   /db_xref="GOA:Q14IT0"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011275"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14IT0"
FT                   /protein_id="CAL08551.1"
FT                   /translation="MARKKITLVGAGNIGGTLAHLALIKQLGDVVLFDIAQGMPNGKAL
FT                   DLLQTCPIEGVDFKVRGTNDYKDLENSDVVIVTAGVPRKPGMSRDDLLGINIKVMQTVG
FT                   EGIKHNCPNAFVICITNPLDIMVNMLQKFSGVPDNKIVGMAGVLDSARFRTFLADELNV
FT                   SVQQVQAYVMGGHGDTMVPLTKMSNVAGVSLEQLVKEGKLKQERLDAIVSRTRSGGGEI
FT                   VALLKTGSAYYAPAAAGIQMAESFLKDKKMILPCAAKVKAGMYGLDEDLFVGVPTEISA
FT                   NGVRPIEVEISDKEREQLQVSINAIKDLNKAAAEILAK"
FT   CDS_pept        557767..558282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0536"
FT                   /product="hypothetical membrane protein"
FT                   /note="ORF ftt0536"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0536"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08552"
FT                   /protein_id="CAL08552.1"
FT                   /translation="MMLKKITNNFGLAIGIIGLIIFMFGLTETDTAQKNLIVLFATFFL
FT                   FLSAAIQKEPFFTGLQGIAFVSAIMVFYNLAAIYNLLVFIFLAFVFAIYYFSRHKLNIA
FT                   RICAFIGLVALCLGILLGRNEPMVVCGIVLAIYAVFSIQEGYTVGWIFLILNILFAVVA
FT                   ANALYSFY"
FT   CDS_pept        558298..558933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0537"
FT                   /product="ubiquinone biosynthesis protein"
FT                   /note="Similar to Q8PD67 Ubiquinone biosynthesis protein
FT                   from Xanthomonas campestris (217 aa). FASTA: opt: 710
FT                   Z-score: 878.4 E(): 4.9e-41 Smith-Waterman score: 710;
FT                   51.887 identity in 212 aa overlap (2-211:8-217) ORF
FT                   ftt0537"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0537"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08553"
FT                   /db_xref="GOA:Q14IS8"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011566"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14IS8"
FT                   /inference="similar to sequence:UniProtKB:Q8PD67"
FT                   /protein_id="CAL08553.1"
FT                   /translation="MRKLSFLDRVIEELDSYARFTKVPLNPSKKSPSSDTIDGKLSEIE
FT                   KKHSAGLMRVDYTGEICAQGLYRGQASVAKSPQTKEHLYHAAAEEYDHLAWCGERLQEL
FT                   GARPSLLNPFWYWTSFGIGAVAGSISDSLSYGFVVETEKQVMKHLDSHLKSLPVNDNRS
FT                   REILKQMYIDESEHAVEAEKAGGKKLPKTVKAIMKLQSKVMTTLAYRF"
FT   CDS_pept        complement(558942..559511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0538c"
FT                   /product="conserved hypothetical lipoprotein"
FT                   /note="Similar to Q87LS3 Hypothetical protein from Vibrio
FT                   parahaemolyticus (203 aa). FASTA: opt: 267 Z-score: 350.1
FT                   E(): 1.3e-11 Smith-Waterman score: 320; 31.795 identity in
FT                   195 aa overlap ORF ftt0538c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0538c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08554"
FT                   /inference="similar to sequence:UniProtKB:Q87LS3"
FT                   /protein_id="CAL08554.1"
FT                   /translation="MLKKFGFRYFVVSLFCLLLLSCSETTKIDTNAGVCEILKQHPNCK
FT                   KSLKQSQAKYNLEPAFIMALIYQESRFYANAKNKYSSAYGYAQVIDSTWKHFQQQVKAN
FT                   AKRNNFDDSIEFIGWHMTQLSKSLNIKMTDYPNLYMAYMLGATGFKRYRAGTLKNHAKI
FT                   AQDKKIALKVKDYTNLYKSQLRKCPL"
FT   CDS_pept        complement(559589..560332)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0539c"
FT                   /product="ThiF family protein, pseudogene"
FT                   /note="Similar to Q8XPA8 Hypothetical protein CPE0057 from
FT                   Clostridium perfringens (253 aa). FASTA: opt: 568 Z-score:
FT                   689.2 E(): 1.7e-30 Smith-Waterman score: 568; 46.961
FT                   identity in 181 aa overlap. Contains an in-frame stop codon
FT                   after aa 181 ORF ftt0539c"
FT                   /inference="similar to sequence:UniProtKB:Q8XPA8"
FT   CDS_pept        complement(560336..561826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0540c"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0540c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0540c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08556"
FT                   /protein_id="CAL08556.1"
FT                   /translation="MKKTILLSLTLFSCLGYSNVVDTTTWKTADVVKDFKSKYFCNKNL
FT                   SQQDCDKNINNVEQYGIDIDSLVNTDIKSIKLDKITYQTTNTFAAIGKITSNVSGLLMM
FT                   PDTDSPKGVILYYHPTVFDNAAVPSNFSNDKSLIFDVTYAAIYAANGYIVVAPDYIGQG
FT                   DDYKNYHPYVLYPKQTVNTAVDLLNDVSNEIRKKYNLETSATLNLFSVGYSEGGGYSIW
FT                   SAKCLGWRGNCKGVNKLDKLYRYRAAAGLSGAYDISDTTLNFMTDDNDSQKYALHSKLA
FT                   TSMLKPGLMANTLMSYLHYSNVSKSISIKDFDNGFFEMQCSTFPQEKCNIAGKHYTFES
FT                   LFLQKHIPNMEFAEAIFNSALYKKYPHQQSASHYAIPTGNNSMYDLFNEKIFSNPELIK
FT                   TMKAADIVDFGERTRTPLYLFALKEDSVVTRLNYDKFMKNANAIVDGFVLDNNKILTNT
FT                   TDWLPVQLDINEVDHVTGETYANLFAYNYINDMNKVYS"
FT   CDS_pept        complement(561881..562480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqaB"
FT                   /locus_tag="FTF0541c"
FT                   /product="haloacid dehalogenase"
FT                   /note="Similar to YQAB_ECOLI (P77475) Hypothetical protein
FT                   yqaB from Escherichia coli (188 aa). FASTA: opt: 336
FT                   Z-score: 422.2 E(): 1.3e-15 Smith-Waterman score: 336;
FT                   33.889 identity in 180 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0541c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08557"
FT                   /inference="similar to sequence:UniProtKB:YQAB_ECOLI"
FT                   /protein_id="CAL08557.1"
FT                   /translation="MISENNMLLPVHKNTKLLIFDCDGTIANNMDIHINAWLNVLKNTK
FT                   VQIESVDFDKYNGLPSEYILKEVFNFDDIQTPKIAAEIKKTSYQLLSQTKPIEPIVDLI
FT                   KYYHNRIPMLVISGGKKLNVYKSLDVLGLKDFFDEIITADDNHPSKNTPKAFTLIADKY
FT                   NLKPRECHVFEDGVPGLISALQAGMTVTDVRNIELD"
FT   CDS_pept        join(562558..562881,562881..563156)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0542"
FT                   /product="AhpC/Tsa family protein, pseudogene"
FT                   /note="Similar to Q88NW9 Antioxidant,AhpC/Tsa family from
FT                   Pseudomonas putida (200 aa). FASTA: opt: 979 Z-score:
FT                   1280.5 E(): 2e-63 Smith-Waterman score: 979; 72.680
FT                   identity in 194 aa overlap. Contains a frameshift after aa
FT                   108 unknown EC_number 1.6.4.- ORF ftt0542"
FT                   /db_xref="PSEUDO:CAL08558.1"
FT                   /inference="similar to sequence:UniProtKB:Q88NW9"
FT   CDS_pept        563221..564597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0543"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0543"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0543"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08559"
FT                   /protein_id="CAL08559.1"
FT                   /translation="MRNAFIILLSLLLLTYNSYAANQVYDIDTQKQLIQTDKTKKSIKA
FT                   DNSAVDVVEQYEGESIVAGNTFDVGKTLLKITHADKVKPPFFDGIDNNVIFSQAMLNTQ
FT                   QQTGDPEFILLSRQNGLLKDNYLYLGGMASFNPTWGKYTRNNIPSNSINNYSLEYYMLS
FT                   TLGEWTSIFASLNTYAIDGQWSATPGGVYFILGNLNKLPVYTYAALSTVNFGNFDETTN
FT                   FIPTLTRTYFMQSGSNVNLSYNKDGLQANFVFLASPKSSLLQVANAYNGNAKLGFSVNM
FT                   KYTKDLQNVGDYWYLGAAYSNVSGFTNEHNDNIGVADFNFGMNINKFEFINEFVFTDKG
FT                   VTKTTNLSGGFNLREAFATAIFPDLNTNQFLTSGGNVLGWSSQLDYTANLYNKDFVPFV
FT                   SYSQIQQASDNYSAAITSGFRYNIFADGWLGFSYTYIKGQAKSFAQQDNIMAMYLRIFI
FT                   "
FT   CDS_pept        564703..565035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnA"
FT                   /locus_tag="FTF0544"
FT                   /product="phosphonoacetate hydrolase"
FT                   /EC_number="3.11.1.2"
FT                   /note="Similar to PHNA_ECOLI PhnA protein from Escherichia
FT                   coli (111 aa). FASTA: opt: 521 Z-score: 674.6 E(): 1.1e-29
FT                   Smith-Waterman score: 521; 66.972identity in 109 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0544"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08560"
FT                   /inference="similar to sequence:UniProtKB:PHNA_ECOLI"
FT                   /protein_id="CAL08560.1"
FT                   /translation="MTTLPRCLKCQSEYVYQDDQLLICPECGYEWQADEISSNELVIRD
FT                   SNGNSLADGDSVAIIKDLKLKGSSQVIKVGTKVKNIRLVTGDHDIDCKIDGFGAIQLKS
FT                   QFVKKV"
FT   CDS_pept        565041..565256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0545"
FT                   /product="hypothetical membrane protein"
FT                   /note="ORF ftt0545"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0545"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08561"
FT                   /protein_id="CAL08561.1"
FT                   /translation="MKFERLLFLIIFISICSFCYAYYVKDNGKKIIVSKKVANTIDDIE
FT                   IQEGESLTQQQIIDIIENSSGSTEEL"
FT   CDS_pept        565260..565871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0546"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0546"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0546"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08562"
FT                   /protein_id="CAL08562.1"
FT                   /translation="MFRKLVALASIFTISTFCLASADQTTEQSESSSSLNNNYSPESIR
FT                   KLESNAFRRVFPNEAYIKDNVPLSSEQLEKAAIQAIQDLSVKEGEALTDSEKRALAKRT
FT                   FDNKINNALNINAIKTSFFNGFRVSETFTHAMLNTQQNTGDPLFMLQARQQGILADDYI
FT                   YMGAKLAVINWQRLNKAPLGGETKLFTYSIEAYAASTISK"
FT   CDS_pept        566226..566759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0547"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0547"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0547"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08563"
FT                   /protein_id="CAL08563.1"
FT                   /translation="METAGDYQFLGLAYSNVSGFQTKNGGNVGTFDVNYGLAISDINFE
FT                   AEALITDKGVGEINNSSSVSPNNIAGVPFFGSVGPSAKLIYDGFLGSGANVASWSTQTS
FT                   YTATVFNRRVIPYVDYSQILQNTKNYSYQYGAGFRVNVFYGSWLGLDYTNINSRSSNFK
FT                   ETQNYLSINYTLYL"
FT   CDS_pept        566811..567503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="FTF0548"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="Similar to Q83EK2 DNA polymerase III, epsilon
FT                   subunit from Coxiella burnetii (232 aa). FASTA: opt: 699
FT                   Z-score: 870.8 E(): 1.3e-40 Smith-Waterman score: 699;
FT                   49.550 identity in 222 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0548"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08564"
FT                   /inference="similar to sequence:UniProtKB:Q83EK2"
FT                   /protein_id="CAL08564.1"
FT                   /translation="MSRQVFIDTETTGFDYKIGNRIIEFGAVEVIDRRITGNNLHFYCN
FT                   PNYEVEAGALAIHGLTNEFLADKPLFEDKVDEMIEFLRGAEVIIHNAAFDVPFINWELS
FT                   LLKNNKYGTLEQNVAKIVDSLDLARKKHPLQKNNLDALCKRYQIRNDHRTFHGALLDSE
FT                   LLADVYLAMTGGQTNLSLQTAKTVSKNSIDIDVNKLNLRNAEDSISDISAHHSYLSNLL
FT                   KLEEDAKW"
FT   CDS_pept        567497..567970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vanY"
FT                   /locus_tag="FTF0549"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /EC_number="3.4.-.-"
FT                   /note="Similar to Q87AM4 Peptidase (202 aa). FASTA: opt:
FT                   481 Z-score: 603.7 E(): 9.8e-26 Smith-Waterman score: 481;
FT                   50.000 identity in 142 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0549"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08565"
FT                   /inference="similar to sequence:UniProtKB:Q87AM4"
FT                   /protein_id="CAL08565.1"
FT                   /translation="MVRKIIFPEAKEHELISAGKDFFARDLLLEKNTYKAWLELKQAAT
FT                   DDGISLFIVSGFRSYEYQQKIIDRKLANGQTLEEIIRVNALPGESEHHTGRAIDLTTGD
FT                   EKEVLTEDFEKTYAFEWLVKNAHKYGFKLSFPCNNDYGFIYEPWHWCYHNEKC"
FT   CDS_pept        567930..569366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0550"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Q8EHZ3 TPR domain protein from Shewanella
FT                   oneidensis (466 aa). FASTA: opt: 304 Z-score: 346.2 E():
FT                   2.2e-11 Smith-Waterman score: 331; 23.333 identity) in 480
FT                   aa overlap ORF ftt0550"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0550"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08566"
FT                   /inference="similar to sequence:UniProtKB:Q8EHZ3"
FT                   /protein_id="CAL08566.1"
FT                   /translation="MSHGTGVITMKNVSRFLFVSIFAILLNSCSTAKKDVTKLEFVSSS
FT                   YPWIFSPVRKELAQGDVSETIKKNNSIGNVRQLKSLNQLESGRLSQLNSDSKASIEIYS
FT                   KAIESLPKNQQQSLDQAKKILLNRNTYNYYDIKSAYDIPDYAITFLYTYQALNYLETNN
FT                   IKEAIQSLNNLDNAKIWRDEQEILAEGMKQLGQKDLDRNEITSDNLGLENFKALTQMLE
FT                   FSKRIPNAYGNPISYYLKALLDSAVSKDYQKSLTDIESAQQYTVGNKYLDQTANEFKSA
FT                   IISQTSPFAMGMGRVVVLYEQGLVYTRSSAQASLDLGNIGVRKIDLPVYNTDYNLFEPK
FT                   RVIISADDTNLIDTYTETLLDTTLFATKSLIESYSKVITQNVVIEAFKYDYENNFALGG
FT                   LLGSTLKFDLSKTDPKRADLRSWLLLPNSVDLFEQQLDSSNYMIKVNNIRQKITIQQGK
FT                   TTLLWIVDIGKFKKVYYFIF"
FT   CDS_pept        join(569727..570032,570034..570786)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0551"
FT                   /product="conserved hypothetical protein, pseudogene"
FT                   /note="Similar to Q92LL0 Hypothetical protein R03032 from
FT                   Rhizobium meliloti (367 aa). FASTA: opt: 921 Z-score:
FT                   1129.8 E(): 4.9e-55 Smith-Waterman score: 921; 44.186
FT                   identity in 344 aa overlap. Contains a frameshift after aa
FT                   102. Frameshift occurs at a heptanucleotide sequence and so
FT                   could be part of a programmed translational frameshift. ORF
FT                   ftt0551"
FT                   /inference="similar to sequence:UniProtKB:Q92LL0"
FT   CDS_pept        570799..572295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0552"
FT                   /product="aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.-"
FT                   /note="Similar to Q8P9Q7 Aldehyde dehydrogenase from
FT                   Xanthomonas campestris (510 aa). FASTA: opt: 1972 Z-score:
FT                   2329.9 E(): 6.9e-122 Smith-Waterman score: 1972; 60.285
FT                   identity in 491 aa overlap ORF ftt0552"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0552"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08568"
FT                   /inference="similar to sequence:UniProtKB:Q8P9Q7"
FT                   /protein_id="CAL08568.1"
FT                   /translation="MSILKELDLGLQAYITNDTNNVIETLNPATGELLAKVRNQSVTTM
FT                   QEAIAKATEVAKQWRQVPAPKRGELVRLIDEELRRNKDHLGSLVSLEMGKSKQEGDGEV
FT                   QEMIDMADFAVGQSRMLYGMMMNSERHNHRMYEQWHPLGVVGVISAFNFPVAVWSWNAF
FT                   IAVICGNTVVWKPSEKIPLCSIAVHNICQKVIKEHNYPEIFYTVISKDVEVSKTLVNDE
FT                   RVNLVSFTGSTKVGQDVGQQVAKRFGKSILELGGNNATIIDESANLKLAIPAAVFGAVG
FT                   TAGQRCTSLRRLFIHESIYDLVKEKMVNAYKQVKVGDPLDQANLMGPLIDQAAVDNFTR
FT                   TVEQAINQGGKVLTGGKSIAKPGFFVEPTIIEANHNMPIVAEENFCPILYIMPFKDIDE
FT                   AIALNNSVIYGLSSSIFTDNLQNAEKFLSSLGSDCGIANVNIGTSGAEIGGAFGGEKHT
FT                   GGGREAGSDAWKAYMRRQTSTINYGKDLPLAQGIKFNLGE"
FT   CDS_pept        572300..573079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0553"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Q8EJ53 Conserved hypothetical protein
FT                   from Shewanella oneidensis (267 aa). FASTA: opt: 859
FT                   Z-score: 1057.9 E(): 4.9e-51 Smith-Waterman score: 859;
FT                   52.809 identity in 267 aa overlap ORF ftt0553"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0553"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08569"
FT                   /inference="similar to sequence:UniProtKB:Q8EJ53"
FT                   /protein_id="CAL08569.1"
FT                   /translation="MSVDILDKLWDQYIRDNPHAKEIYDLFVNNGENPINDHIALRTLD
FT                   DDRINIYKLAEVFIDKGYSICDDYDFAVKHLEHSDKTQPKVFISQLLTNEFSEELQQTL
FT                   KRCVDLIPQQLLNNPENLLLSGVSWQIDYATYQKLLEESEYAAWFYAFGFRANHFTVFI
FT                   NNLKKFSEVSQVNTFLKENGFRLNSSGGEIKGSKDELLEQSSTMSGLAEVNFKDGKREI
FT                   PSCYYEFAKRYPDNSGKLYQGFVAKSADKIFESTNTK"
FT   CDS_pept        573163..573435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0554"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Q99SH0 Hypothetical protein SAV2087 from
FT                   Stafylococcus aureus (97 aa). FASTA: opt: 243 Z-score:
FT                   331.6 E(): 1.4e-10 Smith-Waterman score: 243; 45.455
FT                   identity in 77 aa overlap ORF ftt0554"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0554"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08570"
FT                   /inference="similar to sequence:UniProtKB:Q99SH0"
FT                   /protein_id="CAL08570.1"
FT                   /translation="MSNPCHKKHLVKLNRVTGQVEAIKRMIDDQRYCVDIITQIKAARS
FT                   ALKSIELSILETHMQSCLEKSCQANSKEVLEQRIAEIMKLLRKYQ"
FT   CDS_pept        573449..574180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0555"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="Similar to Q930P5 Hypothetical protein RA0150 from
FT                   Rhizobium meliloti (262 aa). FASTA: opt: 924 Z-score:
FT                   1048.2 E(): 1.7e-50 Smith-Waterman score: 924; 54.202
FT                   identity in 238 aa overlap. Some similarity to glutaredoxin
FT                   ORF ftt0555"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0555"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08571"
FT                   /inference="similar to sequence:UniProtKB:Q930P5"
FT                   /protein_id="CAL08571.1"
FT                   /translation="MNKQQAIIYRMVTDKHICPFGIKAKDLLKRKGYFVEDIHLKDRQQ
FT                   VDEFKNKYDVKTTPQIFIDGNRIGGYDDLVKFFGLVKDKQAKSYKPVIAVFAMTFLLAL
FT                   AFGYFIAGNIFALLTIKVFMGLSIAFLAMLKLQNLDSFINQFITYDLLAMRYLRYAYIY
FT                   PFAEAFVGISIIAAIFSYLAALIAIIIGLIGAISVFYAVYIQKRELKCACVGGNSNVPL
FT                   GFLSLTENIMMIAMGIWMIFM"
FT   CDS_pept        complement(574183..575052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oxyR"
FT                   /locus_tag="FTF0556c"
FT                   /product="oxidative stress transcriptional regulator"
FT                   /note="Similar to O06466 Oxidative stress transcriptional
FT                   regulator from Xanthomonas campestris (313 aa). FASTA: opt:
FT                   707 Z-score: 842.2 E(): 5.1e-39 Smith-Waterman score: 707;
FT                   36.207 identity in 290 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0556c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08572"
FT                   /inference="similar to sequence:UniProtKB:O06466"
FT                   /protein_id="CAL08572.1"
FT                   /translation="MNTRTLEYIISVYETKSFITASEKCFVSQPALSMQIKKFEEYIGI
FT                   QIFERGTKQVLITKSGMKIVNQAYKILDEVNNLKKIAELLLENGKISITIGAFPTLCPY
FT                   LMPKILPAIKQELPNLSIAVIEEKTDILVKMLDQGKIDFALLATPTENYQFHRKKVFDD
FT                   KFYVAVAKTNPLAKNKQICIREIVKQNLMLLDEGHCLRDQTLKLCALKEFNNNDFKGSS
FT                   LETLRQMVSIDEGITLVPKIACTKADNVKYIDIDNRDFYREIDLVMRKSSIYEDLFAKI
FT                   AKIISNNH"
FT   CDS_pept        575150..575674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0557"
FT                   /product="AhpC/TSA family protein"
FT                   /EC_number="1.11.1.-"
FT                   /note="Similar to Q92MY1 Hypothetical protein R02467 from
FT                   Rhizobium meliloti (180 aa). FASTA: opt: 821 Z-score:
FT                   1055.0 E(): 7.2e-51 Smith-Waterman score: 821; 66.092
FT                   identity in 174 aa overlap ORF ftt0557"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0557"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08573"
FT                   /inference="similar to sequence:UniProtKB:Q92MY1"
FT                   /protein_id="CAL08573.1"
FT                   /translation="MTKKVPNVTFKTRVRDESIGGSNPFRWQDVTSADIFDNKRVIVFS
FT                   LPGAFTPTCSTYQLPGFENNAARFKELGIDEIYVLSVNDSFVMNKWIQVQGIQNIKPIP
FT                   DGNGEFTEALDMLVDKSNIGFGKRSWRYAMIVNNGEIEKMFVEPGKRDNADNDPYGESS
FT                   PENLLKYLESK"
FT   CDS_pept        575677..576288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0558"
FT                   /product="conserved hypothetical protein"
FT                   /EC_number="1.-.-.-"
FT                   /note="Similar to Q8XU62 Hypothetical protein RSc3331 from
FT                   Ralstonia solanacearum (201 aa). FASTA: opt: 602 Z-score:
FT                   724.0 E(): 2e-32 Smith-Waterman score: 602; 48.020 identity
FT                   in 202 aa overlap ORF ftt0558"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0558"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08574"
FT                   /inference="similar to sequence:UniProtKB:Q8XU62"
FT                   /protein_id="CAL08574.1"
FT                   /translation="MKRIIVFGATGTIGRATTQSLKNAGYEIVTVSFSGDKTDFAVDIQ
FT                   DSQSIKSLFDKIGNFDALISTTGKVAFKNITAIEQQDWNLSLNNKLLGQINLVQIGSKY
FT                   INDGGSFTLTSGILNFEPIAMGSIAATVNAGLEGFVKAASLEYNKFRINVVSPTVVEEA
FT                   LDKYAPFFIGFKAVKAEEVANAYLKSVAGIANGEVIKVGF"
FT   CDS_pept        complement(576305..576970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmk"
FT                   /locus_tag="FTF0559c"
FT                   /product="cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /note="Similar to KCY_PASMU (P57875) Cytidylate kinase from
FT                   Pasteurella multocida (227 aa). FASTA: opt: 748 Z-score:
FT                   879.9 E(): 4.1e-41 Smith-Waterman score: 748; 53.425
FT                   identity in 219 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0559c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08575"
FT                   /inference="similar to sequence:UniProtKB:KCY_PASMU"
FT                   /protein_id="CAL08575.1"
FT                   /translation="MNNSKIITIDGPSGVGKGTLAKALAKYYDFKLLDSGAIYRLAALH
FT                   CFKNNASLENEDDVCKTLRNLDISFKIEDDLVKAFLSNQDVTKDIRTEQIGMLASKVAA
FT                   YPTVRAILLNKQREFATEQGLVADGRDMGTVVFPQAQYKFFLDASTEITAKRRYDELKT
FT                   KGQKPNFEKILADIKQRDFQDRNRKVAPLRPANDAIIVDTSQLFIKEVFDSVIKKITI"
FT   CDS_pept        complement(576957..578009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serC"
FT                   /locus_tag="FTF0560c"
FT                   /product="phosphoserine aminotransferase"
FT                   /EC_number="2.6.1.52"
FT                   /note="Similar to SERC_PASMU (P57881) Phosphoserine
FT                   aminotransferase from Pasteurella multocida (360 aa).
FT                   FASTA: opt: 936 Z-score: 1129.1 E(): 5.3e-55 Smith-Waterman
FT                   score: 936; 41.525 identity in 354 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0560c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08576"
FT                   /inference="similar to sequence:UniProtKB:SERC_PASMU"
FT                   /protein_id="CAL08576.1"
FT                   /translation="MKINFCAGPAVVPTSIIQQLQQMMTNYKDTGVSLLSISHRDKVFD
FT                   EVHASIQKNLRSLLSIPDNYAVLLMQAGATAQFAAIPLNLADKHNKALYVCSGQWSEKA
FT                   AQEAAKFIDVDAVKYDDNIAQKFQANKYDYIYYTDNETVDGFQINKLAKSCNTELVCDV
FT                   SSSFLSKPINISDYGLIYAGAQKNAGIPGLTIVIIKDSLIKEKQNIPVVFDYLAIKKSN
FT                   SVYNTPSVISWVTFELTLEYLIEKFANLDNVEEFSNQKANLLYSAIDNSKIYKNDIKPE
FT                   YRSNMNIIFHLPTQELTDKFLSNASKAGFYGLKGHRSVGGCRASLYNAVSLEDVKKLVQ
FT                   FMQEFENEQF"
FT   repeat_region   578265..578276
FT                   /note="ISFtu1 12bp terminal inverted repeat"
FT   repeat_region   578277..578292
FT                   /rpt_type=TANDEM
FT                   /note="16bp Short Sequence Tandem Repeat (SSTR)"
FT   repeat_region   578293..578308
FT                   /rpt_type=TANDEM
FT                   /note="16bp Short Sequence Tandem Repeat (SSTR)"
FT   CDS_pept        join(578329..578655,578655..579113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="isftu1"
FT                   /locus_tag="FTF0561"
FT                   /product="Transposase"
FT                   /note="ISFtu1. Transposase, member of the IS630 Tc-1
FT                   mariner family. Identical to Q93EJ6 Putative transposase
FT                   from Francisella tularensis (118 aa) from aa 144-261.
FT                   Identical to Q93EJ7 putative transposase from Francisella
FT                   tularensis (126 aa) from aa 1-109. Q93EJ6 and Q93EJ7
FT                   previously characterised as two separate ORF's. ORF1
FT                   (identical to Q93EJ7) contains a programmed ribosomal
FT                   frameshifting motif, 5'-AAAAAAAG-3' at aa position 109
FT                   which permits frameshifting to ORF2 (identical to Q93EJ6)
FT                   to produce a single ORF. Alignment of this single ORF with
FT                   additional members of the IS630 family, and also mariner
FT                   elements, show that this transposase shares strongly
FT                   conserved residues, including a fully conserved
FT                   dipeptide,Asp-Glu (DE), and a block consisting of a fully
FT                   conserved Asp and highly conserved Glu, separated by 34 or
FT                   35 residues (D35E). The conserved dipeptide is only present
FT                   if ribosomal frameshifting occurs."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0561"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08577"
FT                   /protein_id="CAL08577.1"
FT                   /translation="MPSYSQDFRDIVINKHEEGMTEFELSKFFNIDKRTVVSWIEFYKR
FT                   TGDYSSKQGVGCGRVASFTDKTLIEQYLIDHPDASALDIKEALAPDIPRSTFYDCLNRL
FT                   GFSFKKKTPKYKQRKEHERLEYIEKLKEIAQNLLFYIDEMGCDNKLSILRGWSLIGEPS
FT                   YGEVLAYQTQRRSIVAGYNYADKKIIALLEYSGYTNTEIFNQWFEEHLCPSLKPKTTIV
FT                   MDNASFHKSSKLIEIANKFDVQILYLPPYSPDLNPIEKV"
FT   repeat_region   579201..579212
FT                   /note="ISFtu1 12bp terminal inverted repeat"
FT   CDS_pept        579495..580616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potG"
FT                   /locus_tag="FTF0562"
FT                   /product="polyamine transporter, ABC
FT                   transporter,ATP-binding protein"
FT                   /note="Similar to Q8EHF2 Polyamine ABC
FT                   transporter,ATP-binding protein from Shewanella oneidensis
FT                   (378 aa). FASTA: opt: 1366 Z-score: 1557.5 E(): 7.3e-79
FT                   Smith-Waterman score: 1366; 55.496 identity in 373 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0562"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08578"
FT                   /inference="similar to sequence:UniProtKB:Q8EHF2"
FT                   /protein_id="CAL08578.1"
FT                   /translation="MQKSSKKPLVSIKNLSKQFDDGHLAVDSVNLDVYPKEFFSLLGGS
FT                   GSGKSTLLRMLAGFERPTDGKIIIDGVDMSNTPSYKRPVNMMFQSYALFPHMNVKQNIM
FT                   FGLKQEKSLKKEEIEKATDAALKIIKMDHLAKRKPHQLSGGQRQRVALARCLAKRPKLI
FT                   LLDEPLSALDKNLRDQMQFELVDIQEQTGSTFIMVTHDQEEAMTMSTRIGIMTDGWLEQ
FT                   VSTPSEIYEFPKSRFVANFIGKSTIFEGRVEAVSRTRSIITSEQAGTNFVLRRNIEAIE
FT                   DQEIWVGLRPEKIVISKDKPEDYNPNKPVNCIKGIVEDIAYMGGLSTYHVRTANGNIIK
FT                   STDFNIERNADHPSWDDEVYLTWESENIMVLYS"
FT   CDS_pept        580580..581497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potH"
FT                   /locus_tag="FTF0563"
FT                   /product="polyamine transporter, subunit H, ABC
FT                   transporter, membrane protein"
FT                   /note="Similar to Q8FJE8 Putrescine transport system
FT                   permease protein from Escherichia coli (314 aa). FASTA:
FT                   opt: 949 Z-score: 1040.4 E(): 4.7e-50 Smith-Waterman score:
FT                   949; 43.878 identity in 294 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0563"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08579"
FT                   /inference="similar to sequence:UniProtKB:Q8FJE8"
FT                   /protein_id="CAL08579.1"
FT                   /translation="MGIRKYHGAILIMQNLEKSFRHTLVYLIPFIWFVVFLLIPFLFVV
FT                   GISFTLPADGTPPVTSLMTYKQSALHFTLYLSNYIELIHYNLIFISLLKSFKVAFITTV
FT                   LCILIGYPMALALSKAKKNTQIFFLVLIIIPYWTSFLLRTYAWVTLLGNHTLNQFLMDL
FT                   GLPSMALLYNDFSMYLGMVYCYLPFLVLPLYSTLIKIDPSIYDAAEDLGSRPINSFFKI
FT                   TLPLSMPGLIAGSLLIFIPAIGEVVVPQIMGGMDSLMIGNVIWEEFFTSNNWGMAAAIS
FT                   VVLIVILVLPILWMQRIQAKRTFV"
FT   CDS_pept        581511..582317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potI"
FT                   /locus_tag="FTF0564"
FT                   /product="polyamine transporter, subunit I, ABC
FT                   transporter, membrane protein"
FT                   /note="Similar to Q8EHF0 Polyamine ABC transporter,permease
FT                   protein from Shewanella oneidensis (271 aa). FASTA: opt:
FT                   873 Z-score: 1010.7 E(): 2.1e-48 Smith-Waterman score: 873;
FT                   46.241 identity in 266 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0564"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08580"
FT                   /inference="similar to sequence:UniProtKB:Q8EHF0"
FT                   /protein_id="CAL08580.1"
FT                   /translation="MKRFSFSKIMLILDLIFLYIPLIILVVFSFSNSEIINLWGGFTFD
FT                   WYHEVIHDEDIINATFTSLKIATITSAIATILGTIIAYAMTRFKFFRSRSFLYGLVATP
FT                   LVLPDIILGVALLLMFSTLQHLIGWSHERGTTTVVIAHVTMCTAYVTIVMQSRIASVDI
FT                   SLEEAALDLGAGPIETFFKITLPQLIPALITSALLTFTLSIDDLVVTEFVAGSDNPTLP
FT                   MYIYSTVKNGPTPEINALATIMIGIIVVGVLLGMFISAKFQKRQNG"
FT   repeat_region   complement(582435..582453)
FT                   /note="ISFtu2 19bp terminal inverted repeat"
FT   CDS_pept        complement(582461..583204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="isftu2"
FT                   /locus_tag="FTF0565c"
FT                   /product="Transposase"
FT                   /note="ISFtu2. Transposase, member of the IS5 family.
FT                   Identical to Q8GM03 putative transposase from Francisella
FT                   tularensis (247 aa)."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0565c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08581"
FT                   /protein_id="CAL08581.1"
FT                   /translation="MNYHIKEVFWSIILSFLKSQKGIHTNDEAKLRLFIEAVFYVLRTG
FT                   CQWRMLPFYYGKYRSIHKRFKDWCDKDIFSRLFKSVQNPDLQEVMLDSTIARAHACATG
FT                   YDKDDNQAIGRSVGRITTKIHAMTDALGNPIEILLSEDKTHDSKVAIDLLKNVYNTKVI
FT                   ADRAYHSNEIRQHIQGISSEAVIPCKSNTLNHIPFDSHVYKERHLIENFFSKIKHFRRV
FT                   FSRFDKTILAYIGMIKLACTFIWLR"
FT   repeat_region   complement(583281..583299)
FT                   /note="ISFtu2 19bp terminal inverted repeat"
FT   CDS_pept        583350..583616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0566"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0566"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0566"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08582"
FT                   /protein_id="CAL08582.1"
FT                   /translation="MKESNYVTPEKMLKDGVDGDIFNGVFIRKGTIAAAIKNAQILDDP
FT                   QSNKIDKEKALEYLKDAIPTRLNKAFFGMDKVLSWKNERLNKL"
FT   CDS_pept        complement(join(583745..584176,584175..584900,
FT                   584899..585204))
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0567c"
FT                   /product="conserved hypothetical membrane
FT                   protein,pseudogene"
FT                   /note="Similar to Q83DZ8 Proton/peptide symporter family
FT                   protein from Coxiella burnetii (504 aa). FASTA: opt: 434
FT                   Z-score: 486.3 E(): 3.4e-19 Smith-Waterman score: 434;
FT                   22.400identity in 500 aa overlap. Contains 2 frameshifts
FT                   after aa 102 and 334 ORF ftt0567c"
FT                   /db_xref="PSEUDO:CAL08583.1"
FT                   /inference="similar to sequence:UniProtKB:Q83DZ8"
FT   CDS_pept        585822..586472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0568"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Q26545 Phosphoserine
FT                   phosphohydrolase-like protein trans-spliced from
FT                   Schistosoma mansoni (223 aa). FASTA: opt: 319 Z-score:
FT                   380.8 E(): 2.5e-13 Smith-Waterman score: 319; 29.493
FT                   identity in 217 aa overlap. Similar to eukaryotic proteins.
FT                   Historical HGT-event? ORF ftt0568"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0568"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08584"
FT                   /inference="similar to sequence:UniProtKB:Q26545"
FT                   /protein_id="CAL08584.1"
FT                   /translation="MKNIIFDFDSTLIKKESLELILEPILQKSPAKLKEIEYITNLGMQ
FT                   GDISFRDSLQKRLAIASPTKQSIKEFSNKYCPNLLTDGIKELVQDLKNKGFEIWIFSGG
FT                   LSESIQPFADYLNIPRENIFAVETIWNSDGSFKELDNSNGACDSKLSAFDKAKGLIDGE
FT                   VIAIGDGYTDYQLYEKGYATKFIAYMEHIEREKVINLSKYVARNVAELASLIM"
FT   CDS_pept        complement(586461..587483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0569c"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="Similar to Q8P3T2 Integral membrane protein from
FT                   Xanthomonas campestris (347 aa). FASTA: opt: 906 Z-score:
FT                   1071.1 E(): 9e-52 Smith-Waterman score: 906; 41.739
FT                   identity in 345 aa overlap ORF ftt0569c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0569c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08585"
FT                   /inference="similar to sequence:UniProtKB:Q8P3T2"
FT                   /protein_id="CAL08585.1"
FT                   /translation="MKILKYFYGSFFVTLIGIVIAVFIYPNAPLETIYSVLILAILEIS
FT                   LSFDNAVINAKILGQMSPRWQKIFIYIGLPIAVFGMRLLFPILLVSVTSGINFMNVVTL
FT                   ALDNPQQYQAILEHSMPYICSFGGSFLLMVFLNFFLSENKGHHWIPLIENNIITKKIRN
FT                   YDGGYILLAVIIGVITIYYSDPNYQGSLAIAFLLGIVVHESIGLLNSLFDTAKVSTTDV
FT                   ARNGLIGFIYLEIIDASFSFDGVIGAFAITANIIIIMIGLGIGAMFVRSLTILFVEKKT
FT                   LAKYIYLEHGAHYAIGFLAAVLLLKIFMHIPEWFSGSIGILVLTLAFIHSVISHKKLHN
FT                   "
FT   CDS_pept        587563..587961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0570"
FT                   /product="hypothetical lipoprotein"
FT                   /note="ORF ftt0570"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0570"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08586"
FT                   /protein_id="CAL08586.1"
FT                   /translation="MSIALYTLISLAGCFFAWRNFMKNKEYAISIAERAAVKYNLDLLD
FT                   DTVCLRKLNLWFENKRLVFYRVYSFDYNTQSSDDRYRGYIVIRNGKLNDVVVSEFEKAD
FT                   IINESIISEQATNTSSCKSAHNIINFDE"
FT   CDS_pept        587973..588680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0571"
FT                   /product="conserved hypothetical protein"
FT                   /note="Partially similar to Q96F61 Hypothetical protein
FT                   from Homo sapiens (409 aa). FASTA: opt: 403 Z-score: 516.3
FT                   E(): 7.3e-21 Smith-Waterman score: 403; 34.171 identity in
FT                   199 aa overlap ORF ftt0571"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0571"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08587"
FT                   /protein_id="CAL08587.1"
FT                   /translation="MIHLHQLPKLKGRNYSCSPFCLKLELYLKVTNLNYQNHFNLEFNK
FT                   SPTGKMPYIETMGKKFADSNLIIEMLDKQNHNNLDEHLNSEQKAISTAFIRLCEDSLYW
FT                   VGVYSRWADKDNYTWKQEFLESTKLPKAMASIVYPVAKRNILRQLKAAGVTNLTNNEIY
FT                   SKAERDLQAIADYLGEKEYFFNSKLSLVDLVVFSFLINIADGSCGRRLQNFLVSLKLDN
FT                   FIKNMQESFELNF"
FT   CDS_pept        588805..590259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0572"
FT                   /product="Proton-dependent oligopeptide transport (POT)
FT                   family protein"
FT                   /note="Similar to Q8Z269 Putative PTR2 family transport
FT                   protein from Salmonella typhi (489 aa). FASTA: opt: 729
FT                   Z-score: 778.1 E(): 1.9e-35 Smith-Waterman score: 770;
FT                   30.524identity in 439 aa overlap ORF ftt0572"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0572"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08588"
FT                   /inference="similar to sequence:UniProtKB:Q8Z269"
FT                   /protein_id="CAL08588.1"
FT                   /translation="MQHIEEKQRTKYFISLFWLQLFERFSFFGFFYILIFFCINKLNLT
FT                   ESYASTFAGSFTALCYVLSSLGGFISDKALGVRRTLIAGGICLILGYSLLSTSDMLMNF
FT                   SIYVGLAMIIVGACLFVPMTLNSMSRLYAGDPAKLDSIYAYFNMTNNIGALSGAILIPY
FT                   LSSADSYGLENRHYGIALGVCACGVLLALGNIFMNKKLFSTIAAPVGKKTLSFQQLVLA
FT                   IIGIIFFVSVVTGLLYFSSLIIIVLVLAVVMIVGYFINITFQQDKEYRLKMLLLLVFIF
FT                   YATIFFMTYAQKTTSFFLFNVHHVDLNVLGIKLNSQTVPGLLNTSGILIFSPILAMYFN
FT                   KMGDRLRSTSKFALCLLFAGICYAFLYFVCVFNDPSSKVSFWWEVVAVGVFFSWAEIMA
FT                   TAVGLSLITQLVPTKVRGFCMGMWFLTWAVGIKLGVYVASLYASKDLEHSKSSLLIGQT
FT                   KIDSYLGYENLFMWITIVTVAAAFHF"
FT   CDS_pept        590310..591407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alr"
FT                   /locus_tag="FTF0573"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="Similar to Q81EB9 Alanine racemase from Bacillus
FT                   cereus (408 aa). FASTA: opt: 573 Z-score: 679.1 E():
FT                   6.2e-30 Smith-Waterman score: 573; 29.863 identity in 365
FT                   aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0573"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08589"
FT                   /db_xref="GOA:Q14IP6"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14IP6"
FT                   /inference="similar to sequence:UniProtKB:Q81EB9"
FT                   /protein_id="CAL08589.1"
FT                   /translation="MNILKISKQTLRNNIKIIREYIGNAKMCFPVKANAYGHGIEDIVE
FT                   NTHDLVDFFAVANSLEAFRVTAVAKNPVLVFGVIYYEYIEKMISENIRVSIQDYEDIEK
FT                   LEQIAKELDKKVYAHININTGMNRMGVDYNDACRTIQRAYESDWLILEGVYSHLACADN
FT                   RDHPTNIKQKNRFDSIVKFTKGLSQDIICHLSNSYGFLGQKGICYDMVRPGILSYGFLP
FT                   EFYVDRVIREIKPIARLLSKVVKIITLQEGEGVGYSLIYRGFEDEQLAVIPIGYGDGFP
FT                   RELGDRGFVNINDVMYPMAGRMSMDGLTVSLGINEYDVKVGDTVELISAIPRNRNSAFS
FT                   IAKQTNTIEYDIMSTLNDRIIRKII"
FT   CDS_pept        join(591520..592371,592375..592857,592857..593096)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0574"
FT                   /product="amino acid permease family protein, pseudogene"
FT                   /note="Similar to Q83AT4 Amino acid permease family protein
FT                   from Coxiella burnetii (542 aa). FASTA: opt: 1289 Z-score:
FT                   1363.6 E(): 4.6e-68 Smith-Waterman score: 1289; 42.534
FT                   identity in 442 aa overlap. Contains an in-frame stop codon
FT                   after aa 284 and a frameshift after aa 445 ORF ftt0574"
FT                   /db_xref="PSEUDO:CAL08590.1"
FT                   /inference="similar to sequence:UniProtKB:Q83AT4"
FT   CDS_pept        593182..594024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheA"
FT                   /locus_tag="FTF0575"
FT                   /product="prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="Similar to Q8KBW6 Prephenate dehydratase from
FT                   chlorobium tepidum (280 aa). FASTA: opt: 624 Z-score: 792.7
FT                   E(): 2.9e-36 Smith-Waterman score: 624; 38.489 identity in
FT                   278 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0575"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08591"
FT                   /inference="similar to sequence:UniProtKB:Q8KBW6"
FT                   /protein_id="CAL08591.1"
FT                   /translation="MIKVSFQGEHGAYSEQAITNFLEQQNIKDFQTVTCWSFSDAIEHT
FT                   ISGKSNFVMIPVENSLAGSVVPAYDELIKSNLKVKAEVVLKIKHCLMGLNDVEISEIES
FT                   VISHPQALSQCANSLKKLKLTPEAFVDTAGAAKYIFEKNKRNHLAIAGELAAKTYRLKI
FT                   FQHELEDEQFNYTRFLLMGYDDIKVNSADNKYKTTIIFSVEDKSNALVNTLNVFSKYNI
FT                   NLTKIESRPSRNRAWNYLFFIDFEGSDDDFNVQQALLEVLKKSTFLKVLGSYKSYHFS"
FT   CDS_pept        594050..594718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0576"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Q894N2 Putative zinc metallopeptidase
FT                   from Clostridium tetani (236 aa). FASTA: opt: 434 Z-score:
FT                   526.0 E(): 2.1e-21 Smith-Waterman score: 434; 36.245
FT                   identity in 229 aa overlap ORF ftt0576"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0576"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08592"
FT                   /inference="similar to sequence:UniProtKB:Q894N2"
FT                   /protein_id="CAL08592.1"
FT                   /translation="MSYKVKIIYRDVANLKISLNKDGLVTVVSPQKVTKKEIFKILESK
FT                   KAWLDKHAKRLSVNQKYDYQNYTLNDGDCVYFLGREYPIKIVESKHNIVNYHDDHIQIL
FT                   LNPSVITNRKFKLQLLEEFYKDQADIILNNLVAKYLKITNQEITRVTIKKTKTRWGSCN
FT                   YVKKTINLNFNLVLRDIQAIEYVVLHEIAHLTHPNHSKEFYAYVASYMPDWKVREKRLK
FT                   "
FT   CDS_pept        594774..596147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdaA"
FT                   /locus_tag="FTF0577"
FT                   /product="L-serine dehydratase 1"
FT                   /EC_number="4.3.1.19"
FT                   /EC_number="4.3.1.17"
FT                   /note="Similar to Q8EEW4 L-serine dehydratase 1 from
FT                   Shewanella oneidensis (458 aa). FASTA: opt: 1442 Z-score:
FT                   1806.4 E(): 1e-92 Smith-Waterman score: 1442; 48.922
FT                   identity in 464 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0577"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08593"
FT                   /inference="similar to sequence:UniProtKB:Q8EEW4"
FT                   /protein_id="CAL08593.1"
FT                   /translation="MESTFELFSIGVGPSSSHTIGPMRAGCDFINLYKDKLPQTKSVKI
FT                   DLFGSLALTGKGHKTDYAVVLGVMGFLPESVDIELAKKLYDECLRNKKLNLGQEFEIDF
FT                   DYDKDLVFHYNEFLPEHANGMRFSLFNGEELLCEKEYFSIGGGFIVDKKQIKKDTVPTE
FT                   VSCDKPYKFSTMAELRELCQRDGKTIDEIMFENEKTAYGEQQSLDKLAEIWHVMETSIE
FT                   KGLTCAEATLPGGLKVRKRAPSMIRKLKEQNIVNTDFNYLNAFAIAVNEQNACGERVVT
FT                   APTNGAAGVIPAVLKYYLQTHEIVNQQELKEVVNKYLLVCAAIGILYKSGASISAAEVG
FT                   CQGEVGVACSMAAAGYCALLGGDLDSIESAAEIGMEHNLGLTCDPIGGLVQIPCIERNA
FT                   MGAVQAINAAKLAYLDTGEKRFVGLDYVIKVMYETGLDMSSKYKETSLGGLATNVPVC"
FT   CDS_pept        596250..597473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csdB"
FT                   /locus_tag="FTF0578"
FT                   /product="selenocysteine lyase"
FT                   /EC_number="4.4.1.16"
FT                   /note="Similar to Q8ZDZ4 Putative selenocysteine lyase from
FT                   Yersinia pestis (406 aa). FASTA: opt: 1343 Z-score: 1645.0
FT                   E(): 9.9e-84 Smith-Waterman score: 1343; 48.507 identity in
FT                   402 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0578"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08594"
FT                   /inference="similar to sequence:UniProtKB:Q8ZDZ4"
FT                   /protein_id="CAL08594.1"
FT                   /translation="MYDVNKIRQDFPFLAQKINNKSVLFFDTGASAQKPQAVIECVAEA
FT                   YAYNYANVHRGVYSLSQEASEKYENVRQIVQKFLNSKSADEIVITKGTTEAINLVASSI
FT                   GKGIIRSDDEIVVTEMEHHANFVPWQMLCEDKNLDFKVAAVKDNGELDVDNLLALVTAK
FT                   TKILAITLCSNVLGTINPVKEIIKQVREINPNIIVLVDGAQAVIHTKVDVQDLDCDFFV
FT                   FSGHKLYGPTGVGILYGKYELLKQLPPYNYGGDMVDEVTIAKTTFALPPYRFEAGTPNI
FT                   VEAIGLGRAIEYVDSIGMINIEKHEQKLLEYATAELNKIDGLTIFGQAKHKAGVITFDI
FT                   QGCNAGDIGELLAIKGICVRTGKHCAHPLMYRMGVTSTVRMSFGMYNTFEEIDLFIIAL
FT                   KKVISQLK"
FT   CDS_pept        597494..597850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0579"
FT                   /product="hesB family protein"
FT                   /note="Similar to AAP95950 HesB family protein from
FT                   Haemophilus ducreyi (107 aa). FASTA: opt: 288 Z-score:
FT                   392.8 E(): 5.5e-14 Smith-Waterman score: 288; 41.121
FT                   identity in 107 aa overlap ORF ftt0579"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0579"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08595"
FT                   /inference="similar to sequence:INSDC:AAP95950"
FT                   /protein_id="CAL08595.1"
FT                   /translation="MVEVFDPNASSILEVTDAAAKHFKKHLDKHDGCIGIYVGTKVMGC
FT                   SGLAYDVDFVKQQPQDTQKVQQHGINFFVSNKSMDFLNGLKIDYVKHDFGLYKLEYTNP
FT                   NESARCGCGESFTV"
FT   CDS_pept        597864..598415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0580"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Q83BY3 Hypothetical protein from Coxiella
FT                   burnetii (180 aa). FASTA: opt: 593 Z-score: 750.6 E():
FT                   6.4e-34 Smith-Waterman score: 593; 48.045 identity in 179
FT                   aa overlap ORF ftt0580"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0580"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08596"
FT                   /inference="similar to sequence:UniProtKB:Q83BY3"
FT                   /protein_id="CAL08596.1"
FT                   /translation="MKPTDVTIIRRQVKAIAVPFGNEIELMPGQEVLVTQDKGGSFTLN
FT                   VNGNLLHLDGKDADAIGKQIVRYPVEGYDIKPGDPINMDAIWDQMRTVYDPEIPVNIVD
FT                   LGLIYNIITRKLENGNFHVIIDMTLTAPGCGMGPVLMTDVEKRVAMLPNVDKVDVVMVF
FT                   DPPWNSEMMTEAAKLELGLF"
FT   CDS_pept        598427..598915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaD"
FT                   /locus_tag="FTF0581"
FT                   /product="phosphopantetheine adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="Similar to COAD_LISIN (Q929W5) Phosphopantetheine
FT                   adenylyltransferase from Listeria innocua (161 aa). FASTA:
FT                   opt: 494 Z-score: 653.3 E(): 1.7e-28 Smith-Waterman score:
FT                   494; 50.625identity in 160 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0581"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08597"
FT                   /db_xref="GOA:Q14IN9"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14IN9"
FT                   /inference="similar to sequence:UniProtKB:COAD_LISIN"
FT                   /protein_id="CAL08597.1"
FT                   /translation="MNKIAIYPGTFDPITNGHVDLVERALNIFDEIVVAVSTAYGKNTL
FT                   FDIRIREQMIKEVFKDNQRVKVVSFQGLLVDTAVKHNACAIVRGLRAVSDFDYEFQMSS
FT                   MNNKLNSDIQTIFLTPSEKFSCISSTLVRAVAIHNYKRVDEFVPECVFREIKLKYSKE"
FT   CDS_pept        598920..599165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdx"
FT                   /locus_tag="FTF0582"
FT                   /product="Ferredoxin"
FT                   /note="ferredoxin. Identical to Q47937 Ferredoxin from
FT                   Francisella novicida. Similar to Q88AH4 Ferredoxin from
FT                   pseudomonas syringae (83 aa). FASTA: opt: 431 Z-score:
FT                   563.2 E(): 1.8e-23 Smith-Waterman score: 431; 65.432
FT                   identity in 81 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0582"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08598"
FT                   /protein_id="CAL08598.1"
FT                   /translation="MALLITDECINCDICEPECPNEAISQGEEYYEIDPNKCTECVGHF
FT                   EESQCTKVCPIRCIIIDPNNIETHQQLLDKYNSLVS"
FT   CDS_pept        599272..600453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fopA1"
FT                   /locus_tag="FTF0583"
FT                   /product="outer membrane associated protein"
FT                   /note="No transmembrane helix predicted"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0583"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08599"
FT                   /protein_id="CAL08599.1"
FT                   /translation="MMRLKSIVIATTVLLGSATASIAAGSDNIDTLANTNSATTQSSGF
FT                   AANNFIAPFANTYSALTNKDNTWGPQDRTGQWYLGVDANGLAGTPNSPSGAGANFTIGY
FT                   NINKYFAVQYNQLVGRVFAGLGEGVVNFSNNTMFTPYAAGGAGWANLAGQATGAWDVGG
FT                   GLKFELSRNVQASVDYRYIQTMAPSNISGANGRAGTNMIGAGLTWFFGGKDTTNNDTGN
FT                   IQDNGATTAAQTVAMPTIDESKYVLPAGIKQCEGNFNLTEDGVACYTINGDDVTVYLDT
FT                   KFAYDKATLNAKGKKAIASFVNFIKDSNISSVTVKGYASQGQTGSEFDIYNQKLSEKRA
FT                   QAVADYMKQLGLDSEKIITKGFGYNDTLGGIHKSDPRNQRVEASVSAPLKEAN"
FT   CDS_pept        601115..604486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0584"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0584"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0584"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08600"
FT                   /protein_id="CAL08600.1"
FT                   /translation="MNVKILPIAIDLDVKNTGVFSAFYQKGTSLEKLDNKNGKVYELSK
FT                   DSYTLLMNNRTARRHKRRGIDRKQLVKRLFKLVWTEQLNLEWDKDTQQAISFLFNRRGF
FT                   SFITDGYSTEYLNIVPEQVKAILMDIFDDYNGEDDLDSYLKLATEQESKISEIYNKLMQ
FT                   KILEFKLRKLCTDIKDDKVSTKTLKEITSYEFELLADYLANYSESLKTQKFSYTDKQGN
FT                   LKELSYYHHDKYNIQEFLKRHATINDEILGTLLTDDFDIWNFNFEKFDFDKNEEKLQNQ
FT                   EDKDHTQAHLHHFVFVVNKIKSEMASGGRHRSQYFQEITNVLDENNHQEGYLKNFCENL
FT                   HNKKYSNLSVKNLVNLVGNLSNLELKPLRKYFNDKIHAKADHWDEQKFTETYCHWILGE
FT                   WRVGVKDQDKKDGAKYSYKDLCNELKQKVTKAGLIDFLLELDPCRTIPPYLDNNNRKPP
FT                   KCQSLILNPKFLDNQYPNWQQYLQELKKLQSIQDYLDSFETDLKDLKSSKDQPYFVEYK
FT                   SSNQQMASGQRDYKDLDARILQFIFDRVKASDELLLNEIYFQAKKLKQKASSELEKLES
FT                   SKKLDEVIANSQLSQILKSQHTNGIFEQGTFLHLVCKYYKQRQRARDSRLYIMPEYRYD
FT                   KKLDKYNNTGRFDDNNQLLTYCNHKPRQKRYQLLNDLAGVLQVSRNQLLSSVEEWFQQA
FT                   QRVGEISKSQDEQIFEWLKSFKIASYCKAAVEMQKQYRGTLKNAIQTAIFRQSENINKN
FT                   KNTGNQQQALSENSKDVKSLTADEKKLLKLIENIAKASQKIGESLGLNDKQIKKFNSIY
FT                   SFAQIQQIAFAKRKGNANTCAVCSADNAHRMQQIKITELVEDNKDNIILSAKAQRLPAI
FT                   PTRIVDGAVKKMATILAKNIVDDNWQNIKQVLSAKHQLHIPIITESNAFEFEPALADVK
FT                   GKSLKDRRKKALERISPENIFKDKNNRIKEFAKGISAYSGANLTDGDFDGAKEELDHII
FT                   PRSHKKYGTLNDEANLICVTRDDNKNIFAIDTSKWFEIETPSDLRDIGVATIQYKIDNN
FT                   SRPKVRVKLDYVIDDDSKINYFMNHSLLKSRYPDKVLEILKQSTIIEFESSGFNKTIKE
FT                   MLGMTLAGIYNETSNN"
FT   CDS_pept        join(604467..605008,605008..605422)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0585"
FT                   /product="conserved hypothetical protein, pseudogene"
FT                   /note="Similar to Q99YS7 Hypothetical protein SPy1562 from
FT                   Streptococcus pyogenes (341 aa). FASTA: opt: 377 Z-score:
FT                   453.0 E(): 2.4e-17 Smith-Waterman score: 377; 28.526
FT                   identity in 312 aa overlap. Contains a frameshift after aa
FT                   181 ORF ftt0585"
FT                   /db_xref="PSEUDO:CAL08601.1"
FT                   /inference="similar to sequence:UniProtKB:Q99YS7"
FT   CDS_pept        605855..606433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0586"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Q9YCL9 Hypothetical protein APE1239 from
FT                   Aeropyrum pernix (221 aa). FASTA: opt: 238 Z-score: 303.8
FT                   E(): 5e-09 Smith-Waterman score: 238; 25.683 identity in
FT                   183 aa overlap. Weakly conserved. ORF ftt0586"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0586"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08602"
FT                   /inference="similar to sequence:UniProtKB:Q9YCL9"
FT                   /protein_id="CAL08602.1"
FT                   /translation="MNMDIFDNDLSIPVNLIRQWCFCPRIVYYQELLAIKPNKPLWVAQ
FT                   GEEFHKKVEQLEKRRSFSRYGLNNAIRHFNLSIKSQKYKLHGIVDWVIETDTNVYVVEY
FT                   KTNPNPNSLGHKLQIAAYALLVQEYFAKPCKTTFLTSDKKSYEIKITDELINKLIKTIS
FT                   DILSTLDSGNKPDSSASEQCEYYNFCNDR"
FT   repeat_region   complement(606831..606849)
FT                   /note="ISFtu2 19bp terminal inverted repeat"
FT   CDS_pept        complement(606857..607600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="isftu2"
FT                   /locus_tag="FTF0587c"
FT                   /product="Transposase"
FT                   /note="ISFtu2. Transposase, member of the IS5 family.
FT                   Identical to Q8GM03 putative transposase from Francisella
FT                   tularensis (247 aa)."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0587c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08603"
FT                   /protein_id="CAL08603.1"
FT                   /translation="MNYHIKEVFWSIILSFLKSQKGIHTNDEAKLRLFIEAVFYVLRTG
FT                   CQWRMLPFYYGKYRSIHKRFKDWCDKDIFSRLFKSVQNPDLQEVMLDSTIARAHACATG
FT                   YDKDDNQAIGRSVGRITTKIHAMTDALGNPIEILLSEDKTHDSKVAIDLLKNVYNTKVI
FT                   ADRAYHSNEIRQHIQGISSEAVIPCKSNTLNHIPFDSHVYKERHLIENFFSKIKHFRRV
FT                   FSRFDKTILAYIGMIKLACTFIWLR"
FT   repeat_region   complement(607677..607695)
FT                   /note="ISFtu2 19bp terminal inverted repeat"
FT   CDS_pept        607763..609040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroA"
FT                   /locus_tag="FTF0588"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /note="Similar to AROA_VIBPA (Q87QX9) 3-phosphoshikimate
FT                   1-carboxyvinyltransferase from Vibrio parahaemolyticus (426
FT                   aa). FASTA: opt: 928 Z-score: 1157.4 E(): 1.4e-56
FT                   Smith-Waterman score: 928; 36.916 identity in 428 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0588"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08604"
FT                   /inference="similar to sequence:UniProtKB:AROA_VIBPA"
FT                   /protein_id="CAL08604.1"
FT                   /translation="MKDFILQIKSQIKQQVYLDGSKSISNRSLIIAAMAQGQTKFENLP
FT                   NSADVLACIAALKELGCQLEHSWDSKTLVIQGCSGVFANLDVKIFCNESGTLTRFIIPM
FT                   LAVQSTGKYYVYAKQRMMDRPLADQLKPLEKLGMLANYHQKAYAMPLTIIAKSLDGGYI
FT                   EVDGEKSSQFASGLLMAAPFMHRGLRLNSITDHKQPYLDMTTKVMAEFGVTVDIDENIY
FT                   TANKSQYISPSNYVVEPDVSTASYFWAFAAITGSTIKVMHVTKNSKQGDIKFLEVLEKI
FT                   GCQVNYYNDGIEVTGNNQLRGIQVNMRNFSDTFMTLAAIACFAKGDTHISGLSHTRGQE
FT                   SDRIAAMAEGLSKLGIYVETTQDSILISPARSKFKPAEVDSHNDHRIAMSLALLGLKYQ
FT                   GVIVNNAAAVSKTCPDYFDRMRALVG"
FT   CDS_pept        609043..609633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0589"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0589"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0589"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08605"
FT                   /protein_id="CAL08605.1"
FT                   /translation="MIKKERIITRYLSQRWYKKALIITATESNYFHNINVLKLVACSGY
FT                   LKNQSPLGCIFDIEAWPFENKFFDLIILDESFVSCPKQMRALFNQLHFCLSDDGEVIVA
FT                   CVGGISLYGLLSRFLANGFTSKKVRLINYTNNFIVNIIKKIISKNYVVVFKKDNYFRVD
FT                   PLNVSELVDKPLKAKVYSGGCAREIYGNFQKEK"
FT   CDS_pept        609584..610066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhA"
FT                   /locus_tag="FTF0590"
FT                   /product="Ribonuclease H"
FT                   /EC_number="3.1.26.4"
FT                   /note="Similar to RNH_PSEAE (Q9I2S9) Ribonuclease H from
FT                   Pseudomonas aeruginosa (148 aa). FASTA: opt: 673 Z-score:
FT                   830.4 E(): 2.3e-38 Smith-Waterman score: 673; 62.937
FT                   identity in 143 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0590"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08606"
FT                   /db_xref="GOA:Q14IN1"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14IN1"
FT                   /inference="similar to sequence:UniProtKB:RNH_PSEAE"
FT                   /protein_id="CAL08606.1"
FT                   /translation="MVVALGKYMEIFKKKNRVIAYTDGACKGNPGIGGWGAILSYNGVD
FT                   KEIYGSEKDTTNNRMELMAAIKTLQALKRKCDITIYTDSKYLQNGINEWLANWKANGWK
FT                   TAAKKEVKNKDLWQELDSLTNKHNVTWGWVKGHSGNAGNEKADELANKAIAELIGK"
FT   CDS_pept        610068..611105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ansA"
FT                   /locus_tag="FTF0591"
FT                   /product="L-asparaginase"
FT                   /EC_number="3.5.1.1"
FT                   /note="Similar to Q8EEG1 L-asparaginase I from Shewanella
FT                   oneidensis (337 aa). FASTA: opt: 1041 Z-score: 1293.4 E():
FT                   3.7e-64 Smith-Waterman score: 1041; 49.258identity in 337
FT                   aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0591"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08607"
FT                   /inference="similar to sequence:UniProtKB:Q8EEG1"
FT                   /protein_id="CAL08607.1"
FT                   /translation="MKDLENRANKKILVLYTGGTIGMVSTEQGYDVKPGYLSETIAGIR
FT                   DFYHYNMPQFEIKEYSELIDSSNINPRKWLSLALDIIKTYEDYDGFVILHGTDTLAYTA
FT                   SVLSFMLGELQKPVIVTGSQIPISKIRSDAISNILNSLIFACSDDIKEVCVYFNQKLMR
FT                   GNRTTKISATDFDAFASPNYPALARVGIDIVVRQEKLWQRADTFSQPKLETFAVPKIAI
FT                   LSVFPGMGNDILEAVLEPPLQGLILKTYGAGNMINDPSIHMTLKKTNDRGVVIVNCTQC
FT                   LYGSVKMDAYKAARGLVEAGVVSGYDMTDEAALGKLFYLLSQPNITQQDVKEAFNVSLQ
FT                   GEVTI"
FT   CDS_pept        611176..611862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cynT"
FT                   /locus_tag="FTF0592"
FT                   /product="carbonic anhydrase"
FT                   /EC_number="4.2.1.1"
FT                   /note="Similar to Q87AM3 Carbonic anhydrase from xylella
FT                   fastidiosa (220 aa). FASTA: opt: 577 Z-score: 733.9 E():
FT                   5.5e-33 Smith-Waterman score: 722; 45.536 identity in 224
FT                   aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0592"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08608"
FT                   /inference="similar to sequence:UniProtKB:Q87AM3"
FT                   /protein_id="CAL08608.1"
FT                   /translation="MSDISELIKGNRAWAEEIKKTNPGFFETLSKGQSPEYLWIGCSDS
FT                   RVPANQVCGLIPGEVFVHRNVANVVSLTDLNCLSVLQFAIEVLKIKKIIVCGHYACGGV
FT                   ETVVKDKSYGLIDNWLTSIHEVKEQNKQFIEESLSCYKDNQEEYMKKKVDMMCELNALH
FT                   QALNLCKTTVVKNAWAKGLTFTIHAAIYGIGDGKLYEIGGGVGSRAEMDTTYAQAIKDI
FT                   KSRYCR"
FT   CDS_pept        complement(612149..612754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0593c"
FT                   /product="hypothetical membrane protein"
FT                   /note="ORF ftt0593c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0593c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08609"
FT                   /protein_id="CAL08609.1"
FT                   /translation="MSSFILINILSDVLAIIYAIRSSKFSKDAWLFYITSIIIGSSTFF
FT                   LYNNFSIINYFYSLEAEYYNIAIAVLGLIISLCLTIKTKSISEYNKVYISLFLLVIISS
FT                   FVLLTIFITSEDNFTKIEITYFLLFDILGIIGLALLAIKCIQGLFVQAVYFGISTAIAI
FT                   IHNAFYNHDVTLATLPVSFDIIMTIIFTNGYLRNKNRY"
FT   CDS_pept        complement(612818..613690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0594c"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Q87N89 Hypothetical protein from Vibrio
FT                   parahaemolyticus (344 aa). FASTA: opt: 706 Z-score: 859.6
FT                   E(): 5.5e-40 Smith-Waterman score: 706; 42.160 identity in
FT                   287 aa overlap ORF ftt0594c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0594c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08610"
FT                   /inference="similar to sequence:UniProtKB:Q87N89"
FT                   /protein_id="CAL08610.1"
FT                   /translation="MLSLFQKISFENKDFIVMRDDLSHPIFSGNKARKLAYLLNNPEKY
FT                   SHIQTIISFGGNQSNFMLALSQLAELKGWNFHYWIKPLPKFFRQTKNGNLKLALDNGMQ
FT                   LFETLSSLNLEKIKANYHTDSSLYFFDQGGRNTLAEQGIAECAKEIKKYCKQNNIDDYS
FT                   VIVASGTGTTALYLEKYLPYKVYTIPCVGSSDYLKEQFNNIDSDLVHPKIISPNFKNNF
FT                   GQLDIANYNIYLKLLRETKIEFDLLYDPIAWRTLLSKYHQLPKPIIYIHCGGVSGNQTM
FT                   LARYQRFSQ"
FT   CDS_pept        complement(613699..613869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rubA"
FT                   /locus_tag="FTF0595c"
FT                   /product="Rubredoxin"
FT                   /note="Similar to Q88C68 Rubredoxin from Pseudomonas putida
FT                   (55 aa). FASTA: opt: 334 Z-score: 465.9 E(): 4.6e-18
FT                   Smith-Waterman score: 334; 78.431 identity in 51 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0595c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08611"
FT                   /inference="similar to sequence:UniProtKB:Q88C68"
FT                   /protein_id="CAL08611.1"
FT                   /translation="MEYRKYICIVCGLIYDEAEGWPEDGIEPGTRWEDVPEDWECPDCG
FT                   VSKDEFELLEE"
FT   CDS_pept        complement(613956..614573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0596c"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0596c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0596c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08612"
FT                   /protein_id="CAL08612.1"
FT                   /translation="MEYLKLAIVDSENYNNFAHISAGNFDRVIVFTNSQELESNFNKTE
FT                   IYHNFELVPIIYGEGNKDNMDGYICAKVGEYVERYRDFRTYLSITIFSNDRIFRGIASY
FT                   YTRKGFNIATTAPTQCDTGTSNTDPKIRIKKFLDCHESVVNKTFKKHFNENNKDAFYRL
FT                   IRRHLDKDIPRQITDLFVENNIIFFSNKSRKIGVDESKYNLL"
FT   CDS_pept        614685..616079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0597"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Q9K5Z6 Hypothetical UPF0061 protein BH393
FT                   from Bacillus halodurans (492 aa). FASTA: opt: 1251
FT                   Z-score: 1519.2 E(): 1e-76 Smith-Waterman score: 1357;
FT                   48.233 identity in 481 aa overlap ORF ftt0597"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0597"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08613"
FT                   /inference="similar to sequence:UniProtKB:Q9K5Z6"
FT                   /protein_id="CAL08613.1"
FT                   /translation="MIDFQYTYSQLSEQFYSRQAVYKYPNAKLLILNDCLVTELGLDLA
FT                   NKSEQQLLEFLLGYSSKKPISQAYAGHQFGNFTMLGDGRAILIGEYKKPNGELVDFHLK
FT                   GAGLTKFSRGGDGKAALAPMLREYIVSEAMYNLGIPTSRILAVITTGENIQRNQLKQDA
FT                   IAVRVASSHIRVGTFQYAAMLGESYSQELLDYTITRHNIPHNDNKALSLLDYVIAKQTS
FT                   LITEWERVGFIHSVMNTDNMTISGETIDYGPCAFMDSYDPDTVFSSIDRHGRYAFANQA
FT                   SIAGWNIARLAESLLKLISADEEEAIKLAQDKLQSYSETYKNKWQKMFLAKLGLSINKA
FT                   HNDEMISDLLIEMFKFKLDYTNTFYNLTYKNFGALKDCGLGEWLEKYITKNEINFANMK
FT                   KINPVIIPRNHQVEKALKSAEDTKFGNLYNLVAALKTPYEFNILTEKYITEPVEEEKVR
FT                   FTFCGT"
FT   CDS_pept        complement(616111..617391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0598c"
FT                   /product="Sodium-dicarboxylate symporter family protein"
FT                   /note="Similar to Q8XLU3 Probable transmembrane symporter
FT                   from Clostridium perfringens (435 aa). FASTA: opt: 881
FT                   Z-score: 961.9 E(): 1.1e-45 Smith-Waterman score: 881;
FT                   33.721identity in 430 aa overlap ORF ftt0598c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0598c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08614"
FT                   /inference="similar to sequence:UniProtKB:Q8XLU3"
FT                   /protein_id="CAL08614.1"
FT                   /translation="MRMAILLIISLLILVYLHLKKISFNFRTILALIIGVVIGIIYNST
FT                   DYYSNSFIQISNILGDGYISLLKMLIIPIVLTSIIHSIINLKNYEGSYVIRFAYKTIAI
FT                   LLILTGISAAIGASVAIIMHLGQGIDIASITGNVAKNIKTSSISETILGFLPDNIFHQM
FT                   DNNNVMAVVIFAILLGFAMLIAHREDSKLAAPFISFIDSAFFVIKKLARMIIAITPYGV
FT                   LGLMVQMSIELDKNSISTVLYFILTCYIALIIVLIMHIILLVLFRTNIVRFYRSIWKAM
FT                   LVAATSRSSMGTLPLSIDGLNKYGTTSSIATFAPTMGTTLGMNGCAGVFPAVLAIMAMN
FT                   ATGVDITFSTVVLISLICMLASLGVSGIPGTAFVAAGVVFSYFGLPWQLIALIIGVDAI
FT                   IDSFRTPLNIHGTMTTAIIVDKTTKAS"
FT   CDS_pept        617587..618615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0599"
FT                   /product="SIS domain protein"
FT                   /EC_number="2.6.1.-"
FT                   /note="Similar to Q9AAR1 SIS domain protein from
FT                   Caulobacter crescentus (358 aa). FASTA: opt: 864 Z-score:
FT                   1052.1 E(): 1e-50 Smith-Waterman score: 864; 42.353
FT                   identity in 340 aa overlap. Putative
FT                   Glucosamine-fructose-6-phosphate aminotransferase ORF
FT                   ftt0599"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0599"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08615"
FT                   /inference="similar to sequence:UniProtKB:Q9AAR1"
FT                   /protein_id="CAL08615.1"
FT                   /translation="MTTLMHQEASSSFAKVANQLKLNKDITKSIVKILKEKNIKRIITI
FT                   ARGSSDCVANFAKYLFETQLGFNVSSLPPSITTIYGKNIGDKETLAIAISQSGGSPDLR
FT                   LALEGCKKAGCTTLAIVNVEKSPLAESADLVLPVRADAENAVAATKSVITSLVALVSIV
FT                   AEYNQDQALLDSLNTLPETLEKSLNSDWSPAIKELKKSKNMFVIGRGFGFPIVQEMALK
FT                   FKETCGIHAEAFSSAEVLHGPFALMNQTFTTFTILQHDESAQGTRDIIKRMTDLGFRTI
FT                   FATTDNQSDAKVHLHVDVKTHPILETVVILQKFYLIVNELALSLGYSPDSPSNLKKVTE
FT                   TV"
FT   CDS_pept        join(618640..619842,619842..620045)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0600"
FT                   /product="major facilitator superfamily (MFS) transport
FT                   protein, pseudogene"
FT                   /note="Similar to Q8G3X1 D-xylose-proton symporter from
FT                   Bifodobacterium longum (517 aa). FASTA: opt: 795 Z-score:
FT                   849.1 E(): 2.1e-39 Smith-Waterman score: 795; 33.040
FT                   identity in 454 aa overlap. Contains a frameshift after aa
FT                   401 ORF ftt0600"
FT                   /db_xref="PSEUDO:CAL08616.1"
FT                   /inference="similar to sequence:UniProtKB:Q8G3X1"
FT   CDS_pept        620200..620319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0601"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0601"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0601"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08617"
FT                   /protein_id="CAL08617.1"
FT                   /translation="MKSCGYNFVLSDGRIKPETAIKLALTVIMYSLGKYSMVL"
FT   CDS_pept        complement(620946..622424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0602c"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0602c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0602c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08618"
FT                   /protein_id="CAL08618.1"
FT                   /translation="MYFLYIVMKYIYKKLLIYSFFMCSICHSYAELNNQISILELQKQI
FT                   KELQTEINHFEETKINENFEFTTYSSEVVDSKSKLRNKETKVLYTVQNNNVDIIQNISP
FT                   ESTIIDLRGKPLGKIFNQNGSIDVGNAPAITTDGQAAYLGSYSGNNSIPIGMIPGKLFA
FT                   STIILQKEKFDQYSIFLGGLIRVDAQTWFGDSIPRIDFNNNPTTSFDSKGQNIYPSTAR
FT                   LFFLANMGNYITAAYNVSTSELNNFNIGDAFVIIGNMDVSPYFITVGKSTLTIANLGGG
FT                   GPSTSGIANFLNTGRATNISLNYKTSTLNVSVAFFSTNDQKANFSAGLFYADKWTDNLS
FT                   VGFNTGYVYDLAGAENSSIPRIALNKTIGAFSIDANIAYTINSGIFQINSGWGSTTNSF
FT                   DFNLTGENVLAGAWYIAGNYSANIFGRNSNFNATYGESYNAAAIQCLSPEVDYKMDYQN
FT                   RALKDKLFFQPKDHISMTVYYLVLNMHIKNFIMM"
FT   CDS_pept        622984..623163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0603"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0603"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0603"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08619"
FT                   /protein_id="CAL08619.1"
FT                   /translation="MAFPKMTSLAEASWVDPNITVKDKKINWNSLVYRLATDNTKFLGY
FT                   IDRIINPNSDEKKV"
FT   CDS_pept        623681..624115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0604"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="Similar to Q9CNR2 NhaP NA+/H+ antiporter Conserved
FT                   hypothetical membrane protein from Pasteurella multocida
FT                   (441 aa). FASTA: opt: 315 Z-score: 391.3 E(): 6.6e-14
FT                   Smith-Waterman score: 315; 39.850 identity in 133 aa
FT                   overlap. Matches to a central part of an Nhap protein ORF
FT                   ftt0604"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0604"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08620"
FT                   /inference="similar to sequence:UniProtKB:Q9CNR2"
FT                   /protein_id="CAL08620.1"
FT                   /translation="MKFLNLTKICQKRLKILLEGESLFNDVVSIVLFTMFVGIIDGNSQ
FT                   DVSIFSISELLLREGLGGILLGSVIGYASSFLMKSLDDSNALVLVSLAVVSFDFSIAHI
FT                   LVVSAPLVMVVAGLIISNGSLESRLSDKSLKEFNSFWSSI"
FT   CDS_pept        complement(624301..624489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0605c"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0605c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0605c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08621"
FT                   /protein_id="CAL08621.1"
FT                   /translation="MVLNSFFAYNKNSIYLLKDIPLINIEVITYTYMTKNINILELSSG
FT                   KDNAIDTPPLKPAHVIT"
FT   CDS_pept        complement(join(624490..624777,624774..625193))
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0606c"
FT                   /product="conserved hypothetical protein, pseudogene"
FT                   /note="Similar to Q8KTX3 Putative YbgI protein from Vibrio
FT                   fischeri (251 aa). FASTA: opt: 818 Z-score: 1022.1 E():
FT                   4.9e-49 Smith-Waterman score: 818; 53.112 identity in 241
FT                   aa overlap. Contains a frameshift after aa 140 ORF
FT                   ftt0606c"
FT                   /db_xref="PSEUDO:CAL08622.1"
FT                   /inference="similar to sequence:UniProtKB:Q8KTX3"
FT   CDS_pept        625293..626510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispG"
FT                   /locus_tag="FTF0607"
FT                   /product="1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate
FT                   synthase"
FT                   /EC_number="1.17.4.3"
FT                   /note="Similar to ISPG_BRUSU
FT                   4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase from
FT                   Brucella suis (420 aa). FASTA: opt: 1698 Z-score: 2041.1
FT                   E(): 8.4e-106 Smith-Waterman score: 1698; 63.868 identity
FT                   in 393 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0607"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08623"
FT                   /db_xref="GOA:Q14IL6"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14IL6"
FT                   /inference="similar to sequence:UniProtKB:ISPG_BRUSU"
FT                   /protein_id="CAL08623.1"
FT                   /translation="MGSYMNKTSVVKVGNVLIGGDNPVVVQSMTDTYTADVEKTVKQIL
FT                   ALHKAGSEIVRITVNDESAAAAVPEIVKELAKHDCHVPLVGDFHYNGHTLLSKYPECAK
FT                   ALAKYRINPGNVGFGKKKDTQFAEIIKIAIANDKPVRIGVNWGSLDQALLARLIDENNA
FT                   QENPLSLQQIMHKALITSALESAKYAEELGLAKDKIIISCKVSEVQDLIAVYQKLAKEC
FT                   GYALHLGLTEAGMGTKGIVASAVSLGILLQQGIGNTIRVSLTPAPNAPRTEEVRVCREI
FT                   LQNLGMRTFTPSVTSCPGCGRTTSSFFRELTSKVKDHLDEKMHTWKEQYHGVEAMKVAV
FT                   MGCVVNGPGESKNADIGISLPGSGESPVAPVFIDGKKAHTLRGDNISEEFIEIVENYVK
FT                   NRYGKK"
FT   CDS_pept        626525..627103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0608"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Q9KHC2 Hypothetical 27.0 kDa protein from
FT                   secondary endosymbiont of Glycaspis brimblecombei (244 aa).
FT                   FASTA: opt: 467 Z-score: 605.3 E(): 8e-26 Smith-Waterman
FT                   score: 467; 44.751identity in 181 aa overlap ORF ftt0608"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0608"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08624"
FT                   /inference="similar to sequence:UniProtKB:Q9KHC2"
FT                   /protein_id="CAL08624.1"
FT                   /translation="MSVVFVNTPFAKLKLGYTNNTQGFSKEKYAKFNLADNVGDKCLAV
FT                   EKNRNLFKSYLNADIKWLRQNHTNIVKSFDEYNGDFCDAIITDKPRQACVVLTADCLPI
FT                   ILFDKKMTKVAAIHAGWRGLSQGILEVALKEFVGLELVAWFGPCISANFYEVGSDVHDK
FT                   FIEQHQAFGQAFRSKSEGKYLFDMKLVAR"
FT   CDS_pept        627254..629047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0609"
FT                   /product="Peptidase, M24 family protein"
FT                   /EC_number="3.4.-.-"
FT                   /note="Similar to Q83F75 Peptidase, M24 family protein from
FT                   Coxiella burnetii (597 aa). FASTA: opt: 1665 Z-score:
FT                   1963.9 E(): 1.7e-101 Smith-Waterman score: 1665; 45.286
FT                   identity in 594 aa overlap ORF ftt0609"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0609"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08625"
FT                   /inference="similar to sequence:UniProtKB:Q83F75"
FT                   /protein_id="CAL08625.1"
FT                   /translation="MSEKLQILRSLMQEKDYDFYIVPSVDDHNNEYVPKCWQYRAWISG
FT                   FDGSAGDVLVGMDKAYLSTDGRYFLQAEQQLDKNDFELIKQSSFAPEIVKWLWKNAKGK
FT                   TIAVDPAKLSYKSTLELLDYLNSNDYNVVFDQDNLVHKAQQMLSQVVDVPCTTIQEHAI
FT                   QYSGRSVASKIEELRRTMKQTRSDFYVDSKLDHIAWLLNIRARDVECTPLVISYLFVSL
FT                   DKIILYVNDRKITPAIKKYFDDNHIQTRDYYQFYQDLEATTGKYLLDGANINYKVPLSI
FT                   NKNQNSSCYFLMIDSPVGLSKALKNPVEINGSKEAHRKDAAAFISWWHWIENNYQGVDE
FT                   IEAAAKLREFRAQQQGYVEDSFSYIVGHAANGAIIHYMAKKDANLKKIDDQAPLLCDSG
FT                   GQYREGTTDITRVLHFGKPSKEHRKYYTLVLKGHLGLGRAVFPKGTTGSQLDVLAREHL
FT                   WHFCADYAHGTGHGVGSFLGVHEGPQRINSVSKVELMPGMILSNEPGAYFPGEFGIRIE
FT                   NLCYIKQRNQESPTGHGPFYCFEDLTLVPYEYKLIETWMLTYTEKKTINNYYSRIRKEV
FT                   LPLINDPQVREFLLFKTRHIK"
FT   CDS_pept        629145..630209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0610"
FT                   /product="DNA/RNA endonuclease family protein"
FT                   /EC_number="3.1.30.-"
FT                   /note="Similar to Q8DFB3 DNA/RNA endonuclease G from Vibrio
FT                   vulnificus (247 aa). FASTA: opt: 682 Z-score: 838.7 E():
FT                   8e-39 Smith-Waterman score: 682; 46.311 identity in 244 aa
FT                   overlap ORF ftt0610"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0610"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08626"
FT                   /inference="similar to sequence:UniProtKB:Q8DFB3"
FT                   /protein_id="CAL08626.1"
FT                   /translation="MTKKTSKQKDTKKQTTKKPINYIKIFILLALTIGGGFSGIFFDKF
FT                   DLKEKFINFRHAVYNYFTSEPIKHYTTKDNENIIARFFSQSDEGKKQQQQSNEFDNLKQ
FT                   YPPVRTLPAVTDYCHGFLAYGNPSYGVTDGLGQANLYLCRDGYVVGYNYQTKEASWVAF
FT                   KLTKSKVANHLKRDDRFKEDSDVPFVYRAILDDYSRSGYDRGHLASYASMDFSKKSADQ
FT                   SFLLSNMSPQKAGLNRQGWERLETYERIWANMYDSIYVYTGPIYKKQKIHKTIGDNKIA
FT                   VPDYFFKIIYVPSKNQAIAFVMPNARVEKTKIANYRVSIKDIEQCTGLHFLTNISNRDA
FT                   VINSVSLMWRTAYL"
FT   CDS_pept        complement(630200..631063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0611c"
FT                   /product="beta-lactamase"
FT                   /EC_number="3.5.2.6"
FT                   /note="Similar to Q9L6I3 Extended-spectrum beta-lactamase
FT                   BES-1 from Serratia marcescens (292 aa).FASTA: opt: 621
FT                   Z-score: 723.1 E(): 2.2e-32 Smith-Waterman score: 621;
FT                   34.397 identity in 282 aa overlap ORF ftt0611c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0611c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08627"
FT                   /inference="similar to sequence:UniProtKB:Q9L6I3"
FT                   /protein_id="CAL08627.1"
FT                   /translation="MRLLVTTLSLIPSIILAAPQLDDSFKNLENKYDGKIGIYTLNTDD
FT                   KTNIKYNESYHFPICSVFKFLLVGAILDYDMHNQGFLDKKIPINQDDIGKLGYAPITAK
FT                   NVGKTLTISQLNYAAILSDSPASNILVRELGGLQNLNKFIKKLGDNDTIITADEPEINY
FT                   TQPHSNINKTTPKAITKDIYKLAFGNILDKKHKDIFIKYLQDNNTGANRIAFSMPKDWI
FT                   IGDKTGTCGQYAATNDVAIIWPKNQQPIALGILYTNPNDKNAPSNEEIIQQAAKLIAND
FT                   LTNTYK"
FT   CDS_pept        631499..632311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0612"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0612"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0612"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08628"
FT                   /protein_id="CAL08628.1"
FT                   /translation="MAIDLLKLQNKLGYGVAARGMCHGIAYMAIQAIIRDALETYISRI
FT                   RYLEETLSQHNNNQDAAINEIVEKINVAYEKRKNKQNLDCDEIKLLDILNWFDGVQIYQ
FT                   NHNKLLSGGQSYENATNFFSANTNQNEKENRKIFVIAKELNILTKELIDDIFNKIDNSK
FT                   EPIAFSLSAPGHIISIGKSSNYKPIYLVNHNIHKHILNKKSLYSEVFCAFKYSMRIALS
FT                   IFRYSYQEENISIKYVTNNLDKDDLCELLCIALQDGHAEAIKVYRGDI"
FT   CDS_pept        complement(632632..633051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0613c"
FT                   /product="hypothetical protein"
FT                   /note="This ORF is longer. ORF ftt0613c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0613c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08629"
FT                   /protein_id="CAL08629.1"
FT                   /translation="MKKIITLSTLLLISLTSIAFSKELNNYSDILNAVKDGKNITIFVD
FT                   FLNCKPEIKVSGQFSPKSIMIHNDSIIFSDTHFTRNNPQYPNEPILEYVVYKINGNNVN
FT                   ITIDILDANNSPMEHSKRITIGCQITKDQASFFSN"
FT   CDS_pept        complement(633297..634787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0614c"
FT                   /product="Apolipoprotein N-acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="Similar to Q820B4 Apolipoprotein N-acyltransferase
FT                   from Coxiella burnetii (485 aa). FASTA: opt: 984 Z-score:
FT                   1082.0 E(): 2.2e-52 Smith-Waterman score: 984; 35.903
FT                   identity in 493 aa overlap ORF ftt0614c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0614c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08630"
FT                   /inference="similar to sequence:UniProtKB:Q820B4"
FT                   /protein_id="CAL08630.1"
FT                   /translation="MKKLIFRIVLPLLSGAILTLAFAPFRIDILALISLILFFYQLNKA
FT                   TKIRSAFFTATLFGIGFFGTSISWVYISIHLFTESIAAGLSAAVALVILLSFLHIIPFG
FT                   TFSYILTRKANNFAKLLIYPALWTLFEIVKANLLWGGFPWVSLGYSQTESPLIWYANVG
FT                   GVYLVSYIIAFMACLITFYICNNTTLKKTASVIFIITVLYVGGVIIKYYQPNVQTNQPQ
FT                   KVVLIQGDFVQGFKWDPDNFAKMQKYYQQAATEYKNSLIILSENAIPNYRQYMNSYFSK
FT                   LKELADENNNAMLIGSLSIEQTASRAKIYNSSIIIGNGQGVYNKHHLVPFGEYFPIKFF
FT                   GYVDSVGLSSFNAGDKIQLIMTAFGQPLANFICYEVAYPEQVRDQLQGAKLISIISDDS
FT                   WFGDSIAREQQLQISQVRAIENAKYVLTTTSNGITAVIEPNGEIIKELPKDTRATLEQT
FT                   IYLNDYHTIWMNIGMSLVWLLLIFSIAIGLIIKEKYSK"
FT   CDS_pept        complement(634787..635647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0615c"
FT                   /product="metal ion transporter protein"
FT                   /note="Similar to Q8EHP0 Magnesium and cobalt efflux
FT                   protein CorC from Shewanella oneidensis (291 aa). FASTA:
FT                   opt: 676 Z-score: 772.4 E(): 3.9e-35 Smith-Waterman score:
FT                   676; 39.847 identity in 261 aa overlap ORF ftt0615c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0615c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08631"
FT                   /inference="similar to sequence:UniProtKB:Q8EHP0"
FT                   /protein_id="CAL08631.1"
FT                   /translation="MNKRIKMADNNPFIKRLTSSIFNIKSEEALIDAINRAAANEVIDK
FT                   TSQNMLIGAMKISSLDVGDIMISHTKIVAVDMSMSIREILKKTINSSHTRLPVYCENKS
FT                   EILGILHSKDLLKLIFEKEIESADDEELKAEDIKNILRPAIFIPETKKLNAMLKDFKNS
FT                   QNHIAIVVDEYGAISGLITIEDVLEEIVGDIEDEFDITSQNIVKMADDKFILDATTTIE
FT                   DFNEYFATSIDDNSDYDTIAGMIIQTLECLPQKGDSIVVDGLKFTVQEADNRKIIKILV
FT                   EKFKK"
FT   CDS_pept        complement(635619..636125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0616c"
FT                   /product="cconserved hypothetical protein, UPF0054 family"
FT                   /note="Similar to Q8EHN9 Hypothetical UPF0054 protein SO117
FT                   from Shewanella oneidensis (153 aa). FATSA: opt: 433
FT                   Z-score: 547.4 E(): 1.3e-22 Smith-Waterman score: 433;
FT                   44.025identity in 159 aa overlap ORF ftt0616c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0616c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08632"
FT                   /db_xref="GOA:Q14IK7"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14IK7"
FT                   /inference="similar to sequence:UniProtKB:Q8EHN9"
FT                   /protein_id="CAL08632.1"
FT                   /translation="MKRKLKMDNLNINFINDDEHPIPSQDLLLKCLQLVANKHHISHAE
FT                   VNLNIVSNDEIQQINKQFRNKDKPTNIISFEFEKPQGLPDDIANDFLGDIVIAPAVLEN
FT                   EAKEQNKELNDHWQHIFIHGLLHLLGYDHQDDQEAEVMENLEIQLLAQLGIANPYIEQE
FT                   NQNGR"
FT   CDS_pept        complement(636100..637083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoH"
FT                   /locus_tag="FTF0617c"
FT                   /product="phoH-like protein"
FT                   /note="Simliar to Q87VY0 PhoH-like protein from Pseudomonas
FT                   syringae (340 aa). FASTA: opt: 1132 Z-score: 1306.4 E():
FT                   7.1e-65 Smith-Waterman score: 1132; 52.923 identity in 325
FT                   aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0617c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08633"
FT                   /protein_id="CAL08633.1"
FT                   /translation="MNKTQFILEPYNYDAMMLLCGNLDENIRAIENYFDVEIRHRADEF
FT                   EITSDSSTNNTQAKRFIKSCYAEILAGNTELDLEQITTILNATAKDKAAATAKSRKKVE
FT                   EAEVQMRSKKLKARTHNQAIYLENIKNNFVTFGVGPAGTGKTYMAIACAVAAYEKGEVR
FT                   RIVLVRPAVEAGEKLGFLPGDLAQKIDPYLRPMYDALFDFMGVEKVTKLIEKQAIEIAP
FT                   LAYMRGRTINDSFIVLDESQNTTKEQMKMFLTRIGFNTTAVITGDITQVDLPKNVTSGL
FT                   SHALSILNDIEGVAISYLKSVDIVRHQIVQKIVNAYDKHEEKTKNG"
FT   CDS_pept        complement(637102..638430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yleA"
FT                   /locus_tag="FTF0618c"
FT                   /product="conserved hypothetical protein yleA"
FT                   /note="Similar to Q83DX3 Hypothetical protein from Coxiella
FT                   Burnetii (439 aa). FASTA: opt: 1976 Z-score: 2303.8 E():
FT                   2e-120 Smith-Waterman score: 1976; 65.904 identity in 437
FT                   aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0618c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08634"
FT                   /db_xref="GOA:Q14IK5"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14IK5"
FT                   /inference="similar to sequence:UniProtKB:Q83DX3"
FT                   /protein_id="CAL08634.1"
FT                   /translation="MKEQKKVFIKTLGCQMNEYDSARMHEVLNEHFDTVKTDDYKDADI
FT                   ILINTCSIREKAQEKVFHELGRWKGLKKTNEDLIIGVGGCVASQEGENIIKRAPFVDLV
FT                   FGPQTIHRLPEMIKQKQKTQQSQVDISFPEVEKFDYLPEPKAEGAKAYVSIMEGCDKYC
FT                   SYCVVPYTRGPEVNRPFEDVLAECAILAEQGVKEITLLGQNVNHYLGPMENGQTADLAL
FT                   LIHFIAEIDGIERIRFTTSHPVEFSQNLIDAYATVPELANHLHLPVQHGSDRILINMKR
FT                   NHTILEFKQKIRKLRAIRPDITISSDFIVGFPGETEEDFQKLLDLVKEINFDQSFSFIY
FT                   SKRPGTPAADLPDDTPMEVKKDRLKRLQDLLNSNAQIISRQMVGTNQRILVDGTSKKDD
FT                   NILSGRTENNRVVNFKGDKSLIGQFAMVKITESLPNSLRGELI"
FT   CDS_pept        638653..639327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0619"
FT                   /product="o-methyltransferase family protein"
FT                   /EC_number="2.1.1.-"
FT                   /note="Similar to O67476 O-methyltransferase from Aquifex
FT                   aeolicus (212 aa). FASTA: opt: 382 Z-score: 477.6 E():
FT                   1e-18 Smith-Waterman score: 382; 33.495 identity in 206 aa
FT                   overlap. ORF ftt0619"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0619"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08635"
FT                   /inference="similar to sequence:UniProtKB:O67476"
FT                   /protein_id="CAL08635.1"
FT                   /translation="MQNTQSFLNILISMRQNQFTQDDIWQYCLEHTSDLSDNLKQLSEY
FT                   TRENIHGAQMLSEKMVTKLLQFFVFATRARVCVDVGTFTAMSAIAMAEAAPDTKVYTID
FT                   RTNQVGEQLAKEFIAKYPNIEYCQGNAMDILPTLSNQIDIAFIDADKKQTQEYFDILIT
FT                   KLADTGVIIVDDILWRGEVLDPRDKRAKALDDFNKYVNQRNDLETLVLPIRHGINIIRK
FT                   RT"
FT   CDS_pept        639336..640079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0620"
FT                   /product="HAD superfamily protein"
FT                   /note="Similar to Q8PER3 Acid phosphatase from Xanthomonas
FT                   axonopodis (310 aa). FASTA: opt: 238 Z-score: 293.2 E():
FT                   1.9e-08 Smith-Waterman score: 238; 24.583 identity in 240
FT                   aa overlap. ORF ftt0620"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0620"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08636"
FT                   /inference="similar to sequence:UniProtKB:Q8PER3"
FT                   /protein_id="CAL08636.1"
FT                   /translation="MRQIILIFVIAMQFCFVTAYAATCNSVNIDGVKWYHDSDEKREIY
FT                   LEIYNLAVHRIKHQVKEEHLKKGTWGVILDIDETALDNSWLEYDNYKNYSYSEEKFRQG
FT                   IIEQKAKGLPGAAKLTNLVHKLGGYVSFVSNRYGADPEIIKATEENLTKEDIYYDQILF
FT                   YNEKAKNPKDKNSRFEAVKSGKYTDDIIVTKKLPAHAVIAYFGDNIQDFPQMTQKNMRN
FT                   VDNHKYTIFGEKYYIFPNPMYGSWQ"
FT   CDS_pept        640095..640688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdk"
FT                   /locus_tag="FTF0621"
FT                   /product="thymidine kinase"
FT                   /EC_number="2.7.1.21"
FT                   /note="Similar to Q87QJ8 Thymidine kinase from Vibrio
FT                   parahaemolyticus (192 aa). FASTA: opt: 629 Z-score: 820.6
FT                   E(): 8.2e-38 Smith-Waterman score: 629; 46.465identity in
FT                   198 aa overlap."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0621"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08637"
FT                   /inference="similar to sequence:UniProtKB:Q87QJ8"
FT                   /protein_id="CAL08637.1"
FT                   /translation="MAKLYFRYSAMDAGKTLDLLKVAYNYEDRGRKPLVLTSAIDKRAG
FT                   LNKVKSRIGINQDAYSLTDRDNIFEFVENYNSSNKIDCVLIDEIHFFTQEQVWQLAEIV
FT                   DELNIPVICYGLRTNYLGQPFETAALLLAIADTLEEVKTICHCGKKASFNMMVQNGKAI
FT                   KQGNPIVVDDDSLKEIDTKYVSVCRKHWKEGVYE"
FT   CDS_pept        complement(640731..641195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0622c"
FT                   /product="hypothetical membrane protein"
FT                   /note="ORF ftt0622c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0622c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08638"
FT                   /protein_id="CAL08638.1"
FT                   /translation="MVTIILSICLLITPFIIAFLHSSIIHAKHHINIYANYFIVSNISL
FT                   YNLINSYAYLLDGDNISKFQGWIFTPAVFQIGIFQLALFLFSILALFKNSQFKASCLIF
FT                   FTIYTVLNSLTLFSGSIYYSGVETIFFVNLATALIAYILYRILTRKINIR"
FT   CDS_pept        641350..642666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="FTF0623"
FT                   /product="trigger factor (TF) protein (peptidyl-prolyl
FT                   cis/trans isomerase)"
FT                   /EC_number="5.2.1.8"
FT                   /note="Similar to Q87YR5 Trigger factor from Pseudomonas
FT                   syringae (436 aa). FASTA: opt: 1144 Z-score: 1126.0 E():
FT                   7.9e-55 Smith-Waterman score: 1144; 39.041 identity in 438
FT                   aa overlap. Molecular chaperone involved in cell division."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0623"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08639"
FT                   /db_xref="GOA:Q14IK0"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14IK0"
FT                   /inference="similar to sequence:UniProtKB:Q87YR5"
FT                   /protein_id="CAL08639.1"
FT                   /translation="MQVTVEKKEGIHCSLLIEVPANEIDSVVSKEINRTAKTIKMDGFR
FT                   PGKVPAGMVKKKYGEQIRMEVISDLIPQKYSKAIQDEKLAVAGIEVELKENKEGQPLKF
FT                   VANLELFPEFEVTGFEKIEVQKPVVELTDKEVKQMIENLRKQFATFSEVDKVVEKDDKV
FT                   TIDFVGKKDGEAFEGGTANDIDVIIGSGQMIPGFEDGIIGMKKGEQKTITVTFPQDYQN
FT                   KDLAEAETTFDITVKKIQQAELPEVNDEFVKKFGVKGGVDTFENEIKENMQRELKFILQ
FT                   RKVKDQVFKGLREIAEFETPKSLIKREIDAAKQNLLKQMGGAKGFDVNQLSDNLFEANA
FT                   KQKVETSLILDSIMNSQEFKAEEAEVESLLDELVQAYEEPEKTKEQIKKNDKEIANLKA
FT                   LVIENKLTDWVLEQAKVTEKTEDFFEVIKENMQAQQAGF"
FT   CDS_pept        642692..643297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="FTF0624"
FT                   /product="ATP-dependent Clp protease subunit P"
FT                   /EC_number="3.4.21.92"
FT                   /note="Similar to CLPP_VIBVU ATP-dependent Clp protease
FT                   proteolytic subunit from Vibrio vulnificus (200 aa). FASTA:
FT                   opt: 955 Z-score: 1207.6 bits: 230.3 E(): 2.3e-59
FT                   Smith-Waterman score: 955; 70.558 identity in 197 aa
FT                   overlap."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0624"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08640"
FT                   /db_xref="GOA:Q14IJ9"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14IJ9"
FT                   /inference="similar to sequence:UniProtKB:CLPP_VIBVU"
FT                   /protein_id="CAL08640.1"
FT                   /translation="MITNNLVPTVIEKTAGGERAFDIYSRLLKERIVFLNGEVNDHSAN
FT                   LVIAQLLFLESEDPDKDIYFYINSPGGMVTAGMGVYDTMQFIKPDVSTICIGLAASMGS
FT                   LLLAGGAKGKRYSLPSSQIMIHQPLGGFRGQASDIEIHAKNILRIKDRLNKVLAHHTGQ
FT                   DLETIVKDTDRDNFMMADEAKAYGLIDHVIESREAIIK"
FT   CDS_pept        643321..644574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpX"
FT                   /locus_tag="FTF0625"
FT                   /product="ATP-dependent Clp protease subunit X"
FT                   /note="Similar to CLPX_BACHD ATP-dependent Clp protease
FT                   ATP-binding subunit clpX from Bacillus halodurans (424 aa).
FT                   FASTA: opt: 1681 Z-score: 1809.7 E(): 6.5e-93
FT                   Smith-Waterman score: 1681; 62.189 identity in 402 aa
FT                   overlap."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0625"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08641"
FT                   /inference="similar to sequence:UniProtKB:CLPX_BACHD"
FT                   /protein_id="CAL08641.1"
FT                   /translation="MAKILYCSFCGKSQQEVKNIISGRDGNICNECVSKCAEKIRSTGS
FT                   TSAEDISFEKLPKPVEIKKYLDDYIIGQDNAKKVLSVAVYNHYKRITSNLTKDDDTELK
FT                   KSNVLLIGPTGSGKTLFAQTLAKLLNVPFAIADATTLTEAGYVGDDVENIIVRLLQNAD
FT                   FDVAKAQKGIIYIDEIDKIARKSESTSITRDVSGEGVQQALLKLIEGTVSSVPPKGGRK
FT                   HPNQDMIQVDTSDILFICGGAFAGIEKVIKHRMDKVSIGFNSDVIQQKNSLDSDKLMQK
FT                   IESEDLTRFGLIPELIGRLPIVTVLNELKEEDLVRILTEPKNALIKQYIKLFKFDNVNI
FT                   EFTDQALVEIAKKAITKKTGARGLRTILENVLLEVMFHIPSSEDIEKVIINDKVILEQQ
FT                   EPILATKTQQQKQLKDII"
FT   CDS_pept        644599..646923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lon"
FT                   /locus_tag="FTF0626"
FT                   /product="DNA-binding, ATP-dependent protease La"
FT                   /EC_number="3.4.21.53"
FT                   /note="Similar to Q8Z8V0 Lon protease from Salmonella typhi
FT                   (784 aa). FASTA: opt: 2734 Z-score: 2797.3 E(): 6.4e-148
FT                   Smith-Waterman score: 2734; 54.450 identity in 764 aa
FT                   overlap."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0626"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08642"
FT                   /inference="similar to sequence:UniProtKB:Q8Z8V0"
FT                   /protein_id="CAL08642.1"
FT                   /translation="MSESLNVVPVIPLRDVVIYPSMTLPLNVGRKKSIEAVKQASNNYN
FT                   NYILLATQKNGSSGGDVVENIYDIATLAKVVQIMKLPDGSLKIIVEGIAKRLVAKYEDI
FT                   DGCIYANLDSLHIDDNYDPSQVDKELKAILLSVSDSLKRFVDISGRVSKESLATLINME
FT                   EPHKFIYEIATILNTEIAKKQKILEATDIKNKALLLLSYLYEELEILELEAKIKDRVKA
FT                   QVDKNQREYYLNEQVKAIYKELGEADEESEVSALKKRIEHTKMSKEAKEKCLKELKKLK
FT                   AMPPSSSESAVSRNYIETILSLPWGKRAKVKRDINLAEKVLEKDHYGIKKVKERILEHL
FT                   AVQIKRDSNTKAPILCLVGPPGVGKTSIGQSIARATGREYVRMALGGVRDESEIRGHRR
FT                   TYIGSMPGQIIQKIIKSKTENPLFLLDEIDKISSDFRGDPSAALLEVLDPEQNSTFNDH
FT                   YLEIDYDLSKVMFVATANSLDIDPALRDRLEIINLSGYTEIEKQAIAKQYLIPKALENN
FT                   GLTKDEINFTPKAILDIIRYYTREAGVRNLQQKIDGVCRKAVKNLLKDSNTGKISITQK
FT                   NLEDYLGVHQYDYGVKNAKAKVGQVTGLAWTSVGGELLTIEALAMPGKGKVKYTGSLGD
FT                   VMKESIDAAFSVVRSMSKDYKLEDDFYEKKDIHIHVPEGATPKDGPSAGIAMTTALVSV
FT                   YTNKPVRNDVAMTGEVTLRGEVLAIGGLKEKLLAALRGGIKEVLIPKQNVKNLADVDKE
FT                   ILEKLEITPVSSIKEVLERVF"
FT   CDS_pept        647010..647282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupB"
FT                   /locus_tag="FTF0627"
FT                   /product="Histone-like protein HU form B"
FT                   /note="Similar to Q93TM3 Histone-like protein HU form B
FT                   from Pseudomonas putida (strain KT2440) (90 aa). FASTA:
FT                   opt: 380 Z-score: 519.0 E(): 5.2e-21 Smith-Waterman score:
FT                   380; 68.539 identity in 89 aa overlap."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0627"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08643"
FT                   /inference="similar to sequence:UniProtKB:Q93TM3"
FT                   /protein_id="CAL08643.1"
FT                   /translation="MNKSELVSAIAKEADVTKEVASNTLDATIAAVTKALKNGDSVTLV
FT                   GFGTFQVKERSPREGRNPKTGETIKIPASKVPSFKASKGLKDAVK"
FT   CDS_pept        647394..648824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0628"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to PPID_BUCAP (Q8K987) Peptidyl-prolyl
FT                   cis-trans isomerase from Buchnera aphidicola (subsp.
FT                   Schizaphis graminum) (621 aa). FASTA: opt: 298 Z-score:
FT                   309.1E(): 2.5e-09 Smith-Waterman score: 298; 23.362
FT                   identity in 351 aa overlap. 200 aa shorter (in C-term) than
FT                   most of the homologs. ORF ftt0628"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0628"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08644"
FT                   /inference="similar to sequence:UniProtKB:PPID_BUCAP"
FT                   /protein_id="CAL08644.1"
FT                   /translation="MLQSFNDRLKGPFTWIVVISISFIFVISGMTFFFTNIGSRAYVAK
FT                   VGDNEISSQQFQQYAQSATTEEQKRAILSQMIDQYLILADAQRHDIVVSKLALQSAIFT
FT                   NPMFFDKDGKFSAEKLKQVVAYLGGMDKLEQILAQNIQATIIPKTIVDTSIVIDYDTKL
FT                   LNSIYSVNKYIDYLKVSPTDFKSQIKPSQQDLQSYYDSHKNEYITPAQKTISYFIITKD
FT                   NFVLKNKISEDEIKAYYQAHKELFKDFDNNAKSTIQKIIQNRHALEQFNEYTQNIDSIK
FT                   YTKLEKQFGKAKTATIVDNNDTTINNVANSQFFINSDKYATITIADNKLLVYQVDNSIK
FT                   ATQQKLADIKDKISKAYIEQKSQQFALQHAQNLLNDLTSGKKIDKSFKQATINSDSQAF
FT                   GKDFNDYVMFNSNNQYHDYKTDSGDIYIYKVTKIEPITDKTTQVPSQVIDAYKQEELNF
FT                   YLRVIKQQIPIQVNYKNI"
FT   CDS_pept        648825..649751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaA"
FT                   /locus_tag="FTF0629"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /EC_number="2.5.1.8"
FT                   /note="Similar to MIAA_NEIMA (Q9JUU5) tRNA
FT                   delta(2)-isopentenylpyrophospate transferase from Neisseria
FT                   meningitidis (serogroup A) (313 aa). FASTA: opt: 935
FT                   Z-score: 1078.5 E(): 3.5e-52 Smith-Waterman score: 935;
FT                   50.523 identity in 287 aa overlap."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0629"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08645"
FT                   /db_xref="GOA:Q14IJ4"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14IJ4"
FT                   /inference="similar to sequence:UniProtKB:MIAA_NEIMA"
FT                   /protein_id="CAL08645.1"
FT                   /translation="MSKLIYGLAGPTASGKTSLSILLAKKINAEIISVDSSLVYKGMDI
FT                   GTAKPTLQEQDGIKHHLIDIIEPTGNFSVADFISSVNKLKKEIWARGREVLLVGGTMLY
FT                   FKGLIEGLSALPESQAEIREALEYQKKAKGLQYLHQQLNEIDPQSAQKINPNDQQRIFR
FT                   ALEVIMISGKKYSELVKTSKVGGLDEDLKLCALVPNDRSILHKNIESRFRQMLDQGFLD
FT                   EVQNLHKNPMLTKETTAIRSVGYRQAWEYLDGDISYDEFVKKGIVATRQLAKRQLTWIR
FT                   NWQSSINIVAMENETKELDILKYFGYK"
FT   CDS_pept        649862..650191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hfq"
FT                   /locus_tag="FTF0630"
FT                   /product="host factor I for bacteriophage Q beta
FT                   replication"
FT                   /note="Similar to HFQ_PASMU (Q9CMC6) Hfq protein from
FT                   Pasteurella multocida (95 aa). FASTA: opt: 384 Z-score:
FT                   504.4 E(): 3.3e-20 Smith-Waterman score: 384; 68.182
FT                   identity in 88 aa overlap. Plays a role in degradation of
FT                   RNA transcripts."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0630"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08646"
FT                   /db_xref="GOA:Q14IJ3"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14IJ3"
FT                   /inference="similar to sequence:UniProtKB:HFQ_PASMU"
FT                   /protein_id="CAL08646.1"
FT                   /translation="MSRISSLQDPFLNALRKEKVSVSVYLVNGIKLQGQVEAFDQFCIV
FT                   LRNTVNQMVYKHAISTIVPAKSVRMIYNSFNPYHQNSNDEQDENVDDIHSDDLEIQENE
FT                   GNIHE"
FT   CDS_pept        650243..651550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflX"
FT                   /locus_tag="FTF0631"
FT                   /product="protease, GTP-binding subunit"
FT                   /note="Similar to Q87VJ5 GTP-binding protein HflX from
FT                   Pseudomonas syringae (pv. tomato) (433 aa). FASTA: opt:
FT                   1331 Z-score: 1520.3 E(): 8.6e-77 Smith-Waterman score:
FT                   1331; 49.302 identity in 430 aa overlap. Together with
FT                   HflC-HflK involved in stability of phage lambda cII
FT                   repressor"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0631"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08647"
FT                   /inference="similar to sequence:UniProtKB:Q87VJ5"
FT                   /protein_id="CAL08647.1"
FT                   /translation="MEFFQSYQAGSKCLLVNINFKYHRELNADLTELEGLVIAAEKVVL
FT                   QSLDFNHPEPDIKYFCGMGKIEMIKNKRDELEADLVVFNHPLTPSQERNIEKFLECRVM
FT                   DRTRLILEIFSLRAKTYEGKLQVELAQLNYQSTRLVKGWTHLERQKGGIGVRGGPGETQ
FT                   LEIDRRLIRQRIKQIAQKLEKVKHHRDLSRSSRKKNNIPTISFVGYTNAGKSTLFNKIT
FT                   NADVLAKDQLFATLDPTLRKVIVPKLGEVIFSDTVGFIKNLPHNLVEAFHATLEEAIES
FT                   DLLVHVIDYADEDHKSYIEQVEKVLSEIGIADKETICVYNKIDKLENIKPSFVPLEDSD
FT                   SSVVSRVYLSAQNGDGLVEFYQALATFFNKTWINQTLYLPPKYSKVRAKMYELGVIDKE
FT                   EISEHGNYLLQIKISQDDFERFKRELNLDLEEFFVK"
FT   CDS_pept        complement(651561..652751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0632c"
FT                   /product="monooxygenase family protein"
FT                   /EC_number="1.14.14.1"
FT                   /note="Similar to O53772 Putative oxidoreductase
FT                   (Monooxygenase) from Mycobacterium tuberculosis (388 aa).
FT                   FASTA: opt: 832 Z-score: 997.9 E(): 1.1e-47 Smith-Waterman
FT                   score: 832; 35.550 identity in 391 aa overlap. ORF
FT                   ftt0632c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0632c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08648"
FT                   /inference="similar to sequence:UniProtKB:O53772"
FT                   /protein_id="CAL08648.1"
FT                   /translation="MEVKNEKIAINGTGISGLTLAWWLRKYGFEPTLFEKASELRNGGY
FT                   LVDFWGPACEIMKKMGLFDQLKEKSYQIKNIHCFDENGRRSSKVNISSLITDNYDEFLS
FT                   VKRGDIAETIYKACQGIDIRFATSIDKIEEKDNHITTHLSDGTKEDFDLVIGADGLHSH
FT                   IRSLVFDKSEYQEYELDKYVAALSLKNYNHYEKYTYAISVGDKKQVARVCLDENETLVM
FT                   FIIDLSLVNNFPLTLAEKKQLLVSSFKEFKWETPDILARLTDVDEIYFDKVSQIRMDTW
FT                   YKGRIALVGDSAACPSVLMGLGSIFAIIEAYILAGELHKAKGNYHIAFEQWQNRLKDII
FT                   ARKQKVGLSNLSVAASDEIFKKYLSTITVKISSTPVISKFIGAGIFNDPIQIPEYE"
FT   CDS_pept        652923..653990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflK"
FT                   /locus_tag="FTF0633"
FT                   /product="SPFH domain, band 7 family protein"
FT                   /note="Similar to Q8FAK7 HflK protein from Escherichia coli
FT                   (419 aa). FASTA: opt: 843 Z-score: 932.9 E(): 4.5e-44
FT                   Smith-Waterman score: 843; 40.0 identity in 330 aa overlap.
FT                   With HflC, part of modulator for protease specific for FtsH
FT                   phage lambda cII repressor."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0633"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08649"
FT                   /inference="similar to sequence:UniProtKB:Q8FAK7"
FT                   /protein_id="CAL08649.1"
FT                   /translation="MIKKLKQKWFWSKNSEQGPPDLEEMIKRFFGKKNKTDNDDNESIY
FT                   SKNANKKQSTFNKPPIAKIVTIIVALLIVAWVGFGFYVVQPAEQAIVLRLGKFSKLVEP
FT                   GLHWHPLGVDKVYKENVQELKTISLKRDMLTSEENIVHISFTVQYRIADLEKYLFANTN
FT                   PTLLLQQALESAVRQVVGENKLEQILTTNRAVITQQVRKEMEALLEKYNSGIYVSEVIM
FT                   QPAQAPDAVKSAFDDVIKAREDREREQNEAEAYANRVVPVAQGNAQRILDQANAYKQKI
FT                   VLEAQGEVAQFEQLLPIYKQSPDIVMNQMYFNTISNVLQHNKIFLIDGDGAKNIFYGLS
FT                   DTQKQALLSNTQGGN"
FT   CDS_pept        653992..654918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflC"
FT                   /locus_tag="FTF0634"
FT                   /product="SPFH domain, band 7 family protein"
FT                   /note="Similar to Q8EJ66 HflC protein from Shewanella
FT                   oneidensis (297 aa). FASTA: opt: 799 Z-score: 895.3 E():
FT                   5.6e-42 Smith-Waterman score: 799; 42.466 identity in 292
FT                   aa overlap. With HflK, part of modulator for protease
FT                   specific for FtsH phage lambda cII repressor."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0634"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08650"
FT                   /inference="similar to sequence:UniProtKB:Q8EJ66"
FT                   /protein_id="CAL08650.1"
FT                   /translation="MSKFLKIFLVLVVVLAIVVLSTKFIVKQGSEAVILRLGELVKDKD
FT                   GKAVEYEPGLHIKIPFIDTVKMYDMRNRVLEADSARVVTKEQKDVLINAYVVWKISNNN
FT                   ISTFYTSTSGSVDRAETLLKQFLESSLRAEVGNNDIQSLINNNRDKLMIALTKSVQQQA
FT                   KQIGVDVIDVRVKQIDLPETVTDSIYQRMRSSRQKVAASIRAEGKQLAEKIKAAADAKV
FT                   TVTLAEAEKESKTIMAEADAKAAKIFTQAYSKSVPLYEFLKSMNSYKESFNGKNEVVFM
FT                   LKPDSKFFQGFKLEPNSKLAEDMKEAK"
FT   CDS_pept        654919..655404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wzb"
FT                   /locus_tag="FTF0635"
FT                   /product="low molecular weight (LMW) phosphotyrosine
FT                   protein phosphatase"
FT                   /EC_number="3.1.3.48"
FT                   /note="Similar to O35016 YFKJ protein from Bacillus
FT                   subtilis (156 aa). FASTA: opt: 391 Z-score: 494.5 E():
FT                   1.2e-19 Smith-Waterman score: 391; 38.608 identity in 158
FT                   aa overlap."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0635"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08651"
FT                   /inference="similar to sequence:UniProtKB:O35016"
FT                   /protein_id="CAL08651.1"
FT                   /translation="MSKVKVLFVCKGNICRSPTAHGIFRDIVKQYNLESHIDVASCGTS
FT                   SRMWGHEGHGADMRTLEMAKKYDCDLSDQVSQQLEEAAFDEYDYIVAMDQENIDTMKEM
FT                   FPNADFSKVSRMLEYAPAIALDDVPDPYFENNFEKVFLMIDTACQGFFEKIRLEYKL"
FT   CDS_pept        655401..655994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="engB"
FT                   /locus_tag="FTF0636"
FT                   /product="ATP/GTP-binding protein"
FT                   /note="Similar to ENGB_ECOLI (P24253) Probable GTP-binding
FT                   protein engB from Escherichia coli (210 aa). FASTA: opt:
FT                   707 Z-score: 877.8 E(): 5.3e-41 Smith-Waterman score: 707;
FT                   55.330 identity in 197 aa overlap."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0636"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08652"
FT                   /db_xref="GOA:Q14II7"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14II7"
FT                   /inference="similar to sequence:UniProtKB:ENGB_ECOLI"
FT                   /protein_id="CAL08652.1"
FT                   /translation="MNYSKAKYIMGAAKVSQLPEDTGVEVAFAGRSNAGKSSALNTLTD
FT                   QKGLARVSKTPGRTQLINLFDLGNNNRLVDLPGYGYAKVSESIKRQWQSEMENYLTSRK
FT                   CLNGIVLLVDLRHELKEFDSLMIEMAISFDLNLHILLTKADKLNNKERAQANRMIESFL
FT                   KTFVSTDKISYQLFSSLTKMGLDKFKEKLDTWYQ"
FT   CDS_pept        join(656137..656499,656501..656878,656881..657453)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrC2"
FT                   /locus_tag="FTF0637"
FT                   /product="threonine synthase, pseudogene"
FT                   /EC_number="4.2.3.1"
FT                   /note="Similar to THRC_METJA (Q58860) Probable threonine
FT                   synthase (405 aa). FASTA: opt: opt: 987 Z-score: 1131.2
FT                   E(): 3.7e-55 Smith-Waterman score: 987; 44.875 identity in
FT                   361 aa overlap. Contains 2 frameshifts after aa 121 and
FT                   247"
FT                   /db_xref="PSEUDO:CAL08653.1"
FT                   /inference="similar to sequence:UniProtKB:THRC_METJA"
FT   CDS_pept        657431..657781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0638"
FT                   /product="hypothetical protein"
FT                   /note="Putative fragment. Weak similarity to leuA
FT                   LE12_METJA (Q58595) 2-isopropylmalate synthase 2 from
FT                   Methanococcus jannaschii (518 aa). FASTA: opt: 119 Z-score:
FT                   151.8 E(): 1.5 Smith-Waterman score: 119; 26.316 identity
FT                   in 114 aa overlap (6-115:356-467). Next downstream ORF also
FT                   has similarity to leuA. ORF ftt0638"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0638"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08654"
FT                   /protein_id="CAL08654.1"
FT                   /translation="MVNFFGANYDKSFVAKVRELIERFLVKSKSINVSDIQDIIQDATE
FT                   MADAVSKDVLDVKSFKVKVELDQKSVAEVTVKVAEQLYFASSSSVGPVDAVLNALYKAC
FT                   PSDISYNLTAIK"
FT   CDS_pept        657823..657933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0639"
FT                   /product="hypothetical protein"
FT                   /note="Putative fragment. Weak similarity to leuA
FT                   LE12_METJA (Q58595) 2-isopropylmalate synthase 2 from
FT                   Methanococcus jannaschii (518 aa). FASTA: opt: 86 Z-score:
FT                   142.0 E(): 5.1 Smith-Waterman score: 86; 50.000 identity in
FT                   32 aa overlap (1-32:479-510). Next upstream ORF also have
FT                   similarity to leuA. ORF ftt0639"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0639"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08655"
FT                   /protein_id="CAL08655.1"
FT                   /translation="MSLEKEGIKSIGKAVSPDIIQASVEAFIDAYNIAYA"
FT   CDS_pept        657957..659612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="FTF0640"
FT                   /product="Dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="Similar to CAD77389 Dihydroxy-acid dehydratase from
FT                   Rhodopirellula baltica (587 aa). FASTA: opt: 2464 Z-score:
FT                   2877.4 E(): 2.2e-152 Smith-Waterman score: 2464; 65.814
FT                   identity in 547 aa overlap. 30 aa shorter in the N-terminal
FT                   than the homologs."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0640"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08656"
FT                   /db_xref="GOA:Q14II4"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14II4"
FT                   /inference="similar to sequence:INSDC:CAD77389"
FT                   /protein_id="CAL08656.1"
FT                   /translation="MKKVLNKYSRRLTEDKSQGASQAMLYGTEMNDADMHKPQIGIGSV
FT                   WYEGNTCNMHLNQLAQFVKDSVEKENLKGMRFNTIGVSDGISMGTDGMSYSLQSRDLIA
FT                   DSIETVMSAHWYDGLVSIPGCDKNMPGCMMALGRLNRPGFVIYGGTIQAGVMRGKPIDI
FT                   VTAFQSYGACLSGQITEQERQETIKKACPGAGACGGMYTANTMACAIEALGMSLPFSSS
FT                   TSATSVEKVQECDKAGETIKNLLELDIKPRDIMTRKAFENAMVLITVMGGSTNAVLHLL
FT                   AMASSVDVDLSIDDFQEIANKTPVLADFKPSGKYVKANLHAIGGTPAVMKMLLKAGMLH
FT                   GDCLTVTGKTLAENLENVADLPEDNTIIHKLDNPIKKTGHLQILKGNVAPEGSVAKITG
FT                   KEGEIFEGVANVFDSEEEMVAAVETGKVKKGDVIVIRYEGPKGGPGMPEMLKPTSLIMG
FT                   AGLGQDVALITDGRFSGGSHGFIVGHITPEAYEGGMIALLENGDKITIDAINNVINVDL
FT                   SDQEIAQRKSKWRASKQKASRGTLKKYIKTVSSA"
FT   CDS_pept        join(659750..661030,661030..661470)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvB"
FT                   /locus_tag="FTF0641"
FT                   /product="acetolactate synthase, large subunit
FT                   (pseudogene)"
FT                   /EC_number="2.2.1.6"
FT                   /note="Similar to Q8A609 Acetolactate synthase large
FT                   subunit from Bacteroides thetaiotaomicron (565 aa). FASTA:
FT                   opt: 1850 Z-score: 2038.0 E(): 1.1e-105 Smith-Waterman
FT                   score: 1850; 50.089 identity in 559 aa overlap. Contains a
FT                   frameshift after aa 427"
FT                   /db_xref="PSEUDO:CAL08657.1"
FT                   /inference="similar to sequence:UniProtKB:Q8A609"
FT   CDS_pept        661475..661792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvH"
FT                   /locus_tag="FTF0642"
FT                   /product="acetolactate synthase, small subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="Similar to Q8A610 Acetohydroxyacid synthase small
FT                   subunit (187 aa). FASTA: opt: 159 Z-score: 221.3 E():
FT                   0.0002 Smith-Waterman score: 159; 33.333 identity in 75 aa
FT                   overlap."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0642"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08658"
FT                   /inference="similar to sequence:UniProtKB:Q8A610"
FT                   /protein_id="CAL08658.1"
FT                   /translation="MSENIYFITMNTENTLCVLQRISSVLSRNRINIEQLTVFETANKG
FT                   ISHFNLVVHSTQDKIEKIVRKLANVIEVIDISITNCLPMQGTVVSEVPQNVKTASQRKA
FT                   A"
FT   CDS_pept        join(661820..661930,661932..662864)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvC"
FT                   /locus_tag="FTF0643"
FT                   /product="Ketol-acid reductoisomerase, pseudogene"
FT                   /EC_number="1.1.1.86"
FT                   /note="Similar to Q847R5 Ketol acid reductoisomerase
FT                   mitochondrial from Aster yellows phytoplasma (344 aa).
FT                   FASTA: opt: 1145 Z-score: 1365.8 E(): 3.5e-68
FT                   Smith-Waterman score: 1448; 62.391identity in 343 aa
FT                   overlap. Contains a frameshift after aa 37 and an in-frame
FT                   stop codon after aa 74"
FT                   /inference="similar to sequence:UniProtKB:Q847R5"
FT   CDS_pept        complement(662987..666412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="FTF0644c"
FT                   /product="Transcription-repair coupling
FT                   factor,ATP-dependent"
FT                   /note="Similar to Q9CM06 Mfd from Pasteurella multocida
FT                   (1145 aa). FASTA: opt: 3312 Z-score: 3697.7 E(): 4.5e-198
FT                   Smith-Waterman score: 3312; 44.794 identity in 1143 aa
FT                   overlap."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0644c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08660"
FT                   /inference="similar to sequence:UniProtKB:Q9CM06"
FT                   /protein_id="CAL08660.1"
FT                   /translation="MLNNQISANDTVVSNAYGSAFSILFNEYLKQNNQFNLIVTEDSQQ
FT                   AHKIYKELKYLNKNNSKVDILFFPNLEILPYDRFSASIDIISRRQEILYKMTHQPQKTL
FT                   IITSISNTLRKIAPASFIQKHSFILKTGDNLDITKYKMLLTEAGYTLVNNVFEKGEFSI
FT                   RGSIIDIYPIGSKVAFRIDLFDNEIDSIKELNTESQRSGNQIQSINIMPSHELVYNNQN
FT                   TTFALDKLNKLCGDKALNSTIATYIQNNEYFSGIEFYLPLFYDKLSSLYDYLPPSTNIH
FT                   LVDNITNSIEAFSDEVKFRYNELKHDSDRPILPFQEIFYSQQEIQDIYQQYKNIKWFQQ
FT                   PKSKSKILKVDHLEKISANYKLANPFKDLQQFIDKSNFDKVIFSTDSNGRAELLLEHLN
FT                   KLNLNIQSCKNFNEAIEVSAKFCLIISPFQEGMIIDKKIALITEADLFPEHGYNSTKVS
FT                   QHDHHPTVDLKDLTDLKPGMHVVHIDHGIGRYEGLESIELNGKKDEFILLRYANDAKIY
FT                   VPITSLNLISIYNSSLTEKIALNKLGTDKWKKQKEKTIKKIIDVAANLLEIYAKREMRQ
FT                   GFSNSLDEEEYLRFCADFPYEETPDQLSAINDVFKDMISAKPMDRLICGDVGFGKTEIA
FT                   MRAAFLATQNQKQVAILVPTTILAQQHYNSFKDRFTNTAFNIEVITRSKTPKAQQQLFE
FT                   DLKKGTIDIIIGTHKLISSKIDFKNLGLLIIDEEHRFGVAQKEKLKSLKAEIDILTMSA
FT                   TPIPRSLSMAFSALRDLSIIASPPAKRLSVKTFVKEYDNNIIREAVSRETIRGGQIFYL
FT                   YNKVETIQKKKEILQELFPRLRIAIAHGQMSEKEIQKVMFDFKHNKYHILLCTTIIETG
FT                   IDIPNANTLIIEDANNLGLAQLHQLRGRVGRSHHQAYAYMLIPNEASITKDALKRLEAI
FT                   SNTESLGGGFTLANHDLEIRGAGEILGEEQSGNIDGIGLNLYMDLLDKTIANLRAGKKL
FT                   NIEEVINSTVCEVELNIPTLIPDYYIYDVNTRLNIYKRISKASHQDLVNIKIELIDRFG
FT                   KLPLEVLYLLKVAHIKIDAIALGISQIKMFATSGKISFSNNTKFEPQKLIKLIQSQPSD
FT                   FRLTKEHDLIITKVTKTAEQRIEFIENFLKKIVQ"
FT   CDS_pept        complement(666457..667143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0645c"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="Similar to YCCA_ECOLI (P06967) Hypothetical protein
FT                   yccA from Escherichia coli (219 aa). FASTA: opt: 588
FT                   Z-score: 603.2 E(): 1.1e-25 Smith-Waterman score: 588;
FT                   48.416 identity in 221 aa overlap. ORF ftt0645c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0645c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08661"
FT                   /inference="similar to sequence:UniProtKB:YCCA_ECOLI"
FT                   /protein_id="CAL08661.1"
FT                   /translation="MNNLQNNTRVIDSLSQESVLRANKVLRNTYWLLSMTLLFSAFTAF
FT                   IAMSTGATIMNPLLMLVVYIGLLFGINATKNSPWGIVLTFALTGLLGYSLGPILNMYLT
FT                   MFKNGAELIMMAFGTTGLIFLGLSVVAMSPARNFNRLGSFCAIGAIVALVALVINIFLQ
FT                   LPALALVISLVFAFISGGFILWQTNAIVRGEETNYILATVNIYVSLFNIFVTLLQIFGA
FT                   VAGDRE"
FT   CDS_pept        complement(667259..668518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0646c"
FT                   /product="hypothetical membrane protein"
FT                   /note="ORF ftt0646c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0646c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08662"
FT                   /protein_id="CAL08662.1"
FT                   /translation="MRNSIKISKVNINFNQPKGLHIIAFMIFCLCLCIAPFMTILNGYG
FT                   NINFFYNRNDHLFVIFFAGIFGCISNYIFGSTKSIIHGLQFIIVAIVLSFIHNMVLFSC
FT                   ATLWIGLAIVIVNLLFNLSAFYLKTDIRRIYGFIGVYSSALLGIATGIIIYFLVLKNMY
FT                   HFKILYLLIIIFLLLFFLKNSYKLNTSLTSQTERINISFYGVLLIFFIFAFILFYLLVN
FT                   LNVFSSLNLVILPLSLIYLHVITVTNNKENGKNLLKYIYFSLTLIVINKIFYLSFLRYE
FT                   DVVDPIYLNSAISTFLFLLAEYLLCIIIYFGWRFKFITLRIESITNSHIIKTMLYIEAI
FT                   RVFILITAIFTNNILISNIILIFATILSLVLNIFIVPIYFSLGKILAGGKNEIITTTLL
FT                   YLIFSSLILVSFLYDISISL"
FT   CDS_pept        complement(668518..668949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0647c"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Q82WE7 Hypothetical protein from
FT                   Nitrosomonas europaea (164 aa). FASTA: opt: 383 Z-score:
FT                   490.4 E(): 2e-19 Smith-Waterman score: 383; 41.606 identity
FT                   in 137 aa overlap. ORF ftt0647c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0647c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08663"
FT                   /inference="similar to sequence:UniProtKB:Q82WE7"
FT                   /protein_id="CAL08663.1"
FT                   /translation="MILSQDRYQLRKLFIDSWNKFVNNTPLTALEEQIARIIELHPEYH
FT                   KQITLENIDKDYLPEVGQINPFLHISLHLAIIEQIQTNRPFGISNVYQQLLGKYNNDEH
FT                   KVHHIMIDYLAEEMWKSQKYNTLPDEQNYLTKLQELTLI"
FT   CDS_pept        complement(668946..669584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nth"
FT                   /locus_tag="FTF0648c"
FT                   /product="Endonuclease III"
FT                   /EC_number="4.2.99.18"
FT                   /note="Similar to Q9HYB4 Endonuclease III from Pseudomonas
FT                   aeruginosa (212 aa). FASTA: opt: 916 Z-score: 1153.9 E():
FT                   2.2e-56 Smith-Waterman score: 916; 67.308identity in 208 aa
FT                   overlap."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0648c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08664"
FT                   /inference="similar to sequence:UniProtKB:Q9HYB4"
FT                   /protein_id="CAL08664.1"
FT                   /translation="MNKQKRIQIFETWKQNDPKPTTELEYTSNFELLIAVILSAQATDV
FT                   GVNKATKVLFKVANTPEQIYALGEQKLAEYIKSIGLYKTKAKNVIATCKDLIEKFGSIV
FT                   PDNFDDLISLAGVGRKTANVVLNTAFGKPTMAVDTHIFRLANRIPLAKGKNVNEVEKKL
FT                   LRVIPKEYLHDAHHWIILHGRYICTAQRPRCRNCIIYDYCEFKDKEKYR"
FT   CDS_pept        complement(669577..670206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnfB"
FT                   /locus_tag="FTF0649c"
FT                   /product="Iron-sulfur cluster-binding protein"
FT                   /note="Similar to Q83B23 4Fe-4S binding domain protein from
FT                   Coxiella burnetii (213 aa). FASTA: opt: 552 Z-score: 680.7
FT                   E(): 5e-30 Smith-Waterman score: 552; 42.788 identity in
FT                   208 aa overlap."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0649c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08665"
FT                   /inference="similar to sequence:UniProtKB:Q83B23"
FT                   /protein_id="CAL08665.1"
FT                   /translation="MIISIEAIDKVLPQIQCQKCTYPDCYSYAKAITNGEKHNKCITGG
FT                   EKTLKELAKLLNKPEIPLDSSLGQEKPRAVAKIDESMCIGCEKCLLACPVDAIVGAKKL
FT                   MHTIIEAECTGCELCVEPCPMDCISLVDLAADKQPNNLTNHAYTTQKNHYRDRYEYHKQ
FT                   RVSQTKAKQRDVYKNIATAQEIDKKAYIAASLAKFRNKKKSSPTNE"
FT   CDS_pept        complement(670208..670852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grxB"
FT                   /locus_tag="FTF0650c"
FT                   /product="Glutaredoxin 2"
FT                   /note="Similar to Q9CNB4 Grx2 from Pasteurella multocida
FT                   (215 aa). FASTA: opt: 412 Z-score: 518.8 E(): 5.3e-21
FT                   Smith-Waterman score: 412; 32.243 identity in 214 aa
FT                   overlap."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0650c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08666"
FT                   /inference="similar to sequence:UniProtKB:Q9CNB4"
FT                   /protein_id="CAL08666.1"
FT                   /translation="MKIYLYHHCPYCIKVRLVADLSNFDYQMIILANDDEKAHIDRIGS
FT                   KQVPFLEKDDGTFIKESDEICKFIAKVQNFEIAESTIDDFVKGCITDLEPHYRRIIYPR
FT                   IPHHPRNECDFPTQSAKEYFINKKSQYIGDFDALLRNPPYDSIRAINQILAKIDPFIKT
FT                   PFINSEKFSWDDINIFPIFFILTMSKDLLEIPTNITNYIKNIEAKTNIELY"
FT   CDS_pept        670914..672482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0651"
FT                   /product="Proton-dependent oligopeptide transport (POT)
FT                   family protein"
FT                   /note="Similar to Q9L9P6 IraB from Legionella pneumophila
FT                   (501 aa). FASTA: opt: 1486 Z-score: 1640.1 E(): 1.8e-83
FT                   Smith-Waterman score: 1486; 46.708 identity in 486 aa
FT                   overlap. ORF ftt0651"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0651"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08667"
FT                   /inference="similar to sequence:UniProtKB:Q9L9P6"
FT                   /protein_id="CAL08667.1"
FT                   /translation="MFKQSTIVLKSTKFAKFLFLSRKKDISIKLNTMFKDLKSKQSFTI
FT                   VAITFWGQFATYSFNAILILYLTRSVLDYGIGFSESHAYSFQGIYKAMNYAIIMFGGYI
FT                   ADRYLGLRRSIFWGSLLLAFAYLAVFLSGFMVHFSDEFFIFAFALVPVCGSLQLGTASA
FT                   MVSKIYSDNPVHAKSGMTMFYISINLGSLLAYLVAPSLIGYQFGALAVLSVVFIGKLLA
FT                   IINFSYRYKIYDNVVDEIDKKPMTSIAKKVVLGYLAIVYVFTVICYHYPDYANVVVAVI
FT                   SMFCLLLFLLRTIFFLKDDVHIKQIVGLILIVVAVVFFVIYNQMESTLVMAAKNNSDLL
FT                   MFGFKVNAASYQIVNPILIIFGGMLLIRIYPMFPRFYIPYQFAVGVLLAAAGLFIMYYG
FT                   FSIDNNGIVSGNYITLSYVLISISELFVSAIGLSMIGIYCDSKTIGFAMEAWYISSSMA
FT                   NSITGLLNQVVALPKDGVSALESANMYKTYFFDTSLSVMLIGILVLILAYFLIKFMKIR
FT                   NIDFV"
FT   CDS_pept        complement(672485..672982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftnA"
FT                   /locus_tag="FTF0652c"
FT                   /product="Ferritin-like protein"
FT                   /note="Similar to Q899N4 Ferritin from Clostridium tetani
FT                   (169 aa). FASTA: opt: 527 Z-score: 679.5 E(): 5.9e-30
FT                   Smith-Waterman score: 527; 45.783identity in 166 aa
FT                   overlap."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0652c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08668"
FT                   /inference="similar to sequence:UniProtKB:Q899N4"
FT                   /protein_id="CAL08668.1"
FT                   /translation="MISKRLLYALNDQFNYELESANIYLAMAGYTADLGLGGFTNWFMA
FT                   QYEEELFHAKKIMKFISDKNGRIEVKSVAAPQNNFNSLLEVFQATLVHKQEVSTRFYDL
FT                   MNIALEEKEHSTKSFLQWFIDEQVEEATVGDMINKIKFVKDSGLYLLDQEAAKRNFNAP
FT                   SL"
FT   CDS_pept        673189..674172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipA"
FT                   /locus_tag="FTF0653"
FT                   /product="lipoic acid synthetase"
FT                   /note="Similar to LIPA_DEIRA (Q9RWA4) Lipoic acid
FT                   synthetase from Deinococcus radiodurans (331 aa). FASTA:
FT                   opt: 1208 Z-score: 1395.2 E(): 8e-70 Smith-Waterman score:
FT                   1208; 58.163 identity in 294 aa overlap."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0653"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08669"
FT                   /db_xref="GOA:Q14IH3"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14IH3"
FT                   /inference="similar to sequence:UniProtKB:LIPA_DEIRA"
FT                   /protein_id="CAL08669.1"
FT                   /translation="MKEISGIKVKVESGSKYTTDHGFHAVKDGIRNKKENAVHVRKPDW
FT                   LKVQKQDSKEYLKVKSITKKHKLSTVCEEARCPNINECWSHGTATIMLMGSVCTRACKF
FT                   CSVDTGNPKGWLDKDEPMNAAESVKLMGLEYVVLTSVDRDDLEDGGAGHYAATITAIKN
FT                   LDENIKVEALTPDFAGINENIDKIINTKVDVIAQNIETVERLTHPVRDPRAGYWQTLNF
FT                   LKYVKQKSPNVLTKTSIMVGLGETDEEIYKTMDDARSVGVDIITLGQYMQPTKHHLSVE
FT                   RFVTPQQFEEYRKVGLEKGFLEVASGPMVRSSYRADRVFKRNNLDL"
FT   CDS_pept        674202..674861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="elbB"
FT                   /locus_tag="FTF0654"
FT                   /product="DJ-1/PfpI family protein"
FT                   /note="Similar to Q87IN9 Sigma cross-reacting protein 27A
FT                   from Vibrio parahaemolyticus (216 aa). FASTA: opt: 683
FT                   Z-score: 873.4 E(): 9.3e-41 Smith-Waterman score: 683;
FT                   49.074 identity in 216 aa overlap."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0654"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08670"
FT                   /inference="similar to sequence:UniProtKB:Q87IN9"
FT                   /protein_id="CAL08670.1"
FT                   /translation="MAKVAVVLSGCGYLDGSEIHETVLTILALEKQGVEWQGVALNRDQ
FT                   KQVINHLHQSVDSKASPRNILEESARITRGNVIDIADADSDDYDAIIFPGGFGAAKNIM
FT                   DFAFVGDDSYQMDEEVLKFARAFYLADKPAGYICIAPLMIPLVYPEGTKATVGTDENTT
FT                   AILAKKGAEAIIMDATDICVDESVKIVSTPAYMCARNILEAAQGIEKLVEKVVSYI"
FT   CDS_pept        674877..675623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0655"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to YO32_SHEON (Q8EEF0) Hypothetical UPF0082
FT                   protein SO2432 from Shewanella oneidensis (248 aa). FASTA:
FT                   opt: 1090 Z-score: 1308.8 E(): 5.2e-65 Smith-Waterman
FT                   score: 1090; 64.516 identity in 248 aa overlap. ORF
FT                   ftt0655"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0655"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08671"
FT                   /db_xref="GOA:Q14IH1"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14IH1"
FT                   /inference="similar to sequence:UniProtKB:YO32_SHEON"
FT                   /protein_id="CAL08671.1"
FT                   /translation="MAGHSKWANIKHKKAKEDAKRGKIFTKLIREITVAARLGGGDKDA
FT                   NPRLRAAIATALANNMSKDTIERAVVKGAGGDESANVEEVRYEGYGPGGVAIIVDCMTD
FT                   NRNRTVGEVRHAFTKSGGNLGTDGSVAYMFTKRGIISFAPGVDEDALMEVALEAGAEDI
FT                   ITHEDGSIDVYTDPHDFSDIQEVLIEKGFNSENAEVTFDAETKAELDTETAEKVMALID
FT                   KLEDLDDVQNVYSNANFTQELIEQIG"
FT   CDS_pept        675699..676235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvC"
FT                   /locus_tag="FTF0656"
FT                   /product="holliday junction endodeoxyribonuclease"
FT                   /EC_number="3.1.22.4"
FT                   /note="Similar to Q8EEF1 Crossover junction
FT                   endodeoxyribonuclease from Shewanella oneidensis (173 aa).
FT                   FASTA: opt: 604 Z-score: 745.1 E(): 1.3e-33 Smith-Waterman
FT                   score: 604; 56.875 identity in 160 aa overlap."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0656"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08672"
FT                   /db_xref="GOA:Q14IH0"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020563"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14IH0"
FT                   /inference="similar to sequence:UniProtKB:Q8EEF1"
FT                   /protein_id="CAL08672.1"
FT                   /translation="MVITKYYMVILGIDPGSRITGFGVIKVQDNKIYYVASGCIRITEI
FT                   TTPKRLKQIADGITQIINIYAPTEAAIEQIFMFQNPMGAIKLGQARGVAMCTLAINNLE
FT                   VSEYSAKQIKQAVVGTGGAAKSQVQHMVQSLLGLSKKPPEDAADALAIAICHYHSSKSL
FT                   AKISGASRVSQKRIK"
FT   CDS_pept        join(676308..676502,676506..677501)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0657"
FT                   /product="major facilitator superfamily (MFS) transport
FT                   protein, pseudogene"
FT                   /note="Similar to AAO90981 (Q83BM0) Major facilitator
FT                   family transporter from coxiella burnetti (428 aa). FASTA:
FT                   opt: 586 Z-score: 650.3 E(): 2.3e-28 Smith-Waterman score:
FT                   600; 27.638 identity in 398 aa overlap. Contains 2 in-frame
FT                   stop codons after aa 65 and 190 ORF ftt0657"
FT                   /inference="similar to sequence:INSDC:AAO90981"
FT   CDS_pept        677520..678173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvA"
FT                   /locus_tag="FTF0658"
FT                   /product="holliday junction DNA helicase, subunit A"
FT                   /note="Similar to RUVA_VIBPA (Q87QU8) Holliday junction DNA
FT                   helicase ruvA from Vibrio parahaemolyticus (204 aa). FASTA:
FT                   opt: 555 Z-score: 673.8 E(): 1.2e-29 Smith-Waterman score:
FT                   555; 43.192identity in 213 aa overlap."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0658"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08674"
FT                   /inference="similar to sequence:UniProtKB:RUVA_VIBPA"
FT                   /protein_id="CAL08674.1"
FT                   /translation="MMISFIKGVLIEKDPTALLIDVNGIGYEVFVPMTTFYTLGDIDSQ
FT                   VSLYTHFVVREDAQQLYGFKSKVDKKVFQELIKVNGIGARTAIAILSGMDSKTLLHCIE
FT                   NKDYALLATVPGIGKKTAERLVVEIYDKLLKMANEIYAQTSGTTTTSQDSQAQQAPTSV
FT                   VLANSIFNESVDALLALGYKQKDAEKMARSAMGDATTVAEVIRKALQGSIKSKR"
FT   CDS_pept        678199..679611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0659"
FT                   /product="DNA recombination protein RmuC family protein"
FT                   /note="Similar to Q87TH5 Conserved hypothetical protein
FT                   from Vibrio parahaemolyticus (514 aa). FASTA: opt: 1129
FT                   Z-score: 1083.4 E(): 1.9e-52 Smith-Waterman score: 1132;
FT                   42.000 identity in 450 aa overlap ORF ftt0659"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0659"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08675"
FT                   /inference="similar to sequence:UniProtKB:Q87TH5"
FT                   /protein_id="CAL08675.1"
FT                   /translation="MILAIALIMLLIIFGIIFFLIINKKTAQVDNIRQAFEQYKNSTQE
FT                   ELVSLRSKEITFDTLLNQEKQKNTELKHDSLQRIDELKLELKLERDKAYNYIEEIKNYK
FT                   SQIATLETQLREQNNSLRDKIELLQNSETKLKSEFENLANKIFEDSSKKLTERNQESLN
FT                   SVLNPVKEQLRDFKQKVEDVYDKESNARSALQNELKTLKELNQKMTTEAHNLTNALRNS
FT                   TKQQGIWGEMVLENVLEKSGLREGFEYFREKHATDEEGKVYRPDVVVKLPDNRDIIIDA
FT                   KTSLFAYNDYMAAADHKHSHLKAHIKSIREHIKGLANKNYENLKGINSLDFIFMFIPIE
FT                   GALLLALDNDASLYDEAFKQKIILVSPTTLLVALRAVENTWRYEKQAQSITDIYTRAEE
FT                   LYKKFVGFVEDLEKVGKSINDANKSYENAFSKLKTGRGNLIGQVEKLKQVSNIRTKKEL
FT                   DSNLVENAVSDS"
FT   CDS_pept        679660..680247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0660"
FT                   /product="hypothetical membrane protein"
FT                   /note="ORF ftt0660"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0660"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08676"
FT                   /protein_id="CAL08676.1"
FT                   /translation="MRFFKKLYFFLESFWKYLGKSQDKNFRLIHISLAILVIVQILDSD
FT                   YVHTRYGLSVGAYLHICVGMTIAILSIIMIIAALEKRGLRYYYPYLFNDYTALKSDLSE
FT                   LTRLRLPNPRSGSIAAIVQGFGLLALSIAWISGSMWFIAWNFQFDYTQNLKDLHKTLVG
FT                   LIEFYICVHGIMGIVHYFVQRYFRRFISNVDN"
FT   CDS_pept        complement(680269..680565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0661c"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Q82LF3 Hypothetical protein from
FT                   Streptomyces avermitilis (109 aa). FASTA: opt: 260 Z-score:
FT                   364.1 E(): 2.2e-12 Smith-Waterman score: 260; 47.778
FT                   identity in 90 aa overlap. The homologs are of different
FT                   sizes. ORF ftt0661c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0661c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08677"
FT                   /inference="similar to sequence:UniProtKB:Q82LF3"
FT                   /protein_id="CAL08677.1"
FT                   /translation="MPTKKQQSWTFLTNHSHVLCLINSDPNITIRDMAIKVGITERAVL
FT                   NILSDLTETAYLTVTKIGRNNHYTINKDKKLRHPIESHCNIDDFLKPLAIKKS"
FT   CDS_pept        complement(680728..681111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0662c"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Q9KMT3 Hypothetical protein VCA0237 from
FT                   Vibrio cholerae (189 aa). FASTA: opt: 308 Z-score: 400.0
FT                   E(): 2.2e-14 Smith-Waterman score: 308; 42.857 identity in
FT                   112 aa overlap. ORF ftt0662c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0662c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08678"
FT                   /inference="similar to sequence:UniProtKB:Q9KMT3"
FT                   /protein_id="CAL08678.1"
FT                   /translation="MNFTTYNKVHSSREEKNMNRQDIDKALAKWKNGLLKISKTYREGG
FT                   DYKQLAHDFIKDMYAYDNSEVLFKPTLASNKMFRGDLEGAVSYFVAGNDKYPEDNGFAI
FT                   GPWADLEFENAGYIVEDNIGIVM"
FT   CDS_pept        681224..682036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0663"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0663"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0663"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08679"
FT                   /protein_id="CAL08679.1"
FT                   /translation="MNIVDSHIHFWDITNGYNNWVKDTNLPKLVTPENLEASAFVHIEA
FT                   HSEKFDPLCEYNWLKSKFNNSNIKVVAFVDFTLEISQFEKKIIYLSEHNNIVGIRQIMS
FT                   KTYKSKYSPFEKCIPKDLEQKLKILREHKLIFEAQMYPEQFLPLLEKINNSGVKMVVEH
FT                   FGLPLFGRNNNLAEWQRFIKECSQNTNWNLKLSGFDLNNQMSNVKKALDFVFENISFHQ
FT                   LCYGSNFPVSNHDDYNFWQKFLYKYIDNDEISKHVFKNVARRIYFKEG"
FT   CDS_pept        complement(682023..683159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hdc"
FT                   /locus_tag="FTF0664c"
FT                   /product="histidine decarboxylase"
FT                   /EC_number="4.1.1.22"
FT                   /note="Similar to DCHS_RHILO (Q98A07) Histidine
FT                   decarboxylase from Rhizobium loti (Mesorhizobium loti) (369
FT                   aa). FASTA: opt: 647 Z-score: 787.6 E(): 5.6e-36
FT                   Smith-Waterman score: 647; 30.189 identity in 371 aa
FT                   overlap."
FT                   /db_xref="EnsemblGenomes-Gn:FTF0664c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08680"
FT                   /inference="similar to sequence:UniProtKB:DCHS_RHILO"
FT                   /protein_id="CAL08680.1"
FT                   /translation="MKNIEDLKLRLRHNKKVYVGYPTATDFDYDNCKELISEHFNNIGN
FT                   PYSKGSPFSTLGHERAVINFFLKLYMSNTNDSWGYIASCSSEAILYGVWNARNYFKAYD
FT                   VTLVYSDYAHYCVSKTANILAIKNKVITSRNNGEIDLGSLESFLKENYNKNQAYIFIAT
FT                   IGSTITSSIDNYKEARNIFKKYTDNFYIHLDGAFDGAFLPLKNDYILGEDFQSVNISGH
FT                   KFLGNPMPSGILLIQKKYISQNYVEYIDNDDMTIGGSRNGLSAVLLYNRILSLGSKKGL
FT                   IQRYQECLDKSETFLTILKNNNIKAWKNPQAITIVLENIDKRIFDKWHMPKYKNQATIT
FT                   CLPKLNKQMLMELIFDIKNPDKIDFSNAKKFAEDISPL"
FT   CDS_pept        complement(683267..683872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0665c"
FT                   /product="Aldolase/adducin class II family protein"
FT                   /note="Similar to Q88IX8 Class II aldolase/adducin domain
FT                   protein from Pseudomonas putida (strain KT2440) (251 aa).
FT                   FASTA: opt: 472 Z-score: 599.3 E(): 1.7e-25 Smith-Waterman
FT                   score: 472; 38.579identity in 197 aa overlap. ORF ftt0665c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0665c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08681"
FT                   /inference="similar to sequence:UniProtKB:Q88IX8"
FT                   /protein_id="CAL08681.1"
FT                   /translation="MSTEKNLRKKLAVCHHVIHYYGWDDLLATHISARLPNGNVIITPH
FT                   NVTFNKVTKKNIVTITPNGEIVSDNGYKVMPQAANIHLETYNARKNINAIIHTHSKYAV
FT                   ILSSLECGMQFTNQQSLRFYDDVSYHHYDGLALDNEGKAIAASLGEKNSMMILDNHGII
FT                   TTAESIEKAIYKHYYFEKAIEIEVKTLATGQKIRQIPQ"
FT   CDS_pept        complement(683963..684544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0666c"
FT                   /product="Methylpurine-DNA glycosylase family protein"
FT                   /EC_number="3.2.2.-"
FT                   /note="Similar to Q896H4 DNA-3-methyladenine glycosylase
FT                   from Clostridium tetani (203 aa). FASTA: opt: 451 Z-score:
FT                   589.0 E(): 6.4e-25 Smith-Waterman score: 451; 42.784
FT                   identity in 194 aa overlap. ORF ftt0666c"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0666c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08682"
FT                   /db_xref="GOA:Q14IG1"
FT                   /db_xref="InterPro:IPR003180"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036995"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14IG1"
FT                   /inference="similar to sequence:UniProtKB:Q896H4"
FT                   /protein_id="CAL08682.1"
FT                   /translation="MNNLEAILRLKTIDAAKKLLGHFLVSKYNNKILIGKIVETEAYLY
FT                   NDPACHSYSNRTKRNSMMYAQAGTSYVYFTYGMHYCFNVVTADVGIGEAILIRALEPIA
FT                   GIEQMQLNRSKTKLMDLCSGPAKLTQALNINLKDNGINLLDKDSSILLRYNNDLINEID
FT                   IVQTQRIGISKAKDMPYRFYIKDNIFVSKK"
FT   CDS_pept        684672..685175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0667"
FT                   /product="hypothetical protein"
FT                   /note="ORF ftt0667"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0667"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08683"
FT                   /protein_id="CAL08683.1"
FT                   /translation="MSKLLVVINMQKGFDCSEARAVIPNLNKFYTYFDNVSFVMFENRK
FT                   NSLFETQLKWIDFQNEEDRKLIEGVEIPQNAHFTHHHNYTVYNDELKALIKKLKPAKVY
FT                   LSGLFSDVCLLKTAMDMFDDGIVPYIIKDLSGSPHGDIAHEVAFAAMKEGLGADRIIST
FT                   KEIS"
FT   CDS_pept        685175..685807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0668"
FT                   /product="nicotinamide mononucleotide transport (NMT)
FT                   family protein"
FT                   /note="Similar to Q8A546 Putative membrane transporter
FT                   involved in nicotinamide mononucleotide transport from
FT                   Bacteroides thetaiotaomicron (188 aa). FASTA: opt: 333
FT                   Z-score: 403.8 E(): 1.3e-14 Smith-Waterman score: 333;
FT                   29.016identity in 193 aa overlap. ORF ftt0668"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0668"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08684"
FT                   /inference="similar to sequence:UniProtKB:Q8A546"
FT                   /protein_id="CAL08684.1"
FT                   /translation="MDSIYQSIVSSFYDYQSYFELVAAATGVAGVYFSYKRNILVYIVS
FT                   FISSAIYVCLLYDWKLFGDMLLNFYYLIANVIGFFAWIKHFEGDSKIHVYVTKADTHQK
FT                   KVSLYIFIITFVLTPFIYALQKQTSIIDLPVYSFIDAFVTAISFAGVYLMIKRAIESWY
FT                   LWAIADIISVPLFIYKGYHVTALQYAIFLILVYLGYKEWLRDFNQNK"
FT   CDS_pept        685905..687080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTF0669"
FT                   /product="Sodium/hydrogen exchanger family protein"
FT                   /note="Similar to Q8GRF6 MagA protein from Magnetospirillum
FT                   magnetotacticum (Aquaspirillum magnetotacticum) (432 aa).
FT                   FASTA: opt: 769 Z-score: 826.0 E(): 4.1e-38 Smith-Waterman
FT                   score: 769; 31.635identity in 373 aa overlap. ORF ftt0669"
FT                   /db_xref="EnsemblGenomes-Gn:FTF0669"
FT                   /db_xref="EnsemblGenomes-Tr:CAL08685"
FT                   /inference="similar to sequence:UniProtKB:Q8GRF6"
FT                   /protein_id="CAL08685.1"
FT                   /translation="MHDESLISIFVFVMLGILVVTIVLKKLKQPYVVAYLLTGILLGPY
FT                   GLRLIQDQENLARLGEIGVILLLFFAGMEVSPRKFAENWQVPTIGTMLQMLITSLIVSI
FT                   IGVALGWSIAKILLFGAVISLSSTAVVLKLLNDSGSMKTRLGQNVLGILLIQDLAVVPM
FT                   LILVRLIGGEELSISQIVTQILGGILIISIAAIMAVKKNIKISFISVLGKDEEMRVFAA
FT                   LVICFGMAALTESLELSSALGAFVGGMIVSTLEETEWVGHSLSTVKTIFMALFFISVGM
FT                   LIDLKLFWNHIFLFMALLLLIYSLNTTINALIFKALRQRTEEALIG