(data stored in ACNUC7421 zone)

EMBL: AM286416

ID   AM286416; SV 1; circular; genomic DNA; STD; PRO; 67721 BP.
XX
AC   AM286416;
XX
PR   Project:PRJNA190;
XX
DT   20-DEC-2006 (Rel. 90, Created)
DT   06-FEB-2015 (Rel. 123, Last updated, Version 5)
XX
DE   Yersinia enterocolitica subsp. enterocolitica 8081 plasmid pYVe8081
DE   complete genome
XX
KW   complete genome.
XX
OS   Yersinia enterocolitica subsp. enterocolitica 8081
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Yersiniaceae; Yersinia.
OG   Plasmid pYVe8081
XX
RN   [1]
RP   1-67721
RA   Thomson N.R.;
RT   ;
RL   Submitted (30-JUN-2006) to the INSDC.
RL   Thomson N.R., Pathogen Sequencing Unit, The Wellcome Trust Sanger
RL   Institute, Genome Campus, Hinxton, Cambridge, CB10 1SA, UNITED KINGDOM.
XX
RN   [2]
RX   DOI; 10.1371/journal.pgen.0020206.
RX   PUBMED; 17173484.
RA   Thomson N.R., Howard S., Wren B.W., Holden M.T.G., Crossman L.,
RA   Challis G.L., Churcher C., Mungall K., Brooks K., Chillingworth T.,
RA   Feltwell T., Abdellah Z., Hauser H., Jagels K., Maddison M., Moule S.,
RA   Sanders M., Whitehead S., Quail M.A., Dougan G., Parkhill J.,
RA   Prentice M.B.;
RT   "The complete genome sequence and comparative genome analysis of the high
RT   pathogenicity Yersinia enterocolitica strain 8081";
RL   PloS Genet. 2(12):e206-e206(2006).
XX
DR   MD5; 94aeee072d47d0a06ddf77ebcc829431.
DR   BioSample; SAMEA1705958.
DR   EnsemblGenomes-Gn; EBG00001275624.
DR   EnsemblGenomes-Gn; EBG00001275625.
DR   EnsemblGenomes-Gn; YEP0008.
DR   EnsemblGenomes-Gn; YEP0009.
DR   EnsemblGenomes-Gn; YEP0054.
DR   EnsemblGenomes-Gn; YEP0055.
DR   EnsemblGenomes-Gn; YEP0056.
DR   EnsemblGenomes-Gn; YEP0059.
DR   EnsemblGenomes-Gn; YEP0064.
DR   EnsemblGenomes-Gn; YEP0067.
DR   EnsemblGenomes-Gn; YEP0068.
DR   EnsemblGenomes-Gn; YEP0075.
DR   EnsemblGenomes-Gn; YEP0076.
DR   EnsemblGenomes-Gn; YEP0078.
DR   EnsemblGenomes-Gn; YEP0082.
DR   EnsemblGenomes-Gn; YEP0084.
DR   EnsemblGenomes-Gn; YEP0087.
DR   EnsemblGenomes-Gn; YEP0088.
DR   EnsemblGenomes-Gn; YEP0093.
DR   EnsemblGenomes-Tr; EBT00001807848.
DR   EnsemblGenomes-Tr; EBT00001807849.
DR   EnsemblGenomes-Tr; YEP0008.
DR   EnsemblGenomes-Tr; YEP0009.
DR   EnsemblGenomes-Tr; YEP0054.
DR   EnsemblGenomes-Tr; YEP0055.
DR   EnsemblGenomes-Tr; YEP0056.
DR   EnsemblGenomes-Tr; YEP0059.
DR   EnsemblGenomes-Tr; YEP0064.
DR   EnsemblGenomes-Tr; YEP0067.
DR   EnsemblGenomes-Tr; YEP0068.
DR   EnsemblGenomes-Tr; YEP0075.
DR   EnsemblGenomes-Tr; YEP0076.
DR   EnsemblGenomes-Tr; YEP0078.
DR   EnsemblGenomes-Tr; YEP0082.
DR   EnsemblGenomes-Tr; YEP0084.
DR   EnsemblGenomes-Tr; YEP0087.
DR   EnsemblGenomes-Tr; YEP0088.
DR   EnsemblGenomes-Tr; YEP0093.
DR   EuropePMC; PMC1698947; 17173484.
DR   EuropePMC; PMC2266911; 18221513.
DR   EuropePMC; PMC2613401; 19063735.
DR   EuropePMC; PMC3079665; 21453472.
DR   EuropePMC; PMC3122819; 21325549.
DR   EuropePMC; PMC3469391; 22963272.
DR   EuropePMC; PMC4908373; 27302835.
DR   EuropePMC; PMC6246891; 30488025.
DR   RFAM; RF01089; PK-repBA.
DR   RFAM; RF01396; isrN.
DR   RFAM; RF01405; STnc490k.
DR   StrainInfo; 719455; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..67721
FT                   /organism="Yersinia enterocolitica subsp. enterocolitica
FT                   8081"
FT                   /plasmid="pYVe8081"
FT                   /sub_species="enterocolitica"
FT                   /strain="8081"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:393305"
FT   rep_origin      1..650
FT                   /note="oriR; putative"
FT   CDS_pept        628..1287
FT                   /transl_table=11
FT                   /locus_tag="YEP0001"
FT                   /product="putative transposase"
FT                   /note="Similar to several putative transposases including:
FT                   Agrobacterium tumefaciens IS3 family transposase
FT                   SWALL:Q8UDL7 (EMBL:AE009161) (512 aa) fasta scores: E():
FT                   3.8e-24, 37.56 38d in 197 aa and to Escherichia coli, and
FT                   Shigella flexneri possible transposase of IS1353 YahA
FT                   SWALL:Q9WTH9 (EMBL:AP000342) (514 aa) fasta scores: E():
FT                   9.4e-21, 36.5 38d in 200 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10025"
FT                   /db_xref="GOA:A1JU61"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A1JU61"
FT                   /protein_id="CAL10025.1"
FT                   /translation="MFTEAERIRAIELYFKYGRKLAPVVLELGYPTKRNLRRWIRLWEA
FT                   SDDATKSIRRKPRYSNGQKQAAVEHYLNHGCCLAFTSRTLGYPCCDVLARWVNERHPDR
FT                   RLIFTSTINQNAPFEPEVKRQAVMALCTRHVPAREIAMNVGISRTVLYKWKDEIIGDEA
FT                   YQSMRKHEKPSLTEERDTLREEVNRLNQEIRPACLAYAHRKLRGQIVDELTLYRWF"
FT   repeat_region   complement(1206..1649)
FT                   /note="label:IS1400'"
FT                   /note="partial insertion sequence element IS1400"
FT   CDS_pept        complement(1284..1571)
FT                   /transl_table=11
FT                   /gene="trp1400A"
FT                   /locus_tag="YEP0002"
FT                   /product="IS1400 transposase A"
FT                   /note="Similar to Yersinia enterocolitica is1400
FT                   transposase a trp1400A SWALL:Q9X9H8 (EMBL:AJ132945) (96 aa)
FT                   fasta scores: E(): 4.6e-31, 96.84 38d in 95 aa, and to
FT                   Escherichia coli O6 transposase c2472 SWALL:AAN80931
FT                   (EMBL:AE016762) (88 aa) fasta scores: E(): 5.6e-28, 93.18
FT                   id in 88 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10026"
FT                   /db_xref="GOA:A1JTG9"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A1JTG9"
FT                   /protein_id="CAL10026.1"
FT                   /translation="MSPEEIAMRKIRFTEHQIIAVLKSVEAGRTVKDVCREAAISEASY
FT                   YNWKAKYGGMEAADIKKIKDLEDENRRLKQMFADLSLENRALKDVIEKKL"
FT   repeat_region   complement(1638..1649)
FT                   /note="putative inverted repeats for IS1400"
FT   CDS_pept        1674..2108
FT                   /transl_table=11
FT                   /locus_tag="YEP0003"
FT                   /product="putative transposase"
FT                   /note="Highly similar to Shigella flexneri 2a IS1353
FT                   putative transposase-like protein cp0118 SWALL:Q8VSI3
FT                   (EMBL:AF386526) (140 aa) fasta scores: E(): 2.3e-52,84.17
FT                   38d in 139 aa. Also similar to the C-termini of many other
FT                   transposases including: Agrobacterium tumefaciens IS3
FT                   family transposase SWALL:Q8UDL7 (EMBL:AE009161) (512 aa)
FT                   fasta scores: E(): 2.9e-43, 69.93 38d in 143 aa and
FT                   Klebsiella pneumoniae IS1353 putative transposase
FT                   SWALL:AAM89407 (EMBL:AY123253) (514 aa) fasta scores: E():
FT                   2.9e-39, 63.38 38d in 142 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10027"
FT                   /db_xref="GOA:A1JU63"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A1JU63"
FT                   /protein_id="CAL10027.1"
FT                   /translation="MSPVIDCFDGKVVSWSLGTRPDAELANTMLDGAISTLTAGERPII
FT                   HSDRGGHYRWPGWLKRVNAASLIRSMSRKGCSPDNAACEGFFGRLKTEMYYGHEWSGVT
FT                   PEHFMQHVDAYIRWYNEHRIKLSLGALSPEMYRRQLGIAQ"
FT   misc_feature    1674..2087
FT                   /note="Pfam match to entry PF00665 rve, Integrase core
FT                   domain, score 85.4, E-value 8.4e-23"
FT                   /inference="protein motif:PFAM:PF00665"
FT   CDS_pept        complement(2291..2839)
FT                   /transl_table=11
FT                   /gene="yopQ"
FT                   /locus_tag="YEP0004"
FT                   /product="virulence plasmid protein"
FT                   /note="Previously sequenced as Yersinia enterocolitica YopQ
FT                   protein precursor or Yop20 SWALL:YOPQ_YEREN (SWALL:P27474)
FT                   (182 aa) fasta scores: E(): 2.4e-72, 99.45 id in 182 aa,
FT                   and to Yersinia enterocolitica YopQ SWALL:Q93KV1
FT                   (EMBL:AF336309) (182 aa) fasta scores: E(): 1.5e-72, 100
FT                   38d in 182 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10028"
FT                   /db_xref="InterPro:IPR016505"
FT                   /db_xref="UniProtKB/TrEMBL:A1JU64"
FT                   /inference="similar to sequence:UniProtKB:P27474"
FT                   /protein_id="CAL10028.1"
FT                   /translation="MFIKDAYNMRALCTALEQSAPDTIINTSKEENNSYYCATAHLLRT
FT                   DVCSLVNRVGIEPLKSGSILSTLEELWQAVGIIYRLYEWQHVSDIDTNFKKLPNNSDFG
FT                   IVFSVLDCDIGYVITGKKDSKGNIELYDPKNSLLIENDDIKKYLYDENFHRFCIMLIIS
FT                   KSELEELSRESCDQKCIMG"
FT   misc_feature    complement(2294..2305)
FT                   /note="PS00294 Prenyl group binding site (CAAX box)."
FT                   /inference="protein motif:Prosite:PS00294"
FT   CDS_pept        3352..4320
FT                   /transl_table=11
FT                   /gene="yopT"
FT                   /locus_tag="YEP0005"
FT                   /product="plasmid type III secretion system effector
FT                   protein"
FT                   /note="Previously sequenced: Yersinia enterocolitica
FT                   plasmid type III secretion system effector protein YopT or
FT                   ypcd1.20 SWALL:Q93KV0 (EMBL:AF336309) (322 aa) fasta
FT                   scores: E(): 8.1e-132, 100 38d in 322 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10029"
FT                   /db_xref="GOA:A1JU65"
FT                   /db_xref="InterPro:IPR003951"
FT                   /db_xref="InterPro:IPR006473"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JU65"
FT                   /protein_id="CAL10029.1"
FT                   /translation="MDSIHGHYHIQLSNYSAGENLQSATPPEGVIGAHRVKVETALSHS
FT                   NRQKKLSATIKHNQSSRSMLDRKLTSDGKVNQRSSFTFSMIMYRMIHFVLSTRVPAVRE
FT                   SVANYGGNINFKFAQTKGAFLHQIIKHSDTARGACEALCAHWIRSHAQGQSLFDQLYVG
FT                   GRKGKFQIDTLYSIKQLQIDGCKADVDQDEVTLDWLKKNGISERMIERHCLLPTVDVTG
FT                   TTGSEGPDQLLNAILDTNGIGYGYKKISLSGQMSGHTIAAYVNENSGVTFFDPNFGEFH
FT                   FSDKEKFSKWFTNSFWENSMYHYPLGVGQSFSVFTFDSKEV"
FT   misc_feature    3409..4146
FT                   /note="Pfam match to entry PF03543
FT                   YerHae_surfAg,Yersinia/Haemophilus virulence surface
FT                   antigen, score 580.4, E-value 8.3e-172"
FT                   /inference="protein motif:PFAM:PF03543"
FT   CDS_pept        4320..4712
FT                   /transl_table=11
FT                   /gene="sycT"
FT                   /locus_tag="YEP0006"
FT                   /product="chaperone of YopT"
FT                   /note="Previously sequenced as Yersinia enterocolitica YopT
FT                   chaperone SycT SWALL:Q93KU9 (EMBL:AF336309) (130 aa) fasta
FT                   scores: E(): 5.9e-53, 100 38d in 130 aa and to Yersinia
FT                   pestis yopt chaperone syct or ypcd1.21 SWALL:Q9ZGW6
FT                   (EMBL:AF074612) (132 aa) fasta scores: E(): 1.3e-51, 97.72
FT                   38d in 132 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10030"
FT                   /db_xref="GOA:A1JU66"
FT                   /db_xref="InterPro:IPR010261"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JU66"
FT                   /protein_id="CAL10030.1"
FT                   /translation="MQTTFTELMQQLFLKLGLNHQVNENDVYTFEVDGHIQVLIACYHQ
FT                   QWVQLFSELGADLPTNDNLFGEHWPAHVQGRLDGKPILWSQQSLVGLDIDEMQAWLERF
FT                   IDDIEQRKESQNTKFQPNSTSPILFI"
FT   CDS_pept        complement(6065..6202)
FT                   /transl_table=11
FT                   /locus_tag="YEP0007"
FT                   /product="putative exported protein"
FT                   /note="Similar to the C-terminus of Yersinia pestis
FT                   hypothetical protein Y0062 or Ypcd1.23 SWALL:Q9ZGW8
FT                   (EMBL:AF074612) (139 aa) fasta scores: E(): 1.6e-18,95.55
FT                   38d in 45 aa, and to Salmonella typhimurium lytic enzyme
FT                   Stm1868A SWALL:Q8ZNX9 (EMBL:AE008783) (55 aa) fasta scores:
FT                   E(): 0.00018, 41.86 38d in 43 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10031"
FT                   /db_xref="UniProtKB/TrEMBL:A1JU67"
FT                   /protein_id="CAL10031.1"
FT                   /translation="MKKRLVIATALCVAFYAGMKFEHFLTVDACLDAGGAMQNDIFCER
FT                   "
FT   misc_feature    complement(6122..6190)
FT                   /note="1 probable transmembrane helix predicted for YEP.08c
FT                   by TMHMM2.0 at aa 5-27"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(6146..6202)
FT                   /locus_tag="YEP0007"
FT                   /note="Signal peptide predicted for YEP.08c by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.977) with cleavage site
FT                   probability 0.322 between residues 19 and 20"
FT   CDS_pept        complement(join(6479..6613,6617..6736,6739..6939))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="YEP0008"
FT                   /product="putative transposase (remnant)"
FT                   /note="This CDS appears to be a partial CDS with similarity
FT                   to many transposases e.g. Yersinia intermedia transposase
FT                   SWALL:O87921 (EMBL:Y18002) (245 aa) fasta scores: E():
FT                   1e-48, 84.86 38d in 152 aa"
FT   CDS_pept        join(7099..7362,7364..7681)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="YEP0009"
FT                   /product="putative transposase (remnant)"
FT                   /note="Similar to many including the very N- and C-termini
FT                   of Yersinia enterocolitica hypothetical 45.7 kDa protein
FT                   SWALL:Q93KR3 (EMBL:AF336309) (400 aa) fasta scores: E():
FT                   5.7e-26, 41.5 38d in 400 aa. Also similar in part to many
FT                   proposed transposases including: Yersinia pestis putative
FT                   transposase SWALL:O68702 (EMBL:AF053946) (99 aa) fasta
FT                   scores: E(): 4.1e-33, 90.9 38d in 99 aa and to Yersinia
FT                   pestis KIM putative transposase Y2038 SWALL:AAM85604
FT                   (EMBL:AE013806) (374 aa) fasta scores: E(): 1e-13, 44.44
FT                   38d in 99 aa. This CDS has undergone at least one deletion
FT                   event and has a frameshift mutation following codon 89"
FT   misc_feature    7111..7362
FT                   /note="Pfam match to entry PF00872
FT                   Transpo_mutator,Transposase, Mutator family, score 26.9,
FT                   E-value 7e-08"
FT                   /inference="protein motif:PFAM:PF00872"
FT   misc_feature    7424..7597
FT                   /note="Pfam match to entry PF00872
FT                   Transpo_mutator,Transposase, Mutator family, score 37.7,
FT                   E-value 5.8e-11"
FT                   /inference="protein motif:PFAM:PF00872"
FT   CDS_pept        complement(7724..8827)
FT                   /transl_table=11
FT                   /gene="yopM"
FT                   /locus_tag="YEP0010"
FT                   /product="yop type III secretion system effector protein"
FT                   /note="Previously sequenced:Yersinia enterocolitica
FT                   virulence plasmid type III secretion system effector
FT                   protein YopM SWALL:Q93KU8 (EMBL:AF336309) (367 aa) fasta
FT                   scores: E(): 3.9e-133, 100 38d in 367 aa and to Yersinia
FT                   pestis outer membrane protein YopM or Yop48 or Ypcd1.26c or
FT                   y0059 SWALL:YOPM_YERPE (SWALL:P17778) (409 aa) fasta
FT                   scores: E(): 1.9e-78, 81.66 38d in 409 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10034"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR032674"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:A1JU68"
FT                   /inference="similar to sequence:UniProtKB:P17778"
FT                   /protein_id="CAL10034.1"
FT                   /translation="MFITPRNVSNTFLQEPLRHSSDLTEMPVEAENVKSKTEYYNAWAV
FT                   WERNAPPGNGEQREMAVSRLRDCLDRQAHELELNNLGLSSLPELPPHLESLVASCNSLT
FT                   ELPELPQSLKSLQVDNNNLKALSDLPPSLEFLAAGNNQLEELPELQNSSFLKIIDVDNN
FT                   SLKKLPDLPPSLEFLAAGNNQLEELSELQNLPFLTEIHADNNSLKTLPDLPPSLKTLNV
FT                   RENYLTDLPELPQSLTFLDVSDNIFSGLSELPPNLYYLDASSNGIRSLCDLPPSLVELD
FT                   VRDNQLIELPALPPHLERLIASLNHLAEVPELPQNLKQLHVEHNALREFPDIPESVEDL
FT                   RMDSERVTDTYEFAHETTDKLEDDVFE"
FT   misc_feature    complement(7805..7882)
FT                   /note="Pfam match to entry PF00560 LRR, Leucine Rich
FT                   Repeat, score 10.7, E-value 2.5"
FT                   /inference="protein motif:PFAM:PF00560"
FT   misc_feature    complement(7934..8002)
FT                   /note="Pfam match to entry PF00560 LRR, Leucine Rich
FT                   Repeat, score 12.3, E-value 0.85"
FT                   /inference="protein motif:PFAM:PF00560"
FT   misc_feature    complement(8114..8182)
FT                   /note="Pfam match to entry PF00560 LRR, Leucine Rich
FT                   Repeat, score 15.7, E-value 0.078"
FT                   /inference="protein motif:PFAM:PF00560"
FT   misc_feature    complement(8243..8308)
FT                   /note="Pfam match to entry PF00560 LRR, Leucine Rich
FT                   Repeat, score 11.7, E-value 1.3"
FT                   /inference="protein motif:PFAM:PF00560"
FT   misc_feature    complement(8369..8434)
FT                   /note="Pfam match to entry PF00560 LRR, Leucine Rich
FT                   Repeat, score 10.1, E-value 3.6"
FT                   /inference="protein motif:PFAM:PF00560"
FT   misc_feature    complement(8486..8554)
FT                   /note="Pfam match to entry PF00560 LRR, Leucine Rich
FT                   Repeat, score 14.2, E-value 0.22"
FT                   /inference="protein motif:PFAM:PF00560"
FT   CDS_pept        8950..9168
FT                   /transl_table=11
FT                   /locus_tag="YEP0011"
FT                   /product="putative membrane protein"
FT                   /note="Previously sequenced:Yersinia enterocolitica
FT                   hypothetical 8.0 kDa protein orf91B SWALL:Q93KU7
FT                   (EMBL:AF336309) (72 aa) fasta scores: E(): 2.1e-29, 100 id
FT                   in 72 aa. No other significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10035"
FT                   /db_xref="GOA:A1JU69"
FT                   /db_xref="UniProtKB/TrEMBL:A1JU69"
FT                   /protein_id="CAL10035.1"
FT                   /translation="MSEDCMAAIFRFSTKSFGIGYPGWITPNTTKLFTRYNITINLPAN
FT                   GNTATDAIPALTFLVLLLMLLSSFDWP"
FT   misc_feature    9079..9147
FT                   /note="1 probable transmembrane helix predicted for YEP.15
FT                   by TMHMM2.0 at aa 44-66"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(9654..10574)
FT                   /transl_table=11
FT                   /gene="yopD"
FT                   /locus_tag="YEP0012"
FT                   /product="translocator protein"
FT                   /note="Previously sequenced: Yersinia enterocolitica YopD
FT                   translocator protein SWALL:YOPD_YEREN (SWALL:P37132) (306
FT                   aa) fasta scores: E(): 4e-96, 98.36 38d in 306 aa, and to
FT                   Yersinia pestis YopD homolog or Ypcd1.28C SWALL:O68699
FT                   (EMBL:AF053946) (306 aa) fasta scores: E(): 2.8e-95,97.71
FT                   38d in 306 aa, and to Yersinia pseudotuberculosis YopD
FT                   protein SWALL:YOPD_YERPS (SWALL:Q06131) (306 aa) fasta
FT                   scores: E(): 5.3e-95, 97.38 38d in 306 aa, and to
FT                   Pseudomonas aeruginosa translocator protein PopD popd or
FT                   pa1709 SWALL:Q9I323 (EMBL:AE004597) (295 aa) fasta scores:
FT                   E(): 2.2e-31, 40.76 38d in 287 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10036"
FT                   /db_xref="InterPro:IPR008898"
FT                   /db_xref="UniProtKB/TrEMBL:A1JU70"
FT                   /inference="similar to sequence:UniProtKB:P37132"
FT                   /inference="similar to sequence:UniProtKB:Q06131"
FT                   /protein_id="CAL10036.1"
FT                   /translation="MTINIKTDSPIITTGSQIDAITTETVGQSGEVKKTEDTRHEAQAI
FT                   KSSEASLSRSQVPELIKPSQGINVALLSKSQGDLNGTLSILLLLLELARKAREMGLQQR
FT                   DIENKAAITAQKEQVAEMVSGAKLMIAMAVVSGIMAATSTVASAFSIAKEVKIVKQEQI
FT                   LNSNIAGRDQLIDTKMQQMSNTSDKAVSREDIGRIWKPEQVADQNKLALLDKEFRMTDS
FT                   KANAFNAATQPLGQMANSAIQVHQGYSQAEVKEKEVNASIAANEKQKAEEAMNYNDNFM
FT                   KDVLRLIEQYVSSHTHAMKAAFGVV"
FT   CDS_pept        complement(10593..11798)
FT                   /transl_table=11
FT                   /gene="yopB"
FT                   /locus_tag="YEP0013"
FT                   /product="virulence plasmid YopB transmembrane effector
FT                   protein"
FT                   /note="Previously sequenced: Yersinia enterocolitica
FT                   virulence plasmid YopB transmembrane protein
FT                   SWALL:YOPB_YEREN (SWALL:P37131) (401 aa) fasta scores: E():
FT                   2.2e-121, 98.75 38d in 401 aa, and to Yersinia
FT                   pseudotuberculosis YopB protein yopB SWALL:YOPB_YERPS
FT                   (SWALL:Q06114) (401 aa) fasta scores: E(): 1e-119, 96.5 id
FT                   in 401 aa, and to Yersinia pestis yopb homolog yopb or
FT                   ypcd1.29C SWALL:O68698 (EMBL:AF053946) (401 aa) fasta
FT                   scores: E(): 1.9e-119, 96.25 38d in 401 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10037"
FT                   /db_xref="GOA:A1JU71"
FT                   /db_xref="InterPro:IPR006972"
FT                   /db_xref="UniProtKB/TrEMBL:A1JU71"
FT                   /inference="similar to sequence:UniProtKB:P37131"
FT                   /inference="similar to sequence:UniProtKB:Q06114"
FT                   /protein_id="CAL10037.1"
FT                   /translation="MSALITHDRSTPVTGSLLPYVETPAPAPLQTQQVAGELKDKNGGV
FT                   SSQGVQLPAPLAVVASQVTEGQQQEITKLLESVTRGTAGSQLISNYVSVLTNFTLASPD
FT                   TFEIELGKLVSNLEEVRKDIKIADIQRLHEQNMKKIEENQEKIKETEENAKQVKKSGMA
FT                   SKIFGWLSAIASVVIGAIMVASGVGAVAGAMMIASGVIGMANMAVKQAAEDGLISQEAM
FT                   QVLGPILTAIEVALTVVSTVMTFGGSALKCLADIGAKLGANTASLAAKGAEFSAKVAQI
FT                   STGISNTVGNAVTKLGGSFGSLTMSHVIRTGSQATQVAVGVGSGITQTINNKKQADLQH
FT                   NNADLALNKADMAALQSIIDRLKEELSHLSESHQQVMELIFQMINAKGDMLHNLAGRPH
FT                   TV"
FT   misc_feature    complement(10596..11798)
FT                   /note="Pfam match to entry PF04888 SseC, Secretion system
FT                   effector C (SseC) like family, score 709.7, E-value
FT                   9.3e-211"
FT                   /inference="protein motif:PFAM:PF04888"
FT   misc_feature    complement(11235..11303)
FT                   /note="1 probable transmembrane helix predicted for yopB by
FT                   TMHMM2.0 at aa 166-188"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(11776..12282)
FT                   /transl_table=11
FT                   /gene="sycD"
FT                   /locus_tag="YEP0014"
FT                   /product="yopB/D chaperone/regulatory protein"
FT                   /note="Previously sequenced: Yersinia enterocolitica yopB/D
FT                   chaperone/regulatory protein SycD SWALL:AAK69212
FT                   (EMBL:AF336309) (168 aa) fasta scores: E(): 4.8e-67, 100 id
FT                   in 168 aa. Also highly similar to Yersinia
FT                   pseudotuberculosis low calcium response locus protein H
FT                   LcrH SWALL:LCRH_YERPS (SWALL:P23995) (168 aa) fasta scores:
FT                   E(): 4.8e-67, 100 38d in 168 aa, and to Yersinia pestis low
FT                   calcium response locus protein H LcrH or Ypcd1.30c or y0051
FT                   SWALL:LCRH_YERPE (SWALL:P21207) (168 aa) fasta scores: E():
FT                   2.6e-66, 99.4 38d in 168 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10038"
FT                   /db_xref="InterPro:IPR005415"
FT                   /db_xref="InterPro:IPR011716"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR016379"
FT                   /db_xref="UniProtKB/TrEMBL:A1JU72"
FT                   /inference="similar to sequence:UniProtKB:P23995"
FT                   /inference="similar to sequence:UniProtKB:P21207"
FT                   /protein_id="CAL10038.1"
FT                   /translation="MQQETTDTQEYQLAMESFLKGGGTIAMLNEISSDTLEQLYSLAFN
FT                   QYQSGKYEDAHKVFQALCVLDHYDSRFFLGLGACRQAMGQYDLAIHSYSYGAIMDIKEP
FT                   RFPFHAAECLLQKGELAEAESGLFLAQELIADKPEFKELSTRVSSMLEAIKLKKEMEHE
FT                   CVDNP"
FT   CDS_pept        complement(12285..13259)
FT                   /transl_table=11
FT                   /gene="lcrV"
FT                   /locus_tag="YEP0015"
FT                   /product="virulence-associated V antigen"
FT                   /note="Previously sequenced: Yersinia enterocolitica
FT                   virulence-associated V antigen LcrV SWALL:Q93KU4
FT                   (EMBL:AF336309) (324 aa) fasta scores: E(): 1.9e-111, 100
FT                   id in 324 aa. Also highly similar to Yersinia
FT                   pseudotuberculosis virulence-associated V antigen LcrV
FT                   SWALL:LCRV_YERPS (SWALL:P23994) (326 aa) fasta scores: E():
FT                   2.5e-107, 96.28 38d in 323 aa and to Yersinia pestis
FT                   virulence-associated V antigen LcrV or Ypcd1.31c or y0050
FT                   SWALL:LCRV_YERPE (SWALL:P21206) (326 aa) fasta scores: E():
FT                   4.7e-106, 95.66 38d in 323 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10039"
FT                   /db_xref="GOA:A1JU73"
FT                   /db_xref="InterPro:IPR005413"
FT                   /db_xref="InterPro:IPR036139"
FT                   /db_xref="UniProtKB/TrEMBL:A1JU73"
FT                   /inference="similar to sequence:UniProtKB:P23994"
FT                   /inference="similar to sequence:UniProtKB:P21206"
FT                   /protein_id="CAL10039.1"
FT                   /translation="MIRAYEQNPQHFIEDLEKVRVEQLTGHGSSVLEELVQLVKDKKID
FT                   ISIKYDPKKDSEVFAERVITDDIELLKKILAYFLPEDAILKGGHYDNQLQNGIKRVKEF
FT                   LESSPNTQWELRAFMAVMHFSLTADRIDDDILKVIVDSMNHHGDARSKLREELAELTAE
FT                   LKIYSVIQAEINKYLSNSGTINIHDKSINLMDKNLYGYTDEEIFKASAEYKILEKMSQT
FT                   TIKEGETEKKIVSIKNFLESENKRTGALGNLKNSYSYNKDNNELSHFATACSDKSRPLN
FT                   DLVSQKTTQLSDITSRFNSAIEALNRFIQKYDSVMQRLLDDTR"
FT   misc_feature    complement(12291..13259)
FT                   /note="Pfam match to entry PF04792 LcrV, V antigen (LcrV)
FT                   protein, score 876.9, E-value 4.4e-261"
FT                   /inference="protein motif:PFAM:PF04792"
FT   CDS_pept        complement(13261..13548)
FT                   /transl_table=11
FT                   /gene="lcrG"
FT                   /locus_tag="YEP0016"
FT                   /product="low calcium response locus protein g"
FT                   /note="Previously sequenced: Yersinia enterocolitica LcrG
FT                   SWALL:Q93KU3 (EMBL:AF336309) (95 aa) fasta scores: E():
FT                   5.2e-32, 100 38d in 95 aa. Also highly similar to Yersinia
FT                   pestis, and Yersinia pseudotuberculosis low calcium
FT                   response locus protein G LcrG or Ypcd1.32c or Y0049
FT                   SWALL:LCRG_YERPE (SWALL:P19394) (95 aa) fasta scores: E():
FT                   1.8e-31, 98.94 38d in 95 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10040"
FT                   /db_xref="InterPro:IPR009863"
FT                   /db_xref="UniProtKB/TrEMBL:A1JU74"
FT                   /inference="similar to sequence:UniProtKB:P19394"
FT                   /protein_id="CAL10040.1"
FT                   /translation="MKSSHFDEYDKTLKQAELAIADSDHRAKLLQEMCADIGLTPEAVM
FT                   KIFAGRSAEEIKPAERELLDEIKRQRERQPQHPNDGKRPRKPTMMRGQII"
FT   CDS_pept        complement(13590..14030)
FT                   /transl_table=11
FT                   /gene="lcrR"
FT                   /locus_tag="YEP0017"
FT                   /product="low calcium response locus protein R"
FT                   /note="Previously sequenced: Yersinia enterocolitica low
FT                   calcium response locus protein R which may play an
FT                   important role in its regulation, LcrR SWALL:LCRR_YEREN
FT                   (SWALL:O68549) (146 aa) fasta scores: E(): 4e-62, 99.31 id
FT                   in 146 aa. Also highly similar to Yersinia pestis, and
FT                   Yersinia pseudotuberculosis low calcium response locus
FT                   protein R LcrR or Ypcd1.33c or Y0048 SWALL:LCRR_YERPE
FT                   (SWALL:P19393) (146 aa) fasta scores: E(): 1.3e-61, 98.63
FT                   id in 146 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10041"
FT                   /db_xref="InterPro:IPR013405"
FT                   /db_xref="InterPro:IPR022797"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JU75"
FT                   /inference="similar to sequence:UniProtKB:O68549"
FT                   /inference="similar to sequence:UniProtKB:P19393"
FT                   /protein_id="CAL10041.1"
FT                   /translation="MMEDPLIPWLTEHGLVCHPHTLSGAPISLGSAFQLAGLKLAWRVE
FT                   IEQRRVWIVLIQRVEQRRGLKNPFAALYMLANAARAVLGPDYYLYGNVDVLAGSSLSTQ
FT                   RLAHFYRRWTGAKELSTGWFSLKVSQVITLSNMKKRQNNGFA"
FT   CDS_pept        complement(14027..16141)
FT                   /transl_table=11
FT                   /gene="lcrD"
FT                   /locus_tag="YEP0018"
FT                   /product="low calcium response locus membrane protein d"
FT                   /note="Previously sequenced: Yersinia enterocolitica low
FT                   calcium response locus integral membrane protein D LcrD
FT                   SWALL:LCRD_YEREN (SWALL:P21210) (704 aa) fasta scores: E():
FT                   0, 99.57 38d in 704 aa. Also highly similar to Yersinia
FT                   pestis, and Yersinia pseudotuberculosis low calcium
FT                   response locus protein D LcrD or Ypcd1.34c or Y0047
FT                   SWALL:LCRD_YERPE (SWALL:P31487) (704 aa) fasta scores: E():
FT                   0, 99 38d in 704 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10042"
FT                   /db_xref="GOA:A1JU76"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006302"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JU76"
FT                   /inference="similar to sequence:UniProtKB:P21210"
FT                   /inference="similar to sequence:UniProtKB:P31487"
FT                   /protein_id="CAL10042.1"
FT                   /translation="MNPYDLEWLNRIGERKDIMLAVLLLAVVFMMVLPLPPLVLDILIA
FT                   VNMTISVVLLMIAIYINSPLQFSAFPAVLLVTTLFRLALSVSTTRMILLQADAGQIVYT
FT                   FGNFVVGGNLIVGIVIFLIITIVQFLVITKGSERVAEVSARFSLDAMPGKQMSIDGDMR
FT                   AGVIDVNEARERRATIEKESQMFGSMDGAMKFVKGDAIAGLIIIFVNILGGVTIGVTQK
FT                   GLAAAEALQLYSILTVGDGMVSQVPALLIAITAGIIVTRVSSEDSSDLGSDIGKQVVAQ
FT                   PKAMLIGGVLLLLFGLIPGFPTVTFLILALLVGCGGYMLSRKQSRNDEANQDLQSLLTS
FT                   GSGAPAARTKAKTSGANKGRLGEQEAFAMTVPLLIDVDSSQQEALEAIALNDELVRVRR
FT                   ALYLDLGVPFPGIHLRFNEGMGEGEYLISLQEVPVARGELKAGYLLVRESVSQLELLGI
FT                   PYEKGEHLLPDQETFWVSVEYEERLEKSQLEFFSHSQVLTWHLSHVLREYAEDFIGIQE
FT                   TRYLLEQMEGGYGELIKEVQRIVPLQRMTEILQRLVGEDISIRNMRSILEAMVEWGQKE
FT                   KDVVQLTEYIRSSLKRYICYKYANGNNILPAYLFDQEVEEKIRSAVRQTSAGSYLALDP
FT                   AVTESLLEQVRKTIGDLSQIQSKPVLIVSMDIRRYVRKLIESEYYGLPVLSYQELTQQI
FT                   NIQPLGRVCL"
FT   misc_feature    complement(14054..16066)
FT                   /note="Pfam match to entry PF00771 FHIPEP, FHIPEP family
FT                   ,score 1345.4, E-value 0"
FT                   /inference="protein motif:PFAM:PF00771"
FT   misc_feature    complement(15197..15229)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    complement(order(15203..15271,15371..15439,15482..15541,
FT                   15749..15817,15860..15928,15947..16015,16025..16084))
FT                   /note="7 probable transmembrane helices predicted for lcrD
FT                   by TMHMM2.0 at aa 20-39, 43-65, 72-94, 109-131,
FT                   201-220,235-257 and 291-313"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(15659..15730)
FT                   /note="PS00994 Bacterial export FHIPEP family signature."
FT                   /inference="protein motif:Prosite:PS00994"
FT   CDS_pept        complement(16128..16472)
FT                   /transl_table=11
FT                   /gene="yscY"
FT                   /locus_tag="YEP0019"
FT                   /product="conserved hypothetical protein"
FT                   /note="Previously sequenced: Yersinia enterocolitica YscY
FT                   SWALL:Q93KU0 (EMBL:AF336309) (114 aa) fasta scores: E():
FT                   9.5e-49, 100 38d in 114 aa. Also highly similar to Yersinia
FT                   pestis hypothetical protein Ypcd1.35c or Y0046
FT                   SWALL:Y6D5_YERPE (SWALL:P21209) (114 aa) fasta scores: E():
FT                   7.9e-48, 99.11 38d in 113 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10043"
FT                   /db_xref="GOA:A1JU77"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016684"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JU77"
FT                   /inference="similar to sequence:UniProtKB:P21209"
FT                   /protein_id="CAL10043.1"
FT                   /translation="MNITLTKRQQEFLLLNGWLQLQCGHAERACILLDALLMLNPEHLA
FT                   GRRCRLVALLNNNQGERAEKEAQWLISHDPLQAGNWLCLSRAQQLNGDLDKARHAYQHY
FT                   LELKDHNESL"
FT   CDS_pept        complement(16469..16837)
FT                   /transl_table=11
FT                   /gene="yscX"
FT                   /locus_tag="YEP0020"
FT                   /product="conserved hypothetical protein"
FT                   /note="Previously sequenced: Yersinia enterocolitica
FT                   hypothetical protein SWALL:YLC3_YEREN (SWALL:P21208) (122
FT                   aa) fasta scores: E(): 1.8e-46, 99.18 38d in 122 aa. Also
FT                   highly similar to Y. ersinia pestis and Y. enterocolitica
FT                   hypothetical 13.8 kDa protein Y0045 or Ypcd1.36c or YscX
FT                   SWALL:O68696 (EMBL:AF053946) (122 aa) fasta scores: E():
FT                   9.9e-47, 100 38d in 122 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10044"
FT                   /db_xref="GOA:A1JU78"
FT                   /db_xref="InterPro:IPR012672"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JU78"
FT                   /inference="similar to sequence:UniProtKB:P21208"
FT                   /protein_id="CAL10044.1"
FT                   /translation="MSRIITAPHIGIEKLSAISLEELSCGLPERYALPPDGHPVEPHLE
FT                   RLYPTAQSKRSLWDFASPGYTFHGLHRAQDYRRELDTLQSLLTTSQSSELQAAAALLKC
FT                   QQDDDRLLQIILNLLHKV"
FT   CDS_pept        complement(16834..17205)
FT                   /transl_table=11
FT                   /gene="sycN"
FT                   /locus_tag="YEP0021"
FT                   /product="YopN chaperone SycN"
FT                   /note="Previously sequenced: Yersinia enterocolitica YopN
FT                   chaperone SycN SWALL:Q93KT9 (EMBL:AF336309) (123 aa) fasta
FT                   scores: E(): 1.6e-48, 100 38d in 123 aa. Also highly
FT                   similar to Yersinia pestis and Yersinia pseudotuberculosis
FT                   hypothetical protein Ypcd1.37c or Y0044 SWALL:Y6D7_YERPE
FT                   (SWALL:P16162) (123 aa) fasta scores: E(): 3.6e-48, 99.18
FT                   id in 123 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10045"
FT                   /db_xref="GOA:A1JU79"
FT                   /db_xref="InterPro:IPR012673"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JU79"
FT                   /inference="similar to sequence:UniProtKB:P16162"
FT                   /protein_id="CAL10045.1"
FT                   /translation="MSWIEPIISHFCQDLGVPTSSPLSPLIQLEMAQSGTLQLEQHGAT
FT                   LTLWLARSLAWHRCEDAMVKALTLTAAQKSGTLPLRAGWLGESQLVLFVSLDERSLTLP
FT                   LLHQAFEQLLRLQQEVLAP"
FT   CDS_pept        complement(17192..17470)
FT                   /transl_table=11
FT                   /gene="tyeA"
FT                   /locus_tag="YEP0022"
FT                   /product="type III secretion system protein"
FT                   /note="Previously sequenced: Yersinia enterocolitica TyeA
FT                   SWALL:AAK69221 (EMBL:AF336309) (92 aa) fasta scores: E():
FT                   9.8e-35, 100 38d in 92 aa. Also highly similar to Yersinia
FT                   pestis, Yersinia enterocolitica, and Yersinia
FT                   pseudotuberculosis protein TyeA or Ypcd1.38c or Y0043
FT                   SWALL:TYEA_YERPE (SWALL:P16161) (92 aa) fasta scores: E():
FT                   9.8e-35, 100 38d in 92 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10046"
FT                   /db_xref="InterPro:IPR013351"
FT                   /db_xref="InterPro:IPR015144"
FT                   /db_xref="InterPro:IPR038347"
FT                   /db_xref="UniProtKB/TrEMBL:A1JU80"
FT                   /inference="similar to sequence:UniProtKB:P16161"
FT                   /protein_id="CAL10046.1"
FT                   /translation="MAYDLSEFMGDIVALVDKRWAGIHDIEHLANAFSLPTPEIKVRFY
FT                   QDLKRMFRLFPLGVFSDEEQRQNLLQMCQNAIDMAIESEEEELSELD"
FT   CDS_pept        complement(17451..18332)
FT                   /transl_table=11
FT                   /gene="yopN"
FT                   /locus_tag="YEP0023"
FT                   /product="type III secretion outer membrane protein"
FT                   /note="Previously sequenced: Yersinia enterocolitica
FT                   plasmid type III secretion system outer membrane protein
FT                   YopN or LcrE SWALL:YOPN_YEREN (SWALL:P16945) (292 aa) fasta
FT                   scores: E(): 7.8e-96, 95.54 38d in 292 aa. Also highly
FT                   similar to Yersinia pestis, and Yersinia pseudotuberculosis
FT                   outer membrane protein YopN or LcrE or Ypcd1.39c or y0042
FT                   SWALL:YOPN_YERPE (SWALL:P16160) (292 aa) fasta scores: E():
FT                   6.3e-99, 97.6 38d in 292 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10047"
FT                   /db_xref="GOA:A1JU81"
FT                   /db_xref="InterPro:IPR010812"
FT                   /db_xref="InterPro:IPR013401"
FT                   /db_xref="UniProtKB/TrEMBL:A1JU81"
FT                   /inference="similar to sequence:UniProtKB:P16945"
FT                   /inference="similar to sequence:UniProtKB:P16160"
FT                   /protein_id="CAL10047.1"
FT                   /translation="MTTLHNISYGNTPLRNEHPETASSQIVNQTLGQFRGESVQIVSGT
FT                   LQSIADMAEEVTFVFSERKELSLDKRKLSDSQARVSDVEEQVNQYLSKVPELEQKQNVS
FT                   ELLSLLSNSPNISLSQLKAYLEGKSEEPSEQFKMLCGLRDALKGRPELAHLSHLVEQAL
FT                   VSMAEEQGEAIVLGARITPEAYRESQSSVNPLQPLRDTYRDAVMGYQGIYAIWSDLQKR
FT                   FPNGDIDSVILFLQKALSADLQSQQSGSGREKLGIVISDLQKLKEFGSVSDQVKGFWQF
FT                   FSEGITNGVRPF"
FT   CDS_pept        18530..19849
FT                   /transl_table=11
FT                   /gene="yscN"
FT                   /locus_tag="YEP0024"
FT                   /product="probable type III secretion system ATP synthase"
FT                   /EC_number="3.6.3.14"
FT                   /note="Previously sequenced: Yersinia enterocolitica
FT                   probable ATP synthase YscN SWALL:YSCN_YEREN (SWALL:P40290)
FT                   (439 aa) fasta scores: E(): 8e-158, 99.76 38d in 427 aa.
FT                   Also highly similar to Yersinia pestis, and Yersinia
FT                   enterocolitica Yops secretion ATPase YscN or Ypcd1.40
FT                   SWALL:O68695 (EMBL:AF053946) (439 aa) fasta scores: E():
FT                   4e-158, 100 38d in 427 aa, and to Yersinia
FT                   pseudotuberculosis probable ATP synthase YscN
FT                   SWALL:YSCN_YERPS (SWALL:P40291) (439 aa) fasta scores: E():
FT                   1.2e-156, 99.29 38d in 427 aa, and to Pseudomonas
FT                   aeruginosa ATP synthase in type III secretion system Pa1697
FT                   SWALL:Q9I330 (EMBL:AE004596) (440 aa) fasta scores: E():
FT                   1.3e-130, 84.89 38d in 417 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0024"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10048"
FT                   /db_xref="GOA:A1JU82"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR013380"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:A1JU82"
FT                   /inference="similar to sequence:UniProtKB:P40290"
FT                   /inference="similar to sequence:UniProtKB:P40291"
FT                   /protein_id="CAL10048.1"
FT                   /translation="MLSLDQIPHHIRHGIVGSRLIQIRGRVTQVTGTLLKAVVPGVRIG
FT                   ELCYLRNPDNSLSLQAEVIGFAQHQALLIPLGEMYGISSNTEVSPTGTMHQVGVGEHLL
FT                   GQVLDGLGQPFDGGHLPEPAAWYPVYQDAPAPMSRKLITTPLSLGIRVIDGLLTCGEGQ
FT                   RMGIFAAAGGGKSTLLASLIRSAEVDVTVLALIGERGREVREFIESDLGEEGLRKAVLV
FT                   VATSDRPSMERAKAGFVATSIAEYFRDQGKRVLLLMDSVTRFARAQREIGLAAGEPPTR
FT                   RGYPPSVFAALPRLMERAGQSSKGSITALYTVLVEGDDMTEPVADETRSILDGHIILSR
FT                   KLAAANHYPAIDVLRSASRVMNQIVSKEHKTWAGDLRRLLAKYEEVELLLQIGEYQKGQ
FT                   DKEADQAIERMGAIRGWLCQGTHELSHFNETLNLLETLTQ"
FT   misc_feature    18608..18805
FT                   /note="Pfam match to entry PF02874 ATP-synt_ab_N, ATP
FT                   synthase alpha/beta family, beta-barrel domain, score 59.0,
FT                   E-value 7.5e-15"
FT                   /inference="protein motif:PFAM:PF02874"
FT   misc_feature    18812..19621
FT                   /note="Pfam match to entry PF00006 ATP-synt_ab, ATP
FT                   synthase alpha/beta family, nucleotide-binding domain
FT                   ,score 512.5, E-value 2.2e-151"
FT                   /inference="protein motif:PFAM:PF00006"
FT   misc_feature    19034..19057
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    19574..19603
FT                   /note="PS00152 ATP synthase alpha and beta subunits
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00152"
FT   CDS_pept        19846..20310
FT                   /transl_table=11
FT                   /gene="yscO"
FT                   /locus_tag="YEP0025"
FT                   /product="type III secretion system translocation protein"
FT                   /note="Similar to Yersinia enterocolitica type III
FT                   secretion system translocation protein YscO SWALL:Q93KT7
FT                   (EMBL:AF336309) (154 aa) fasta scores: E(): 9.7e-51, 100 id
FT                   in 154 aa, and to Yersinia pseudotuberculosis Yop proteins
FT                   translocation protein O YscO SWALL:YSCO_YERPS
FT                   (SWALL:P40294) (154 aa) fasta scores: E(): 3.1e-49, 96.75
FT                   id in 154 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10049"
FT                   /db_xref="InterPro:IPR009929"
FT                   /db_xref="UniProtKB/TrEMBL:A1JU83"
FT                   /inference="similar to sequence:UniProtKB:P40294"
FT                   /protein_id="CAL10049.1"
FT                   /translation="MIRRLHRVKVLRVERAEQAIKTQQACLQAAHRRHQEAVQTSQDYH
FT                   LWRIDEEQRLFDQRKNTTLNCKDLEKWQRQIASLREKEANYELECAKLLERLANERERL
FT                   TSCQKTLQQARHKENKFLELVRREDEDELNQQHYQEEQEQEEFLQHHRNA"
FT   CDS_pept        20310..21671
FT                   /transl_table=11
FT                   /gene="yscP"
FT                   /locus_tag="YEP0026"
FT                   /product="putative type III secretion protein"
FT                   /note="Previously sequenced: Yersinia enterocolitica YscP
FT                   SWALL:Q93KT6 (EMBL:AF336309) (453 aa) fasta scores: E():
FT                   1.8e-171, 100 38d in 453 aa. Also highly similar to
FT                   Yersinia pestis, and Yersinia pseudotuberculosis Yop
FT                   proteins translocation protein P YscP or Ypcd1.42 or Y0039
FT                   SWALL:YSCP_YERPE (SWALL:P40295) (455 aa) fasta scores: E():
FT                   2.2e-159, 93.84 38d in 455 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10050"
FT                   /db_xref="GOA:A1JU84"
FT                   /db_xref="InterPro:IPR013354"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="UniProtKB/TrEMBL:A1JU84"
FT                   /inference="similar to sequence:UniProtKB:P40295"
FT                   /protein_id="CAL10050.1"
FT                   /translation="MNKITTRSPLEPEYQPLGKPHHDLQARVDFEQALLHNKDNRHPKE
FT                   EPRRPVRPHDLGKKEGQKGDGLRAHAPLAATFQPGREVGLKPQHNHQNNHDFNLSPLAE
FT                   GATNRKHLYQQDSRFDDRVESIINALMPLAPFLEGVTCETGTSSESPCEPFGHDELFVQ
FT                   QSPIDSAQPVQLNTKPTVQSLNPAADGAEVMIWSVGRDTLASIAKNQRDSRQKRLAEEP
FT                   LPLHQEALPEVCPPAVSTTPDDHLVARWCATPVAEVAEKSARFPHKATVQSEQLDMTEL
FT                   ADRSQHLTDGVDSSKDTIEPPRPEELLLPREETLPEMYSLSFTAPVITPGDHLLATMRA
FT                   TRLASVSEQLIQLAQRLAVELELRGGSSQVTQLHLNLPELGAIMVRIAEIPGKLHVELI
FT                   ASRETLRILAQGSYDLLERLQRIEPTQLDFQASGDSEQESRQKRHVYEEWEAEE"
FT   CDS_pept        21668..22591
FT                   /transl_table=11
FT                   /gene="yscQ"
FT                   /locus_tag="YEP0027"
FT                   /product="putative type III secretion protein"
FT                   /note="Previously sequenced: Yersinia enterocolitica YscQ
FT                   SWALL:Q9ZA78 (EMBL:AF102990) (307 aa) fasta scores: E():
FT                   2.9e-123, 100 38d in 307 aa. Also highly similar to
FT                   Yersinia pseudotuberculosis Yop proteins translocation
FT                   protein Q YscQ SWALL:YSCQ_YERPS (SWALL:P40296) (307 aa)
FT                   fasta scores: E(): 2.5e-121, 98.69 38d in 307 aa, and to
FT                   Yersinia pestis Yop proteins translocation protein Q YscQ
FT                   or ypcd1.43 or y0038 SWALL:YSCQ_YERPE (SWALL:P42713) (307
FT                   aa) fasta scores: E(): 9.4e-121, 98.04 38d in 307 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10051"
FT                   /db_xref="GOA:A1JU85"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR003283"
FT                   /db_xref="InterPro:IPR013385"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:A1JU85"
FT                   /inference="similar to sequence:UniProtKB:P40296"
FT                   /inference="similar to sequence:UniProtKB:P42713"
FT                   /protein_id="CAL10051.1"
FT                   /translation="MSLLTLPQAKLSELSLRQRLSHYRQNYLWEEGKLELTVSEPPSSL
FT                   NCILQLQWKGTHFTLYCFGDDLANWLTPDLLGAPFSTLPKELQLALLERQTVFLPKLVC
FT                   NDIATASLSVTQPLLSLRLSRDNAHISFWLTSAEALFALLPARPNSERIPLPILLSLRW
FT                   HKVYLTLDEVDSLRLGDVLLAPEGSGPNSPVLAYVGENPWGYFQLQSNKLEFIGMSHES
FT                   DELNPKPLTDLNQLPVQVSFEVGRQILDWHTLTSLEPGSLIDLTTPVDGEVRLLANGRL
FT                   LGHGRLVEIQGRLGVRIERLTEVTIS"
FT   misc_feature    22352..22582
FT                   /note="Pfam match to entry PF01052 SpoA, Surface
FT                   presentation of antigens (SPOA) protein, score
FT                   103.1,E-value 3.7e-28"
FT                   /inference="protein motif:PFAM:PF01052"
FT   CDS_pept        22588..23241
FT                   /transl_table=11
FT                   /gene="yscR"
FT                   /locus_tag="YEP0028"
FT                   /product="putative type III secretion protein"
FT                   /note="Previously sequenced: Yersinia enterocolitica YscR
FT                   SWALL:Q9ZA77 (EMBL:AF102990) (217 aa) fasta scores: E():
FT                   1.6e-80, 100 38d in 217 aa. Also highly similar to Yersinia
FT                   pestis, and Yersinia pseudotuberculosis Yop proteins
FT                   translocation protein R YscR or Ypcd1.44 or Y0037
FT                   SWALL:YSCR_YERPE (SWALL:P40297) (217 aa) fasta scores: E():
FT                   2.1e-80, 99.07 38d in 217 aa, and to Pseudomonas aeruginosa
FT                   translocation protein in type III secretion PscR or pa1693
FT                   SWALL:Q9I334 (EMBL:AE004596) (217 aa) fasta scores: E():
FT                   5.2e-66, 79.26 38d in 217 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10052"
FT                   /db_xref="GOA:A1JU86"
FT                   /db_xref="InterPro:IPR005773"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:A1JU86"
FT                   /inference="similar to sequence:UniProtKB:P40297"
FT                   /protein_id="CAL10052.1"
FT                   /translation="MIQLPDEINLIIILSLLTLLPLVSVMATSFVKFAVVFSLLRNALG
FT                   VQQIPPNMAMYGLAIILSLYVMAPVGFATQDYLQANEVSLTNIESVEKFFDEGLAPYRM
FT                   FLKQHIQAQEYSFFVDSTKQLWPKQYADRLESDSLFILLPAFTVSELTRAFEIGFLIYL
FT                   PFIVIDLVISNILLAMGMMMVSPMTISLPFKLLLFVLLDGWTRLTHGLVISYGG"
FT   sig_peptide     22588..22689
FT                   /gene="yscR"
FT                   /locus_tag="YEP0028"
FT                   /note="Signal peptide predicted for YEP.32 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.930) with cleavage site
FT                   probability 0.437 between residues 34 and 35"
FT   misc_feature    order(22612..22680,22738..22806,23062..23130)
FT                   /note="3 probable transmembrane helices predicted for
FT                   YEP.32 by TMHMM2.0 at aa 9-31, 51-73 and 159-181"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    22624..23223
FT                   /note="Pfam match to entry PF00813 FliP, FliP family ,score
FT                   460.9, E-value 7.6e-136"
FT                   /inference="protein motif:PFAM:PF00813"
FT   misc_feature    23017..23064
FT                   /note="PS01060 Flagella transport protein fliP family
FT                   signature 1."
FT                   /inference="protein motif:Prosite:PS01060"
FT   misc_feature    23161..23199
FT                   /note="PS01061 Flagella transport protein fliP family
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS01061"
FT   CDS_pept        23243..23509
FT                   /transl_table=11
FT                   /gene="yscS"
FT                   /locus_tag="YEP0029"
FT                   /product="putative type III secretion protein"
FT                   /note="Previously sequenced: Yersinia enterocolitica YscS
FT                   SWALL:AAD16829 (EMBL:AF102990) (88 aa) fasta scores: E():
FT                   1.5e-30, 100 38d in 88 aa. Also highly similar to Yersinia
FT                   pestis, and Yersinia pseudotuberculosis yop proteins
FT                   translocation protein S YscS or ypcd1.45 or y0036
FT                   SWALL:YSCS_YERPE (SWALL:P40298) (88 aa) fasta scores: E():
FT                   1.5e-30, 100 38d in 88 aa, and to Pseudomonas aeruginosa
FT                   probable translocation protein in type III secretion Pa1692
FT                   SWALL:Q9I335 (EMBL:AE004596) (88 aa) fasta scores: E():
FT                   3.6e-23, 75 38d in 88 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10053"
FT                   /db_xref="GOA:A1JU87"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006306"
FT                   /db_xref="UniProtKB/TrEMBL:A1JU87"
FT                   /inference="similar to sequence:UniProtKB:P40298"
FT                   /protein_id="CAL10053.1"
FT                   /translation="MSQGDIIHFTSQALWLVLVLSMPPVLVAAVVGTLVSLVQALTQIQ
FT                   EQTLGFVIKLIAVVVTLFATASWLGNELHSFAEMTMMKIQGIR"
FT   sig_peptide     23243..23326
FT                   /gene="yscS"
FT                   /locus_tag="YEP0029"
FT                   /note="Signal peptide predicted for YEP.33 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.921) with cleavage site
FT                   probability 0.713 between residues 28 and 29"
FT   misc_feature    23252..23479
FT                   /note="Pfam match to entry PF01313 Bac_export_3, Bacterial
FT                   export proteins, family 3, score 153.1, E-value 3.3e-43"
FT                   /inference="protein motif:PFAM:PF01313"
FT   misc_feature    order(23279..23347,23384..23452)
FT                   /note="2 probable transmembrane helices predicted for
FT                   YEP.33 by TMHMM2.0 at aa 13-35 and 48-70"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        23506..24291
FT                   /transl_table=11
FT                   /gene="yscT"
FT                   /locus_tag="YEP0030"
FT                   /product="putative type III secretion protein"
FT                   /note="Previously sequenced: Yersinia enterocolitica YscT
FT                   SWALL:Q93KT5 (EMBL:AF336309) (261 aa) fasta scores: E():
FT                   3e-95, 100 38d in 261 aa. Also highly similar to Yersinia
FT                   pestis, and Yersinia pseudotuberculosis yop proteins
FT                   translocation protein T YscT or Ypcd1.46 or Y0035
FT                   SWALL:YSCT_YERPE (SWALL:P40299) (261 aa) fasta scores: E():
FT                   5.2e-94, 98.85 38d in 261 aa, and to Pseudomonas aeruginosa
FT                   translocation protein in type III secretion PscT or Pa1691
FT                   SWALL:Q9I336 (EMBL:AE004596) (262 aa) fasta scores: E():
FT                   1.9e-65, 68.34 38d in 259 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10054"
FT                   /db_xref="GOA:A1JU88"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006304"
FT                   /db_xref="UniProtKB/TrEMBL:A1JU88"
FT                   /inference="similar to sequence:UniProtKB:P40299"
FT                   /protein_id="CAL10054.1"
FT                   /translation="MIADLIQRPLLTYTLLLPRFMACFVILPVLSKQLLGGVLLRNGIV
FT                   CSLALYVYPAVANQPYIEVDAFTLMLLIGKEFILGLLIGFVATIPFWALESAGFIVDNQ
FT                   RGAAMASLLNPGLDSQTSPTGLLLTQTLITIFFSGGAFLSLLSALFHSYVNWPVASFFP
FT                   EVSEQWVDFFYNQFSQILLIAAVLAAPLLIAMFLAEFGLALISRFAPSLNVFVLAMPIK
FT                   SAIASLLLVIYCMQMMSHASKVMLLVMDPISLLIPVLEK"
FT   misc_feature    23521..24264
FT                   /note="Pfam match to entry PF01311 Bac_export_1, Bacterial
FT                   export proteins, family 1, score 381.6, E-value 5.7e-112"
FT                   /inference="protein motif:PFAM:PF01311"
FT   misc_feature    order(23533..23598,23617..23676,23734..23802,23899..23967,
FT                   24043..24111,24145..24213)
FT                   /note="6 probable transmembrane helices predicted for
FT                   YEP.34 by TMHMM2.0 at aa 10-31, 38-57, 77-99,
FT                   132-154,180-202 and 214-236"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        24291..25355
FT                   /transl_table=11
FT                   /gene="yscU"
FT                   /locus_tag="YEP0031"
FT                   /product="putative type III secretion protein"
FT                   /note="Previously sequenced: Yersinia enterocolitica YscU
FT                   SWALL:Q93KT4 (EMBL:AF336309) (354 aa) fasta scores: E():
FT                   2.5e-130, 100 38d in 354 aa. Also highly similar to
FT                   Yersinia pestis, and Yersinia pseudotuberculosis yop
FT                   proteins translocation protein U YscU or Ypcd1.47 or Y0034
FT                   SWALL:YSCU_YERPE (SWALL:P40300) (354 aa) fasta scores: E():
FT                   3.6e-129, 99.15 38d in 354 aa, and to Pseudomonas
FT                   aeruginosa translocation protein in type iii secretion pscu
FT                   or pa1690 SWALL:Q9I337 (EMBL:AE004596) (349 aa) fasta
FT                   scores: E(): 6.3e-91, 66.85 38d in 347 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10055"
FT                   /db_xref="GOA:A1JU89"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006307"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:A1JU89"
FT                   /inference="similar to sequence:UniProtKB:P40300"
FT                   /protein_id="CAL10055.1"
FT                   /translation="MSGEKTEQPTPKKIRDARKKGQVAKSKEVVSTALIVALSAMLMGL
FT                   SDYYFEHLSRLMLIPAEQSYLPFSQALSYVVDNVLLEFFYLCFPLLTVAALMAIASHVV
FT                   QYGFLISGEAIKPDIKKINPIEGAKRIFSIKSLVEFLKSILKVVLLSILIWIIIKGNLV
FT                   TLLQLPTCGIECITPLLGQILRQLMVICTVGFVVISIADYAFEYYQYIKELKMSKDEIK
FT                   REYKEMEGSPEIKSKRRQFHQEIQSGNMRENVKRSSVVVANPTHIAIGILYKRGETPLP
FT                   LVTFKYTDAQVQTVRKIAEEEGVPILQRIPLARALYWDALVDHYIPAEQIEATAEVLRW
FT                   LERQNIEKQHSEML"
FT   misc_feature    24291..25316
FT                   /note="Pfam match to entry PF01312 Bac_export_2, FlhB HrpN
FT                   YscU SpaS Family, score 678.1, E-value 3.2e-201"
FT                   /inference="protein motif:PFAM:PF01312"
FT   misc_feature    order(24372..24440,24525..24593,24696..24764,24846..24914)
FT                   /note="4 probable transmembrane helices predicted for
FT                   YEP.35 by TMHMM2.0 at aa 28-50, 79-101, 136-158 and
FT                   186-208"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        25931..26326
FT                   /transl_table=11
FT                   /gene="virG"
FT                   /locus_tag="YEP0033"
FT                   /product="putative type III secretion effector targeting
FT                   lipoprotein"
FT                   /note="Previously sequenced: Yersinia enterocolitica
FT                   lipoprotein VirG SWALL:Q56851 (EMBL:AF102990) (131 aa)
FT                   fasta scores: E(): 3e-51, 100 38d in 131 aa. Also highly
FT                   similar to Yersinia pestis pre-lipoprotein VirG or YscW or
FT                   Ypcd1.48 SWALL:O68694 (EMBL:AF053946) (131 aa) fasta
FT                   scores: E(): 3.2e-49, 96.18 38d in 131 aa, and to
FT                   Pseudomonas aeruginosa exoenzyme S synthesis protein B ExsB
FT                   or Pa1712 SWALL:EXSB_PSEAE (SWALL:P26994) (137 aa) fasta
FT                   scores: E(): 3.1e-06, 29.54 38d in 132 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10056"
FT                   /db_xref="InterPro:IPR013400"
FT                   /db_xref="InterPro:IPR039366"
FT                   /db_xref="UniProtKB/TrEMBL:A1JU90"
FT                   /inference="similar to sequence:UniProtKB:P26994"
FT                   /protein_id="CAL10056.1"
FT                   /translation="MSRIIALIISFLLVGCATPPMPAQRIVGEVRMSRPLSRTAHIDVS
FT                   IFGLYEGKVREVQRTRFETGNLPLFFSIKLNPAQRGEGELYLRSTLSFPERGVQAVAQQ
FT                   KLIGKNKVVLQMIPKTCYPNCQSPNTR"
FT   sig_peptide     25931..26005
FT                   /gene="virG"
FT                   /locus_tag="YEP0033"
FT                   /note="Signal peptide predicted for YEP.37 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.867) with cleavage site
FT                   probability 0.683 between residues 25 and 26"
FT   misc_feature    25946..25978
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        26450..27265
FT                   /transl_table=11
FT                   /gene="virF"
FT                   /locus_tag="YEP0035"
FT                   /product="virulence regulon transcriptional activator"
FT                   /note="Previously sequenced: Yersinia enterocolitica
FT                   virulence regulon transcriptional activator VirF
FT                   SWALL:VIRF_YEREN (SWALL:P13225) (271 aa) fasta scores: E():
FT                   9.7e-110, 98.52 38d in 271 aa. Also highly similar to
FT                   Yersinia pestis thermoregulatory protein LcrF or ypcd1.49
FT                   or y0032 SWALL:LCRF_YERPE (SWALL:P28808) (271 aa) fasta
FT                   scores: E(): 1.3e-108, 97.78 38d in 271 aa and to
FT                   Pseudomonas aeruginosa exoenzyme S synthesis regulatory
FT                   protein ExsA or pa1713 SWALL:EXSA_PSEAE (SWALL:P26993) (278
FT                   aa) fasta scores: E(): 1.3e-57, 57.41 38d in 263 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10057"
FT                   /db_xref="GOA:A1JU91"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JU91"
FT                   /inference="similar to sequence:UniProtKB:P13225"
FT                   /inference="similar to sequence:UniProtKB:P28808"
FT                   /inference="similar to sequence:UniProtKB:P26993"
FT                   /protein_id="CAL10057.1"
FT                   /translation="MASLEIIKLEWATPIFKVVEHSQDGLYILLQGQVSWQNSSQTYDL
FT                   DEGNMLFLRRGSYAVRCGTKEPCQLLWIPLPGSFLSTFLHRFGSLLSEIRRDNSTPKPL
FT                   LIFNISPILSQSIQNLCAILERSDFPSVLTQLRIEELLLLLAFSSQGTLFLSALRHLGN
FT                   RPEERLQKFMEENYLQGWKLSKFAREFGMGLTTFKELFGTVYGISPRAWISERRILYAH
FT                   QLLLNCKMSIVDIAMEAGFSSQSYFTQSYRRRFGCTPSQARLTKIATTG"
FT   misc_feature    26954..27091
FT                   /note="Pfam match to entry PF00165 HTH_AraC, Bacterial
FT                   regulatory helix-turn-helix proteins, araC family, score
FT                   33.4, E-value 3.7e-07"
FT                   /inference="protein motif:PFAM:PF00165"
FT   misc_feature    27098..27226
FT                   /note="PS00041 Bacterial regulatory proteins, araC family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00041"
FT   misc_feature    27110..27241
FT                   /note="Pfam match to entry PF00165 HTH_AraC, Bacterial
FT                   regulatory helix-turn-helix proteins, araC family, score
FT                   53.8, E-value 2.7e-13"
FT                   /inference="protein motif:PFAM:PF00165"
FT   CDS_pept        27345..27443
FT                   /transl_table=11
FT                   /gene="yscA"
FT                   /locus_tag="YEP0036"
FT                   /product="conserved hypothetical hydrophobic protein"
FT                   /note="doubtful CDS. Previously sequenced: Yersinia
FT                   enterocolitica yop proteins translocation protein A YscA
FT                   SWALL:YSCA_YEREN (SWALL:Q01242) (32 aa) fasta scores: E():
FT                   9.5e-14, 100 38d in 32 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10058"
FT                   /db_xref="GOA:A1JU92"
FT                   /db_xref="InterPro:IPR035181"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JU92"
FT                   /inference="similar to sequence:UniProtKB:Q01242"
FT                   /protein_id="CAL10058.1"
FT                   /translation="MSQITTKHITVLFRRWMAIICCLIIKIAYLAY"
FT   misc_feature    27378..27437
FT                   /note="1 probable transmembrane helix predicted for YEP.40
FT                   by TMHMM2.0 at aa 12-31"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        27668..28081
FT                   /transl_table=11
FT                   /gene="yscB"
FT                   /locus_tag="YEP0037"
FT                   /product="conserved hypothetical protein"
FT                   /note="Previously sequenced: Yersinia enterocolitica YscB
FT                   SWALL:Q93KT2 (EMBL:AF336309) (137 aa) fasta scores: E():
FT                   1.5e-52, 100 38d in 137 aa. Also highly similar to Yersinia
FT                   pestis KIM5 YscB or Ypcd1.51 SWALL:Q56973 (EMBL:M83225)
FT                   (137 aa) fasta scores: E(): 1.7e-51, 97.81 id in 137 aa,
FT                   and to Pseudomonas aeruginosa PscB SWALL:P95430
FT                   (EMBL:U56077) (140 aa) fasta scores: E(): 8.4e-16, 43.41
FT                   38d in 129 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0037"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10059"
FT                   /db_xref="GOA:A1JU93"
FT                   /db_xref="InterPro:IPR010261"
FT                   /db_xref="InterPro:IPR013353"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JU93"
FT                   /protein_id="CAL10059.1"
FT                   /translation="MQNLLKNLATSLGREPFVADKQGVYRLTIDKHLVMLAPHGSELVL
FT                   RTPIDAPMLREGNNVNVTLLRSLMQQALAWAKRYPQTLVLDDCGQLVLEARLRLQELDT
FT                   HGLQEVINKQLALLEYLIPQLTPFSVASRVGWN"
FT   CDS_pept        28087..29910
FT                   /transl_table=11
FT                   /gene="yscC"
FT                   /locus_tag="YEP0038"
FT                   /product="putative type III secretion protein"
FT                   /note="Previously sequenced: Yersinia enterocolitica yop
FT                   proteins translocation protein C precursor YscC
FT                   SWALL:YSCC_YEREN (SWALL:Q01244) (607 aa) fasta scores: E():
FT                   0, 99.17 38d in 607 aa. Also highly similar to Yersinia
FT                   pestis KIM5 or Yscc or Ypcd1.52 SWALL:Q56974 (EMBL:M83225)
FT                   (607 aa) fasta scores: E(): 0, 98.35 38d in 607 aa, and to
FT                   Pseudomonas aeruginosa type III secretion protein PscC or
FT                   pa1716 SWALL:Q9I319 (EMBL:AE004598) (600 aa) fasta scores:
FT                   E(): 2.2e-146, 62.74 38d in 604 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0038"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10060"
FT                   /db_xref="GOA:A1JU94"
FT                   /db_xref="InterPro:IPR003522"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:A1JU94"
FT                   /inference="similar to sequence:UniProtKB:Q01244"
FT                   /protein_id="CAL10060.1"
FT                   /translation="MAFPLHSFFKRVLTGTLLLLSSYSWAQELDWLPIPYVYVAKGESL
FT                   RDLLTDFGANYDATVVVSDKINDKVSGQFEHDNPQDFLQHIASLYNLVWYYDGNVLYIF
FT                   KNSEVASRLIRLQESEAAELKQALQRSGIWEPRFGWRPDASNRLVYVSGPPRYLELVEQ
FT                   TAAALEQQTQIRSEKTGALAIEIFPLKYASASDRTIHYRDDEVAAPGVATILQRVLSDA
FT                   TIQQVTVDNQRIPQVATRASAQARVEADPSLNAIIVRDSPERMPMYQRLIHALDKPSAR
FT                   IEVALSIVDINADQLTELGVDWRVGIRTGNNHQVVIKTTGDQSNIASNGALGSLIDARG
FT                   LDYLLARVNLLENEGSAQVVSRPTLLTQENAQAVIDHSETYYVKVTGKEVAELKGITYG
FT                   TMLRMTPRVLTQGDKSEISLNLHIEDGNQKPNSSGIEGIPTISRTVVDTVARVGHGQSL
FT                   IIGGIYRDELSVALSKVPLLGDIPYLGALFRRKSELTRRTVRLFIIEPRIIDEGIAHHL
FT                   ALGNGQDLRTGILAVDEISNQSTTLNKLLGGSQCQPLNKAQEVQKWLSQNNKSSYLTQC
FT                   KMDKSLGWRVVEGACTPAESWCVSAPKRGVL"
FT   sig_peptide     28087..28164
FT                   /gene="yscC"
FT                   /locus_tag="YEP0038"
FT                   /note="Signal peptide predicted for YEP.42 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 1.000 between residues 26 and 27"
FT   misc_feature    28417..28608
FT                   /note="Pfam match to entry PF03958 GSPII_III_N, Bacterial
FT                   type II/III secretion system short domain, score
FT                   48.3,E-value 1.2e-11"
FT                   /inference="protein motif:PFAM:PF03958"
FT   misc_feature    28636..28929
FT                   /note="Pfam match to entry PF03958 GSPII_III_N, Bacterial
FT                   type II/III secretion system short domain, score
FT                   110.3,E-value 2.7e-30"
FT                   /inference="protein motif:PFAM:PF03958"
FT   misc_feature    28933..29616
FT                   /note="Pfam match to entry PF00263 GSPII_III, Bacterial
FT                   type II and III secretion system protein, score
FT                   267.5,E-value 1.2e-77"
FT                   /inference="protein motif:PFAM:PF00263"
FT   misc_feature    29449..29550
FT                   /note="PS00875 Bacterial type II secretion system protein D
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00875"
FT   CDS_pept        29907..31163
FT                   /transl_table=11
FT                   /gene="yscD"
FT                   /locus_tag="YEP0039"
FT                   /product="putative type III secretion protein"
FT                   /note="Previously sequenced: Yersinia enterocolitica yop
FT                   proteins translocation protein D YscD SWALL:YSCD_YEREN
FT                   (SWALL:Q01245) (418 aa) fasta scores: E(): 5.1e-158,99.04
FT                   38d in 418 aa. Also highly similar to Yersinia pestis kim5
FT                   YscD or Ypcd1.53 SWALL:Q56975 (EMBL:M83225) (419 aa) fasta
FT                   scores: E(): 1.1e-156, 98.56 38d in 419 aa and to
FT                   Pseudomonas aeruginosa PscD SWALL:P95432 (EMBL:U56077) (432
FT                   aa) fasta scores: E(): 1.5e-59, 44.41 id in 421 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10061"
FT                   /db_xref="GOA:A1JU95"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR012843"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="InterPro:IPR032034"
FT                   /db_xref="UniProtKB/TrEMBL:A1JU95"
FT                   /inference="similar to sequence:UniProtKB:Q01245"
FT                   /protein_id="CAL10061.1"
FT                   /translation="MSWVCRFYQGKHRGVEVELPHGRCVFGSDPLQSDIVLSDSEIAPV
FT                   HLVLMVDEEGIRLTDSAEPLLQEGLPVPLGTLLRAGSCLEVGFLLWTFVAVGQPLPETL
FT                   QVPTQRKEPTDRLPRSRLGIVLGVLSLLLLLTFLGMLGHGLWREYNQDGQLVEQEVRRL
FT                   LATAAYKDVVLTSPKEGEPWLLTGYIQDNHARLSLQNFLESHGIPFRLELRSMEELRQG
FT                   AEFILQRLGYHGIEVSLAPQAGWLQLNGEVSEEIQKQKIDSLLQAEVPGLLGVENKVRI
FT                   AGNQRKRLDALLEQFGLDSDFTVNVKGELIELRGQVNDEKLSSFNQLQQTFRQEFGNRP
FT                   KLELVNVGGQPQHDELNFEVQAISLGKVPYVVLDNHQRYPEGAILNNGVRILAIRRDAV
FT                   IVSKGKREFVIQLNGGKPQ"
FT   misc_feature    30276..30344
FT                   /note="1 probable transmembrane helix predicted for YEP.43
FT                   by TMHMM2.0 at aa 124-146"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        31160..31363
FT                   /transl_table=11
FT                   /gene="yscE"
FT                   /locus_tag="YEP0040"
FT                   /product="putative type III secretion protein"
FT                   /note="Previously sequenced: Yersinia enterocolitica
FT                   putative yop proteins translocation protein E YscE
FT                   SWALL:YSCE_YEREN (SWALL:Q01246) (66 aa) fasta scores: E():
FT                   3.3e-23, 96.97 38d in 66 aa. Also highly similar to
FT                   Yersinia pestis yop proteins translocation protein E
FT                   homolog YscE or Ypcd1.54 SWALL:O68692 (EMBL:AF053946) (66
FT                   aa) fasta scores: E(): 7.7e-23, 93.93 38d in 66 aa, and to
FT                   Pseudomonas aeruginosa PscE SWALL:P95433 (EMBL:U56077) (67
FT                   aa) fasta scores: E(): 0.091, 27.27 38d in 66 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10062"
FT                   /db_xref="GOA:A1JU96"
FT                   /db_xref="InterPro:IPR012671"
FT                   /db_xref="UniProtKB/TrEMBL:A1JU96"
FT                   /inference="similar to sequence:UniProtKB:Q01246"
FT                   /protein_id="CAL10062.1"
FT                   /translation="MTQLEEQLHNVETVRSITMQLEMALAKLKKDMMRGGDAKQYQVWQ
FT                   SESKAIESAIAIIHYVTGDLKK"
FT   CDS_pept        31360..31623
FT                   /transl_table=11
FT                   /gene="yscF"
FT                   /locus_tag="YEP0041"
FT                   /product="putative type III secretion protein"
FT                   /note="Previously sequenced: Yersinia enterocolitica yop
FT                   proteins translocation protein F YscF SWALL:YSCF_YEREN
FT                   (SWALL:Q01247) (87 aa) fasta scores: E(): 1.1e-27, 94.25 id
FT                   in 87 aa. Also highly similar to Yersinia pestis yop
FT                   proteins translocation protein F homolog YscF or ypcd1.55
FT                   SWALL:O68691 (EMBL:AF053946) (87 aa) fasta scores: E():
FT                   2.4e-27, 93.1 38d in 87 aa, and to Pseudomonas aeruginosa
FT                   PscF or pa1719 SWALL:P95434 (EMBL:U56077) (85 aa) fasta
FT                   scores: E(): 2.7e-13, 68.05 38d in 72 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10063"
FT                   /db_xref="GOA:A1JU97"
FT                   /db_xref="InterPro:IPR011841"
FT                   /db_xref="InterPro:IPR021123"
FT                   /db_xref="InterPro:IPR037203"
FT                   /db_xref="UniProtKB/TrEMBL:A1JU97"
FT                   /inference="similar to sequence:UniProtKB:Q01247"
FT                   /protein_id="CAL10063.1"
FT                   /translation="MSNFSGFAKGTDITDLDAVAQTLKKPADGANKAVNDSIAALKETP
FT                   DNPALLADLQHSINKWSVIYNISSTIVRSMKDLMQGILQKFP"
FT   CDS_pept        31625..31972
FT                   /transl_table=11
FT                   /gene="yscG"
FT                   /locus_tag="YEP0042"
FT                   /product="putative type III secretion protein"
FT                   /note="Previously sequenced: Yersinia enterocolitica
FT                   putative yop proteins translocation protein G YscG
FT                   SWALL:YSCG_YEREN (SWALL:Q01248) (115 aa) fasta scores: E():
FT                   3.7e-45, 96.52 38d in 115 aa. Also highly similar to
FT                   Yersinia pestis yop proteins translocation protein G
FT                   homolog YscG or Ypcd1.56 SWALL:O68690 (EMBL:AF053946) (115
FT                   aa) fasta scores: E(): 3.5e-44, 96.52 38d in 115 aa, and to
FT                   Pseudomonas aeruginosa PscG or Pa1720 SWALL:P95435
FT                   (EMBL:U56077) (115 aa) fasta scores: E(): 4.5e-21, 55.14 id
FT                   in 107 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10064"
FT                   /db_xref="GOA:A1JU98"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013348"
FT                   /db_xref="UniProtKB/TrEMBL:A1JU98"
FT                   /inference="similar to sequence:UniProtKB:Q01248"
FT                   /protein_id="CAL10064.1"
FT                   /translation="MKYKLNVLLAEIALIGTGNHCHEEANCIAEWLHLKGEEEAVQLIH
FT                   LSSLMNRGDYASALQQGNKSAYPDLEPWLALCEYRLGLGNALESRLNRLARSQDPRIQT
FT                   FVNGMREQLKT"
FT   CDS_pept        31969..32466
FT                   /transl_table=11
FT                   /gene="yscH"
FT                   /locus_tag="YEP0043"
FT                   /product="putative type III secretion protein"
FT                   /note="Previously sequenced: Yersinia enterocolitica yop
FT                   proteins translocation protein H YscH SWALL:YSCH_YEREN
FT                   (SWALL:Q01249) (165 aa) fasta scores: E(): 8.6e-58, 98.18
FT                   id in 165 aa. Also highly similar to Yersinia pestis, and
FT                   Yersinia pseudotuberculosis yop proteins translocation
FT                   protein H YscH or lcrp or ypcd1.57 or y0024
FT                   SWALL:YSCH_YERPE (SWALL:Q00929) (165 aa) fasta scores: E():
FT                   5.7e-56, 96.97 38d in 165 aa, and to Pseudomonas aeruginosa
FT                   type III export protein PscH or Pa1721 SWALL:Q9I316
FT                   (EMBL:AE004598) (143 aa) fasta scores: E(): 0.0003, 36.55
FT                   38d in 93 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10065"
FT                   /db_xref="GOA:A1JU99"
FT                   /db_xref="InterPro:IPR013349"
FT                   /db_xref="InterPro:IPR041814"
FT                   /db_xref="UniProtKB/TrEMBL:A1JU99"
FT                   /inference="similar to sequence:UniProtKB:Q01249"
FT                   /inference="similar to sequence:UniProtKB:Q00929"
FT                   /protein_id="CAL10065.1"
FT                   /translation="MTVTLNRGSITSLMSSSQAVSTLQPVESELKTQLEHKLKSESAEK
FT                   TREVLWQQYYASNPPDHAVLEVLATPVREALLARFGQHQGPVVPAIDLPELRSVLQQFD
FT                   SFGKRREAILLQVLEGIKPNESQVGLPYLSELINKELMILLPYNSIVDSLLHNSHQIDM
FT                   DT"
FT   sig_peptide     31969..32025
FT                   /gene="yscH"
FT                   /locus_tag="YEP0043"
FT                   /note="Signal peptide predicted for YEP.47 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.940) with cleavage site
FT                   probability 0.622 between residues 19 and 20"
FT   CDS_pept        32467..32814
FT                   /transl_table=11
FT                   /gene="yscI"
FT                   /locus_tag="YEP0044"
FT                   /product="putative type III secretion protein"
FT                   /note="Previously sequenced: Yersinia enterocolitica yop
FT                   proteins translocation protein I YscI SWALL:YSCI_YEREN
FT                   (SWALL:Q01250) (115 aa) fasta scores: E(): 2e-40, 99.13 id
FT                   in 115 aa. Also highly similar to Yersinia pestis, and
FT                   Yersinia pseudotuberculosis yop proteins translocation
FT                   protein I YscI or lcro or ypcd1.58 or y0023
FT                   SWALL:YSCI_YERPE (SWALL:Q00933) (115 aa) fasta scores: E():
FT                   2.6e-39, 95.65 38d in 115 aa, and to Pseudomonas aeruginosa
FT                   type III export protein PscI or pa1722 SWALL:Q9I315
FT                   (EMBL:AE004598) (112 aa) fasta scores: E(): 5e-13, 50.46
FT                   38d in 107 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10066"
FT                   /db_xref="GOA:A1JUA0"
FT                   /db_xref="InterPro:IPR012670"
FT                   /db_xref="UniProtKB/TrEMBL:A1JUA0"
FT                   /inference="similar to sequence:UniProtKB:Q01250"
FT                   /inference="similar to sequence:UniProtKB:Q00933"
FT                   /protein_id="CAL10066.1"
FT                   /translation="MPNIEIAQADEVIITTLEEFGPVEPTTEQIMRFDAAMSEDTQGLG
FT                   HSLLKEVSDIQKTFKTAKSDLHTKLAVSVDNPNDLMLMQWSLIRITIQEELIAKTAGRM
FT                   SQNVETLSKGG"
FT   CDS_pept        32821..33555
FT                   /transl_table=11
FT                   /gene="yscJ"
FT                   /locus_tag="YEP0045"
FT                   /product="type III secretion lipoprotein"
FT                   /note="Previously sequenced: Yersinia enterocolitica yop
FT                   proteins translocation lipoprotein J precursor YscJ or YlpB
FT                   SWALL:YSCJ_YEREN (SWALL:Q01251) (244 aa) fasta scores: E():
FT                   4.9e-87, 100 38d in 244 aa. Also highly similar to Yersinia
FT                   pestis, and Yersinia pseudotuberculosis yop proteins
FT                   translocation lipoprotein J precursor YscJ or YlpB or LcrkA
FT                   or Ypcd1.59 or y0022 SWALL:YSCJ_YERPE (SWALL:Q00926) (244
FT                   aa) fasta scores: E(): 1.3e-86, 99.59 38d in 244 aa, and to
FT                   Pseudomonas aeruginosa type iii export protein PscJ or
FT                   pa1723 SWALL:Q9I314 (EMBL:AE004598) (248 aa) fasta scores:
FT                   E(): 1.5e-62, 71.54 38d in 239 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10067"
FT                   /db_xref="GOA:A1JUA1"
FT                   /db_xref="InterPro:IPR003282"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="UniProtKB/TrEMBL:A1JUA1"
FT                   /inference="similar to sequence:UniProtKB:Q01251"
FT                   /inference="similar to sequence:UniProtKB:Q00926"
FT                   /protein_id="CAL10067.1"
FT                   /translation="MKVKTSLSTLILILFLTGCKVDLYTGISQKEGNEMLALLRQEGLS
FT                   ADKEPDKDGKIKLLVEESDVAQAIDILKRKGYPHESFSTLQDVFPKDGLISSPIEELAR
FT                   LNYAKAQEISRTLSEIDGVLVARVHVVLPEEQNNKGKKGVAASASVFIKHAADIQFDTY
FT                   IPQIKQLVNNSIEGLAYDRISVILVPSVDVRQSSHLPRNTSILSIQVSEESKGRLIGLL
FT                   SLLILLLPVTNLAQYFWLQRKK"
FT   sig_peptide     32821..32883
FT                   /gene="yscJ"
FT                   /locus_tag="YEP0045"
FT                   /note="Signal peptide predicted for YEP.49 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.734) with cleavage site
FT                   probability 0.218 between residues 21 and 22"
FT   misc_feature    32821..33405
FT                   /note="Pfam match to entry PF01514 YscJ_FliF, Secretory
FT                   protein of YscJ/FliF family, score 335.3, E-value 4.9e-98"
FT                   /inference="protein motif:PFAM:PF01514"
FT   misc_feature    32845..32877
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    33472..33540
FT                   /note="1 probable transmembrane helix predicted for YEP.49
FT                   by TMHMM2.0 at aa 218-240"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        33555..34184
FT                   /transl_table=11
FT                   /gene="yscK"
FT                   /locus_tag="YEP0046"
FT                   /product="type III secretion protein"
FT                   /note="Previously sequenced:Yersinia enterocolitica yop
FT                   proteins translocation protein K YscK SWALL:YSCK_YEREN
FT                   (SWALL:Q01252) (209 aa) fasta scores: E(): 2.7e-86, 99.52
FT                   id in 209 aa. Also highly similar to Yersinia pestis, and
FT                   Yersinia pseudotuberculosis yop proteins translocation
FT                   protein k ysck or lcrkb or ypcd1.60 or y0021
FT                   SWALL:YSCK_YERPE (SWALL:Q00927) (209 aa) fasta scores: E():
FT                   2.4e-86, 99.52 38d in 209 aa, and to Pseudomonas aeruginosa
FT                   type iii export protein PscK or Pa1724 SWALL:Q9I313
FT                   (EMBL:AE004598) (208 aa) fasta scores: E(): 4.6e-27, 40.97
FT                   38d in 205 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0046"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10068"
FT                   /db_xref="GOA:A1JUA2"
FT                   /db_xref="InterPro:IPR009510"
FT                   /db_xref="UniProtKB/TrEMBL:A1JUA2"
FT                   /inference="similar to sequence:UniProtKB:Q01252"
FT                   /inference="similar to sequence:UniProtKB:Q00927"
FT                   /protein_id="CAL10068.1"
FT                   /translation="MMENYITSFQLRFCPAAYLHLEQLPSLWRSILPYLPQWRDSAHLN
FT                   AALLDEFSLDTDYEEPHGLGALPLQPQSQLELLLCRLGLVLHGEAIRRCVLASPLQQLL
FT                   TLVNQETLRQIIVQHELLIGPWPTHWQRPLPTEIESRTMIQSGLAFWLAAMEPQPQAWC
FT                   KRLSLRLPLATPSEPWLVAESQRPLAQTLCHKLVKQVMPTCSHLFK"
FT   CDS_pept        34130..34801
FT                   /transl_table=11
FT                   /gene="yscL"
FT                   /locus_tag="YEP0047"
FT                   /product="yop proteins translocation protein L"
FT                   /product="putative type III secretion protein"
FT                   /note="Previously sequenced as: Yersinia enterocolitica yop
FT                   proteins translocation protein L YscL SWALL:YSCL_YEREN
FT                   (SWALL:Q01253) (223 aa) fasta scores: E(): 5.2e-75, 98.65
FT                   id in 223 aa. Also highly similar to Pseudomonas aeruginosa
FT                   type III export protein PscL or pa1725 SWALL:Q9I312
FT                   (EMBL:AE004598) (214 aa) fasta scores: E(): 1.4e-38, 56.58
FT                   38d in 205 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10069"
FT                   /db_xref="InterPro:IPR012842"
FT                   /db_xref="InterPro:IPR018035"
FT                   /db_xref="UniProtKB/TrEMBL:A1JUA3"
FT                   /inference="similar to sequence:UniProtKB:Q01253"
FT                   /protein_id="CAL10069.1"
FT                   /translation="MSQTCQTGYAYMQPFVQIIPSNLSLACGLRILRAEDYQSSLTTEE
FT                   LISAAKQDAEKILADAQEVYEQQKQLGWQAGMDEARTLQATLIHETQLQCQQFYRHVEQ
FT                   QMSEVVLLAVRKILNDYDQVDVTLQVVREALALVSNQKQVVVRVNPDQAGAIREQIAKV
FT                   HKDFPEISYLEVTADARLDQGGCILETEVGIIDASIDGQIEALSRAISTTLGQMKVIEE
FT                   E"
FT   misc_feature    34178..34210
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        35020..35367
FT                   /transl_table=11
FT                   /gene="yscM"
FT                   /locus_tag="YEP0048"
FT                   /product="yop proteins translocation protein M"
FT                   /product="putative type III secretion regulatory protein"
FT                   /note="Previously sequenced as: Yersinia enterocolitica yop
FT                   proteins translocation protein M YscM SWALL:YSCM_YEREN
FT                   (SWALL:Q01254) (115 aa) fasta scores: E(): 1.8e-41, 100 id
FT                   in 115 aa, and to Yersinia pestis, and Yersinia
FT                   pseudotuberculosis yop proteins translocation protein m
FT                   yscm or lcrq or ypcd1.62 or y0019 SWALL:YSCM_YERPE
FT                   (SWALL:Q00930) (115 aa) fasta scores: E(): 3.3e-41, 99.13
FT                   id in 115 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10070"
FT                   /db_xref="GOA:A1JUA4"
FT                   /db_xref="InterPro:IPR015103"
FT                   /db_xref="InterPro:IPR036484"
FT                   /db_xref="UniProtKB/TrEMBL:A1JUA4"
FT                   /inference="similar to sequence:UniProtKB:Q01254"
FT                   /inference="similar to sequence:UniProtKB:Q00930"
FT                   /protein_id="CAL10070.1"
FT                   /translation="MKINTLQSLINQQITQVGHGGQAGRLTETNPLTENSHQISTAEKA
FT                   FASEVLEHVKNTALSRHDIACLLPRVSNLELKQGKAGEVIVTGLRTEQLSLSDAKLLLE
FT                   AAMRQDTAADG"
FT   CDS_pept        35593..35760
FT                   /transl_table=11
FT                   /locus_tag="YEP0049"
FT                   /product="hypothetical protein"
FT                   /note="doubtful CDS with no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10071"
FT                   /db_xref="GOA:A1JUA5"
FT                   /db_xref="UniProtKB/TrEMBL:A1JUA5"
FT                   /protein_id="CAL10071.1"
FT                   /translation="MVILMSSQAIFVAITGIPALPVGWLTLLPKNRGDGYFIFLRHAGG
FT                   ALELKTYLSK"
FT   misc_feature    35617..35676
FT                   /note="1 probable transmembrane helix predicted for YEP.53
FT                   by TMHMM2.0 at aa 9-28"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        36049..37455
FT                   /transl_table=11
FT                   /locus_tag="YEP0050"
FT                   /product="putative protein-tyrosine phosphatase Yop
FT                   effector"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10072"
FT                   /db_xref="GOA:A1JUA6"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003546"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR015103"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR036484"
FT                   /db_xref="UniProtKB/TrEMBL:A1JUA6"
FT                   /protein_id="CAL10072.1"
FT                   /translation="MNLSLSDLHRQVSRLVQQESGDCTGKLRGNVAANKETTFQGLTIA
FT                   SGARESEKVFAQTVLSHVANIVLTQEDTAKLLQSTVKHNLNNYELRSVGNGNSVLVSLR
FT                   SDQMTLQDAKVLLEAALRQESGARGHVSSHSHSVLHAPGTPVREGLRSHLAPRTPPLPP
FT                   RERPHTSGHHGAGEVRATAPSTVSPYGPEARAELSSRLTTLRNTLTPATNDPRYLQACG
FT                   GEKLNRFRDIQCCRQTAVRADLNANYIQVGNTRTIACQYPLQSQLESHFRMLAENRTPV
FT                   LAVLASSSEIANQRFGMPDYFRQSGTYGSITVESKMTQQVGLGDGIMADMYTLTIREAG
FT                   QKTISVPVVHVGNWPDQTAVSSEVTKALASLVDQTAETKRNMYESKGSSAVADDSKLRP
FT                   VIHCRAGVGRTAQLIGAMCMNDSRNSQLSVEDMVSQMRVQRNGIMVQKDEQLDVLIKLA
FT                   EGQGRPLLNS"
FT   misc_feature    36715..37428
FT                   /note="Pfam match to entry PF00102
FT                   Y_phosphatase,Protein-tyrosine phosphatase, score 137.2,
FT                   E-value 2.1e-38"
FT                   /inference="protein motif:PFAM:PF00102"
FT   misc_feature    37249..37287
FT                   /note="PS00383 Tyrosine specific protein phosphatases
FT                   active site."
FT                   /inference="protein motif:Prosite:PS00383"
FT   CDS_pept        complement(37677..38108)
FT                   /transl_table=11
FT                   /locus_tag="YEP0051"
FT                   /product="putative yopH targeting protein"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10073"
FT                   /db_xref="GOA:A1JUA7"
FT                   /db_xref="InterPro:IPR010261"
FT                   /db_xref="UniProtKB/TrEMBL:A1JUA7"
FT                   /protein_id="CAL10073.1"
FT                   /translation="MRTYSSLLEEFATELGLEEIETNELGHGAVTIDKIWVVHLAPINE
FT                   KELVVFMRAGILTGQSQLYDILRKNLFSPHSGVIRCALDKDDHWLLWSQLNINDTSGTK
FT                   LASVLTSLVDKAVTISCEPTMKKEDEDDDHRPSSSHLLV"
FT   CDS_pept        complement(38462..38854)
FT                   /transl_table=11
FT                   /locus_tag="YEP0052"
FT                   /product="putative YopE chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10074"
FT                   /db_xref="GOA:P31490"
FT                   /db_xref="InterPro:IPR005416"
FT                   /db_xref="InterPro:IPR010261"
FT                   /db_xref="PDB:1N5B"
FT                   /db_xref="UniProtKB/Swiss-Prot:P31490"
FT                   /protein_id="CAL10074.1"
FT                   /translation="MYSFEQAITQLFQQLSLSIPDTIEPVIGVKVGEFACHITEHPVGQ
FT                   ILMFTLPSLDNNNEKETLLSHNIFSQDILKPILSWDEVGGHPVLWNRQPLNNLDNNSLY
FT                   TQLEMLVQGAERLQTSSLISPPRSFS"
FT   CDS_pept        39047..39706
FT                   /transl_table=11
FT                   /locus_tag="YEP0053"
FT                   /product="putative outer membrane virulence protein"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10075"
FT                   /db_xref="GOA:A1JUA9"
FT                   /db_xref="InterPro:IPR003537"
FT                   /db_xref="InterPro:IPR014773"
FT                   /db_xref="InterPro:IPR015110"
FT                   /db_xref="InterPro:IPR037168"
FT                   /db_xref="UniProtKB/TrEMBL:A1JUA9"
FT                   /protein_id="CAL10075.1"
FT                   /translation="MKISSFISTSLPLPTSVSGSSSVGEMSGRSVSQQKSEQYANNLAG
FT                   RTESPQGSSLASRITEKLSSMAHSAIEFIKRMFSEGSHKPVVTPAPTPAQMPSPTSFSD
FT                   SIKQLAAETLPKYMQQLSSLDAETLQKNHDQFATGSGPLRGSITQCQGLMQFCGGELQA
FT                   EASAILNTPVCGIPFSQWGTIGGAASAYVASGVDLTQAANELKGLAQQMHQLLSLM"
FT   sig_peptide     39047..39115
FT                   /locus_tag="YEP0053"
FT                   /note="Signal peptide predicted for YEP.57 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.985) with cleavage site
FT                   probability 0.473 between residues 23 and 24"
FT   misc_feature    39425..39631
FT                   /note="Pfam match to entry PF03545 Yers_vir_YopE, Yersinia
FT                   virulence determinant (YopE), score 161.3, E-value 1.2e-45"
FT                   /inference="protein motif:PFAM:PF03545"
FT   repeat_region   complement(39712..40187)
FT                   /note="label:'IS1669"
FT                   /note="Partial sequemce of insertion sequence element
FT                   IS1669"
FT   CDS_pept        complement(39747..40172)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="YEP0054"
FT                   /product="putative transposase for insertion element IS1669
FT                   (remnant)"
FT                   /note="Similar to parts of many transposases including:
FT                   Yersinia pestis putative integrase core domain protein
FT                   ypo2009 SWALL:Q8ZEY7 (EMBL:AJ414151) (169 aa) fasta scores:
FT                   E(): 1.9e-51, 92.9 38d in 141 aa and to Porphyromonas
FT                   gingivalis transposase SWALL:Q9L796 (EMBL:AF224744) (312
FT                   aa) fasta scores: E(): 8e-13, 41.54 id in 142 aa, and to
FT                   Corynebacterium diphtheriae transposase subunit b tnpB
FT                   SWALL:Q8RMK1 (EMBL:AF492560) (306 aa) fasta scores: E():
FT                   1.5e-12, 39.16 38d in 143 aa. Note this CDS appears to be a
FT                   gene remnant lacking its 5' end"
FT   misc_feature    complement(39756..40085)
FT                   /note="Pfam match to entry PF00665 rve, Integrase core
FT                   domain, score 75.2, E-value 1.2e-21"
FT                   /inference="protein motif:PFAM:PF00665"
FT   CDS_pept        complement(40240..40794)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="YEP0055"
FT                   /product="conserved hypothetical protein (remnant)"
FT                   /note="Similar to the very C-termini of many putative
FT                   reverse transcriptase-like proteins including: Escherichia
FT                   coli Orf59 protein SWALL:Q9S109 (EMBL:AB024946) (502 aa)
FT                   fasta scores: E(): 2.4e-73, 93.47 38d in 184 aa and
FT                   Shigella flexneri reverse transcriptase-like protein SfiA
FT                   SWALL:O34211 (EMBL:U97489) (431 aa) fasta scores: E():
FT                   1.4e-36, 94.11 38d in 102 aa. Note this CDS appears to be a
FT                   gene remnant lacking it 5' end."
FT   repeat_region   complement(40786..40999)
FT                   /note="label:IS1669'"
FT                   /note="Partial sequence of insertion sequence element
FT                   IS1669"
FT   CDS_pept        complement(40794..40943)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="YEP0056"
FT                   /product="IS1669 conserved hypothetical protein (remnant)"
FT                   /note="Similar to the very C-termini of many including:
FT                   Salmonella typhimurium putative cytoplasmic protein Stm0948
FT                   SWALL:Q8ZQE1 (EMBL:AE008740) (133 aa) fasta scores: E():
FT                   7.9e-15, 82 38d in 50 aa, Shewanella oneidensis
FT                   hypothetical protein Soa0117 SWALL:AAN53040 (EMBL:AE015918)
FT                   (80 aa) fasta scores: E(): 4.5e-10, 64 38d in 50 aa and to
FT                   Vibrio cholerae transposase subunit A vc1477 SWALL:Q9KS05
FT                   (EMBL:AE004225) (117 aa) fasta scores: E(): 2.3, 30 38d in
FT                   50 aa"
FT   misc_feature    order(41015..41068,41111..41179)
FT                   /note="2 probable transmembrane helices predicted for
FT                   YEP.60 by TMHMM2.0 at aa 7-24 and 39-61"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(41132..41434)
FT                   /transl_table=11
FT                   /locus_tag="YEP0057"
FT                   /product="conserved hypothetical protein"
FT                   /note="Previously sequenced as: Yersinia enterocolitica
FT                   hypothetical 11.8 kDa protein SWALL:Q93KR9 (EMBL:AF336309)
FT                   (100 aa) fasta scores: E(): 1.7e-40, 100 38d in 100 aa.
FT                   Also highly similar to Yersinia pestis hypothetical protein
FT                   y0075 or ypcd1.08C SWALL:Q9ZGW2 (EMBL:AF074612) (99 aa)
FT                   fasta scores: E(): 3.2e-38, 95.96 38d in 99 aa and to
FT                   Escherichia coli O157:H7 hypothetical protein z0510 z0510
FT                   or ecs0462 SWALL:Q8XE95 (EMBL:AE005220) (93 aa) fasta
FT                   scores: E(): 5.8e-07, 35.95 38d in 89 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10079"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR028344"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A1JUB0"
FT                   /protein_id="CAL10079.1"
FT                   /translation="MYKLSELADEDIYNIASYTIRHFGVTQAKLYHENLAKVFELLAKN
FT                   LELGAECNWICSDMRRFQYKKHGIYYITLSNDILISRVLHQSIDIDAQDFPEYEQ"
FT   CDS_pept        complement(41427..41669)
FT                   /transl_table=11
FT                   /locus_tag="YEP0058"
FT                   /product="conserved hypothetical protein"
FT                   /note="Previously sequenced as: Yersinia enterocolitica
FT                   hypothetical 8.9 kDa protein SWALL:Y6A9_YEREN
FT                   (SWALL:O85269) (80 aa) fasta scores: E(): 1.8e-28, 100 38d
FT                   in 80 aa. Also highly similar to Yersinia pestis
FT                   hypothetical protein ypcd1.09c or y0074 SWALL:Y6A9_YERPE
FT                   (SWALL:Q9ZGW3) (80 aa) fasta scores: E(): 1.2e-27, 97.5 id
FT                   in 80 aa and to Vibrio cholerae hypothetical protein
FT                   Vca0360.1 SWALL:YV6A_VIBCH (SWALL:P58093) (80 aa) fasta
FT                   scores: E(): 1.2e-08, 54.38 38d in 57 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10080"
FT                   /db_xref="GOA:A1JUB1"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR022789"
FT                   /db_xref="InterPro:IPR038296"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JUB1"
FT                   /inference="similar to sequence:UniProtKB:O85269"
FT                   /inference="similar to sequence:UniProtKB:Q9ZGW3"
FT                   /inference="similar to sequence:UniProtKB:P58093"
FT                   /protein_id="CAL10080.1"
FT                   /translation="MARVTSVTLGEHLTGFVGEMIQSGRYGNISEVLRDALRLMEAREQ
FT                   RVQHVRDMVLAGTNAPVSHRLMDEIFSAAVKDTSV"
FT   misc_feature    complement(41442..41669)
FT                   /note="Pfam match to entry PF03693 UPF0156,Uncharacterised
FT                   protein family (UPF0156), score 66.8,E-value 3.2e-17"
FT                   /inference="protein motif:PFAM:PF03693"
FT   CDS_pept        complement(41813..42133)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="YEP0059"
FT                   /product="putative transposase (remnant)"
FT                   /note="Similar in parts to many putative transposases
FT                   including: Yersinia pestis Ypcd1.10C protein SWALL:Q9RI25
FT                   (EMBL:AL117189) (83 aa) fasta scores: E(): 3.2e-33, 92.77
FT                   id in 83 aa, Pantoea agglomerans IS1327 transposase TnpA
FT                   SWALL:P94785 (EMBL:X87144) (234 aa) fasta scores: E():
FT                   2.4e-22, 66.66 38d in 90 aa and to Xylella fastidiosa
FT                   transposase xf2303 SWALL:Q9PB42 (EMBL:AE004042) (188 aa)
FT                   fasta scores: E(): 9.5e-20, 63.95 38d in 86 aa"
FT                   /db_xref="PSEUDO:CAL10081.1"
FT   repeat_region   42548..42592
FT                   /rpt_unit_seq="tggatatccaatgccaacgttggtaattgggaccacggtcccac
FT                   c"
FT   repeat_region   42593..42637
FT                   /rpt_unit_seq="tggatatccaatgccaacgttggtaattgggaccacggtcccac
FT                   c"
FT   repeat_region   42638..42682
FT                   /rpt_unit_seq="tggatatccaatgccaacgttggtaattgggaccacggtcccac
FT                   c"
FT   repeat_region   42683..42727
FT                   /rpt_unit_seq="tggatatccaatgccaacgttggtaattgggaccacggtcccac
FT                   c"
FT   repeat_region   42728..42772
FT                   /rpt_unit_seq="tggatatccaatgccaacgttggtaattgggaccacggtcccac
FT                   c"
FT   repeat_region   42773..42808
FT                   /rpt_unit_seq="tggatatccaatgccaacgttggtaattgggaccacggtcccac
FT                   c"
FT   CDS_pept        complement(42931..43893)
FT                   /transl_table=11
FT                   /locus_tag="YEP0061"
FT                   /product="putative plasmid partitioning control protein"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10082"
FT                   /db_xref="GOA:A1JUB3"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR040873"
FT                   /db_xref="UniProtKB/TrEMBL:A1JUB3"
FT                   /protein_id="CAL10082.1"
FT                   /translation="MKRSPVLRNAPSINFDDAKPAISNAEPSVSAPAVSQLASRVSGMK
FT                   GNTIVLPVCGRNIAFTLKVIAAPDVESKTIVFSGNERNQALLSETSLDDLIPSFLTSGQ
FT                   QIPALAREHNGNIEVADGSRRRKAAILTGSDYKVLVGNLNDEQMLWLSQIANEYRPTSA
FT                   YERGLRYAQRLISEFEGNISKLAEAEHLSRKIIQRCIKTAELPLKTIQLFANPNELSAR
FT                   SGEALNKAYENNVDTLKLVTHKIMKQKQEGRQFTTEELIVLLMPERKQPENIHKKNFGK
FT                   NIEAKYSKDNVSFYLKSAPESLVKQIEELLNTYAKEHSL"
FT   misc_feature    complement(43423..43686)
FT                   /note="Pfam match to entry PF02195 ParBc, ParB-like
FT                   nuclease domain, score 57.9, E-value 1.5e-14"
FT                   /inference="protein motif:PFAM:PF02195"
FT   CDS_pept        complement(43893..45059)
FT                   /transl_table=11
FT                   /locus_tag="YEP0062"
FT                   /product="putative plasmid partitioning transcription
FT                   repressor"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10083"
FT                   /db_xref="GOA:A1JUB4"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1JUB4"
FT                   /protein_id="CAL10083.1"
FT                   /translation="MDLKSTLDRCIERGQFMTQEIAKSQFGNDSPAARTITRRWRITEA
FT                   AELVGVTPQTIRNYEDSGKLPPPDTAMIGRVEQRTGYSIQQINDMRDVFKTRLSKPKGE
FT                   NPVVLAIAAHKGGAYKTSTSVHIAQWMALQGLRVLLIDATDPQATASLYHGYVPDLHIH
FT                   EEDTLLPYYLGQRDDAAYAIKPTCWPNLEVIPSCLAVHRIESEIYSLHDQGKLPVAPHL
FT                   LLRAAIESVWDSYDVVVLDSAPNLGIGTINVVCAADVIVVPTPAELYDYVSTLQFFTML
FT                   RDLMSNIDLNGFEPDVRVLITKFSNAIGSQSQWMDDQIRNAWGGMVLKEVVRVTDEVGK
FT                   GQVRMRTVFEQAANQRSTPAAWRNAVSIWEPVCAEIFNRLVKPRWENA"
FT   misc_feature    complement(44118..44456)
FT                   /note="Pfam match to entry PF00991 ParA, ParA family
FT                   ATPase, score 79.9, E-value 3.8e-21"
FT                   /inference="protein motif:PFAM:PF00991"
FT   misc_feature    complement(44832..44939)
FT                   /note="Pfam match to entry PF00376 merR, MerR family
FT                   regulatory protein, score 19.6, E-value 0.00037"
FT                   /inference="protein motif:PFAM:PF00376"
FT   CDS_pept        complement(45373..45588)
FT                   /transl_table=11
FT                   /locus_tag="YEP0063"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Yersinia enterocolitica hypothetical 7.7
FT                   kDa protein SWALL:Q93KR6 (EMBL:AF336309) (71 aa) fasta
FT                   scores: E(): 4.5e-26, 97.18 38d in 71 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10084"
FT                   /db_xref="UniProtKB/TrEMBL:A1JUB5"
FT                   /protein_id="CAL10084.1"
FT                   /translation="MSLVTYELAAPSSSYFDFAQAVAIRRMALNLSDQPAYLLESETTL
FT                   QIPSGEHLSASLPGENVSRLSVAIQW"
FT   CDS_pept        complement(45764..45856)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="YEP0064"
FT                   /product="putative transposase (remnant)"
FT                   /note="Similar to the N-terminus of many transposases e.g.
FT                   Desulfovibrio vulgaris transposase OrfA SWALL:O31217
FT                   (EMBL:AF034211) (88 aa) fasta scores: E(): 7.1e-06, 61.29
FT                   id in 31 aa. This CDS appears to be a gene remnant"
FT   CDS_pept        complement(46109..46984)
FT                   /transl_table=11
FT                   /gene="yomA"
FT                   /locus_tag="YEP0065"
FT                   /product="putative exported protein"
FT                   /note="Previously sequenced as: Yersinia enterocolitica
FT                   YomA SWALL:Q93KR5 (EMBL:AF336309) (291 aa) fasta scores:
FT                   E(): 7.8e-105, 100 38d in 291 aa. Also highly similar to
FT                   Salmonella typhimurium integral membrane protein PagO or
FT                   stm1862 SWALL:PAGO_SALTY (SWALL:O30646) (304 aa) fasta
FT                   scores: E(): 1.7e-62, 57.39 38d in 284 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10086"
FT                   /db_xref="GOA:A1JUB6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A1JUB6"
FT                   /inference="similar to sequence:UniProtKB:O30646"
FT                   /protein_id="CAL10086.1"
FT                   /translation="MLMKNFLVILLFIMVSVTWGTTWLAMKLTVETIPPIFATGIRFML
FT                   AAPVLILISVLTKTRLLFPDGQKFFQLFVCIFYFSIPFSLMIYGETYISPALASIIFSS
FT                   MPVCVLFFSWLLLNEKVGIIAILGLVTSTVSLLAILFIETNIGNNNQWVGIISLVISVI
FT                   MHALVYVQCKKRSCSISVLTFNAIPSLVAGILLCIVGWIAEQPVISKFSQQSLLSVIYL
FT                   GIIAGVFGILCYFQLQNKASAFQASTVFLVFPIIALLLDGYVYGRYFSLYSILLIIPLL
FT                   TGVLLISLRK"
FT   misc_feature    complement(order(46115..46183,46193..46261,46280..46348,
FT                   46376..46444,46478..46531,46559..46624,46643..46711,
FT                   46721..46780,46817..46879,46907..46966))
FT                   /note="10 probable transmembrane helices predicted for
FT                   YEP.69c by TMHMM2.0 at aa 7-26, 36-56, 69-88,
FT                   92-114,121-142, 152-169, 181-203, 213-235, 242-264 and
FT                   268-290"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(46118..46498)
FT                   /note="Pfam match to entry PF00892 DUF6, Integral membrane
FT                   protein DUF6, score 99.1, E-value 6.2e-27"
FT                   /inference="protein motif:PFAM:PF00892"
FT   misc_feature    complement(46562..46936)
FT                   /note="Pfam match to entry PF00892 DUF6, Integral membrane
FT                   protein DUF6, score 108.9, E-value 6.7e-30"
FT                   /inference="protein motif:PFAM:PF00892"
FT   sig_peptide     complement(46925..46984)
FT                   /gene="yomA"
FT                   /locus_tag="YEP0065"
FT                   /note="Signal peptide predicted for YEP.69c by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.970) with cleavage site
FT                   probability 0.577 between residues 20 and 21"
FT   CDS_pept        complement(47054..48322)
FT                   /transl_table=11
FT                   /locus_tag="YEP0066"
FT                   /product="putative YadA invasin"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10087"
FT                   /db_xref="GOA:A1JUB7"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008126"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="PDB:2LME"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JUB7"
FT                   /protein_id="CAL10087.1"
FT                   /translation="MTKDFKISVSAALISALFSSPYAFANNDEVHFTAVQISPNADPDS
FT                   HVVIFQPAAEALGGTNALAKSIHSIAVGASAEAAKQAAVAVGAGSIATGVNSVAIGPLS
FT                   KALGDSAVTYGAASTAQKDGVAIGARAFTSDTGVAVGFNSKVDAKNSVAIGHSSHVAVD
FT                   HDYSIAIGDRSKTDRKNSVSIGHESLNRQLTHLAAGTKDTDAVNVAQLKKEIEKTQVNA
FT                   NKKSAEVLGIANNYTDSKSAETLENARKEAFDLSNDALDMAKKHSNSVARTTLETAEEH
FT                   TNKKSAETLARANVYADSKSSHTLQTANSYTDVTVSNSTKKAIRESNQYTDHKFRQLDN
FT                   RLDKLDTRVDKGLASSAALNSLFQPYGVGKVNFTAGVGGYRSSQALAIGSGYRVNESVA
FT                   LKAGVAYAGSSDVMYNASFNIEW"
FT   misc_feature    complement(47057..47290)
FT                   /note="Pfam match to entry PF03895 YadA, YadA-like
FT                   C-terminal region, score 145.1, E-value 8.8e-41"
FT                   /inference="protein motif:PFAM:PF03895"
FT   sig_peptide     complement(48248..48322)
FT                   /locus_tag="YEP0066"
FT                   /note="Signal peptide predicted for YEP.70c by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.999 between residues 25 and 26"
FT   repeat_region   48835..49479
FT                   /note="label:'IS1400'"
FT                   /note="degenerate insertion sequence element IS1400"
FT   CDS_pept        join(48870..48902,48906..48923)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="trp1400A"
FT                   /locus_tag="YEP0067"
FT                   /product="IS1400 transposase A (remnant)"
FT                   /note="Similar to the very N-terminus of Yersinia
FT                   enterocolitica IS1400 transposase A trp1400A SWALL:Q9X9H8
FT                   (EMBL:AJ132945) (96 aa) fasta scores: E(): 0.0089, 61.11 id
FT                   in 18 aa, and to Escherichia coli O6 transposase c2472
FT                   SWALL:AAN80931 (EMBL:AE016762) (88 aa) fasta scores: E():
FT                   0.052, 81.81 38d in 11 aa"
FT   CDS_pept        join(48925..49317,49321..49479)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="trp1400B"
FT                   /locus_tag="YEP0068"
FT                   /product="putative IS1400 transposase B (remnant)"
FT                   /note="Similar in parts to many transposases including:
FT                   Yersinia enterocolitica IS1400 transposase B trp1400B
FT                   SWALL:Q9X9H9 (EMBL:AJ132945) (294 aa) fasta scores: E():
FT                   9.1e-20, 76.04 38d in 192 aa and to Xanthomonas campestris
FT                   ISxcc1 transposase xcc3124 or xcc3135 SWALL:Q8NL31
FT                   (EMBL:AE012428) (255 aa) fasta scores: E(): 3.4e-14,56.18
FT                   38d in 194 aa. Note this CDS appears to be a gene remnant
FT                   that has undergone a series of deletion events"
FT   misc_feature    49096..49317
FT                   /note="Pfam match to entry PF00665 rve, Integrase core
FT                   domain, score 33.5, E-value 1.3e-09"
FT                   /inference="protein motif:PFAM:PF00665"
FT   misc_feature    49336..49479
FT                   /note="Pfam match to entry PF00665 rve, Integrase core
FT                   domain, score 19.8, E-value 1.1e-05"
FT                   /inference="protein motif:PFAM:PF00665"
FT   CDS_pept        49605..50807
FT                   /transl_table=11
FT                   /locus_tag="YEP0069"
FT                   /product="transposase"
FT                   /note="Highly similar to Shewanella oneidensis
FT                   ISsod4,transposase so2292 SWALL:AAN55332 (EMBL:AE015670)
FT                   (400 aa) fasta scores: E(): 1.5e-123, 75.25 38d in 400 aa,
FT                   and to Yersinia enterocolitica hypothetical 45.7 kDa
FT                   protein tnP SWALL:Q93KR3 (EMBL:AF336309) (400 aa) fasta
FT                   scores: E(): 4.1e-156, 99.75 38d in 400 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10090"
FT                   /db_xref="GOA:A1JUB8"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A1JUB8"
FT                   /protein_id="CAL10090.1"
FT                   /translation="MSQPFDFDKALKALQDGQALTGKDGILTPLIKQLTEAALAAELDS
FT                   HLAQDIEANRKNGSTKKTVKTPTGAFELATPRDRNGSFEPQLVKKHQTTLSDEIERKII
FT                   RMFALGMSYKDISQEIEDLYAFSVSSATITAVTDKVIPELKQWQQRPLEAVYPFVWLDA
FT                   IHYKIREDGHYQSKAVYTVLALNLEGKKENLGLYLSENEGANFWLSVLTDLQNRGVDDI
FT                   LIACVDGLTRSPEAINSIYPDTEVQLCVIHQIRNSIKYVASKHHKAFMADLKPVYRAVS
FT                   KEAAETALDELEEKWGQQYPVVLQSWRRKWENLSHYFRYPATIRKVIYTTNAIESVHRQ
FT                   FRKLTKTKGAFPNENSLLKLLYLGLMNAQEKWAMPIQSWNLTLSQLAIYFEGRLDKVIT
FT                   L"
FT   misc_feature    49608..50000
FT                   /note="Pfam match to entry PF00872
FT                   Transpo_mutator,Transposase, Mutator family, score 37.1,
FT                   E-value 8.8e-11"
FT                   /inference="protein motif:PFAM:PF00872"
FT   misc_feature    50001..50729
FT                   /note="Pfam match to entry PF00872
FT                   Transpo_mutator,Transposase, Mutator family, score 78.7,
FT                   E-value 8.8e-21"
FT                   /inference="protein motif:PFAM:PF00872"
FT   CDS_pept        complement(50937..51245)
FT                   /transl_table=11
FT                   /locus_tag="YEP0071"
FT                   /product="hypothetical protein"
FT                   /note="Previously sequenced as: Yersinia enterocolitica
FT                   hypothetical 11.4 kDa protein SWALL:Q93KR2 (EMBL:AF336309)
FT                   (102 aa) fasta scores: E(): 1.9e-34, 100 38d in 102 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10091"
FT                   /db_xref="UniProtKB/TrEMBL:A1JUB9"
FT                   /protein_id="CAL10091.1"
FT                   /translation="MIVADVSKLKKGNSRLGVPPSMDEAATSLAAPEIAPAPLDDHQPY
FT                   IRRDGRSARKTNRTLAFATRVSPEFDAELRDIAEEKNLKLVELLEEMLEAYKQKNNI"
FT   CDS_pept        complement(51245..51874)
FT                   /transl_table=11
FT                   /locus_tag="YEP0072"
FT                   /product="conserved hypothetical protein"
FT                   /note="Previously sequenced as: Yersinia enterocolitica
FT                   hypothetical 22.3 kDa protein SWALL:Q93KR1 (EMBL:AF336309)
FT                   (209 aa) fasta scores: E(): 9.8e-72, 100 38d in 209 aa.
FT                   Also similar to several plasmid partition proteins
FT                   including: Xanthomonas axonopodis partition protein A ParA
FT                   SWALL:Q8NKZ8 (EMBL:AE008924) (208 aa) fasta scores: E():
FT                   2.9e-06, 31.28 38d in 195 aa and to Agrobacterium
FT                   tumefaciens ParA protein SWALL:PARA_AGRTU (SWALL:P07175)
FT                   (222 aa) fasta scores: E(): 0.099, 25.98 38d in 204 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10092"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1JUC0"
FT                   /inference="similar to sequence:UniProtKB:P07175"
FT                   /protein_id="CAL10092.1"
FT                   /translation="MAWIVAFISQKGGIGKSAKARALAREATKGGIKTKLADLDTEQAT
FT                   SADWHRRRLAAGYEPAASVEVFSTAAQALAAAENFELLIIDGPARASKGTTEIAKVADL
FT                   IVQPTGASLDDLIPAVKVFHGLVKEGIPKSKLVFSLSRIGTDAEETEARNYLIEAGYEV
FT                   LNGCIFEQPAYRQAINAGLTLTETRYKGLNARADELIQSLINKIGG"
FT   CDS_pept        complement(52049..52783)
FT                   /transl_table=11
FT                   /locus_tag="YEP0073"
FT                   /product="putative resolvase/recombinase"
FT                   /note="Similar to many site-specific recombinases
FT                   including: Escherichia coli resolvase ResD SWALL:REDF_ECOLI
FT                   (SWALL:P06615) (268 aa) fasta scores: E(): 2.6e-17, 47.24
FT                   38d in 254 aa, Yersinia enterocolitica hypothetical 27.8
FT                   kDa protein SWALL:Q93KR0 (EMBL:AF336309) (244 aa) fasta
FT                   scores: E(): 1.1e-98, 100 38d in 244 aa and Escherichia
FT                   coli probable site-specific recombinase IntM or inT
FT                   SWALL:INTM_ECOLI (SWALL:P56979) (246 aa) fasta scores: E():
FT                   9.3e-44, 50.4 38d in 248 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10093"
FT                   /db_xref="GOA:A1JUC1"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR016423"
FT                   /db_xref="UniProtKB/TrEMBL:A1JUC1"
FT                   /inference="similar to sequence:UniProtKB:P06615"
FT                   /inference="similar to sequence:UniProtKB:P56979"
FT                   /protein_id="CAL10093.1"
FT                   /translation="MLSLIPHENSQISRSAITPYFNYEKAVALRRMALKAGASLPRYLL
FT                   APEITVLLDYLPDLRQRLLFDTLWNTGARINECLVLTPGDFELDGAGPFVTLKTLKQRH
FT                   RGPGRPENGEALKRIVPLSDPAYVRRLQEYAATMKITRRKPLWPMKSDDTARNWLKAAV
FT                   QRAERDGVTFTIPITPHTFRHSFAMHLLQNGLPFKVLQAYMGHQDTKSTEIYTRIFALD
FT                   VGHQYGVRFSMDTLDARALLLP"
FT   misc_feature    complement(52109..52681)
FT                   /note="Pfam match to entry PF00589 Phage_integrase, Phage
FT                   integrase family, score 100.5, E-value 2.4e-27"
FT                   /inference="protein motif:PFAM:PF00589"
FT   CDS_pept        complement(52920..53117)
FT                   /transl_table=11
FT                   /locus_tag="YEP0074"
FT                   /product="hypothetical protein"
FT                   /note="Previously sequenced as: Yersinia enterocolitica
FT                   hypothetical 7.4 kDa protein SWALL:Q93KQ9 (EMBL:AF336309)
FT                   (65 aa) fasta scores: E(): 5.4e-28, 100 38d in 65 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10094"
FT                   /db_xref="UniProtKB/TrEMBL:A1JUC2"
FT                   /protein_id="CAL10094.1"
FT                   /translation="MIFYLYGLLAPPITRRFGFTQRKPNSPPALHLVFYQLATNTRCGV
FT                   WRCRVRLSGGVQPLPVSAAR"
FT   CDS_pept        53569..54147
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="YEP0075"
FT                   /product="Putative transposase (remnant)"
FT                   /note="Similar in parts to many transposases including:
FT                   Yersinia enterocolitica IS1400 transposase B trp1400B
FT                   SWALL:Q9X9H9 (EMBL:AJ132945) (294 aa) fasta scores: E():
FT                   1.4e-48, 65.44 38d in 191 aa, and to Xanthomonas campestris
FT                   isxcc1 transposase xcc1607 SWALL:Q8PA81 (EMBL:AE012262)
FT                   (255 aa) fasta scores: E(): 5.9e-47,63.29 38d in 188 aa.
FT                   Note this CDS appears to be a gene remnant"
FT   misc_feature    53671..54147
FT                   /note="Pfam match to entry PF00665 rve, Integrase core
FT                   domain, score 111.8, E-value 9.2e-31"
FT                   /inference="protein motif:PFAM:PF00665"
FT   CDS_pept        complement(54207..54509)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="YEP0076"
FT                   /product="transposase for insertion sequence element IS1328
FT                   (remnant)"
FT                   /note="Highly similar to the very N-terminus of Shigella
FT                   flexneri 2a IS1328 transposase SWALL:Q93EZ2 (EMBL:AF326777)
FT                   (334 aa) fasta scores: E(): 1.2e-30, 79.2 id in 101 aa.
FT                   Previously sequenced as Yersinia enterocolitica IS1328
FT                   transposase trp1328 SWALL:Q9RIG6 (EMBL:AJ132945) (334 aa)
FT                   fasta scores: E(): 1.4e-30, 77 id in 100 aa"
FT   repeat_region   complement(54207..54575)
FT                   /note="label:IS1328'"
FT                   /note="partial insertion element IS1328"
FT   repeat_region   complement(54556..54575)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for insertion element IS1328"
FT   CDS_pept        complement(54959..55135)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="YEP0078"
FT                   /product="putative transposase (remnant)"
FT                   /note="Highly similar to the N-terminal regions of many
FT                   transposases including: Xanthomonas axonopodis ISxac3
FT                   transposase SWALL:Q8NKZ0 (EMBL:AE011632) (90 aa) fasta
FT                   scores: E(): 2.2e-05, 57.14 38d in 42 aa and to Pantoea
FT                   agglomerans putative transposase A SWALL:Q9AM90
FT                   (EMBL:AF327445) (94 aa) fasta scores: E(): 0.006, 40.42 id
FT                   in 47 aa.Previously sequenced as: Yersinia enterocolitica
FT                   hypothetical 10.1 kDa protein Orf86 SWALL:Q93KQ8
FT                   (EMBL:AF336309) (88 aa) fasta scores: E(): 3.4e-35, 100 38d
FT                   in 88 aa."
FT   misc_feature    complement(55010..55126)
FT                   /note="Pfam match to entry PF01527
FT                   Transposase_8,Transposase, score 36.6, E-value 2.3e-10"
FT                   /inference="protein motif:PFAM:PF01527"
FT   CDS_pept        55297..55728
FT                   /transl_table=11
FT                   /locus_tag="YEP0080"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10098"
FT                   /db_xref="UniProtKB/TrEMBL:A1JUC3"
FT                   /protein_id="CAL10098.1"
FT                   /translation="MINSTFTELLQKIASHFGLDKLSQDEYGLCELILNDRVVIILRAD
FT                   EILNRLTLLGPILGFSGPEARGAASQLFFCYSINALNKDAPCFAWSDELGLIAFKHLSL
FT                   DELNVENVSKEIANFYDWLSLVSLPAETAPSYSIYSIGY"
FT   CDS_pept        55746..57935
FT                   /transl_table=11
FT                   /gene="yopO"
FT                   /locus_tag="YEP0081"
FT                   /product="putative targeted effector protein kinase"
FT                   /note="Highly similar to Yersinia pseudotuberculosis
FT                   effector protein kinase YpkA precursor SWALL:YPKA_YERPS
FT                   (SWALL:Q05608) (732 aa) fasta scores: E(): 0, 96.98 38d in
FT                   729 aa and to Yersinia enterocolitica protein kinase YopO
FT                   SWALL:Q93KQ6 (EMBL:AF336309) (729 aa) fasta scores: E(): 0,
FT                   100 38d in 729 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0081"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10099"
FT                   /db_xref="GOA:A1JUC4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR003547"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR019093"
FT                   /db_xref="UniProtKB/TrEMBL:A1JUC4"
FT                   /inference="similar to sequence:UniProtKB:Q05608"
FT                   /protein_id="CAL10099.1"
FT                   /translation="MKIMGTMSPSISLAKAHERISKHWQNPVGELNIEGKRYRIIDNQV
FT                   LRLNPHSGFSLFREGVGKIFSGKMFSFSIARNLTDTLHAAQKTTSQELRSDIPNALSNL
FT                   FGAKPQTELPLGWKGKPLSGAPDLEGMRVAETDKFAEGESHISIIETKDKQRLVAKIER
FT                   SIAEGHLFAELEAYKHIYKTAGKHPNLANVHGMAVVPYGNRKEEALLMDEVDGWRCSDT
FT                   LRSLADSWKQGKINSEAYWGTIKFIAHRLLDVTNHLAKAGIVHNDIKPGNVVFDRASGE
FT                   PVVIDLGLHSRSGEQPKGFTESFKAPELGVGNLGASEKSDVFLVVSTLLHGIEGFEKDP
FT                   EIKPNQGLRFITSEPAHVMDENGYPIHRPGIAGVETAYTRFITDILGVSADSRPDSNEA
FT                   RLHEFLSDGTIDEESAKQILKDTLTGEMSPLPTDVRRITPKKLRELSDLLRTHLSSAAT
FT                   KQLDMGVVLSDLDTMLVALDKAEREGGVDKDQLKSFNSLILKTYSVIGAYIKGREGDTK
FT                   SSSTEVSPYHRSNFMLSIVEPSLQRIQKHLDQTHSFSDIGSLMRAHKHLETLLEVLVTL
FT                   SQQGQPVSSETYSFLNRLAEAKVTLSQQLNTLQQQQESAKAQLSILINRSGSWADVARQ
FT                   SLQRFDSTRPVVKFGTEQYTAIHRQMMAAHAAITLQEVSEFTDDMRNFTADSIPLLIQL
FT                   GRSSLMDEHLVEQREKLRELTTIAERLNRLEREWM"
FT   misc_feature    56142..56960
FT                   /note="Pfam match to entry PF00069 pkinase, Protein kinase
FT                   domain, score -38.6, E-value 7.7e-08"
FT                   /inference="protein motif:PFAM:PF00069"
FT   misc_feature    56532..56570
FT                   /note="PS00108 Serine/Threonine protein kinases active-site
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00108"
FT   CDS_pept        join(58175..58180,58185..58301)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="YEP0082"
FT                   /product="hypothetical 10.2 kDa protein"
FT                   /note="Highly similar to the C-terminus of Yersinia
FT                   enterocolitica hypothetical 10.2 kDa protein SWALL:O85240
FT                   (EMBL:AF102990) (91 aa) fasta scores: E(): 2e-16, 97.5 38d
FT                   in 40 aa. Note this CDS appears to be a gene remnant"
FT                   /note="hypothetical protein (remnant)"
FT   CDS_pept        58302..59168
FT                   /transl_table=11
FT                   /gene="yopJ"
FT                   /locus_tag="YEP0083"
FT                   /product="type III secretion system effector protein"
FT                   /product="putative targeted effector protein"
FT                   /note="Similar to Yersinia pseudotuberculosis YopJ type III
FT                   secretion system effector protein SWALL:YOPJ_YERPS
FT                   (SWALL:P31498) (264 aa) fasta scores: E(): 2.6e-88, 92 38d
FT                   in 250 aa, and to Yersinia enterocolitica Yop effector YopP
FT                   SWALL:Q93KQ5 (EMBL:AF336309) (288 aa) fasta scores: E():
FT                   7.4e-112, 100 38d in 288 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10101"
FT                   /db_xref="InterPro:IPR005083"
FT                   /db_xref="UniProtKB/TrEMBL:A1JUC5"
FT                   /inference="similar to sequence:UniProtKB:P31498"
FT                   /protein_id="CAL10101.1"
FT                   /translation="MIGPISQINSPGGLSEKETSSLISNEELKNIITQLETDIADGSWF
FT                   HKNYSRTDVKVMPALVTQANNKYPEMNLNFVTSPLDLSIEIKNVIENGVGSSRFIINMG
FT                   EDGIHFSVIDYKHINGKTSLILFEPANFNSMGPAMLAIRAKTAIERYQLPDCHFSMVEM
FT                   DIQRSSSECGIFSLALAKKLYTERDNLLKIHEDNIKGILSDGENPLPHDKLDPYLPVTF
FT                   YKHTQGKKRLNEYLNTNPQGVGTVVNKKNETIFNRFDNNKSIIDGKELSVSVHKKRIAE
FT                   YKTLLKV"
FT   misc_feature    58392..59024
FT                   /note="Pfam match to entry PF03421 Peptidase_C55,Peptidase
FT                   C55 family, score 471.9, E-value 3.8e-139"
FT                   /inference="protein motif:PFAM:PF03421"
FT   CDS_pept        59262..59393
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="YEP0084"
FT                   /product="mobilization protein (remnant)"
FT                   /note="Similar to the very C-termini of: Escherichia coli
FT                   mobilization protein MbeA SWALL:MBEA_ECOLI (SWALL:P13658)
FT                   (517 aa) fasta scores: E(): 1.4e-08, 83.72 38d in 43
FT                   aa,Escherichia coli MobA SWALL:Q9F899 (EMBL:AF251289) (517
FT                   aa) fasta scores: E(): 2.7e-09, 86.04 38d in 43 aa and
FT                   Salmonella cholerae-suis mobilization protein MobA
FT                   SWALL:Q93LC3 (EMBL:AY048853) (517 aa) fasta scores: E():
FT                   2.7e-09, 86.04 38d in 43 aa"
FT                   /inference="similar to sequence:UniProtKB:P13658"
FT   CDS_pept        59787..60137
FT                   /transl_table=11
FT                   /gene="yscM2"
FT                   /locus_tag="YEP0086"
FT                   /product="regulatory protein"
FT                   /note="Previously sequenced as: Yersinia enterocolitica
FT                   regulatory protein Yscm2 SWALL:Q93KQ4 (EMBL:AF336309) (116
FT                   aa) fasta scores: E(): 4.9e-40, 100 38d in 116 aa. Also
FT                   highly similar to Yersinia pestis, and Yersinia
FT                   pseudotuberculosis Yop proteins translocation protein M
FT                   YscM or LcrQ or ypcd1.62 or y0019 SWALL:YSCM_YERPE
FT                   (SWALL:Q00930) (115 aa) fasta scores: E(): 1.2e-17, 59.09
FT                   id in 110 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0086"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10103"
FT                   /db_xref="GOA:A1JUC6"
FT                   /db_xref="InterPro:IPR015103"
FT                   /db_xref="InterPro:IPR036484"
FT                   /db_xref="UniProtKB/TrEMBL:A1JUC6"
FT                   /inference="similar to sequence:UniProtKB:Q00930"
FT                   /protein_id="CAL10103.1"
FT                   /translation="MGSIMKINDLKSLISMQIAEFGGGEKIGRLKSTLQQVSTQAITSD
FT                   ERRFAYAVLEHAKNTILNRQDVAKLLPRASNFELSQGKKGEVILKGLRVEQLSLEDAKL
FT                   LLDAVTRKMQKL"
FT   misc_feature    60319..60489
FT                   /note="Pfam match to entry PF01526
FT                   Transposase_7,Transposase, score 122.3, E-value 6.3e-34"
FT                   /inference="protein motif:PFAM:PF01526"
FT   CDS_pept        join(60325..60492,60492..60896,60896..61009)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="YEP0087"
FT                   /product="transposase for transposon Tn3 (remnant)"
FT                   /note="Similar to many transposases including: Escherichia
FT                   coli transposase for transposon Tn3 TnpA SWALL:TNP3_ECOLI
FT                   (SWALL:P03008) (1015 aa) fasta scores: E(): 2e-88, 95.69 id
FT                   in 232 aa and Klebsiella pneumoniae transposase tnpA
FT                   SWALL:Q8RNS1 (EMBL:AF479774) (1001 aa) fasta scores: E():
FT                   1.7e-89, 96.94 38d in 229 aa. Note this CDS has undergone
FT                   several rounds of deletion and framshift mutations."
FT                   /inference="similar to sequence:UniProtKB:P03008"
FT   CDS_pept        complement(61007..61570)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="YEP0088"
FT                   /product="transposase (remnant)"
FT                   /note="Similar to the N-terminus of many transposases
FT                   including: Shewanella oneidensis ISsod4, transposase so2292
FT                   SWALL:AAN55332 (EMBL:AE015670) (400 aa) fasta scores: E():
FT                   3.8e-51, 69.51 38d in 187 aa. Also similar to the
FT                   N-terminus of the upstream CDS YEP0069 99.242 identity in
FT                   132 aa overlap. Similar to the whole of Yersinia
FT                   enterocolitica transposase Tnp SWALL:AAN37566
FT                   (EMBL:AY150843) (191 aa) fasta scores: E(): 3.4e-70, 100 id
FT                   in 188 aa, and to Shewanella oneidensis ISsod4,transposase
FT                   so2292 SWALL:AAN55332 (EMBL:AE015670) (400 aa) fasta
FT                   scores: E(): 3.8e-51, 69.51 38d in 187 aa"
FT   misc_feature    complement(61010..61567)
FT                   /note="Pfam match to entry PF00872
FT                   Transpo_mutator,Transposase, Mutator family, score -154.2,
FT                   E-value 2e-07"
FT                   /inference="protein motif:PFAM:PF00872"
FT   CDS_pept        complement(61617..62168)
FT                   /transl_table=11
FT                   /locus_tag="YEP0089"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to many nucleases including: Proteus
FT                   vulgaris EDTA-resistant nuclease SWALL:BAB93759
FT                   (EMBL:AP004237) (221 aa) fasta scores: E(): 3.3e-11,38.09
FT                   38d in 126 aa and Salmonella typhimurium EDTA-resistant
FT                   Nuclease Nuc SWALL:Q9R2H3 (EMBL:AB027308) (183 aa) fasta
FT                   scores: E(): 1.3e-09, 32.09 38d in 134 aa. Previously
FT                   sequenced as: Yersinia enterocolitica hypothetical 20.4 kDa
FT                   protein SWALL:Q93KQ3 (EMBL:AF336309) (183 aa) fasta scores:
FT                   E(): 1.7e-72, 100 38d in 183 aa."
FT                   /db_xref="EnsemblGenomes-Gn:YEP0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10106"
FT                   /db_xref="GOA:A1JUC7"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:A1JUC7"
FT                   /protein_id="CAL10106.1"
FT                   /translation="MHLVGGFNALVGFSPIVMHLISSCTALRALKPVLMWQRKPIAVAL
FT                   IAAKNRGVKVRVVADMKANQDKYTVVNFLANQEVAVKLNHRYAIMHNKYMVVDGHNVQT
FT                   GSFNYTSSAAKRNAENVILFKNAPAMRASMIVPNVYHCCTVISQTRSKPISPVTCATIT
FT                   NRLIKIIADEIYIKIFKREC"
FT   repeat_region   62168..62183
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS4-like element"
FT   repeat_region   62168..63045
FT                   /note="label:IS1665"
FT                   /note="IS4-like insertion sequence element IS1665"
FT   CDS_pept        complement(join(62177..62512,62514..62963))
FT                   /transl_table=11
FT                   /locus_tag="YEP0090"
FT                   /product="transposase for insertion sequence element
FT                   IS1665"
FT                   /note="Similar the N-terminal and C-terminal regions of
FT                   many transposases including: Escherichia coli transposase
FT                   InsG for insertion sequence element IS4 or b4278
FT                   SWALL:INSG_ECOLI (SWALL:P03835) (442 aa) fasta scores: E():
FT                   5.5e-50, 51.36 38d in 440 aa and to Shigella flexneri is4
FT                   orf s0243 SWALL:Q9AFL8 (EMBL:AF348706) (439 aa) fasta
FT                   scores: E(): 8.5e-53, 50.82 38d in 427 aa. This transposase
FT                   appears to lack the central transposase core domain,
FT                   thought to be involved in metal binding, and possesses a
FT                   possible site for programmed ribosomal frameshifting,
FT                   following codon 150. IS1665 is also highly similar in the
FT                   N-terminal and C-terminal regions to the Y. enterocolitica
FT                   IS1660. Both IS1665 and IS1660 share the same inverted
FT                   repeat sequences."
FT                   /db_xref="EnsemblGenomes-Gn:YEP0090"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10107"
FT                   /db_xref="InterPro:IPR024473"
FT                   /db_xref="UniProtKB/TrEMBL:A1JJC4"
FT                   /inference="similar to sequence:UniProtKB:P03835"
FT                   /protein_id="CAL10107.1"
FT                   /translation="MHIAQALDLVSRYDSLRNPLTTLGDYLDPQLISRCLAESGTVTLR
FT                   KRRLPLEMMVWCIVGMALERKEPLHQIVNRLDIMLPGDRPFVAPSAVIQARQRLGSEAV
FT                   RRVFSQTAQLWHGSVTHPHWCGLTLLAVDGVVWQTDNATEQADAAEKKPELVEQELWGV
FT                   LLGYNLVRYQMIKMTGALKGYWPNQLSFSESCGMVIRMLMTLQGASPGRIPELMRDMES
FT                   MAQMVKLPIRRERAFPRVVKERPYKYGKARNKNASQLLN"
FT   misc_feature    complement(62507..62513)
FT                   /note="possible site of programmed ribosomal slippage"
FT   CDS_pept        complement(63019..64356)
FT                   /transl_table=11
FT                   /locus_tag="YEP0092"
FT                   /product="transposase for insertion sequence element IS4"
FT                   /note="Similar to Escherichia coli transposase InsG for
FT                   insertion sequence element IS4 or b4278 SWALL:INSG_ECOLI
FT                   (SWALL:P03835) (442 aa) fasta scores: E(): 4.2e-165,89.72
FT                   38d in 438 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0092"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10108"
FT                   /db_xref="GOA:A1JJC5"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024473"
FT                   /db_xref="UniProtKB/TrEMBL:A1JJC5"
FT                   /inference="similar to sequence:UniProtKB:P03835"
FT                   /protein_id="CAL10108.1"
FT                   /translation="MHIGQALDLVSRYDSLRNPLTTLGDYLDPQLISRCLAESGTVTLR
FT                   KRRLPLEMMVWCIVGMALERKEPLHQIVNRLDIMLPGDRPFVAPSAVIQARQRLGSEAV
FT                   RRVFSQTAQLWHGSVTHPHWCGLTLLAVDGVVWRTPDTPENDTAFPRQTYAGQPGLYPQ
FT                   VKMVCQMELTSHLLTAAAFGTMKESEYTLAEQLIDQTADNTLTLMDKGYYSLGLLNAWS
FT                   QAGEHRHWMIPLKKGAQYEEIRKLGKGDHLVKLKTSPQARKKWPELGAEMTARLLTITR
FT                   KGKVYHLLTSMTDTMRYPGGEMADLYGHRWEIELGYREIKQTMQLSRLTLRSKKPELVE
FT                   QELWGVLLAYNLVRYQMIKMAGALKGYWPNQLSFSESCGMVMRMLMTLQGASPGRIPEL
FT                   MRDMESMAQMVKLPIRRERAFPRVVKERPYKYGKARNKNADQLRIG"
FT   repeat_region   complement(63031..63045)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS4-like element IS1665"
FT   repeat_region   63031..64440
FT                   /note="label:IS1660"
FT                   /note="IS4-like insertion sequence element IS1660"
FT   misc_feature    complement(63301..63978)
FT                   /note="Pfam match to entry PF01609
FT                   Transposase_11,Transposase DDE domain, score 160.8, E-value
FT                   1.6e-45"
FT                   /inference="protein motif:PFAM:PF01609"
FT   repeat_region   complement(64424..64439)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS4-like element IS1660"
FT   CDS_pept        64448..64915
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="YEP0093"
FT                   /product="transposase for insertion sequence element IS1328
FT                   (remnant)"
FT                   /note="Similar to the very C-terminus of Yersinia
FT                   enterocolitica transposase for insertion sequence element
FT                   IS1328 SWALL:TRA8_YEREN (SWALL:Q56897) (334 aa) fasta
FT                   scores: E(): 4.7e-36, 61.61 38d in 198 aa and Shigella
FT                   flexneri 2a IS1328 transposase SWALL:Q93EZ2 (EMBL:AF326777)
FT                   (334 aa) fasta scores: E(): 2.6e-33,56.63 38d in 196 aa.
FT                   Note this CDS lacks a possible 5' end."
FT                   /db_xref="PSEUDO:CAL10109.1"
FT                   /inference="similar to sequence:UniProtKB:Q56897"
FT   repeat_region   64448..65189
FT                   /note="label:IS1328"
FT                   /note="degenerate insertion element IS1328"
FT   misc_feature    64481..64801
FT                   /note="Pfam match to entry PF02371
FT                   Transposase_20,Transposase IS116/IS110/IS902 family, score
FT                   115.3,E-value 8.2e-32"
FT                   /inference="protein motif:PFAM:PF02371"
FT   repeat_region   65170..65189
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for insertion element IS1328"
FT   repeat_region   65191..65900
FT                   /note="label:IS1541"
FT                   /note="IS1541"
FT   CDS_pept        65333..65791
FT                   /transl_table=11
FT                   /gene="tnp"
FT                   /locus_tag="YEP0094"
FT                   /product="transposase for IS1541"
FT                   /note="Identical to Yersinia enterocolitica IS1541 element
FT                   transposase tnp SWALL:Q9X9G8 (EMBL:AJ238015) (152 aa) fasta
FT                   scores: E(): 4.6e-66, 100 38d in 152 aa and highly similar
FT                   to Yersinia pestis putative transposase y1761
FT                   SWALL:AAM85329 (EMBL:AE013779) (169 aa) fasta scores: E():
FT                   8.3e-64, 96.71 38d in 152 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10110"
FT                   /db_xref="GOA:A1JUD1"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:A1JUD1"
FT                   /protein_id="CAL10110.1"
FT                   /translation="MRDEKSLAHTRWNCKYHIVFAPKYRRKVFYGEKRKAIGSILRKLC
FT                   EWKSVNILEAECCVDHIHMLLEIPPKMSVSGFMGYLKGKSSLMLYEQFGDLKFKYRNRE
FT                   FRCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGSPFTGRK"
FT   misc_feature    65387..65698
FT                   /note="Pfam match to entry PF01797
FT                   Transposase_17,Transposase IS200 like, score 222.9, E-value
FT                   3.3e-64"
FT                   /inference="protein motif:PFAM:PF01797"
FT   CDS_pept        65993..66238
FT                   /transl_table=11
FT                   /locus_tag="YEP0095"
FT                   /product="putative plasmid copy number control protein"
FT                   /note="Similar to Escherichia coli copy number control
FT                   protein CopB SWALL:Q8RTD2 (EMBL:AF467508) (82 aa) fasta
FT                   scores: E(): 2.3, 30.15 38d in 63 aa. Previously sequenced
FT                   as: Yersinia enterocolitica putative replication protein
FT                   RepC SWALL:Q93KQ2 (EMBL:AF336309) (81 aa) fasta scores:
FT                   E(): 8.6e-31, 100 38d in 81 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0095"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10111"
FT                   /db_xref="GOA:A1JUD2"
FT                   /db_xref="InterPro:IPR019661"
FT                   /db_xref="UniProtKB/TrEMBL:A1JUD2"
FT                   /protein_id="CAL10111.1"
FT                   /translation="MIEGVHERKRRPKGPQKSNASYQRDFWERRKLTHSRIVMVVPNEV
FT                   KEDLELLSSVYGKTKTEVIEQLIKMAKDGCGFKDPL"
FT   CDS_pept        66500..66556
FT                   /transl_table=11
FT                   /locus_tag="YEP0096"
FT                   /product="putative leader peptide RepB"
FT                   /note="Similar to Yersinia enterocolitica putative leader
FT                   peptide RepB repB SWALL:Q93KQ1 (EMBL:AF336309) (18 aa)
FT                   fasta scores: E(): 1.4e-07, 100 38d in 18 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0096"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10112"
FT                   /db_xref="UniProtKB/TrEMBL:A1JUD3"
FT                   /protein_id="CAL10112.1"
FT                   /translation="MYNPNQAFRPAISAVWGG"
FT   CDS_pept        66549..67571
FT                   /transl_table=11
FT                   /gene="repA"
FT                   /locus_tag="YEP0097"
FT                   /product="replication initiation protein"
FT                   /note="Similar to Escherichia coli replication initiation
FT                   protein RepA1 SWALL:REP4_ECOLI (SWALL:P13961) (340 aa)
FT                   fasta scores: E(): 1.3e-51, 43.71 38d in 334 aa. Previously
FT                   sequenced as: to Yersinia enterocolitica putative
FT                   replication initiator protein RepA SWALL:Q933Q8
FT                   (EMBL:AF336309) (340 aa) fasta scores: E(): 1.7e-138, 100
FT                   id in 340 aa. Also similar to Klebsiella pneumoniae RepA
FT                   SWALL:Q48418 (EMBL:U27345) (351 aa) fasta scores: E():
FT                   5.4e-65, 54.57 38d in 328 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YEP0097"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10113"
FT                   /db_xref="GOA:A1JUD4"
FT                   /db_xref="InterPro:IPR003446"
FT                   /db_xref="UniProtKB/TrEMBL:A1JUD4"
FT                   /inference="similar to sequence:UniProtKB:P13961"
FT                   /protein_id="CAL10113.1"
FT                   /translation="MDKQKFSNFSKDHSWEDIDFEALERASIEYFQEQTSFDTSKTEKK
FT                   RTLRKRGEHSTECKCPNPFFSRPEHYKPLAGELGHAYRRLTQKDKKTGKVSLRIRISRH
FT                   PYFVWARKAVGRQRDFRPVREQLLDALFVLLVSCVDRATHIVTMNESRLAAELSPKDDN
FT                   GNVIPATAVTVTRICRLLQELNKFGLIALPEGVQWDAYNKQFFPKHVILTEQAWKLIGV
FT                   NLDKLYAEQEERLQAEIDGVLQPGEDVSVKTARKRWYDRMRHATLVRRRGEAIKQKRAN
FT                   KLGKLELNDRVYEMSNFLQRTLPYDELYHMTPEHFEKLVWQRLHQLDIAMAHEPPEPYH
FT                   "
XX
SQ   Sequence 67721 BP; 19032 A; 14799 C; 14945 G; 18945 T; 0 other;
     ttacccacaa atatccgcaa atggataaat aaccttatct ggaaatgaag tatcaacaag        60
     ccgcaaagta ttcctaacct tatggttaga aatttcttta atcataaaaa aaatacttat       120
     tcagtcctgc ttccctatga attaaaggaa taaaggaata aatgacttct cttgcggctg       180
     gctaacgcca gcgccgctca gagaagagat aagaatgtag ctccctacgc ttcactacag       240
     gcaactaaca gtacagagac ataacccccg taagtgttcg ctacgcgccc actaacgacc       300
     aggaaatcac gctcagcgtg tctacgccac actgaccgct cacctggtta aaggggttag       360
     attaattaca tcgtcgtttg aagcccagca aggcttagca gggcaggggg ttatcacgat       420
     ctctaatgat cctgtaccgg cttcgccggg tatcacaggc atttaccatc tgtattatct       480
     gttaccactt ttgcctgttc ccatgcgcta acgcgcataa aatacaaaat tggatatagg       540
     aagactgttg gttgaataat gttctaaata tgcaatattc ttgtttaggg ggtgcggacg       600
     atttcttgga ctctcaggag aaaacttatg tttaccgaag cagaacggat ccgcgcaatt       660
     gagctttact ttaaatacgg cagaaaactt gctcctgtag ttcttgaact gggttacccc       720
     actaaaagaa atctacgacg ctggatccgt ttatgggaag cgagtgacga tgctacaaaa       780
     tccatacgcc gtaagcctcg ttactctaat gggcaaaagc aggctgctgt tgaacattat       840
     cttaaccatg gctgctgcct ggcgtttacc agcaggactc ttggttatcc ctgctgtgat       900
     gtattggctc gctgggttaa tgaacgtcat cccgacagac ggcttatttt caccagtacg       960
     atcaatcaaa atgcaccttt tgaacctgag gtgaaacgtc aggctgtcat ggcgctttgt      1020
     acacggcatg tacctgccag agaaatcgcc atgaacgttg gcatcagtcg cacggtattg      1080
     tacaaatgga aagatgaaat catcggcgat gaggcttacc agtccatgcg taaacatgaa      1140
     aagccgtctc ttacggaaga gcgcgacact ctgcgcgaag aagttaaccg acttaatcag      1200
     gagatacgtc ctgcatgcct ggcgtatgct catcgtaaac tgcgtggtca gatagttgat      1260
     gagctcacgc tttatcgctg gttttaaagc tttttttcaa tgacgtcttt taacgcgcga      1320
     ttttccagac tcaggtcagc aaacatctgt ttgagacgtc ggttctcatc ttcaaggtct      1380
     ttgatttttt taatatcagc cgcttccatc ccgccatact tagccttcca gttgtaatag      1440
     ctggcttcgg aaatagcagc ctcgcggcac acatctttga cggtcctacc cgcttcgact      1500
     gatttcagta cggcgatgat ctggtgctcg gtgaatcgga ttttacgcat agcgatctcc      1560
     tcaggggaca taatcagtat gtcggaagat ctctaaaagt gaatgggccg tttaagcggg      1620
     atacttacag tttaagcggg atacttacac agctaccgtc aggcaaagta tggttgtcac      1680
     ctgtaatcga ctgcttcgat ggtaaagttg tgagctggtc gttgggtaca cgcccggatg      1740
     cagaactggc gaataccatg ctggatggtg caatcagcac attaaccgca ggcgaacgac      1800
     caataatcca tagcgatcga ggcgggcatt accgctggcc aggctggctt aagcgtgtga      1860
     atgctgccag tcttatccgt tcgatgtccc gtaaaggctg ttcaccggat aatgcggcct      1920
     gtgaagggtt ctttggtcgc ctgaaaacgg aaatgtacta tggtcatgag tggtcaggcg      1980
     tgacacctga gcactttatg cagcatgttg atgcctatat acgatggtat aacgaacatc      2040
     gcatcaagtt gtcgctggga gcactcagcc cggaaatgta ccgtcgacaa ctcggcatcg      2100
     cgcaataaaa ccgtccaaga aaacgtccgc atccccattt ccttcattgg caaggtcagt      2160
     atgccggaag atctctaaat gtgaatggta cgattatgcc ggatgattac ataccactgg      2220
     tttttatatg ttacagataa ttaaccttta acataatcaa ctatcatatc ccaaactctt      2280
     taatatagct tcatcccata atacattttt gatcgcagga ttcgcgactc aattcctcca      2340
     actcagattt agatatgatc agcataatac aaaaacgatg aaaattttca tcatatagat      2400
     atttttttat gtcatcattc tctataagta gagagttttt cggatcatac aattctatat      2460
     tccctttact gtcttttttc cctgtgatca cataacctat atcacaatct aatacagaaa      2520
     acacaatacc aaaatcagaa ttatttggta gtttcttaaa gttggtgtca atgtcgctga      2580
     catgttgcca ttcgtataag cgatatatta taccaacagc ctgccataac tcttctaaag      2640
     tagataatat tgatccactt ttaagtggtt caatccctac tctattgacc aatgaacaaa      2700
     catccgttct cagtaaatga gcagtagcgc agtagtaact gttattttct tctttagatg      2760
     tatttattat tgtatcaggt gccgactgtt caagagcggt acataaagca cgcatgttat      2820
     aagcatcttt aataaacata gttactactc caaaatttac tttataaact acactattta      2880
     ataaccgtca ctacgagtgt ataattaagc tcactccgta atttataaaa atagaatatc      2940
     tactctcaat gagcttccca tgcatcggaa tatttcaagc atcctccact ccgtgacgtt      3000
     gctctttaaa tattaatttt aaagctacag atatagtata atatatcatt attagaatga      3060
     atttttatca cattagagtt tattataaac tctccccgcg acgccccgac gctatcaaca      3120
     taacatcact gttcccataa gttgaatttt tataataaaa attaactttt aactattgaa      3180
     aaaatattta atcgaatgta caacatgtac tatgactcag agaaaattcc tgagtcacct      3240
     attggttgta atttattgta ggctctatcg ttcattgcca gatgtcaaaa tccagctata      3300
     ttcaatttat cggtatagca aaataatggc taacataaat agattataca gatggacagt      3360
     attcacggac actaccatat tcaactatcg aattattctg ccggtgaaaa ccttcaatca      3420
     gctacacccc ccgaaggggt gattggcgca caccgagtga aagtggaaac agcactgtca      3480
     cactcaaacc ggcagaaaaa gttatcagcc accataaaac ataaccagtc aagccgttct      3540
     atgctggata gaaagttgac cagcgacggc aaagttaacc aacgcagcag ctttaccttc      3600
     agtatgatta tgtatcgcat gatacatttt gtactcagta ctcgtgtgcc cgcggtgaga      3660
     gagtctgttg caaattacgg aggtaacatc aatttcaagt ttgctcagac caaaggggct      3720
     tttcttcatc aaataataaa acattcagac accgctaggg gggcctgtga ggctttatgt      3780
     gcacattgga tcaggagcca tgcacagggc caaagcttat ttgaccagct ctatgttggc      3840
     gggcgtaagg ggaaattcca gatcgataca ctttactcaa ttaaacagtt gcaaatagat      3900
     ggttgtaaag cagacgttga tcaagatgag gtaacactag attggctcaa gaaaaatggc      3960
     atatcagaac gtatgattga acggcattgc ttactgccta cagttgatgt tactggtacg      4020
     acgggatcgg aagggccgga tcaattatta aacgctatcc ttgatactaa tgggataggt      4080
     tacggttata aaaaaatatc tctctctggc caaatgtcag gccacaccat agcggcgtat      4140
     gtcaacgaaa atagtggtgt tactttcttc gatcccaatt tcggtgaatt ccacttttct      4200
     gataaggaaa agttcagcaa atggtttact aactcattct gggaaaattc tatgtatcat      4260
     tatcctttgg gggtggggca gagttttagc gtttttacat ttgactccaa ggaggtttaa      4320
     tgcagacaac cttcacagaa cttatgcaac agcttttcct gaagcttggc ttgaaccatc      4380
     aagttaatga aaatgacgtt tatacatttg aagtggatgg gcacatccaa gtactgattg      4440
     cttgttatca tcaacaatgg gtacagttgt tcagtgagct aggtgctgat ttgccaacca      4500
     acgataattt gtttggcgaa cattggcctg cccatgttca aggaaggctg gacggtaaac      4560
     ctattctctg gtctcaacaa tcactggtag ggttggatat cgatgaaatg caggcttggt      4620
     tagaacgttt cattgatgat attgagcaga gaaaagaatc gcaaaatact aagtttcagc      4680
     ccaactcgac atcacccata ttattcatct gaaatgtaaa caatcatatc tattaaattt      4740
     aatagatatg gtttatataa taactcattt gtttttaatt cactataaat taagaaattt      4800
     tcattattta tccagatttt aacatataca tggcacaaat tagtgttatc aataatgatt      4860
     atttttatta gtaatataga cgatttatcg aaatatcctg ccaagttaaa tcttccccag      4920
     ttaataaccc accattaagt atttcggtga tgcctccaat tggttgaatt ttatatgtcc      4980
     actccccgtt atctgagaca aacctgttta gagttttcta gctgttttcg gtatgtctcc      5040
     gggggaagat gccccagact ttcatgtgta cgattccggt tataatcctg ttgccagaac      5100
     catgccatat ctcttacctg acttaatgat tcaaataact aagcgtttaa aaattcccgg      5160
     cgaaatgagc cattaaatct ctcaatgaac ccgttctgct ttccagttat aaaaagttgc      5220
     attactgatc ccgttctgac ggcagatttc ttcaaccttc atacctgaat cggcaatctt      5280
     caggatgtta acgatctgag tttcagtaaa acgtgctttt ccattttgac ctctgcaaat      5340
     gtaaaggcag aaaatctaat tatagctgtc tcattttagg gggagtggac aaacgcttca      5400
     gggatttgaa atattgcgac gactgaataa aggtcaattt gatatttggt tacgccgtga      5460
     cgaacctgaa tatcgagtgc gggaaggatc tacctttatg aatcggctct ttaacattga      5520
     ggtggtttta gcctaattat tacacccatc aatgagtaaa atcaccgact ctcattattt      5580
     gcaacaaatc catatattgc gctgaattat aaatcgccca tcataactgg ggataaaacc      5640
     acttaatatg ttgtaacccc cacggtttca tatgagtatt ctccgattac atatatgtta      5700
     gttgccatgg ataatccgta atgttaaata gagttatttt ctgtgtcaca ataataaata      5760
     acacaattgt tctttcagaa ctcaatattt ttaatatact gtagcaatag tatcaatagt      5820
     catacttatt aaaatgatat ttttcccaca gttaattaca cagcgtgaag taatgatatg      5880
     gtgtttattt ttttattaaa tgtcgtatct tgtttggtgg ttttatttat gtgtttaact      5940
     gatttcaatg taaaaatatt ttttacattt ggtaactcat gtcaatgata tttgataaag      6000
     ataattactg cttaattgat ggatattttt tgtttttttt atcaacggtg gcgtcgctat      6060
     cgccttaacg ttcacagaag atatcattct gcatggctcc gccagcatcc aggcaagcat      6120
     ctactgtcag aaagtgctca aatttcatac cagcataaaa agcaacgcac aatgcggtgg      6180
     ctatcactag tcgttttttc attgcatcgt cctcgtaggt tagattatgc ccatgagcta      6240
     tcgttgtctt gagctttctg tccgggggga ttatcgaatt ttactttatt tacatagaat      6300
     tcagattcta tcacaccata attaaacttt acttgaataa aaacatcggt gtgctgacca      6360
     tattcctgat aataatatag ccttaatgct catggtaata aagagccctg cagcaatttc      6420
     ggcaggtttg ttgcaaataa tgagagtcgg tgattttact cattgatggg tgtaataatt      6480
     aggctaaaac cacctcaata ttaaagagcc gattcataaa ggtagatcct tcccgcactc      6540
     gatattcagg ttcgtcacgg cgtaaccaaa tatcaaattg acttttattc agtcgtcgca      6600
     atgtttcaaa tccctaaagc gttgaccagg cacggtttgg ccgtttgaaa tccccggccg      6660
     cgtttaccca ttttttgatg ggggcatggt tagacgcgat acgattattc aggtatttga      6720
     cttgccgctg ctttgcagca tcccgtatct tttcctttct ttcatcaaac gagtgatagc      6780
     gtaaccgtat gacgaatgtt tatcggtatt gagtatttta ggctgtcttt caacaggata      6840
     gggttttaac acccgtttaa tgaatggata ggcggtattt ttatttcgct taggcgaaaa      6900
     gtaaaaatct aatgtagtgc cgtgcttatt gatggcgcga tcaagaccgc caagaaggca      6960
     attaattgtt tttatggaat ttattacatc attcatccaa taaattattc taatgccagt      7020
     tgcgaaccat aatctattaa tgggagcatt agaaatgctg tgtcattcca gtaatatgca      7080
     atcaaaaaag aataacacat gtcccaaccc tttgatttcg acagcgcgct taaagcactc      7140
     cagtttggtc aggctctaac gggaaaggat agtatcttaa cgccattaac caaacagtta      7200
     accgaagtcg cactgactgc cgaacttgac tcgcatctgg ctctggacat cgaagccaac      7260
     cgcaaaaatg gttcgtccag aaaaacggtc aaaactccca ctggtacgtt tgaactcgcc      7320
     acgccctgtg atcgcaatgg aacttttgag cctcaactgg taatggggcc aacaatatcc      7380
     agtggtactc cagtcgtgac ggaaaaaatg ggccaatttg tcgtgttact tccggtatcc      7440
     gacaacgatc cgcaaggtca tttacatgac aaatgccatt gaatcggtac atcggctgtt      7500
     cagaaagctg acaaaaacga aaggcgtttt ccctaattaa aacagtctgt tgaaattact      7560
     gtgtctgaaa ttaataaatg cgcaggaaag atggacaatg ccaatccaga gctggaattt      7620
     gacattgtca cagttggcga tttattttga aggtcgcctc gataaagtga ttacgttgta      7680
     atgatatttt aacgtgacgc agaattatga acgctcttgc gtactactca aatacatcat      7740
     cttcaagttt gtctgtagtc tcatgagcaa attcatatgt atcagttaca cgttcagagt      7800
     ccatccgaag atcttccact gactcaggta tatcgggaaa ctctcttaga gcgttgtgct      7860
     ctacgtggag ctgtttcagg ttttgcggca attcaggtac ttcagcaaga tgattaagtg      7920
     aagcgattaa acgttctaag tgtggaggta acgctggcag ttcgatcaac tgattatctc      7980
     tgacatcaag ttctaccagt gaagggggta aatcgcataa ggatcttatt ccattgctgg      8040
     atgcatcgag ataatacaag tttggtggca attccgataa tccagaaaaa atattatcag      8100
     aaacatctaa gaaggttaaa ctctgcggta attctggcag atcagttaaa taattttctc      8160
     tgacattaag tgttttcagg gaagggggta aatcgggtaa tgttttcagt gaattgttat      8220
     cagcatgaat ctcagtcaag aatggcaagt tttgtaactc tgacaattct tccagctgat      8280
     tattaccagc agcaagaaat tccagtgaag gaggtaaatc aggtagtttt ttcagtgaat      8340
     tgttatcaac atcaataatt ttcaagaagg acgagttttg caactctggc aattcttcca      8400
     gctgattatt accagcagca agaaattcca gtgaaggagg taaatcggat aatgccttca      8460
     gattgttatt atcaacttga agtgatttca ggctctgcgg caattccggt aattctgtaa      8520
     gagaattaca tgacgccact aaactctcta aatgcggagg taattccggc aaagaactca      8580
     gccccagatt atttagttct agctcatggg cttgtcggtc caggcaatcg cgtaaccttg      8640
     aaaccgccat ttccctctgt tcaccattcc ccggaggggc atttcgttcc cataccgccc      8700
     atgcattata atattcagtc ttagatttaa cattttctgc ttcaaccggc atctcagtta      8760
     aatcagaaga atgacgtaat ggttcttgca aaaaagtatt agatacattt cttggagtta      8820
     taaacatatt gaatgccttt ctgaaaatgt ttttattatc gggttttttc aaaaaaacat      8880
     acgtattaaa tttatatatg tatacagttt ttggtcgaaa atttttatgc ataaataacc      8940
     agaagaaata tgtcagagga ttgtatggcc gctattttta gattctcgac aaaatcattt      9000
     ggcatcggtt atcctggttg gataacaccc aacaccacaa aattatttac tcggtataat      9060
     atcaccataa acttaccagc caatggcaat accgccaccg atgcaatccc tgcattgaca      9120
     ttcttggtgt tattattaat gctgttgtcc agttttgact ggccgtagaa tcaaccttac      9180
     cggctatcat taaactttaa atcagtgtat tttggggcag tagtttcaat accggccatc      9240
     tgctctttag tttcttcaat ggtttcattt ctcaatgtaa ttcctgatct ataataccac      9300
     ttatagcatc gctatttacc ttctgaacag tataattatt agcatccttc aatgttgagt      9360
     ctgctttatt attggtatag gtattggctc tgtccaatgt attactgctg acgggttgcc      9420
     gttcaacaac cggtaactgt cagctcaggt cttgagcgac tacatgtaaa taatctttta      9480
     ttttaattgt catattatcc taacttatta tttttaattt aataataaaa gccctggatt      9540
     aactaatagt aatccaaggc ttttcagcac cttatacctt atataaataa gttctatcac      9600
     cataaggggt aaataaaact ttcggttaat taactaacca aggtcataaa tggtcagaca      9660
     acaccaaaag cggctttcat ggcgtgagta tgactgctaa catattgttc aatcaagcgc      9720
     aggacatctt tcataaagtt atcattatag ttcatcgcct cttcggcttt ttgcttctcg      9780
     ttggcagcaa tacttgcatt gacttctttc tctttgacct cggcttgaga atacccttga      9840
     tgaacttgaa tcgcactgtt tgccatttgt cctaacggct gcgttgcggc attaaacgca      9900
     ttggcttttg agtcggtcat tctgaattct ttatccaata atgccagctt attttgatcc      9960
     gctacctgct ctggtttcca tattctcccg atatcctctc tgcttaccgc tttatcactg     10020
     gtgttactca tttgttgcat ttttgtatca ataagttgat cgcggccagc aatattactg     10080
     tttagaattt gttcctgttt aactattttc acctctttcg ctatagaaaa agcactagca     10140
     accgtagaag tagcagccat gatgccagac accaccgcca tggcgatcat cagttttgca     10200
     ccgctgacca tctccgctac ctgctccttt tgggcagtaa tagcagcttt attttctata     10260
     tccctttgtt gcaaacccat ttctcgcgct ttacgtgcca gttccaacag caacaacaag     10320
     atacttaaag taccattaag atctccctgg cttttactca gtaatgcaac attgattccc     10380
     tgactcggtt tgatcaattc aggcacttgt gaccgagata agcttgcctc gctactcttt     10440
     attgcttgtg cttcatgacg ggtgtcttct gtttttttaa cctcaccgct ttgcccgact     10500
     gtctctgtag tgatggcatc aatctgtgaa ccggtcgtga taattgggct gtctgtcttg     10560
     atatttattg tcattgttat tcctccttaa acttaaacag tatggggtct gccggccaaa     10620
     ttatgcagca tgtcaccttt tgcattaatc atctggaaaa tcagttccat cacttgttga     10680
     tgtgactctg acaaatggga taactcttct ttgagtcggt caataatact ttgtaacgct     10740
     gccatgtctg ccttgttcaa ggccaaatca gcgttattat gttgtaaatc agcttgtttt     10800
     ttattattga tggtctgagt tattccgctg cccacaccaa cggcgacttg tgttgcctgt     10860
     gatcctgtac ggattacatg gctcattgtt aaactaccaa aactgccccc taatttagtc     10920
     actgcattcc cgacagtgtt tgatatgcct gtcgaaattt gggcaacttt ggccgaaaac     10980
     tcggctcctt tagcagcaag acttgcggtg ttagcaccga gttttgcgcc aatatcagcc     11040
     aggcatttta gtgccgaacc gccaaaggtc attacggttg aaactacagt caatgcgact     11100
     tcaatcgcag tgagtatcgg ccctaatact tgcattgcct cttgggatat caggccatct     11160
     tccgccgctt gtttcacagc catattcgcc atcccaatta cgcctgaggc aatcatcatt     11220
     gcaccggcaa cggctcctac ccctgaggcc accatgatgg caccgataac cactgaggct     11280
     atggcgctga gccagccaaa aatctttgat gccatgccgg atttcttgac ttgcttggca     11340
     ttctcttctg tttctttgat tttctcttga ttctcttcaa ttttcttcat gttttgttca     11400
     tgaagacgct gaatatcagc gatttttatg tctttgcgta cttcttctaa attagaaact     11460
     agcttaccta actcaatctc aaatgtatca ggtgaagcga gcgtaaaatt cgttagcact     11520
     gaaacataat ttgatatcag ttgagatcct gccgtgccgc gggtgaccga ctccaataat     11580
     ttagtgattt cttgctgttg tccttcagtg acttggctgg caaccactgc tagtggtgca     11640
     gggagctgta cgccctgaga actcacccca ccatttttat ccttcagttc tcccgcgact     11700
     tgttgagtct gaaggggggc gggcgctggt gtctcgacgt agggaagtag acttccagtt     11760
     actggcgttg agcgatcatg ggttatcaac gcactcatgt tccatctcct ttttcaattt     11820
     aattgcttct aacattgagc taactcgggt ggaaagctcc ttaaactcag gtttgtctgc     11880
     gataagctct tgagccaaga acaagccact ttctgcttca gcaagctctc ccttttgcag     11940
     taaacattcg gcagcatgaa acggaaaacg aggttctttt atatccatta tggcgccata     12000
     gctgtagcta tgaatcgcta agtcgtattg ccccatggct tgacgacaag cgcctagccc     12060
     taaaaagaaa cgtgaatcat agtggtctag cacacagaga gcttgaaaga ccttgtgagc     12120
     atcctcgtat tttcctgact ggtattggtt aaacgcaaga gagtagagtt gctctaaagt     12180
     gtcacttgaa atttcgttga gcatggcgat agttccccct ccttttagga aggattccat     12240
     tgccagctgg tattcttgag tgtctgtcgt ctcttgttgc ataattacct cgtgtcatct     12300
     agcagacgtt gcattactga atcatatttc tgaatgaaac ggttcagtgc ttcaatagct     12360
     gaattaaaac gtgatgtaat atcagacagc tgagttgttt tttggctaac caagtcgttg     12420
     agcggcctgg acttatccga gcaggcggtg gcaaagtgag ataattcatt attatcttta     12480
     ttataagagt atgaattttt caggttaccc aacgccccgg ttcttttatt ctcactttca     12540
     agaaagttct ttatcgagac tatttttttt tcggtctcac cttccttaat ggtggtttga     12600
     gacattttct caagaatttt gtactctgcg ctggctttaa aaatctcttc atctgtataa     12660
     ccatataaat ttttatccat gagattaatt gatttatcat ggatatttat ggtgccacta     12720
     ttcgacagat acttattaat ttcagcttga ataactgaat aaatttttaa ttcggcggta     12780
     agctcagcta attcttcacg caacttgcta cgggcatcac catgatgatt cattgaatca     12840
     acaatcactt tcaaaatatc atcatcgata cgatcggcgg ttaaagagaa atgcattact     12900
     gccatgaacg ctcgcaactc ccattgtgta ttcggcgatg attcaaggaa ctcttttact     12960
     cgcttgatgc cattttgcag ttggttgtca taatgaccgc ctttaagaat ggcatcctcg     13020
     ggtagaaaat aagccaggat tttcttgagt aattcgatat catcagtaat taccctttcg     13080
     gcaaaaacct ccgaatcttt tttgggatca tatttaatgg aaatatctat ctttttatct     13140
     ttgactaact gaaccaattc ttctaaaact gaagaaccat gaccagtaag ttgttccacc     13200
     ctaacttttt ctagatcctc aataaaatgt tgtgggtttt gttcgtaggc tctaatcata     13260
     ttaaataatt tgccctcgca tcatcgttgg ttttcttggc ctcttcccat cgttgggatg     13320
     ttgaggctgc ctctccctct gacgcttaat ttcatcaagc aactcgcgct ccgctggctt     13380
     tatctcttcg gcggaacggc ccgcaaatat cttcattacg gcttcaggcg ttaagccgat     13440
     atcagcacac atttcttgca ataattttgc gcggtgatcg ctgtcggcta ttgccagttc     13500
     tgcttgttta agcgttttgt catattcatc aaaatgggaa gatttcataa tctatctcct     13560
     attctattac gttattttta tttagcttgt caggcaaagc cgttgttttg tcgctttttc     13620
     atattagata aggtaatgac ttgtgatact tttagtgaga accacccggt gcttaattct     13680
     ttggccccgg tccaacgtcg ataaaaatga gcgagccgtt gcgtactgag agaactcccc     13740
     gccagtacat cgacattgcc atacagataa tagtcagggc caagaacggc ccgcgctgca     13800
     ttagctaaca tatagagtgc cgcgaagggg tttttcagcc ctcgacgttg ttccactcgt     13860
     tggataagca cgatccaaac ccgcctttgt tcaatttcta cgcgccaggc aagcttgagg     13920
     ccagctaatt gaaaggccga acctaaagaa atgggggcgc cagataaagt atgagggtgg     13980
     caaaccaagc catgttcggt aagccacgga attaaagggt cttccatcat aagcaaactc     14040
     gtccaagtgg ttggatatta atctgctgag tcagctcttg gtatgaaagt accggcaagc     14100
     catagtattc gctctcaatc agtttgcgta catagcgacg aatatccata gaaacaatca     14160
     gcaccggttt actctggatt tgtgacagat cgccaatagt cttgcggact tgttcaagta     14220
     aactctcggt aacagcagga tccaatgcca aataactccc tgcactggtt tggcgcacag     14280
     cactacgaat tttttcttct acttcttgat cgaaaagata agctggcaat atattgttgc     14340
     cattagcgta tttgtagcag atataacgtt ttagactact gcgaatatac tctgtgagtt     14400
     gaacgacgtc tttctctttt tgtccccatt ccaccatagc ttcaagaata gaccgcatat     14460
     tacggataga aatatcttct ccaactaatc gttgtaatat ttcggtcatt cgttgtaagg     14520
     gaacgattct ttgtacttct ttaattaatt cgccatagcc tccttccatc tgttcgagca     14580
     gatagcgggt ttcttggata ccaatgaaat cttcggcata ttcacgtagg acatgagaaa     14640
     gatgccaggt tagaacttgg gaatgagaga aaaattccag ttgagacttt tccaggcgct     14700
     cctcatattc aaccgatacc cagaaagttt cctgatcggg tagcaaatgt tccccttttt     14760
     catagggtat acccagtaat tcgagttggc tgacggattc acgtacgagt aaataacctg     14820
     ccttaagctc acctcgcgcc actggaactt cttgcaagga aataagatat tcgccttcac     14880
     ccatcccctc attaaaacgc agatggatcc cagggaaagg tacgccaaga tcaagataaa     14940
     gagcacggcg cactcgaacc agctcatcat ttagtgctat tgcttccagt gcttcctgtt     15000
     ggcttgaatc tacatcaatc agcaagggaa ccgtcatagc aaatgcttct tgttctccta     15060
     gtcggccctt gtttgcccca cttgttttgg ctttggttcg ggcagccggg gcaccagaac     15120
     cgctcgtcag tagggattgc aggtcttgat tagcttcgtc attacgactc tgcttacggc     15180
     tgagcatata accaccacag cctaccaata gcgccaaaat cagaaaggtg actgttggga     15240
     agccggggat aagaccaaag agcaacagca gtactccacc aattagcatg gctttaggct     15300
     gagcgacaac ctgtttacca atatcgctac ccaagtctga tgaatcttct gaagagacgc     15360
     gggtgacgat aatacccgcg gtaatagcta tcagcagggc aggtacctga gaaaccatcc     15420
     catccccgac agtgaggatg gaatagagtt gcagtgcctc agcggccgct aatccttttt     15480
     gggtaacacc aatggtgacg ccgcctaata tattgacaaa gataataatg aggccagcta     15540
     ttgcatcccc tttgacgaac ttcatggcgc cgtccataga accgaacatt tggctttctt     15600
     tttctatcgt cgcgcgccgc tcacgcgctt cattgacatc gatcaccccg gctcgcatat     15660
     cgccatcgat actcatctgt ttacccggca tcgcatcaag agagaatctg gcactaactt     15720
     ctgctacacg ttctgagcct ttcgttatca ctaaaaattg cacaatagtg atgatcagga     15780
     agatgacaat cccgacgatg aggttaccgc caacgacgaa attaccaaag gtgtaaacaa     15840
     tctgccccgc atcagcctgt agcaggatca tgcgggtggt gctaactgaa agtgcgagac     15900
     gaaataacgt ggtaacgagt agcaccgctg ggaaagctga aaattgtaaa ggagagttga     15960
     tatagatcgc tatcattaac aacaccactg aaatggtcat gttaacagca atcagaatgt     16020
     ccaacacgag gggggggagt ggtaagacca tcatgaatac cacagctaac agcagcactg     16080
     ccagcatgat atctttacgc tcgccaatac gatttagcca ctcaagatca tagggattca     16140
     ttatgatctt tcaactccaa ataatgttga taagcatggc gagccttatc aagatcgccg     16200
     ttcagttgtt gggcacggct caagcagagc caatttccag cctgtaaagg gtcatgtgat     16260
     attagccatt gcgcttcttt ttcggcacgt tctccctggt tattattaag tagcgcgact     16320
     aatcggcaac gccgaccggc taaatgctca ggatttaaca tcagcaaggc gtccaataga     16380
     atacatgcgc gctctgcatg gccacattgt agttgtaacc aaccgttgag cagcaagaac     16440
     tcctgttgtc gtttggttaa agtaatattc atactttgtg caacaggtta aggattattt     16500
     gcagtaaccg atcatcatct tgttggcatt tcagcagcgc cgcggcagct tgtagctctg     16560
     aggactgact ggtggttagc agtgactgca aggtatccag ttcgcgccga taatcttgag     16620
     ctcgatgtaa tccatgaaat gtatagccgg gagaagcaaa gtcccatagg ctacgcttgc     16680
     tttgtgctgt agggtaaagg cgctctaaat gtggttcgac tggatgccca tcaggcggca     16740
     aggcataacg ttcaggcaag ccacaggata gctcttccag gctaatcgcc gacagttttt     16800
     cgatgccaat atggggggca gttattatgc gactcacggc gcaagcacct cttgctgcaa     16860
     tcgcagtaat tgttcgaaag cttgatgtaa aaggggcaag gttaaggaac gctcatcaag     16920
     cgagacaaat aacaccagct gactttcccc taaccacccc gctcgcagcg gtaaagtgcc     16980
     actcttttgg gccgccgtga gcgttagcgc tttgaccata gcatcttcac atcggtgcca     17040
     ggcgagagaa cgcgctaacc acaatgtcag tgtcgcacca tgttgttcca gttgcagcgt     17100
     gccagattga gccatctcta attgaataag aggcgaaagg gggctagatg ttggcactcc     17160
     cagatcctgg cagaaatggg aaatgatggg ttcaatccaa ctcactcaat tcttcctctt     17220
     cactctcaat agccatatcg atcgcatttt gacacatttg caataaattt tgccgttgct     17280
     cctcatcgct aaataccccc agagggaaaa gacgaaacat tctttttaaa tcttgataga     17340
     aacgcacttt gatttcaggc gtaggaaggg aaaaggcgtt ggcaagatgt tcaatgtcat     17400
     gaatccccgc ccagcgcttg tcaaccagtg cgacaatatc tcccataaac tcagaaaggt     17460
     cgtacgccat tagttatacc ctctgaaaaa aattgccaaa atcctttaac ctggtcactc     17520
     acgctaccaa actcctttag cttctgtaag tcactaataa caattcctaa tttttcccgt     17580
     ccagacccgc tttgttgact ttgtagatct gcactaagcg ccttttgcag gaataatatc     17640
     actgagtcta tatccccatt gggaaaacgt ttttgtaaat cactccagat cgcataaatc     17700
     ccttgataac ccatcactgc atcgcggtag gtatcacgga gcggctgcag tggattaaca     17760
     ctcgactggg attctctgta cgcttccggg gttatcctgg cacccaatac aatggcttct     17820
     ccttgctctt cagccatgct gaccagagct tgttcaacca aatgcgaaag atgtgctaat     17880
     tcagggcgcc ctttcagggc atcacgcaag ccgcagagca ttttgaattg ctcactcggt     17940
     tcttctgatt tcccctccag ataagccttt aactgggaca agcttatatt ggggctgtta     18000
     ctcaacagac tgagcagctc actcacattc tgtttttgtt ccaactctgg aactttgcta     18060
     aggtattgat taacctgctc ctcaacgtcg ctaactcgag cttggctgtc acttaatttg     18120
     cgtttgtcga gggagagctc cttacgctcg gagaagacaa atgttacctc ttctgccata     18180
     tcagctatag actgcagagt gccgctgact atctgcacag attctccccg aaattgaccc     18240
     agagtctgat ttacgatctg actactggca gtctctggat gctcattacg cagcggggta     18300
     ttgccataag atatgttatg aagtgtcgtc ataactactc cctgagatga acagtttata     18360
     attgcaatta ccgcgattat aaaaatagtt cttgcttatc gatgccaaaa tcagccgaga     18420
     aattttagtg ctgcttggct atttttctaa aaactcgcgg ctcccgctac aattttttag     18480
     cgtttttagt cactaaaata gtggttaata tttcaagcat tatggattta tgctctcact     18540
     agatcagata cctcatcata ttcgtcatgg cattgtaggt agccgcctaa tccaaattag     18600
     aggacgtgtc actcaagtga caggaacgct attaaaagct gtagtgcctg gtgtgcgcat     18660
     cggtgagtta tgttacttac gtaacccaga caacagcctg tctttacagg ctgaagtcat     18720
     aggttttgcc caacatcaag cattacttat tccacttggt gaaatgtacg ggatatcttc     18780
     taatactgaa gttagcccga cagggacaat gcatcaggtt ggggtgggtg aacatctgct     18840
     gggacaggtg ttggatggtt tagggcagcc tttcgatggg gggcatctcc ctgaaccggc     18900
     ggcttggtac ccagtttatc aggatgcccc agctccgatg agccgaaaac ttattaccac     18960
     accactttct ttggggatcc gggttattga cggtttgctt acctgtggcg aggggcaaag     19020
     aatgggcatc ttcgcggccg ccgggggggg gaaaagtaca ctgcttgctt cgcttattcg     19080
     tagtgctgaa gtagacgtaa ccgtgctggc gcttattggt gagcgtggac gcgaagtgcg     19140
     tgagtttatt gagtctgatt taggcgaaga ggggttacgc aaagcggttc tagtggtggc     19200
     cacctcggat cggccctcga tggaaagagc caaagctgga ttcgtggcga catctattgc     19260
     tgaatatttt cgcgatcaag ggaaacgcgt attgttactt atggactctg taacacggtt     19320
     tgctcgtgct cagcgtgaaa taggcttagc cgcgggagaa ccaccgactc gccgcggtta     19380
     tcctccgtca gtatttgccg ctttaccccg tttgatggaa agggcgggtc agtccagcaa     19440
     aggatcaatt acggctctct ataccgtact ggtcgaaggg gacgatatga cagaacccgt     19500
     ggccgacgaa acacgttcga tacttgatgg tcatattatt ctgtcacgga aattagcggc     19560
     agctaatcat taccctgcca ttgacgtatt acgttcagcg agcagggtga tgaatcaaat     19620
     tgtcagcaag gagcacaaaa cctgggcggg ggacttacgc cgtttattgg ccaaatatga     19680
     agaagtagaa ttgctgttgc aaatcgggga gtaccagaaa gggcaagaca aagaggccga     19740
     tcaagcgatt gaacgcatgg gggcgattcg aggatggctc tgccaaggga cgcacgagtt     19800
     aagccatttc aatgagacgc tgaacttatt ggagacgctg acccaatgat acgccgcctg     19860
     caccgggtta aagttttacg cgttgaacgt gcggagcaag ccatcaagac tcagcaagct     19920
     tgcttgcagg cagctcatcg acgtcatcaa gaggcggtgc aaaccagtca ggattaccat     19980
     ttgtggcgta ttgatgagga gcaacgtcta tttgatcagc gaaaaaacac cacactgaat     20040
     tgtaaagatt tggagaaatg gcagcgacaa atagcgtcgc tacgtgaaaa ggaggccaat     20100
     tatgaactgg agtgcgccaa attattggaa cgtttagcca atgagcgtga gcgccttacg     20160
     tcatgccaaa agacgctgca acaggctcgt cataaggaaa ataagtttct cgagctagtg     20220
     cgacgagaag atgaagatga gctaaatcaa caacattatc aggaagaaca agaacaagaa     20280
     gagtttctac agcatcacag gaacgcctaa tgaataaaat caccactcgt tccccattag     20340
     aacctgagta tcaacctctg gggaagccgc atcatgattt gcaagcacgt gtcgattttg     20400
     agcaagcgct gttgcataat aaggataatc gtcatcccaa agaagagccg cgtagacctg     20460
     tacgtccgca tgaccttggc aaaaaagaag gtcagaaagg agatggcttg cgtgcgcatg     20520
     cgccattagc ggcgacgttt caacccggta gggaggtagg attaaaacct caacacaacc     20580
     atcagaataa tcatgatttc aacttatctc cacttgccga aggtgctacc aatagaaagc     20640
     acttatacca gcaggatagc cgttttgatg accgcgtaga gagtattatt aatgctctca     20700
     tgccattggc gcccttttta gagggggtga cttgtgaaac ggggacatca agtgaatccc     20760
     cctgcgagcc gtttggacat gatgagttat ttgttcagca atcgcctatc gattccgctc     20820
     agccagttca attgaatacc aagccgactg ttcagtcatt gaatcctgct gctgacggcg     20880
     cagaggttat gatatggtct gtcggtaggg atactctggc cagcatagca aaaaaccagc     20940
     gcgatagcag gcaaaaacgc cttgcagaag aaccgttacc tcttcatcaa gaagcattgc     21000
     cagaggtatg tcccccggca gttagtacca caccagatga tcatttggta gcaagatggt     21060
     gtgctactcc tgtggctgag gtagcagaaa aatctgctcg ttttccgcac aaagcgacag     21120
     tgcagtcaga gcaactggat atgaccgagc tggcggatcg gtcccaacat cttactgatg     21180
     gcgttgatag cagcaaagat accatcgaac caccgcgacc agaagaactg ttacttccgc     21240
     gcgaagaaac cttgccggag atgtattcct tatcttttac agcaccggtt atcacgccgg     21300
     gtgatcacct attagcaaca atgcgcgcga ccaggctggc atcagtctca gagcaactta     21360
     tacagttagc acagcgacta gcggtagaac tagaactgcg cggcggctca tcccaagtaa     21420
     cccaattaca ccttaactta cctgaattgg gggctattat ggttcgtatt gctgagattc     21480
     cgggaaaact gcatgtagaa ctgatcgcca gtcgggaaac tttaagaatt ttagcgcagg     21540
     gaagttatga ccttcttgag cgattacaac gcattgagcc aacacaactt gattttcaag     21600
     ctagcggtga cagtgaacag gagtcacgtc agaagcgcca cgtctatgag gagtgggagg     21660
     ctgaagaatg agtttgttaa ccttgccaca agccaaatta agtgaactgt cgctacgtca     21720
     acggctcagc cattatcgac aaaactactt gtgggaagag ggaaaactcg aacttaccgt     21780
     ctctgagcct ccttcgtctt tgaactgtat attacagtta caatggaagg gaacgcactt     21840
     cacgctctac tgttttggcg atgatctggc taactggtta acccccgact tactaggggc     21900
     tccattctct actctgccga aagagttgca acttgcgctg ttggaacgcc agacagtttt     21960
     cctgccgaaa ctggtctgta atgatatagc gacagcgtct ctttctgtca cgcaacctct     22020
     gttgagtttg cggctgtccc gagataatgc gcatatctcc ttctggctaa cctcagctga     22080
     ggctctgttc gctctgttac ccgcacgacc caattctgag cgcatacctt tgcctatcct     22140
     tctttctttg cgttggcaca aagtatacct gactctagat gaggttgatt cccttcgatt     22200
     aggtgatgtg ttgttggccc ctgaggggag tgggcctaat tcgccagtac tcgcctatgt     22260
     tggtgagaac ccttggggct actttcaatt acaatcaaat aaattggagt ttatcggtat     22320
     gagtcatgaa tctgacgaac ttaaccccaa accattgacc gatttgaacc aacttccggt     22380
     tcaagttagc tttgaagtgg ggcggcaaat cttagattgg cacacactca ctagcctgga     22440
     gccgggttct cttattgatc ttacaacacc tgttgatggt gaagtgcgct tgctggctaa     22500
     cggccggttg cttggacatg gtcgattggt cgagatccaa ggacgcctcg gggttcgaat     22560
     tgaacgcctg acagaggtta cgatttcatg atccagttac cggatgaaat taatctcatc     22620
     atcattttat ctttgcttac tctgcttcca ttggtttcgg taatggctac atcgtttgtc     22680
     aaatttgcgg tggttttttc actactccgc aatgcccttg gggtacagca aatccccccc     22740
     aacatggcaa tgtatggctt agcaatcatc cttagtcttt atgtaatggc acccgttggc     22800
     ttcgcgacgc aagactattt acaagctaat gaggttagcc tcacgaacat agaatctgtt     22860
     gagaaattct ttgatgaagg gcttgccccc tatcgcatgt tccttaagca gcatattcaa     22920
     gcgcaagaat actctttttt tgttgacagc actaaacagt tatggcccaa gcagtatgct     22980
     gaccggttag agtcagacag cctgttcatt ttattgcctg cgtttacggt gagtgagttg     23040
     actcgagcat ttgagatagg ctttctcatc tatttaccat ttatcgtcat tgatctggtt     23100
     atttccaata tcttgttggc aatggggatg atgatggttt cccccatgac tatttcactg     23160
     ccatttaaat tgctgctatt tgttttactt gatggttgga cacgactcac gcatgggctg     23220
     gtgattagtt acggagggtg acatgagtca aggtgacata attcacttca ccagtcaggc     23280
     attatggctg gtgctagtcc tttcaatgcc gccggtgtta gtggctgcgg tggtaggaac     23340
     tttggtatct ttagtacaag ctttaacgca aatccaagag caaactctgg gcttcgttat     23400
     caaattgatc gctgtggtgg tcacactgtt tgctaccgcc tcgtggcttg gtaatgaatt     23460
     gcacagtttt gcagaaatga ccatgatgaa gatacaaggc ataagatgat agcggattta     23520
     atccaaagac cattgctcac ttataccctg ctgttgcctc gttttatggc ttgttttgtt     23580
     atattgccag tgttaagtaa acagctcctc ggtggagtat tgctgcgtaa tggtattgtc     23640
     tgttcattgg ctctttatgt ctatcctgcc gtcgctaacc aaccttatat tgaggttgat     23700
     gcgtttacgt taatgctgct tatcggcaaa gagttcatac tggggttatt gattgggttt     23760
     gtggccacca tccctttctg ggccttagaa tccgcaggat ttattgtaga taaccaaaga     23820
     ggtgccgcga tggcatctct actcaaccct ggacttgata gtcaaaccag tccgactggt     23880
     ttacttttga ctcaaacgtt aataacaatt ttcttcagcg gaggggcttt cctctctttg     23940
     ctttcagccc tctttcacag ctatgtaaat tggccggtgg ccagcttttt ccctgaagtt     24000
     agtgaacagt gggttgattt cttttataac caattcagcc agatactatt aatcgccgct     24060
     gtattggctg ctcctttact catcgctatg tttttagctg aatttggact tgcactcatc     24120
     agtcgttttg cgccttcttt aaacgtcttt gtgctggcta tgccgataaa aagcgcgata     24180
     gcaagcctgt tgttggttat ctactgtatg caaatgatga gtcatgccag taaagtaatg     24240
     ctgttggtta tggatcctat aagtttactg atccctgttt tggagaagta atgagcggag     24300
     aaaagacaga gcaacccacc ccgaagaaaa tccgtgatgc gcgcaaaaag ggacaggtag     24360
     cgaaaagtaa ggaagtggtc tctactgcgc ttatcgtcgc gctgagtgcg atgttaatgg     24420
     ggctttctga ctactatttc gagcatttga gtaggctgat gctaatcccc gcagagcaga     24480
     gctatcttcc tttctcgcag gcgcttagct atgtggttga caatgtgttg ctcgagtttt     24540
     tttatctctg ttttcctttg ttaacagtag cggcattgat ggcgatcgct tctcatgttg     24600
     tgcagtatgg ttttcttata agtggtgaag caattaaacc ggatattaaa aaaatcaatc     24660
     caatagaggg tgccaagcgc atcttttcca tcaaaagttt agtggagttt ctcaaatcca     24720
     ttctcaaggt tgttttgctc agtatactca tctggataat cattaaggga aatctagtca     24780
     cactcttgca gttgccaacc tgtggaattg aatgtattac ccctttattg gggcaaatac     24840
     tccggcagtt gatggtgatc tgtactgttg gctttgtggt catctccata gctgactatg     24900
     cctttgaata ctatcaatat attaaggaac ttaaaatgag caaggatgag atcaaacgcg     24960
     agtacaaaga aatggagggt agcccagaaa tcaaaagcaa gcgccgtcag tttcatcaag     25020
     agatccaatc ggggaacatg cgggaaaatg ttaaacgctc atcagtggtg gtagctaatc     25080
     cgacccatat tgctattggt attctttaca agcgagggga aacaccacta ccgttggtaa     25140
     cattcaaata taccgatgcc caagttcaga ctgtgcgcaa aatagcagaa gaagaagggg     25200
     tgcctatttt acaacgtatc ccattagccc gtgctcttta ttgggatgcg ctcgtcgatc     25260
     actatattcc ggctgagcaa atagaggcca cagctgaagt gctacgatgg ctagaaaggc     25320
     aaaatatcga gaaacagcat tccgaaatgt tataataggc tgcaatgtaa ctaggaatat     25380
     ggttaaaaca gatggcattt ttgttggtct atactatttc ctctactttc tagtctatgt     25440
     ttttttatcg gaaaaatggg gtgattaaca ccggctattg ggaatatgta atttattcga     25500
     tatggttaac caacaagagg ttcacttata ttaggaatat atgatgcgat ttaaaccata     25560
     tataaagtat ggtgattgta tttctcctgt gcattttaca attaaacata actagcacta     25620
     attaggatta atctcttgac tttttttgtt gaatacaaat aatacagtat tgtcattact     25680
     attacatgtg tttgtttgct gattccgatt ctaaccaaac atcctttctt tcgtgaaaga     25740
     aaggatgttt ggttttatac acacaaggtg tgatattgca gtagctaaat taaatgggtt     25800
     cgcggtggac ccgttgagct aattgggtat gggttgttat tttacaataa taaatttcac     25860
     cacatattgc gtgaactcgg attgctatca tctggctatc ttctttgtgt gaattcaagg     25920
     ggagactggc atgagtcgta ttatagcact tatcatttct tttctattag tggggtgcgc     25980
     taccccccca atgccagctc agcgtattgt gggggaggtg cgtatgtcac gaccattatc     26040
     tcgcacagca cacattgatg ttagtatatt tgggttgtat gaggggaaag ttcgagaggt     26100
     tcagcgcact cgtttcgaaa caggtaacct acctttattc ttttctataa aactgaatcc     26160
     agctcagcgc ggggaaggtg aactttacct acggtcaacc ctctcttttc cagagcgagg     26220
     ggttcaggcg gtggctcagc aaaaacttat tggtaaaaac aaagtcgttt tacaaatgat     26280
     acctaaaaca tgttatccaa attgccagtc acctaatacc agataggtga tttattatat     26340
     tggttttggt tgcattaatc gatggttgta catcgcacgc ataataactc aatacacctc     26400
     attagataaa tatatacaag ttttagattt ttaggacagt ataacattta tggcatcact     26460
     agagattatt aaattagaat gggccacacc tatatttaag gttgttgagc attcacaaga     26520
     tggcctatat attcttttgc aaggtcaggt ttcatggcag aacagcagtc agacatatga     26580
     tttagatgag gggaatatgc tgtttttgcg tcgtggcagc tatgctgttc gatgtggtac     26640
     aaaagaaccc tgccaattac tttggattcc attaccaggc agttttttga gtactttttt     26700
     acatcggttt ggttctttgc ttagtgaaat tagacgagac aattccacac ctaagccatt     26760
     gttaattttt aatatttcac caatattatc acaatccatt caaaatctat gtgccatatt     26820
     ggaacggagt gattttccgt cagtattaac gcaactgcgt attgaggaat tactgctttt     26880
     gcttgccttt agctcgcaag ggactttatt cctctcggct ctacgccatt taggcaaccg     26940
     cccagaagaa cggttgcaaa aatttatgga ggaaaattat ctacaagggt ggaaactaag     27000
     caaatttgcg cgagaattcg gcatgggact aaccacattc aaagaactgt ttggtacagt     27060
     ttatggcatt tcaccacgcg cctggataag cgagcgacgt attctctatg ctcaccaatt     27120
     acttcttaat tgtaagatga gtattgttga tattgccatg gaagcagggt tctcgagtca     27180
     gtcttatttc actcaaagtt atcgacgtcg cttcggatgc actcccagcc aagcccgtct     27240
     tactaaaata gcaaccacag gctaaaatta tctgtttttt ttttaaaaaa acacttttgg     27300
     actataaagt aaaatgcggg gttagatttt gaagattcaa tgggatgagc caaattacaa     27360
     cgaaacatat aacagtattg tttcgccgct ggatggcaat aatatgttgt ttaataatca     27420
     agatagctta tctggcttat taagtgcggt ggcgcaagaa acgagcgcca tcaaatagag     27480
     caagtctcat tagttcgatt aacgtaatat catctattgc tatataggtg gttgataatt     27540
     atcacgaaca tttttttgaa tatctggaag tttgagctga accgcgaaac cttatgtcac     27600
     gataactgaa gtaggttatt tatttggcgc aggattactt agtttacata taaccatctg     27660
     agaaataatg caaaatttac taaaaaactt ggctaccagt ttaggaagag aaccgtttgt     27720
     tgccgataaa caaggtgttt accgtttaac tatagataag catcttgtca tgctggctcc     27780
     gcatggttca gaactggtat tacgcactcc tattgacgca ccaatgttac gtgaaggaaa     27840
     taacgttaac gtcacattgc ttcgctccct aatgcaacaa gcgttggcgt gggctaaacg     27900
     ttatcctcaa actttagtat tggatgattg tggtcaattg gtgctggagg cgcgtttacg     27960
     tctacaagag cttgatactc acggattgca agaagtaata aataaacaac tggctctgct     28020
     agaatattta attcctcagt taacgccatt ttctgtagcg tctcgcgtgg ggtggaatta     28080
     agtaatatgg cttttccgct acattctttt ttcaagcgcg tactcaccgg gacgttactg     28140
     ttactttcta gctatagctg ggcgcaagaa cttgattggt tgcctatacc ttatgtttat     28200
     gtggcgaagg gggaaagttt acgcgattta ttaactgatt tcggcgctaa ttatgatgct     28260
     acagtggtag taagcgataa gattaatgac aaagtttccg gccagtttga gcatgataac     28320
     cctcaggatt tcctacagca tattgcctcc ctttacaatt tggtttggta ctatgatggc     28380
     aatgtgctct acatttttaa aaatagtgag gtagcgtctc gtctcattcg tttacaggaa     28440
     agtgaggccg cagagttaaa gcaggcatta caacgttctg gtatatggga gcctcgtttt     28500
     ggctggcgcc ctgatgctag caaccgcctg gtttacgtct ctggtcctcc tcgttatctt     28560
     gaattggttg aacagaccgc agccgcattg gaacaacaga cgcaaattcg cagtgaaaaa     28620
     acaggggcat tagcgattga gattttccct ctcaaatatg catcagcgag cgaccgaact     28680
     attcattacc gtgatgacga agtggctgct cctggggttg caacgatact tcaacgcgtg     28740
     ttaagcgatg ctactatcca acaagtgaca gtggataatc agagaatacc gcaggtcgca     28800
     acccgggctt cagctcaagc cagggttgaa gcggatccat cgctcaatgc gataatagtg     28860
     cgcgattctc ctgagcgtat gccaatgtat caacggttaa ttcatgcgct tgataagcct     28920
     agcgctcgta ttgaagtggc gttatccatt gtcgatataa atgccgacca acttactgaa     28980
     ttaggtgtgg actggcgagt tggcattcgt actggcaaca atcatcaggt ggtaataaaa     29040
     acaacggggg atcaaagtaa catcgcttca aacggtgcat tgggtagttt gattgatgca     29100
     cgcgggcttg actacctatt agcaagagtc aatttacttg aaaatgaagg ttcggctcaa     29160
     gttgtttcac gtccgaccct gttaacacaa gaaaatgccc aagcggtgat tgatcacagt     29220
     gaaacctatt acgtcaaagt gacaggtaaa gaagtggctg aactgaaagg gatcacctac     29280
     ggcactatgc tgcgtatgac gccaagggtg ctgactcaag gagataagtc agaaatcagt     29340
     ctcaatctac acattgagga tgggaaccaa aaaccgaata gttcagggat tgaaggaatc     29400
     cccactatca gtcgtacggt cgttgatact gtcgctcgcg tgggacatgg ccagagtttg     29460
     attattggtg gtatttatcg tgacgaattg agtgttgctc ttagtaaggt gcctttgctt     29520
     ggtgatattc cttatcttgg cgcacttttc cgccgtaaaa gtgagttaac tcgccgtacg     29580
     gtacggctat ttatcatcga accacggatt attgacgaag gtattgcgca tcatttagcg     29640
     ttaggtaatg gtcaggatct acgtactggt atcttagctg ttgatgaaat atctaatcaa     29700
     agcactacct tgaataagtt attaggtggc tcccagtgtc agcctttaaa caaagcgcaa     29760
     gaagtgcaga aatggctgag tcaaaacaat aaatcatcct atcttactca gtgcaagatg     29820
     gacaaaagtt tgggatggcg cgtggttgaa ggtgcttgta ctcccgcgga atcatggtgt     29880
     gtttcagcgc ctaagcgtgg cgtattgtga gttgggtctg tcgtttttat caagggaagc     29940
     accgtggtgt tgaagttgag cttcctcatg ggcgttgtgt ttttggttca gacccgttgc     30000
     aatcagatat tgttctttct gacagcgaaa tagcacccgt gcatttagtg ctgatggtcg     30060
     atgaagaagg tattcgtcta actgattctg cagaacctct actacaagaa gggcttcccg     30120
     tgccgttggg gactcttctt cgcgcgggct cttgtctgga agtagggttt ttactgtgga     30180
     catttgtcgc cgtagggcaa cctttgccag agacgttaca ggttcccacg cagagaaaag     30240
     agccaaccga caggttacct cgttcacgac ttgggattgt gcttggagtt ctttctttat     30300
     tgttgctttt gacttttttg gggatgctag ggcacgggtt gtggcgcgag tataaccagg     30360
     atggacaact tgttgagcaa gaagtacggc gcttgctggc aactgctgcc tacaaggatg     30420
     tcgttttaac atcgcccaaa gagggtgaac cttggttatt aactggttat atccaggata     30480
     atcatgcccg cttgtcactg caaaattttc ttgagagcca tggtattcca ttccggcttg     30540
     aactgcgcag catggaagaa ctgcgtcagg gggcagaatt cattctgcaa cggttgggat     30600
     accatggaat tgaggtttct ttagcaccgc aagcgggatg gctacaattg aatggggaag     30660
     tgtcagagga aatacaaaag caaaaaattg atagcctgct gcaagctgaa gtgccagggc     30720
     tgctcggtgt agaaaataaa gtgcggattg ccggtaatca acgcaagcgg cttgatgcat     30780
     tacttgaaca atttggtctg gattcagatt tcacggtaaa tgttaaaggt gagctgattg     30840
     aattacgcgg gcaagtcaat gatgaaaaat tgagttcatt taatcaacta caacaaactt     30900
     ttcgccaaga gtttggcaat cgacctaaat tagaactggt caatgtcggg gggcaacccc     30960
     agcatgatga attgaatttt gaggtgcaag ctatctcgtt agggaaagtg ccctatgtgg     31020
     tactcgacaa tcatcaacgc tatccagaag gcgccatact taacaatggc gttcgtattc     31080
     tggctattcg acgcgatgcg gtgattgtga gtaaaggaaa acgggaattt gtgatccagc     31140
     tcaatggagg taaacctcaa tgacacaatt agaggagcaa ctgcataacg tggagacagt     31200
     gcgctctatc accatgcaac tagaaatggc gctagcgaag ctcaaaaaag atatgatgcg     31260
     cggtggtgat gccaagcagt atcaggtttg gcagagtgaa tctaaagcta ttgagtcagc     31320
     tatagccatt attcattatg taacaggaga cctaaaaaaa tgagtaattt ctctgggttt     31380
     gcaaaaggaa ccgatatcac agacttagat gcggtggctc aaacgctcaa gaagccagca     31440
     gacggcgcaa acaaagcggt taatgactcg atagcagcgt tgaaagagac gcctgacaac     31500
     ccggcgctac ttgctgactt acaacattca attaataaat ggtcggtaat ttacaatata     31560
     agctcaacca tagttcgtag catgaaagac ttaatgcaag gcatcctaca gaagttccca     31620
     taatatgaaa tataaactca acgtactgtt agcagagatt gctctgattg gaaccggcaa     31680
     ccactgccac gaagaagcga attgcattgc tgaatggtta catttgaaag gtgaagaaga     31740
     ggcggttcaa ttgattcacc tttcctcttt gatgaaccgt ggggactacg caagcgcctt     31800
     gcaacaagga aataaatcag cttatcctga tttggaacct tggttagcct tatgtgaata     31860
     tcgcctcggg ttggggaacg ccttagagtc acgtttaaat cgtctcgcaa ggagtcagga     31920
     ccctagaata cagacatttg tgaatggaat gagggagcaa ctaaaaacat gacggttacc     31980
     cttaatagag gttccattac atcgttgatg tcttcgtctc aggcagtctc tacgctacaa     32040
     ccggtagaat ctgagctgaa aacacaactg gagcataagc taaaaagtga atccgctgaa     32100
     aagacacggg aagttctgtg gcagcaatat tatgccagta accctcctga ccatgccgtt     32160
     cttgaggttt tggcgacgcc cgtacgtgag gcgttactgg cgcgtttcgg tcaacatcaa     32220
     gggcctgttg taccggctat agatttacct gaattgcgta gtgtattgca gcagtttgac     32280
     tcgtttggta agcggcggga agcaattttg ctccaagtat tagagggtat aaaacccaat     32340
     gagagccagg ttggattacc ttatttatca gagttaataa ataaagaatt aatgatccta     32400
     ttaccgtata actcgattgt agatagccta cttcataaca gccatcaaat tgatatggat     32460
     acataaatgc cgaacataga aatagctcag gccgatgagg tgatcataac cacgctggag     32520
     gaattcgggc cggtagagcc aacaactgag caaataatgc gctttgatgc ggcaatgtca     32580
     gaagatacgc agggactggg ccattcactc ctcaaggagg ttagtgatat tcagaagact     32640
     tttaagacgg ctaaaagtga cttgcacact aagctggctg tttcagttga taatcccaac     32700
     gacctgatgc taatgcaatg gtcacttatc cgtataacaa tccaagaaga acttatcgcc     32760
     aagactgccg ggcgaatgag ccaaaatgtt gaaaccttgt cgaagggggg gtgagaacta     32820
     gtgaaagtta agacttcact gtcaacattg atattaatct tgtttttaac tggttgcaaa     32880
     gttgatcttt ataccggaat tagtcagaag gaagggaacg aaatgctcgc gctgttgcgc     32940
     caagaaggcc tttccgcaga caaagagcca gacaaagatg ggaagattaa gctcttggtt     33000
     gaggagtcag atgtcgctca ggctattgat attctcaaac ggaagggcta tccacacgag     33060
     agtttctcca cgttacagga tgtgttcccc aaagatgggt tgatatcttc accgatagaa     33120
     gagttggcga ggcttaatta tgccaaggcg caagagatct cccgcacttt atctgaaatt     33180
     gacggggtat tagtggctcg agtgcatgtc gtattgcctg aagagcaaaa taacaaaggt     33240
     aagaagggcg tagcagcatc cgcttcggtt tttatcaagc acgcagcaga tattcagttt     33300
     gatacctaca tacctcagat taaacaatta gtgaataata gtattgaggg gctggcctat     33360
     gatcgcatca gtgtcatttt ggtgccatcg gtagatgttc gtcaaagctc tcatttacct     33420
     cgtaacacga gcatactgtc aattcaagtg agtgaagagt caaaagggcg tcttattggc     33480
     ttgttgtcgt tgcttatttt gcttttgcca gtgaccaatc ttgctcaata tttttggtta     33540
     caacgcaaga agtgatgatg gaaaattata ttacctcttt tcaattgcgc ttctgccccg     33600
     cggcttattt gcacttggaa cagttaccat cattatggcg ttcaatattg ccctacttac     33660
     ctcagtggcg cgatagtgct catctcaatg ctgctttatt ggatgaattt tctcttgata     33720
     ccgactatga agagccccat gggctggggg cgctgccttt gcagccccaa tcacagctcg     33780
     aactgttact ttgtcgcctt ggattagttc tgcatgggga ggcgattcgc cgttgtgtac     33840
     tggcctcccc attacagcaa ttattgacat tggttaatca agaaacatta aggcaaatta     33900
     ttgtacagca tgagctgcta atcgggcctt ggcccactca ctggcagcgc ccgctgccga     33960
     cagaaataga gagccgtacc atgatccagt cggggctggc tttttggtta gcagcaatgg     34020
     aaccccaacc tcaggcatgg tgtaaacggc tcagtttacg cctcccatta gctacgccgt     34080
     cagaaccttg gttagtggcc gagtcacaac gcccactggc ccaaacttta tgtcacaaac     34140
     ttgtcaaaca ggttatgcct acatgcagcc atttgttcaa ataataccaa gtaatctctc     34200
     gctcgcttgc ggtctgcgta ttttgcgcgc cgaagattac caatccagtt taactaccga     34260
     agagttgatt agtgccgcaa aacaggatgc tgaaaagatc ctggctgacg cccaggaggt     34320
     ttatgagcaa caaaagcagt taggatggca ggctggcatg gatgaggcgc gtaccttaca     34380
     ggcgactttg attcatgaaa cacagttaca atgtcagcaa ttttatcgcc acgttgaaca     34440
     acagatgagt gaagttgtac ttttggcggt acgtaaaatc ctcaatgact atgatcaagt     34500
     ggatgtgaca ctgcaagttg tgcgggaggc tttagccttg gtgagtaatc agaagcaagt     34560
     cgtggtcagg gtcaaccctg atcaggcagg agctattcgt gaacaaatag ctaaagtaca     34620
     taaagacttc ccggaaataa gctatttaga ggtgactgcc gatgcgcgtt tggatcaagg     34680
     gggctgtata ttagagactg aggtaggtat tattgacgcg agtattgatg ggcaaattga     34740
     agcactttct cgggcaatat ctaccacttt aggacaaatg aaagttatag aagaggaata     34800
     actatcgata tatgtttagt gttatctatt ataagattga gttatctacc taaattggat     34860
     gtttcatcct cgttttatga gaacgattcc ccagaataat tttttattgt gattttccgt     34920
     ttaaaagccg attaaaaaaa taaatcgtct acgacagtgg tttagcaaaa ataaataact     34980
     tagaatatcg tagagataat tatagcgaca ggagactcga tgaaaatcaa tactcttcaa     35040
     tcgttaataa atcaacaaat tacccaagtg ggacacgggg ggcaggccgg tcgtctcact     35100
     gaaactaacc cactcacaga gaatagccat cagatatcta ccgccgaaaa agcctttgcc     35160
     agtgaggtac tggaacatgt gaaaaatacg gctctcagtc gtcacgatat tgcctgctta     35220
     ttaccacgcg tttctaattt ggaactaaag cagggcaagg caggggaagt gatagtgacc     35280
     ggcttgcgta ctgaacaact ctcgcttagt gatgctaagt tattgctgga agccgccatg     35340
     cgccaggata cggcggctga cggctgacga taatatatat ctactgtata ttgaggcgat     35400
     aataccccca ggttgattta cgtaactatt tttcaaaaag tcatgtatca attctttccc     35460
     ttgagccaat ttagaataat aatacgtctc cttcggtgat cccctgaagt ggggtattta     35520
     tcagtagagt ctgctcctca tataaattga aggaattagg atgaaagatc acattgtagc     35580
     gactaccggg ttatggttat tttgatgtca tcccaggcaa tattcgttgc tatcactggt     35640
     attcctgcat taccagtggg ttggctgaca ttattgccaa aaaatagggg ggatggatac     35700
     tttatatttt tacgccatgc cggcggggca ttggaattaa aaacgtattt atctaaatga     35760
     taatgagttt aaattacatt tgcgtattaa aatgaataac gcattattaa cgtattacca     35820
     tctgttcccg cttaattttt taaaaaattt aaggtaacaa tgagtatata tcttatggga     35880
     aaagccaaaa aactaacgaa cactataata attcgattaa cattaatgaa aatacacggc     35940
     tcacctatta ttaaaataat acgactagca ttataagaaa aaatattttt tatgtttata     36000
     gtataggcgt gtatttaatt agttcttaat ttaattaagg agggaagcat gaacttatca     36060
     ttaagcgatc ttcatcgtca ggtatctcga ttggtgcagc aagagagcgg tgattgtacc     36120
     gggaaattaa gaggtaacgt tgctgccaat aaagaaacta cctttcaagg tttgaccata     36180
     gccagtggtg ccagagagtc agaaaaagta tttgctcaaa ctgtactaag ccacgtagca     36240
     aatattgttc taactcaaga agataccgct aagctattgc aaagcacggt aaagcataat     36300
     ttgaataatt atgaattaag aagtgtcggc aatggtaata gtgtacttgt cagtttacgt     36360
     agtgaccaaa tgacactaca agacgccaaa gtgctgttgg aggctgcatt gcgacaagag     36420
     tcgggagcga gggggcatgt atcatctcat tcacattcag tccttcacgc accgggaact     36480
     ccggtgcgtg aaggactgcg ttcacatcta gcccccagaa caccaccgtt gccaccgcgt     36540
     gaacgaccac acacttctgg ccatcacggg gctggcgaag tcagagccac cgcaccaagc     36600
     actgtttctc cttatggccc agaagcgcgc gcagaactca gcagccgcct caccacattg     36660
     cgcaatacgc tgacgccagc aacgaatgat ccgcgttact tacaagcctg cggcggtgaa     36720
     aagctaaacc gatttagaga tattcaatgc tgtcggcaaa ccgcagtacg cgccgatctt     36780
     aatgccaatt acatccaggt cggtaacact cgtaccatag cgtgccagta tccgctacaa     36840
     tctcaacttg aaagccattt ccgtatgctg gcagaaaacc gaacgccagt gttggctgtt     36900
     ttagcgtcca gttctgagat agccaatcaa agattcggta tgccagatta tttccgccag     36960
     agtggtacct atggcagtat cactgtagag tctaaaatga ctcagcaagt tggtctcggt     37020
     gacgggatta tggcagatat gtatacttta acgattcgtg aagcgggtca aaaaacaatt     37080
     tctgttcctg tggttcatgt tggtaattgg cccgatcaga ccgcagttag ctctgaagtt     37140
     accaaggcac tcgcttcact ggtagatcaa acagcagaaa caaaacgcaa tatgtatgaa     37200
     agcaaaggaa gttcagcggt agcagatgac tccaaattac ggccggtaat acattgccgt     37260
     gcgggtgttg gccgtactgc gcaactgatt ggcgcaatgt gcatgaatga tagtcgtaat     37320
     agtcagttaa gcgtagaaga tatggtcagc caaatgcgag tacaaagaaa tggtattatg     37380
     gtacaaaaag atgagcaact tgatgttctg attaagttgg ctgaaggaca agggcgacca     37440
     ttattaaata gctaatgtaa atatttattc ctatgagtaa ataaaattac taagatatat     37500
     acgctacttt gccaatcaaa gaaactttaa acctcaacta aagtaagcaa ttagttgagg     37560
     tttatctgct gtagaataat tattaacaaa aatataaaca acaaaattaa aagttatgtg     37620
     tctactttat gtaaccaaac ccattaatgg ataccgtacg tttttctttt atagaattaa     37680
     accagtaaat gagatgatga aggacgatga tcatcatcct catcctcttt cttcattgtg     37740
     ggttcacaag aaatagtaac agctttatca accagcgacg tcaatacgct cgccagtttc     37800
     gtcccactgg tgtcattaat gtttaactga ctccacaata gccagtgatc atctttatca     37860
     agcgcacaac gaatcacacc agagtgtggg ctaaagaggt ttttccgcaa aatatcataa     37920
     agttgagact gaccagtcaa gatccctgcc cgcataaaaa ccactaactc cttctcattg     37980
     ataggtgcca gatgtactac ccatatttta tcaatggtaa cagccccatg ccccaactca     38040
     tttgtttcta tttcttcaag acctagctct gtagcaaatt cttcaagtaa tgaactgtaa     38100
     gtgcgcatat aactgaccct ttaaaattag aaaaatatag agttttttat ttctcccctt     38160
     cccagatgct accccaacgt tgtatcaccg tggatataaa gtataacaaa cttatacagc     38220
     tcaaccattc acattgagaa ctcttccggt actcctcatt accaatgagg aggcggtgat     38280
     tccaccaagt gaatgggctt aatacaagtc ttttacatta aaaattgtta aaaaacggga     38340
     gataaaagtc aacactccaa cttggtgtta acttttactg agcgaaatct gatattgctg     38400
     gcaccacaaa tttataggtt atcgctattt ccgtataata aggcaacaac caaaaatcta     38460
     ctcaactaaa tgaccgtggt ggtgagatta gtgatgaggt ttgtagccgt tcagccccct     38520
     gtaccagcat ttcaagctga gtatatagcg agttattatc caggttgttc aatggttggc     38580
     gattccataa cactgggtgc cccccgacct cgtcccaaga taagatgggt tttaatatat     38640
     cttgactgaa tatattatgg ctaagtaagg tttccttttc attattattg tcaagagaag     38700
     gcagggtaaa cattaatatt tgcccgacag gatgctctgt tatatggcag gcgaattccc     38760
     caactttgac accgataacc ggttcaatag tatctggaat agacagcgaa agttgttgaa     38820
     ataattgagt gatagcttgt tcaaatgaat acatttgatc tcctaatagt tagataaaat     38880
     atcaagttaa ccaaagcact ctcggcagac catcaatttg agcctataat ttttagtttt     38940
     tattttgtct aatataacaa caaaaacagc agcgattttt tatatagcca ccggctattt     39000
     tcccactaag ataaccttgt tttaatagcc aagggaataa atagtcatga aaatatcatc     39060
     atttatttct acatcactgc ccctgccgac atcagtgtca ggatctagca gcgtaggaga     39120
     aatgtctggg cgctcagtct cacagcaaaa aagtgagcaa tatgcaaaca atctggctgg     39180
     gcgcactgaa agccctcagg gttccagctt agccagccgt atcactgaga agttatcatc     39240
     aatggcccac tctgcgattg aatttatcaa acgcatgttc tcggagggga gccataaacc     39300
     ggtggtgaca ccagcaccca cgcctgcaca aatgccaagt cctacgtctt tcagtgatag     39360
     tatcaagcaa cttgctgctg agacgctgcc aaaatacatg cagcagttga gtagcttgga     39420
     tgcagagacg ctgcagaaaa atcatgatca gttcgccacg ggcagcggcc ctcttcgtgg     39480
     cagtatcact caatgccaag ggctgatgca gttttgtggt ggggaattgc aagctgaggc     39540
     cagtgccatc ttaaacacgc ctgtttgtgg tattcccttc tcgcagtggg gaactattgg     39600
     tggggcggcc agcgcgtacg tcgccagtgg cgttgatcta acgcaggcag caaatgagct     39660
     caaagggctg gcgcaacaga tgcatcaatt actgtcattg atgtgatatg gtgactagtc     39720
     ctgctatagg ttgacacttt tcagccttaa aacgcctgat gaacttcatc gggcgttttg     39780
     tattttaacg acagatgcgg tcgccgcgtg ttgtagattt ccactgactc cctgaccatc     39840
     tttcttgcct ggccaatatc ttccggctta accagcagat attccatttt taatatccca     39900
     ttgacccgct ccgccagcgc attctgataa caatcatatc catccgtcat cgaacagatg     39960
     acaccgtgac gttgatgtaa cgcctgatat tctgttgaac agtactggac accttggtct     40020
     gagtgatgta tcagcgcaga ttctgtgcgc ctactcacca gcgccatttt gagcgcagcg     40080
     gctacatggc gggtgtgcag gctttcatgc acatgatatc ccacgatttt tctcgaccag     40140
     gcgtcagtga ccagactcac atacgccgtt cctgtccgca ggggaagtag agtaagaggc     40200
     agggcgtagt cgaactattt ccctgcctct cctctccgtt taaacgctgg cgaacgccat     40260
     tgccacgtca gtgtagcgcg atgtatacgt atttctggct tccgtcctca gatagggatt     40320
     accttcgggc agacgccagc ggaaccgctt cttgccttgc cctaccaacc ggtacagaat     40380
     ttcgccgctg agcttgtcgt gattggtttt accaaataaa acccacgttt tgctctgacc     40440
     tggtttcggc gatttacacc accacctcat cagagaagcg attcccgtac ggtatttacg     40500
     ggccagccag tgagccagct tccagaacac gacacggtca atataactga agactttggc     40560
     cttaaaatca acgaactggt agaacgcagc ccaacctttc aatttccggt tgagttgttc     40620
     agccatatcg actttgcttt cactgtaatt acctgataac agtgctgtca gcgatgcagc     40680
     gaagtttctg gctttctcct tctggatcgt cgataccacc cgcatatcgc cgtaacgact     40740
     gcgtttgcgg atgatccggt gacccagaaa gacaaatccg tcattaactt gcgtagccac     40800
     ttcaggacgg tagaacggcc ttgaataccg tagcggtctt gcgcctgtcg gtaagtcatt     40860
     tccctttttt cgacctgttc gacaacggcc aatttaaagg atagaggata atcgcgttgc     40920
     gtgcgtttaa catattggtt catcacattt tcctcagtac atgagttaaa tgtgtcaacg     40980
     ctatttagga cgggtcatgg ataaaaacaa ggggatagtg tttccccctt tttctatcaa     41040
     tattgcgaat atcttcgtcc ctgatctttc aggggcgaat cgttttttag catgcccatt     41100
     gttagaattt ctgacttatc tctcttctgt attactgctc atactctgga aaatcctggg     41160
     cgtctatatc tatggattga tgcaacactc gagaaatcaa aatatcattg ctaagcgtta     41220
     tatagtatat accgtgcttt ttatactgaa aacggcgcat gtcagagcaa atccagttac     41280
     actcagcccc taactctaga tttttagcta atagctcgaa tacctttgcc aagttctcat     41340
     ggtataactt agcctgagtc acaccgaaat gccggatagt ataactggca atattataaa     41400
     tatcctcatc agccagttca gatagtttat acactagtat ctttcaccgc agcagaaaaa     41460
     atctcatcca ttaaacgatg gctcacaggt gcgtttgttc ctgcaagcac catatcgcgt     41520
     acatgttgaa cacgctgttc acgtgcttcc attagcctta aagcatcacg aagcacttct     41580
     gatatattgc cataacgacc agactgaatc atttccccca caaaacctgt caaatgctct     41640
     ccaagtgtta cgctggttac gcgagccata tcccctccgt tatgtattac tgagtaatac     41700
     aattatagct aaacaatctg taatgagcca gccttgccta ctttaatata tgaatttacc     41760
     gggagacctg ataacagtag gcacagtgct gccgccgcat cctgctttac cgtcagcaga     41820
     aaatcgatag tctaaccgcg agtattaacc gcccggtaca ggtatttcca ctgacctttg     41880
     aggtttcatc catacgccac cggcgaccca cggtacattt ataacgacaa aacgctttat     41940
     gcagtaatgg caccacacga ataacccaac tgtggagtgt ggaatgctca acagagatac     42000
     cgtgttccgt catcatttcc tctggattta gaaaactcag ggcatagcca agataccagt     42060
     gaacacactg agctataaca tcgatggggt aatgcaggcg acaaaaaaat ttttggatta     42120
     aagatatgtg caggtaatat cataaaaaaa cagcacgtta ccagactgtg ccttaatgca     42180
     atagagccgt cattgttaca tcgatactaa catgaaatcg ccgtatccaa cctggcggga     42240
     tggatatcgc tatcaaaaag ccgacatcat gcttaatgac gttggcagtc gaccaggtca     42300
     gatagatatg tttgatgaaa caccgccgca cgcgaacagt aaacatctga tgcaagttgt     42360
     tgatgcatca atagctctgg gctaagaaca gtatgacttg gtgaacagag tattgcgaag     42420
     gggtgataaa tgaagcgaaa attactatct ccataatgaa atatccgcta gtttaatctc     42480
     cctaaagcta tcactaaaaa aaatgctcat cgacttaatc gctttcaatt cgaatcacat     42540
     ttccacttgg atatccaatg ccaacgttgg taattgggac cacggtccca cctggatatc     42600
     caatgccaac gttggtaatt gggaccacgg tcccacctgg atatccaatg ccaacgttgg     42660
     taattgggac cacggtccca cctggatatc caatgccaac gttggtaatt gggaccacgg     42720
     tcccacctgg atatccaatg ccaacgttgg tgattgggac cacggtccca cctggatatc     42780
     caatgccaac gttggtgatt gggatcacag ttcagattag gaaatgagtt gtaaagaagg     42840
     tgatcttcta tgaaggatga gctaaaacaa tagatataca ctaaataaag gcgggcagac     42900
     aacccacctt gttctgatct tattcaggca ctacaaagaa tgttcctttg cataggtatt     42960
     caagagttct tctatttgtt taaccaagga ctctggcgca gatttgagat agaaagaaac     43020
     attgtctttt gaatattttg cttctatatt tttgccaaag ttttttttat gaatgttctc     43080
     tggctgtttt ctctcaggca tcagcaatac gattaattct tccgtagtaa actggcgacc     43140
     ttcctgtttt tgcttcataa ttttatgcgt aactagcttt agcgtatcaa cgttattttc     43200
     ataagcttta tttaacgctt cgccactacg agcacttaat tcattagggt tagcaaacag     43260
     ttgaatagtt ttaaggggca gctcagccgt tttaatacaa cgctgaataa ttttgcgaga     43320
     gagatgctcg gcctctgcca acttactaat attaccttca aattcagata ttagccgttg     43380
     ggcgtaacgc aggcctcgtt cataagcact cgttggacga tactcattag caatttggga     43440
     cagccatagc atctgctcat cattcaagtt accaaccaga accttatagt cacttccggt     43500
     gagtatcgcg gctttacgtc ggcgacttcc atcagcaacc tcgatgttcc cgttatgttc     43560
     acgtgcaagg gcggggatct gctgccctga cgttaaaaat gaagggatca agtcatctaa     43620
     cgacgtctca cttaataatg cttggtttcg ctcattacca ctaaaaacga ttgttttaga     43680
     ttcaacatca ggtgctgcta tcactttaag cgtaaaagca atgttcctcc cacaaacagg     43740
     taatacgatt gtgttgcctt tcatgccact aactcgagaa gcaagctgac tcaccgccgg     43800
     agcagaaacc gagggctctg cattgctgat tgcgggttta gcatcatcaa aattaattga     43860
     aggcgcatta cgtaacactg gtgacctttt catcatgcat tctcccaacg aggcttaacc     43920
     agccgattga atatttctgc acaaacaggc tcccaaatcg aaacagcgtt acgccacgca     43980
     gctggcgttg aacgctggtt agctgcctgt tcaaatacag tacgcattcg tacttggcct     44040
     ttccccactt cgtcagtcac gcgaacaact tctttcaaca ccattccacc ccatgcattc     44100
     cttatctgat cgtccatcca ctgagactga ctaccgatcg cattactaaa tttagtaatt     44160
     aaaacgcgca catcaggttc aaaaccgttg agatcaatat ttgacatcaa atccctaagc     44220
     atggtgaaaa attgcaacgt ggaaacatag tcataaagct ccgccggggt aggcactacg     44280
     atgacatcag cagcgcacac gacattaata gtcccaatac ctaagtttgg tgcactatct     44340
     aacaccacga catcataact atcccagact gactcaatag cagcacgtaa taaaagatga     44400
     ggggctacag gtaatttccc ctgatcatgc aagctataaa tttccgactc aatacgatgc     44460
     actgccagac aagaaggaat gacttcaaga tttggccagc aagtcggttt tatcgcataa     44520
     gcagcatcat ctcgttgacc aagataataa ggcaacaaag tgtcttcttc atgtatatgc     44580
     aggtcgggaa catagccatg atataaagag gccgtagctt gaggatcagt cgcatcaatc     44640
     aacaaaaccc gtaacccttg taacgccatc cattgagcaa tatgaacaga tgtcgatgtc     44700
     ttgtatgcac cacctttatg agctgcaatg gcaagaacaa caggattttc gccttttggt     44760
     ttggatagcc ttgttttaaa cacatcacgc atatcattaa tttgctggat ggaatatcca     44820
     gttcgttgct caacacgacc aatcattgct gtatcaggcg gtggcagttt gcctgagtct     44880
     tcatagttac ggatcgtttg tggtgttact ccgacaagtt cagcagcttc agtaatacgc     44940
     cagcgtcgag taatcgttcg agcagctgga ctgtcattac cgaattgtga tttagcaatt     45000
     tcttgagtca tgaactgtcc acgttcaata cagcggtcaa gagttgactt tagatccata     45060
     tgtattatct ctatgaaatt tgcgtcttta tagtaaaaca tcaaaaaata cgcaaaacaa     45120
     caaaaataac gcaaagatat atagtttgac agttacctaa tctgctgtag atgacctttc     45180
     tttttgctcg tcggtaacag cagggcatgc cagtatatag gtactaaaaa tttatcctat     45240
     acgtacataa tcgaaaacac tcgtctagct acaaaaaacg ataaatatca gtcagtaaaa     45300
     tgggttaact gaagctgtat attatctgca tcttcaaact aagagtgtcc tttgtttttg     45360
     cttgataccg tgctaccact gaatcgccac ggataatcta gacacattct cgccaggaag     45420
     actggctgac aaatgttccc ccgaggggat ctgcaaggta gtttccgact ccagaagata     45480
     ggctggctga tctgacagat tcagcgccat ccggcgaatg gccaccgcct gcgcaaaatc     45540
     aaaatacgag gaggagggag cggccagttc ataggtgacg agtgacattc aatactcctc     45600
     gaatgattag cccaacatag ctatcagatc atacggataa aaaatcgccg ttttatttgg     45660
     ttgcgctacg tgaaatctgc agggtaatcc ccctattggt tttaaattat tcacgtagcg     45720
     caatctgcgc caattttgac cattcttatc gccgatgacc ggcgttctga cggcagattt     45780
     cttcaacctt catacctgaa tcagcaagct tcaggatgtt aacgatctga gttttagtaa     45840
     aacgtgtttt tttcattttg acctctgcaa atgtaaaggc agaaaatcta attatagctg     45900
     tctcatttta gggggagtgg acaagggtaa ctgtgtggat gatcgctata agtagagtaa     45960
     agccgaaagg gaaggagaaa aataaatatg ggatacaact aacctgtcac tatattttag     46020
     gttaataacg ttttaaaatt cattccaggt ggcggtgttt taaatccgcc acctggttat     46080
     ataataaatc aataagatta ttacccctct atttcctcaa tgagatcaaa agaacacctg     46140
     ttagcaaagg tatgattaat aatatagaat atagagagaa atatcttcca tacacatatc     46200
     cgtctaacag caaagcgata ataggaaaaa ccaaaaaaac cgtcgaagcc tgaaaggcac     46260
     tagctttatt ctgtaattgg aaatagcaaa gaataccaaa aacccccgca ataataccta     46320
     aataaatgac tgataatagt gattgctgtg agaactttga tataacaggt tgttcagcaa     46380
     tccatccaac aatgcaaagt aatataccag cgacgagact aggaattgca ttaaatgtca     46440
     atacagagat agaacagctt ctttttttac attgaacata aactaatgca tgcataataa     46500
     cagaaatcac gagggaaata ataccaaccc actgattatt gttcccgata ttagtctcga     46560
     taaataatat agcaagtaag gaaactgtcg aggttacaag tcctaatatc gcaataatac     46620
     ctactttctc atttaataat agccatgaaa aaaatagaac acacacaggc atactagaga     46680
     aaataataga tgccaaggct gggctaatat aagtttcacc atatatcatc aaggagaaag     46740
     gaattgaaaa ataaaaaata caaacaaata attgaaagaa cttttgtcca tctggaaata     46800
     aaagcctggt tttggtcaat actgatatta ggattaatac aggcgcagcc aacataaatc     46860
     gaatgcccgt agcaaatatc ggagggattg tttcgacggt taatttcatc gctaaccatg     46920
     tagttcccca tgtaactgaa accatgataa aaagcagaat tactaaaaaa tttttcatta     46980
     gcatatgaat aaaacaccga ttaaaattat gtaatcggtg ttttcctata gacttgttaa     47040
     cttctaaatg atattaccac tcgatattaa atgatgcatt gtacatgaca tccgaggaac     47100
     cggcataagc cacaccggct ttaagtgcga cactctcatt tacacgatag ccagaaccaa     47160
     ttgctaatgc ctgactagag cgatatcccc cgacacctgc agtaaagttt actttcccca     47220
     caccatatgg ctggaacaag ctgtttaaag cggctgaact ggctaaacct ttgtcaactc     47280
     gtgtgtcaag tttatctaaa cggttgtcaa gttgacggaa tttatgatct gtgtattgat     47340
     tcgattcacg gattgctttc ttagtcgaat tacttacagt cacatcggta tagctatttg     47400
     cagtttgtag tgtgtgagaa gacttgctgt ctgcatacac attagctctt gctaacgtct     47460
     cagctgattt tttatttgta tgttcttcag cagtttctaa agttgttcta gcaacactat     47520
     ttgagtgttt ttttgccata tccaaagcat cgttagacag gtcaaaagcc tctttacgcg     47580
     cattttccaa tgtttcagca cttttactat cagtatagtt atttgcgatc cctagcacct     47640
     cagctgattt tttatttgca tttacctgtg ttttttcaat ttctttcttt aattgcgcga     47700
     cattcactgc atcagtgtct ttagtgccag ccgcaagatg tgtcaattgg cgattaaggc     47760
     tttcatgacc aatggataca ctattttttc ggtcagtttt agaacgatcc ccaattgcaa     47820
     ttgaataatc atgatctacc gcaacgtgac tagagtgtcc aatggcaaca gagttttttg     47880
     catcaacttt cgagttaaaa ccgacagcga caccagtatc tgaagtgaat gctctcgcac     47940
     cgatagctac tccatctttc tgggcggtac tagctgcccc ataagtaact gccgaatctc     48000
     ccaatgcctt acttaaagga ccaattgcaa cagaattaac tcctgttgca attgaaccag     48060
     cgcccacagc aactgcagct tgtttcgctg cttcagcact agcaccaacc gcaatgctat     48120
     ggatactctt agcgagagca ttggtcccgc ctagggcttc tgctgctggt tgaaatatca     48180
     caacatgcga atcaggatca gcatttgggc ttatttgaac tgctgtaaaa tgaacctcgt     48240
     cattattggc aaatgcatat ggagatgaga acaacgcaga tattaatgcc gcagagacac     48300
     tgatcttaaa atctttagtc attgtaagca ccttttatat ttctttagtt tcccgtgaat     48360
     aaaagctcag ttataacatc tgagaaatat attaattaaa gcgaacgcct cccatagaag     48420
     agggatagga ttatctatga cttattttct gataatcatg caaaaaacag cactaatcga     48480
     tcttaaaaag atatcgatta actactgaat atatgcgtcg tttgtaatct ctaatcatcg     48540
     gagtcagccc actacaaaat actttcagat aacacgaaaa gtgttatgcg gataatataa     48600
     aaaaaaattc ctcacctcaa accggatgtt ttgtgtaatc tttcgaaatt acctgacaac     48660
     acatttactt tcaccaaaga aaaacataag catagataaa aacaccagaa aatagcaacc     48720
     aactattgat ttataatttt tttatttatt atcctccttc tctcaaaaaa tataaaaaaa     48780
     agtgggtaat aaatgatata aaataatctg tactgtaata gtcatcaaaa ataaccattc     48840
     tcttttagag aatttccgac atactgaata tgtattttga ggagttcacc atgcgaaaaa     48900
     actgattcac tgaacaccag atcagtggtc gagcgttatc cacgcgacgg tttctttaag     48960
     gtttttcaaa tcctgaggcg atggggatat gtctggaacc ataaacgggt acaccgtatc     49020
     tattgtctcc tgaaactcaa tattcgccgc aaagggaaac aacgcctgcc agctcgtacc     49080
     ccatcaccgc tggcggtgcc ggaacgactt aacctgagcg ggtcggtcga ttttatgcac     49140
     gatgcactga tctgtgtgga tgattacaat cgtgaaacgc tggcgattga aatcgatctt     49200
     aacctgccaa cacagcacgt catcagagta ctggatcgca ttgtggccaa ccgtggctac     49260
     ccggtgatgc tgcgaatgga caacgggccg gagtttattt cgcttgcgct ggcgaaatga     49320
     gctgagagcc atgcagtgaa acttgagttt atcaaaccag ggaaaccgac tcagaatgca     49380
     tttatagaga tatttaatcg gacatatcga acagaaatac tggattttta cctgttcaga     49440
     acgctgaatg aagtacggga aatcacagat aaatggctgt atgaataggg gctgacgctc     49500
     agtggaacga aaactcacgt taagcaacgt tttctgcctc tgacgccggg agtgttagaa     49560
     attctgtgtc attccagtaa tatataatca aaaaggaatg acacatgtcc caacccttcg     49620
     atttcgacaa agccctgaaa gcacttcagg atggccaggc cttgacgggc aaagatggca     49680
     tattaactcc gttaatcaag cagttgacgg aagctgcttt ggctgctgag cttgactccc     49740
     atctggctca agacattgaa gccaatcgta aaaacggctc aactaaaaaa acagtcaaaa     49800
     cacccactgg tgcttttgaa ttggccacgc cccgcgatcg taatggctct ttcgaaccgc     49860
     aattggtgaa aaaacatcag accacgcttt ctgatgagat agagcgcaag attattcgca     49920
     tgttcgcgct gggtatgagc tacaaagata tcagccagga aatcgaggat ttatacgctt     49980
     tcagtgtatc cagtgccacg atcaccgctg tcacagataa ggttattcct gagttaaaac     50040
     aatggcaaca gcgcccgctg gaggcggtat accctttcgt ctggctggat gctatccact     50100
     ataaaatccg cgaagacgga cattatcaaa gcaaagcggt gtacacggtt ctcgcgctga     50160
     atctggaagg caagaaagag aaccttggtc tgtatctgtc tgaaaacgaa ggcgctaact     50220
     tctggttgtc ggtactgacc gatctgcaaa accgtggcgt ggatgatatt ctgatcgcct     50280
     gtgtggatgg cctgaccaga tcccctgaag cgataaacag catttacccg gatactgaag     50340
     tccagctctg tgttatccat cagatccgta actcgataaa atacgtcgcc tcaaagcatc     50400
     ataaagcgtt tatggcggat ctgaagccgg tgtatcgggc ggtatcaaag gaggcggcag     50460
     aaacggcact ggatgagctg gaggagaaat ggggccagca gtacccagtg gtgctccagt     50520
     catggcggcg aaaatgggaa aacctgtcac attacttccg gtatccggcg acgatccgta     50580
     aagtgattta cacgacaaat gccatagaat ccgttcaccg ccagtttaga aaactgacga     50640
     aaacaaaagg cgcattccct aatgaaaaca gtctattgaa gttgctttat ctggggttaa     50700
     tgaacgctca ggaaaaatgg gcaatgccta tccagagctg gaatttgaca ttgtcccaat     50760
     tggcgattta ttttgaaggc cgcctcgata aagtgattac gttgtagacc ttttaacgtg     50820
     acacagaatt ctgaacgctc tcttttaagc cgctattcat aatgttacct ctgaagcaag     50880
     tagacaagaa aaaactcaat ctagcagcca tctaatatct agccgctaga ttgcggctag     50940
     atattatttt tctgcttata tgcctctagc atttcttcaa gcagttctac taacttcaaa     51000
     tttttctctt cagcaatatc ccgtaattcg gcgtcaaact caggactaac acgtgtagca     51060
     aaagcgagag tccggttagt ctttcgagca gaacgaccat cacgacgaat atagggttgg     51120
     tgatcgtcaa gaggagcagg tgcaatttca ggagcagcaa gactggttgc agcctcatcc     51180
     atagaaggag ggacgcccaa cctgctattt ccctttttca atttactgac gtctgccaca     51240
     atcattaccc tccaatcttg tttatcaacg actgaatcaa ttcatcggct cttgcattca     51300
     atcctttata ccgagtttca gtaagagtaa ggccagcgtt tattgcctgc ctataagctg     51360
     gctgttcaaa aatacaccca ttcagaactt catacccagc ttcaatgagg tagtttctgg     51420
     cttctgtctc ttccgcatct gtacctatac gactgagtga aaaaacaagt tttgatttcg     51480
     gtattccctc tttgaccaag ccgtggaaga ctttaaccgc tgggatcaaa tcatcaagtg     51540
     atgcccctgt aggttgcacg atgaggtctg cgaccttcgc aatttctgtt gtgcctttgc     51600
     tcgctcgtgc aggcccatca ataatgagaa gttcaaaatt ttcagctgct gctaaagcct     51660
     gagctgctgt agagaaaacc tctactgaag cagcaggctc ataaccagca gcaagacgcc     51720
     gacggtgcca gtcagcagag gtggcttgct ctgtatcgag gtcagcaagt ttggttttta     51780
     tgcccccctt agttgcttct cgtgccaatg ctctggcttt tgcacttttg ccaatgccac     51840
     ctttttgtga aataaatgcc actatccacg ccatatgttc accttaatca tgcagcaaga     51900
     tagcagcatg atttaataca agtaaaaata taattgccgc aagattgcag caatctacct     51960
     gcaagataat aaaaacatat attaatgata gctgcaatca tgctattaca cagcagcaag     52020
     atatatgcaa gaatttatga atttagcctt acggtaacaa caaggctctg gcgtccagcg     52080
     tgtccatcga gaaccgcacc ccgtactgat gccccacgtc cagcgcaaat atccgggtgt     52140
     agatctccgt gctcttggtg tcctgatgcc ccatgtaagc ctgaagcact ttaaatggaa     52200
     gtccattctg taacaggtgc atggcaaaac tgtgtcggaa tgtatgcggg gtgataggga     52260
     tcgtaaaggt tacgccgtca cgttcggccc gttgtacagc ggcctttaac cagttccggg     52320
     cggtatcgtc actcttcatc ggccacaacg gtttacgccg ggtgatcttc atcgtggcgg     52380
     catattcctg tagccgccgc acgtaagccg gatcagacag tggcacgatg cgctttaagg     52440
     cttcgccgtt ttcgggtcgc cccggccccc ggtgacgttg tttcaatgtc ttcagtgtga     52500
     cgaacggccc ggccccgtcc agctcaaaat cgcccggtgt caaaaccagg cattcattaa     52560
     ttcgtgcgcc ggtgttccat aacgtatcga acaacaggcg ttgacgcaga tcaggcagat     52620
     agtccagtaa cacggtaatt tccggggcca acagatagcg cggcaaactg gccccggctt     52680
     tgagtgccat ccggcgcagt gccaccgctt tttcatagtt gaaatacgga gtgatcgcgc     52740
     tacgtgaaat ctggctgttt tcgtggggga taagactcaa cattttaaaa tccgcaattt     52800
     gcactggata cgcatagttt gacgtaagcg gggcagggga gcgacaaaat taaataggtg     52860
     atcggtcatt ttcaaaagag agtcaattta gggagttttc cggtaaaggg gaataatccc     52920
     taacgtgccg cactgacggg caagggctga acgccccctg acagcctcac ccgacagcgc     52980
     caaacaccac atctagtatt ggtcgccagc tgataaaaca caagatgtag ggcagggggg     53040
     gaattaggtt ttctctgcgt aaagccgaac cgccgcgtaa tggggggagc taacaggcca     53100
     tacaggtaaa aaatcatttg ctcaacagct cccccacacg gataatcatt cgccagatcg     53160
     ctgagcgata catttctgcg ggctaatgat gaaatatagg aaattaatta aataataatc     53220
     aatattattg taatagatat tttgtataca taaaaacatg ctaattaaaa aatgaaatac     53280
     tatacttcta tttattcact ttaacttatc ttgcttaccc atttttaatg tgattgacta     53340
     ttttaattat gttttgatta ttatcaggat aataatcata ttgttatcct tgtattttaa     53400
     agttgactga ttagtcctca cttaagcatt tttgaatgct agagaatgca ttgaggtgtt     53460
     ttatgatgag taccgcatta gactgtaatg agttagatgt gagtgttatt cgcgagcaat     53520
     ttccaattct taagcagaaa attaacggca ttccactgac ttatgcagtg gaatgcaaaa     53580
     agggtttacc gggtatatcg cctgctgaaa ctcaacttcc ggcgtaaggg gaaaaagcgt     53640
     ttacccaacc gatatccgca gcctctggcc gtgccaagcg atataaacca ctgttggtca     53700
     gttgatttta tgagcgatgc tctgatggat gggagaaggt tccgtctgtt caacgtggtg     53760
     gatgatttta accgggaagc gctggcaatc gatgttgatt taaatatacc tgctcatcgt     53820
     gttgttcgta tcgtggaacg attaagtgcc gaaagaggtt atccggcttt tattcgcagc     53880
     gataacgatc cggaatttat tgccgccgcc tttgctgaat gggcagagcg gcatggagta     53940
     atactcgatg ttattcagcc gggcaaggcg atgcagaacg gttttatcga acggttcaat     54000
     aaaacgttgc gaacagaaat cctggacatg tatctgttca ggtcgctatc agaagttcgg     54060
     attttaaccg aacagtggcg tactgaatat aacgaagaac gcccgtacag cttactgggt     54120
     aatatgccac ccgttatcta tgcgaggcaa aaactctggc cagaaaccct aactggcggt     54180
     ggtactaaaa accggaggga ctacaaagcg gcttcacaaa tggcttcggc atcaacaaag     54240
     tcgttcttgt tacttttgac aaaaggacgg acaaactggg gggaaataag cttaacctgg     54300
     tgactgagtt gttgaatttt acgggccata aaatgggcgc cggtacaggc ttccatcacc     54360
     acagtggagg cggaacaatc ggagaggaac tcggtaagct tcttgcgaga gaacttttta     54420
     cgcaataaag cgttgccgtg tttatcctga cagtggatat ggaatgaatg tttgccgggg     54480
     tcgataccga taagcgaaat gttttgcatg atgagctccc agaaagaaaa acaccctgtc     54540
     agcgtaccgc tcacagggtg ggggtgacca tctcagtgaa accccagcgg gcggagtttc     54600
     actgaggaaa aatacaatgt attcttatcg atatctttcg atatcatcga gccttttcac     54660
     taagggtttc cagacaataa attttggtat aacttacaga tagttaacca atgttacagg     54720
     aattgttatg agagtcctga cgaaaaaaac tcacgttaaa acaaccacgt acagttcctt     54780
     ctaatgaaca taatggcccc ccctggatcc gacacttctc agtagacaac agctagaatt     54840
     cgcgggggca gaaagacaat agtgtatgtc actcagccac caacatggaa aaagaaaaaa     54900
     acagcacatc aaactcatac agagataaag gcgaaactga aatcccatgt tgcaggaaaa     54960
     tctgtgccgg ccattgcaac tccgtagagc gaggtgttac cggatcagcc catttataaa     55020
     gactgtgcgc cgacacgccg aggtgttctg aaacgtcggc aacggaatag ctccgctcag     55080
     tgatctgacg gtcagcttct tccttaaatt caggggtaaa acgtggtgtg cccatagact     55140
     cctcctatgc ttaaaatata ggtcagattt gtctacaggc tcgggggcac tccaaatatc     55200
     tacaatcact aaaaatcagt ggctggaagt gatatattct ggggcgggtt taatcaatga     55260
     tagatatcat cgtaaatcag attaaagagc ttttgtgtga ttaactcaac ctttactgag     55320
     ctactccaaa aaatagcaag tcactttgga ttagataaat tgagccaaga tgaatatggc     55380
     ttgtgtgagc ttatcctcaa cgaccgagtc gttattatac tgagggctga tgaaatattg     55440
     aatcgattga ctctgttggg gccaatctta ggattttctg gaccagaggc gcgcggtgcc     55500
     gctagtcagc tttttttctg ttatagcatc aatgccttga ataaggacgc cccttgtttc     55560
     gcttggagtg acgaactggg gctgatcgca ttcaagcacc tttctctcga cgagctgaat     55620
     gttgagaacg ttagcaagga gatagcgaac ttttacgact ggttgagctt ggtcagttta     55680
     ccagcagaaa ctgccccctc ttactcaatc tactcaatcg gttattaaat ggggatgagt     55740
     aaagcatgaa aatcatggga actatgtcac cttcgatctc cctcgccaaa gctcatgagc     55800
     gcatcagcaa acattggcaa aatcctgtcg gtgagctcaa tatcgaagga aaacggtata     55860
     ggattatcga taatcaagtg ctgcgcttga acccccacag tggtttttct ctctttcgag     55920
     aaggggttgg taagatcttt tcggggaaga tgtttagctt ttcaattgct cgtaacctta     55980
     ctgacacact ccatgcagcc cagaaaacta cttcgcagga gctaaggtct gatatcccca     56040
     atgctctcag taatctcttt ggagccaagc cacagaccga actgccgctg ggttggaaag     56100
     ggaagccttt gtcaggagct ccggatcttg aagggatgcg agtggctgaa accgataagt     56160
     ttgccgaggg cgaaagccat attagtataa tagaaactaa ggataagcag cggttggtgg     56220
     ctaagattga acgctccatt gccgaggggc atttgttcgc agaactggag gcttataaac     56280
     acatctataa aaccgcgggc aaacatccta atcttgccaa tgtccatggc atggctgtgg     56340
     tgccatacgg taaccgtaag gaggaagcat tgctgatgga tgaggtggat ggttggcgtt     56400
     gttctgacac actaagaagc ctcgccgata gctggaagca aggaaagatc aatagtgaag     56460
     cctactgggg aacgatcaag tttattgccc atcggctatt agatgtaacc aatcaccttg     56520
     ccaaggcagg gatagtacat aacgatatca aacccggtaa tgtggtattt gaccgcgcta     56580
     gcggagagcc cgttgtcatt gatctaggat tacactctcg ttcaggggaa caacctaagg     56640
     ggtttacaga atccttcaaa gcgccggagc ttggagtagg aaacctaggc gcatcagaaa     56700
     agagcgatgt ttttctcgta gtgtcaaccc ttctacatgg tatcgaaggt tttgagaaag     56760
     atccggagat aaagcctaat caaggactga gattcattac ctcagaacca gcgcacgtaa     56820
     tggatgagaa tggttatcca atccatcgac ctggtatagc tggagtcgag acagcctata     56880
     cacgcttcat cacagacatc cttggtgttt ccgctgactc aagacctgat tccaacgaag     56940
     ccagactcca cgagttcttg agcgacggaa ctatcgacga agaatcggcc aagcagatcc     57000
     tgaaagatac cctaaccgga gaaatgagcc cattacctac tgatgtaagg cggataacac     57060
     ccaagaagct tcgggagctc tctgatttgc ttaggacgca tttgagcagt gcagcaacta     57120
     agcaattgga tatgggggtg gttttgtcgg atcttgatac catgttggtg gcactcgaca     57180
     aggccgaacg cgagggggga gtagacaagg atcagttgaa gagttttaac agtttgatcc     57240
     tgaagactta cagcgtgatt ggagcctata tcaaaggcag agaaggggat accaagagtt     57300
     ccagtacgga agtatccccc tatcatcgca gtaactttat gctatcgatc gtcgaacctt     57360
     cactgcagag gatccagaag catctggacc agacacactc tttttctgat atcggttcac     57420
     taatgcgcgc acataagcac ctggaaacgc ttttagaggt cttagtcacc ttgtcacagc     57480
     aagggcagcc cgtgtcctct gaaacctaca gcttcctgaa tcgattagct gaggctaagg     57540
     tcaccttgtc gcagcaattg aatactctcc agcagcagca ggagagtgcg aaagcgcaac     57600
     tatctattct gattaatcgt tcaggttctt gggctgatgt tgctcgtcag tccctgcagc     57660
     gttttgacag tacccggcct gtagtgaaat tcggcactga gcagtatacc gcaattcacc     57720
     gtcagatgat ggcggcccat gcagccatta cgctacagga ggtatcggag tttactgatg     57780
     atatgcgaaa ctttacagcg gactctattc cactactgat tcaacttgga cgaagcagtt     57840
     taatggatga gcatttggtt gaacagagag aaaagttgcg agagctgaca accatcgccg     57900
     agcgactgaa ccggttggag cgggaatgga tgtgacaagt gccccctaag ccttgagttg     57960
     atatatccga gaatgggcta agatttggca attgcttaac aataattatt ttttattaaa     58020
     aatgcataac acaaaaaata cgttatatat acaaatgaat atttccagta ttaatctcaa     58080
     caagcttctc taccggagaa tattaatctg gaatacgtaa tagatagagt ttattatgct     58140
     ataaaatctt cctttttcgc agaaatatcc aatggttcga gtgagtgctg cccgtctgtt     58200
     ccgggttcac ccatcaacga ttgaacgtct tattgcaagg taccgtttat ccggaatata     58260
     aaattcatac tactgttaac tccctgaata aggataaata aatgattgga ccaatatcac     58320
     aaataaacag ccccggtggc ttatcagaaa aagagaccag ttctttaatc agtaatgaag     58380
     agcttaaaaa tatcataaca cagttggaaa ctgatatagc ggatggatcc tggttccata     58440
     aaaattattc acgtacagat gtaaaagtca tgcccgcatt ggtaactcag gcgaacaata     58500
     aatatcctga aatgaatctt aattttgtta catctccact ggacctttcg atagaaataa     58560
     aaaacgtcat agaaaatgga gttggatctt cccgcttcat aattaacatg ggggaagatg     58620
     gaatacattt cagtgtaatt gattacaaac atataaatgg gaaaacatct ctgatattgt     58680
     ttgaaccagc aaactttaac agtatggggc cagcgatgct ggcaataagg gcaaaaacgg     58740
     ccattgaacg ttatcaatta cctgattgcc atttctccat ggtggaaatg gatattcagc     58800
     gaagctcatc tgaatgtggt atttttagtt tggcactggc aaaaaaactt tacaccgaga     58860
     gagataacct gttgaaaata catgaagata atataaaagg tatattaagt gatggtgaaa     58920
     atcctttacc ccacgataag ttggatccgt atctcccggt aactttttac aaacatactc     58980
     aaggtaaaaa acgtcttaat gaatatttaa atactaaccc gcagggagtt ggtactgttg     59040
     ttaacaaaaa aaatgaaacc atctttaata ggtttgataa caataaatcc attatagatg     59100
     gaaaggaatt atcagtttcg gtacataaaa agagaatagc tgaatataaa acacttctca     59160
     aagtataatg tattttggaa atcttgctcc agtatgggaa tacggttcag ctctttctgg     59220
     ctcatggtca ccaacataga cgctccggat tgcctgcctg tgagccagtt atacagcgag     59280
     aactggagag aagagacgaa cggctcatgc aggagcgtga acatcggctg tctctggatc     59340
     gggaacgtca gctggaaatt caggaacgca cgctggatgg cctttcgttg tgatagtgaa     59400
     actatgaaaa atgacaggtt cagctgattt tggcgggcta tagcggcata cgcagccagg     59460
     ctgcataggt attcatgcgg ttaaaattta tcgggtgcga tcgcgatagt ttttcgggga     59520
     gtttgttgct ctttctgcct gtttactgct gtggtcgcgc taaacgcatt tctgcggtgc     59580
     gttaaatcca tcttatgtta aatgatacag gggcagagaa atgtttgcgt tacgagcatc     59640
     gccagttctt tcccccactg tcagtctatc cttaacatca tacttgataa gaatattgcg     59700
     tttacttgaa aatttttaca gaaccccccc tatttatggt ggtttagttt gtgtttattt     59760
     taaaatatac atgacatatc gacgttatgg ggagcattat gaaaataaac gatcttaaat     59820
     cattaataag catgcaaatt gcagagtttg ggggagggga aaaaatcggt cgcttaaaaa     59880
     gcactttaca acaagtttct actcaagcta ttacttccga tgagcgcaga tttgcatacg     59940
     cggtacttga acatgcaaaa aatacaatac tcaatcgtca agatgttgcg aaactattac     60000
     caagggcgtc taattttgag ttaagtcaag gaaaaaaagg tgaagtgata ttaaaaggtt     60060
     tacgggttga acaactgtca cttgaggatg caaaattatt gctagatgca gtgacacgga     60120
     aaatgcaaaa gctttaatat cacaacttaa tgataagtta ccttaaaact aaaaattcaa     60180
     tttttcactg aattatatag tacgatgaag aatggttgct atatttatac tggcttgcgt     60240
     tcgccatccg aaaatagttc ttagggttta gggtggcgtt gtaaacacac cgactttagt     60300
     gccattcact ttttgaggcc tcactttggt aataacagag ggatcacttg gtacaacttt     60360
     gtgtccgatc agtattccgg ctttcattgc atcgttatac cggggacgct gagggactct     60420
     atctttgtgc tggaaggcct tctggaacag gagaccgggc tgaatccaac cgaaattatg     60480
     accgatacag aggtgccagc aatcttgtct ttggcctttt ctggctgctg ggataccagt     60540
     tttctccgcg cctggctgat gccggtgctt cggttttctg gcgaatggac catgatgccg     60600
     actatggcgt gctgaatgat attgccagag ggcaatcaga tccccgaaaa atagtctttc     60660
     agtgggacga aatgatccga accgcaggct ccctgaagct gggcaaagta caggcttcag     60720
     tgctggttcg ttcattgctg aaaagtgaac gttcctccgg gctaactcag gcaatcattg     60780
     aagtggggcg catcaacaaa acgctgtatc tgcttaatta tattgatgat gaagattatc     60840
     gccggcgcat tctgacccaa cttaatcggg gagaaagccg ccatgccgtt gcggagccat     60900
     ctgtcacggt cagaaaggtg agataagaaa gcgatatatc gacggtcagg aagatcagtt     60960
     gggagcactg gggctggtca ctaacgccgt cgtgttatgg aacactattg atattcagcg     61020
     cgagaaccgt gtacacagct ttgctttgat aatgtccgtc ctcgcggatt ttatagtgga     61080
     tagcatccag ccagacgaaa gggtataccg cctccagcgg gcgctgttgc cattgtttta     61140
     actcaggaat aaccttatct gtgacagcgg tgatcgtggc actggataca ctgaaagcgt     61200
     ataaatcctc gatttcctgg ctgatatctt tgtagctcat acccagcgcg aacatgcgaa     61260
     taatcttgcg ctctatctca tcagaaagcg tggtctgatg ttttttcacc aattgcggtt     61320
     cgaaagagcc attacgatcg cggggcgtgg ccaattcaaa agcaccagtg ggtgttttga     61380
     ctgttttttt agttgagccg tttttacgat tggcttcaat gtcttgagcc agatggaagt     61440
     caagctcagc agccaaagca gcttccgtca actgcttgat taacggagtt aatatgccat     61500
     ctttgcccgt caaggcctgg ccatcctgaa gtgctttcag ggctttgtcg aaatcgaagg     61560
     gttgggacat gtgtcattcc tttttgatta tatattactg gaatgacaca gaatttctaa     61620
     cactcccgct taaaaatttt aatgtatatt tcatctgcta tgatttttat cagcctgtta     61680
     gttatcgttg cacatgtcac aggactaatt ggctttgatc tcgtttggga aatcacagta     61740
     caacaatggt atacatttgg gactatcata ctagctctca ttgccggggc atttttgaat     61800
     agaatcacat tctctgcatt acgcttggcc gcgctagatg tgtagttgaa agagccagtt     61860
     tgaacgttat ggccatcgac caccatgtac ttgttgtgca tgatcgcata acgatggttt     61920
     aatttgacag ccacctcttg attagccagg aagttgacca ctgtatactt atcctggtta     61980
     gctttcatat ctgcaacgac tctaacctta acacctcgat ttttggctgc tataagcgct     62040
     actgcaatcg gtttgcgctg ccacatcaat actggcttga gcgccctcaa tgccgtacag     62100
     gacgatatta agtgcatcac tattggcgaa aatcccacta acgcgttaaa accacccacc     62160
     agatgcataa tgccagtcag ttaagcaact gactggcatt tttgttcctg gcttttccat     62220
     atttatacgg cctttccttc accaccctcg ggaaggctct ttctcttctt atcggtaact     62280
     tcaccatctg cgccatgctc tccatatccc gcatcagttc cgggatacga cctggtgaag     62340
     ctccctgcag cgtcatcagc atccgtatca ccatcccgca cgattctgag aagctcagct     62400
     gattcggcca gtatcctttc agcgctcccg tcatcttaat catctgataa cgcaccagat     62460
     tatagcccag cagtactccc catagctcct gctcaacaag ctccggcttt ttactccgca     62520
     gcgtcagcct gctcagttgc attgtctgtt tgccagacca cgccatccac ggccagcaac     62580
     gtcagaccgc accagtgagg atgggtgacg gagccatgcc acagctgcgc cgtttgtgag     62640
     aatacccggc gaacagcctc gcttcccagc ctttgccgtg cctggataac ggcgctgggg     62700
     gccacgaagg ggcgatcgcc cggcagcatg atatccagcc ggttaacgat ttgatgaaga     62760
     ggttctttac gctcgagtgc catcccgaca atgcaccaga ccatcatttc cagtggcagg     62820
     cggcgcttgc gcagagtcac cgtgccggat tcggcaagac aacgggagat gagctggggg     62880
     tcgaggtaat ctcccagtgt ggtcagtggg ttacgcagtg agtcgtagcg ggaaacgaga     62940
     tcaagagcct gtgcgatgtg cataaaaaaa tccggaaacg aagaacattt ctggattctt     63000
     acacaaccac tggatcggtc aaccgatcct taactgatcg gcatttttgt tcctggcttt     63060
     tccatattta tacggccttt ccttcaccac cctcgggaag gctctttctc ttcttatcgg     63120
     taacttcacc atctgcgcca tgctctccat atcccgcatc agttccggga tgcgacctgg     63180
     tgaagctccc tgtagcgtca tcagcatccg catcaccatc ccgcacgatt ctgagaagct     63240
     cagctgattc ggccagtatc ctttcagcgc tcccgccatc ttaatcatct gataacgcac     63300
     cagattatag gccagcagca ctccccatag ctcctgctca acaagctccg gctttttact     63360
     ccgcagcgtc agtctgctca gttgcattgt ctgcttgatt tcccggtaac ccagctcaat     63420
     ttcccaacga tgaccgtaca gatccgccat ctctcccccg ggataacgca tcgtatctgt     63480
     catggatgtc agcaggtggt acaccttccc ttttcgggtg atggtcagca ggcgggctgt     63540
     catttcagcc cccagctcgg gccacttttt ccgggcctgt gggctggttt tcaacttcac     63600
     cagatgatcg ccttttccca gtttccgtat ctcttcatac tgtgcgcctt tcttcagcgg     63660
     gatcatccag tggcggtgct cgccggcctg gctccaggca ttcagaagcc ccagtgagta     63720
     gtagccttta tccatcaacg tcagtgtgtt atcagcagtc tggtctatca gttgctcagc     63780
     cagcgtgtat tcgctttctt tcatcgtacc gaaggccgcc gctgttaaca ggtggctggt     63840
     cagttccatc tggcagacca ttttcacctg tgggtaaagg cccggttgtc cggcataagt     63900
     ctggcgcggg aaggcggtat cgttctctgg cgtatctggt gttcgccaga ccacgccatc     63960
     cacggccagc aacgtcagac cgcaccagtg aggatgggtg acggagccat gccacagctg     64020
     cgccgtttgt gagaataccc ggcgaacagc ctcgcttccc agcctttgcc gtgcctggat     64080
     aacggcgctg ggggccacga aggggcggtc gcccggcagc atgatatcca gccggttaac     64140
     gatttgatga agaggttctt tacgctcgag tgccatcccg acaatgcacc agaccatcat     64200
     ttccagcggc aggcggcgct tgcgcagagt caccgtgccg gattcggcaa gacaacggga     64260
     gatgagctgg gggtcgaggt aatctcccag tgtggtcagt gggttacgca gtgagtcgta     64320
     gcgggaaacg agatcaagag cctgtccgat gtgcataaaa aaatccggaa acgaagaaca     64380
     tttccggatt cttacacaac cactggatcg gtcaaccgat ccttaactga tcggcattac     64440
     ccaccagatg cacgcttttt tgctggagtt cggcgtcagc ctgccgcgcg gtattgccgt     64500
     gatacggcgt ctgagcgctg tgctggaaga aaacgcacag cgcctgctga tcattcccgg     64560
     cgtcgggccg gtaacggcga gtctgttagc cacgcggctg ggtgacggaa aaaactatgc     64620
     cagcagccgt gactttgctg cgtcgacagg tatggttcct cgccagtaca gcacaggtgg     64680
     aaaaacaacg ctgatgggca tcagcaagcg gggtgataaa aatctgcggc gacttctggt     64740
     acagtgtgca cgggtcttta tacagcggct ggagcacaat ccagggcgtc tggcagagtg     64800
     ggttagaaag ccgcttgcca accatcattt aaacgtggtg gcgtgcgcag tggcaaacaa     64860
     actggcccgc atagcctggg cagtgacggc acatcaggcg gcgttcagtc aataaaagag     64920
     ccaacgaaaa actcgtcagc tcagttaatt aacacgttac tttctggttt ttcgacgaca     64980
     gataattgat gacatgaacg gcatatcggc ctgctgatga acctgacata aaaaatggct     65040
     ctttgaagcc ggcggctttt taaggttcgg caggcgcgga actcatcgtg gcgcgggcat     65100
     taatgctcac cagacaccga atagatttac gcaagcccat cataaaatca aaatctgtgt     65160
     tgcaaaaacg ggggtgacta tagattttta tgcacagaaa acctcccgct aggctggagg     65220
     ttccgtaaag ctttcagctt tgagccagtt ataaaaaccc cttttgattt gttaaaacag     65280
     tttgcggtct ggccactgca aatgttcaac aagaaatcaa aagggggtcc ctatgaggga     65340
     cgaaaagagc ttagcgcaca cgcgatggaa ctgtaaatat cacatagttt ttgcgccgaa     65400
     gtaccgaaga aaggtgttct acggggaaaa gcgcaaagcg ataggcagta tcttaagaaa     65460
     gctgtgcgaa tggaaaagcg tgaatattct ggaagcagaa tgctgtgtgg atcacatcca     65520
     tatgcttctg gaaatcccgc ccaaaatgag tgtgtcgggt tttatgggat acctgaaagg     65580
     aaagagcagc ctgatgcttt atgagcagtt tggcgatttg aagttcaaat accgtaacag     65640
     ggagttcagg tgtcgagggt attacgttga tacggttggg aaaaatacag ccaggataca     65700
     agaatacata aagcaccagt tggaagagga taaaatgggt gagcaactct cgatccccta     65760
     tccggggagc ccgtttacgg gccgtaagta atccataaat gcaaatgtca gatcgcgatg     65820
     cgcctgttag ggcgcggctg gcaacagagc cttataggcg catatgaaaa acctccggct     65880
     atgccggagg atatttattt aactgatttt ttggtaatgt gaaaacaata gttttttgct     65940
     attgttttag aatgcttttt tgttcgattg aacatcaaat ttagaggtta aaatgatcga     66000
     aggtgtgcat gagcgaaaac gtaggccgaa aggcccacag aaatctaatg cttcttatca     66060
     gcgggatttt tgggaacgcc gtaaacttac acacagtaga atagtgatgg ttgtacctaa     66120
     cgaggtgaaa gaggatctag agcttttatc aagtgtgtat ggtaagacaa agacggaagt     66180
     tattgaacaa cttataaaaa tggctaaaga tggctgcggc ttcaaagatc cactatagtt     66240
     tctttgttaa taagatgagt attgatcata ctttttgatc gtggtacctt acggtggttt     66300
     acaaaagcga aagattaggt tttgtaacac aagaattttt tgggggggac gttcccagta     66360
     atagcgtcta aagggaggcg gtgattttga aaccgctaga aagtagaagc ccccgaatct     66420
     ctattcacaa tcttggcgga tgggtttaga gagaatcagg ggctcaaata ctggctgctg     66480
     ccagcaagga ttataacgca tgtacaatcc aaatcaagcc ttccgacccg ccataagcgc     66540
     agtgtggggt ggataagcag aaattctcta atttttctaa agatcattct tgggaagata     66600
     ttgattttga agcactagaa cgagcttcaa tcgaatattt tcaagaacag acttctttcg     66660
     atacatccaa aactgaaaag aaaagaacgc ttcggaaacg gggtgaacac tcaactgagt     66720
     gtaaatgtcc taatccattc tttagtcgcc cagagcatta caagccatta gctggtgagc     66780
     tgggccatgc ttatcgtcga ttaactcaga aagacaaaaa aaccggcaaa gtatctctcc     66840
     gaattcgtat atcccggcat ccatattttg tgtgggcgcg taaagctgtt ggccgtcaac     66900
     gcgattttag acccgttcgt gaacaactgc tcgatgcact ctttgtatta ctggttagct     66960
     gtgtagatcg agcaacccat attgttacga tgaacgagag ccgtttagct gcggagctta     67020
     gccccaaaga tgataatggt aacgtcattc ctgcaacggc cgtgacagtg acgcgaattt     67080
     gtcggttgtt acaagagctg aataaatttg gcctcatcgc attacctgaa ggtgttcaat     67140
     gggatgctta taataagcag ttcttcccga agcatgtcat tttgactgaa caggcttgga     67200
     aactgatcgg ggtaaatctc gataagttat atgcggagca ggaagaacgg ttacaggccg     67260
     agatagacgg agttttacaa ccaggggaag acgtttctgt gaaaacagcg cgtaaacgtt     67320
     ggtatgaccg tatgcgacat gccacgttag ttcgccgcag aggtgaagcc atcaaacaaa     67380
     aacgtgcgaa caaacttgga aagttagaac tcaatgatcg cgtgtatgaa atgagtaatt     67440
     tcttgcaacg tacattacct tacgatgagc tgtaccatat gactccagag cactttgaaa     67500
     agctggtatg gcaacggttg catcaactgg atatcgctat ggctcacgag ccgccagaac     67560
     cctatcacta atagctacat ccaacctaat aaagtccctt accgccgctg gcggtgtctg     67620
     tgtttccgac cccgcaataa acgtataaat aatagccacg ctgttgccgc ccaataatcc     67680
     atttttctat caaattgccc gatatcgtaa tacgttgtta g                         67721
//

If you have problems or comments...

PBIL Back to PBIL home page