(data stored in SCRATCH zone)

EMBL: AM295250

ID   AM295250; SV 1; linear; genomic DNA; STD; PRO; 2566424 BP.
XX
AC   AM295250;
XX
PR   Project:PRJEA34811;
XX
DT   02-FEB-2009 (Rel. 99, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 6)
XX
DE   Staphylococcus carnosus subsp. carnosus TM300 complete genome
XX
KW   complete genome.
XX
OS   Staphylococcus carnosus subsp. carnosus TM300
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Staphylococcaceae;
OC   Staphylococcus.
XX
RN   [1]
RP   1-2566424
RA   Rosenstein R.;
RT   ;
RL   Submitted (27-JUL-2006) to the INSDC.
RL   Rosenstein R., Mikrobielle Genetik, Universitaet Tuebingen, Waldhaeuser
RL   Strasse 70/8, 72076, GERMANY.
XX
RN   [2]
RX   DOI; 10.1128/AEM.01982-08.
RX   PUBMED; 19060169.
RA   Rosenstein R., Nerz C., Biswas L., Resch A., Raddatz G., Schuster S.C.,
RA   Gotz F.;
RT   "Genome analysis of the meat starter culture bacterium Staphylococcus
RT   carnosus TM300";
RL   Appl. Environ. Microbiol. 75(3):811-822(2009).
XX
DR   MD5; 06c689e2242a43f28ec5ee6e54766160.
DR   BioSample; SAMEA2272563.
DR   EuropePMC; PMC2632126; 19060169.
DR   EuropePMC; PMC3187289; 21832022.
DR   EuropePMC; PMC3417630; 22919635.
DR   EuropePMC; PMC3637587; 23521926.
DR   EuropePMC; PMC4168904; 25247133.
DR   EuropePMC; PMC4729746; 26843698.
DR   EuropePMC; PMC5343137; 28348860.
DR   EuropePMC; PMC6156374; 30283431.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00503; RNAIII.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01492; rli28.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01775; RsaOG.
DR   RFAM; RF01819; RsaD.
DR   RFAM; RF01820; RsaE.
DR   RFAM; RF01821; RsaH.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; AM295250.
DR   SILVA-SSU; AM295250.
XX
CC   Clone requests: ralf.rosenstein@uni-tuebingen.de
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2566424
FT                   /organism="Staphylococcus carnosus subsp. carnosus TM300"
FT                   /sub_species="carnosus"
FT                   /strain="TM300"
FT                   /mol_type="genomic DNA"
FT                   /country="Germany:Bavaria"
FT                   /db_xref="taxon:396513"
FT   CDS_pept        87..224
FT                   /transl_table=11
FT                   /gene="rpmH"
FT                   /locus_tag="SCA_0001"
FT                   /product="50S ribosomal protein L34"
FT                   /note="Similar to RpmH of B.
FT                   stearothermophilus:,>RL34_BACST,Length = 44,Score = 47.0
FT                   bits (110), Expect = 2e-07,Identities = 40/44
FT                   (90%),Positives = 42/44 (95%)"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0001"
FT                   /db_xref="GOA:B9DI93"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DI93"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26916.1"
FT                   /translation="MVKRTYQPNKRKHSKVHGFRKRMSTKNGRKVLARRRRKGRKVLSA
FT                   "
FT   CDS_pept        376..723
FT                   /transl_table=11
FT                   /gene="rnpA"
FT                   /locus_tag="SCA_0002"
FT                   /product="putative ribonuclease P protein component"
FT                   /function="RNase P protein component"
FT                   /EC_number="3.1.26.5"
FT                   /note="(P58031) Ribonuclease P protein component (EC
FT                   3.1.26.5) (RNaseP protein) (RNase P protein) (Protein
FT                   C5),InterPro: Bacterial ribonuclease P protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0002"
FT                   /db_xref="GOA:B9DI94"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DI94"
FT                   /inference="similar to AA sequence:UniProtKB:P58031"
FT                   /protein_id="CAL26917.1"
FT                   /translation="MEKAYRIKKNSDFQAIYRRGKSVANRQFVIYMMPDKGLTHFKLGI
FT                   SVSKKLGNAVTRNRIKRAIRENFKVHKDDMLPRNIIVIARHPAKDMTVLEIQKSLEHVL
FT                   KVAKLFNKRIK"
FT   CDS_pept        853..2235
FT                   /transl_table=11
FT                   /gene="trmE"
FT                   /locus_tag="SCA_0003"
FT                   /product="putative tRNA modification GTPase TrmE"
FT                   /function="predicted GTPase"
FT                   /note="(Q8CMN5) tRNA modification GTPase trmE,InterPro:
FT                   tRNA modification GTPase TrmE"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0003"
FT                   /db_xref="GOA:B9DI95"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/TrEMBL:B9DI95"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26918.1"
FT                   /translation="MMDLDTITSISTPMGEGAIGIVRLSGKEAVEITDKLYKGKKPLAE
FT                   VESHTINYGHIVDPETNEVVEEVMVSVLRAPKTFTREDIVEINCHGGILTINHVLELTM
FT                   SYGARLAEPGEYTKRAFLNGRIDLSQAEAVMDFIRSKTDRASKVAMNQIEGRLSDMIKR
FT                   QRQSILEILAQVEVNIDYPEYDDVEDATTEFLLKQSKEIKEDIDKLLATGTQGKIMREG
FT                   LSTVIVGKPNVGKSSMLNNLIQDNKAIVTEVAGTTRDVLEEYVNVRGVPLRLVDTAGIR
FT                   ETEDIVEKIGVERSRKALSEADLILFVLNYNEGLTEEDRKLYEVIKNEDAIIIVNKTDL
FT                   EQHLDLDEVKAMVGDMPVIETSMLKQEGIDQLEEQIRDLFFGGEVQNQDMTYVSNSRHI
FT                   SLLKQARNAIQDAIDAAEAGVPMDMVQIDLTRTWQILGEIIGESASDELIDQLFSQFCL
FT                   GK"
FT   CDS_pept        2251..4125
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /locus_tag="SCA_0004"
FT                   /product="glucose inhibited division protein A"
FT                   /function="NAD/FAD-utilizing enzyme apparently involved in
FT                   cell division"
FT                   /note="(Q8CMN6) Glucose inhibited division protein
FT                   A,InterPro: Glucose-inhibited division protein A subfamily"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0004"
FT                   /db_xref="GOA:B9DI96"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9DI96"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26919.1"
FT                   /translation="MSLDYDVIVIGAGHAGIEAGLASARRGAKTLMLTINLDNVGFMPC
FT                   NPSVGGPAKGIVVREIDALGGQMAKTIDRTHIQMRMLNTGKGPAVRALRAQADKVLYQK
FT                   EMKRVLEDEENLHIMQGMVDELIIEDDEIKGVRTNIGTEYRSKAVVITTGTFLRGEIIL
FT                   GNLKYSSGPNHQLPSVTLADNLRELGFDIVRFKTGTPPRVNAKTIDYSKTEIQPGDDVG
FT                   RAFSFETTEFILDQLPCWLTYTNDKTHQVIDDNLHLSAMYSGMIKGTGPRYCPSIEDKY
FT                   VRFNDKPRHQLFLEPEGRDTNEVYVQGLSTSLPEHVQREMLQTIEGLEKADMMRAGYAI
FT                   EYDAIVPTQLWPTLETKKIKNLYTAGQINGTSGYEEAAGQGIMAGINAAGRVLGTGEKV
FT                   LSRSDAYIGVLIDDLVTKGTNEPYRLLTSRAEYRLLLRHDNADLRLTDLGHELGMISDE
FT                   RYARFNEKRDQIEAEINRLTNIRIKPNEHTQEVIKSRNGSPLKDGILAIELLRRPEMDY
FT                   QAILDILEEDHQIPADVEEQVEIQTKYEGYINKSLQQVEKVKRMEQKKIPHDLDYSKID
FT                   SLASEAREKLAEVKPLNIAQASRISGVNPADISILLVYLEQGKLERVK"
FT   CDS_pept        4126..4848
FT                   /transl_table=11
FT                   /gene="gidB"
FT                   /locus_tag="SCA_0005"
FT                   /product="glucose inhibited division protein B"
FT                   /function="predicted S-adenosylmethionine-dependent
FT                   methyltransferase involved in bacterial cell division"
FT                   /EC_number="2.1.-.-"
FT                   /note="(Q8NUF9) Methyltransferase gidB (EC 2.1.-.-)
FT                   (Glucose inhibited division protein B),InterPro: Glucose
FT                   inhibited division protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0005"
FT                   /db_xref="GOA:B9DI97"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DI97"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26920.1"
FT                   /translation="MGVEWLVEKLQEHDITLNDKQKQQFQTYYELLVEWNEKMNLTSIT
FT                   DEEGVYLKHFYDSITAAFYIDMNQELSICDVGAGAGFPSIPLKIVFPQLKVTIVDSLNK
FT                   RIQFLNHLADALDLRGVSVVHERAENFGNVRGDNRESYDIVTARAVARLSVLSELCLPL
FT                   VKTGGHFIAMKSSKGEEELEEARFGIGVFGGRVEAVETFELPGDAGERQMIIIEKRSKT
FT                   PKKYPRKAGTPNKSPLLK"
FT   CDS_pept        4895..5737
FT                   /transl_table=11
FT                   /locus_tag="SCA_0006"
FT                   /product="putative DNA-binding protein"
FT                   /function="predicted transcriptional regulators"
FT                   /note="similar to SpoOJ-like homolog,probably involved in
FT                   regulation of transcription,InterPro: ParB-like partition
FT                   protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0006"
FT                   /db_xref="GOA:B9DI98"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR023705"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:B9DI98"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26921.1"
FT                   /translation="MKKPFSKLFGLTNKDEDITGYTEEERNNNVESIQIERIVPNRYQP
FT                   RQVFDQNKINELAESIQEHGLLQPIVVRPIEEGMFEIIAGERRFRALSTNQMAYADVII
FT                   REMTDEETAVVALIENIQRENLSAVEEAEAYQKLLELGDTTQSELAQSVGKSQSFIANK
FT                   LRLLKLAPKVKQKLSEGKITERHARALLSLTFEQQEEMVQTIIDQHLNVKQTEARVKSL
FT                   VGPEKVKAKPFQFAKDLTNARETLQSSLDKIEQSGIHIEQKERDCDDYLEIKIRVYKR"
FT   CDS_pept        5872..6801
FT                   /transl_table=11
FT                   /locus_tag="SCA_0007"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0007"
FT                   /db_xref="UniProtKB/TrEMBL:B9DI99"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26922.1"
FT                   /translation="MKIKHLFSATAALTILLASCGSQEKSDNDTKHEEKTKKDDNQKTE
FT                   KKESNSTSSSTNKNQSSKSSESKKESNSNVKPVSQLTPQEKVALALYAPKSADFTVTPS
FT                   ELLNHSYVQNGNGGDIQRTIQQLKLSKVEDVPKYIPSAPQNMDFYYSNNSKAASVVVIG
FT                   VSDTQVLISGTQGINPYQQLVNIGGLYDVKDLYNQYKDRNFQQVANLITFTESAEPAPK
FT                   EDDSSSDSKSSSSDSGEKVTRANVIDKVEDYEGHKLDTSTYTYKEPEQKSDGSWGFSFV
FT                   DKSGKLAGSYIVHSDGSVEKFDAKGQPE"
FT   CDS_pept        6816..6989
FT                   /transl_table=11
FT                   /locus_tag="SCA_0008"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0008"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIA0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26923.1"
FT                   /translation="MKMKYLFAASATLALLLSGCGHSDNKSSDSKKDNKQEAKHKDNKT
FT                   SEKQTNKERFSE"
FT   CDS_pept        7083..7754
FT                   /transl_table=11
FT                   /locus_tag="SCA_0009"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0009"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIA1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26924.1"
FT                   /translation="MFAVGHSKYAKTTISAEELLNHSYEKLDSLKKVQKSIQNIKFQRT
FT                   FDGQVPGQPSNMDVYESYESKGNYLTMMAMTDSQIIIMPEQGTNTYQQLLDYGAIYNLK
FT                   DLYEKYKDNPNFSKVVNMISVSETPEVGTSSKSDSSSESNAKESTSSSGTVTRANVIDK
FT                   VEDYEGHKLDTSTYTYKEPEQKSDGSWGFSFVDKSGNLAGSYIVNSDGSVEKFDSKGQP
FT                   E"
FT   CDS_pept        8074..9234
FT                   /transl_table=11
FT                   /locus_tag="SCA_0010"
FT                   /product="putative aminotransferase"
FT                   /function="Aspartate/tyrosine/aromatic aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="(O31665) Transaminase mtnE (EC 2.6.1.-),InterPro:
FT                   Aminotransferase class I and II"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0010"
FT                   /db_xref="GOA:B9DIA2"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIA2"
FT                   /inference="similar to AA sequence:UniProtKB:O31665"
FT                   /protein_id="CAL26925.1"
FT                   /translation="MVMSRRLAKIPDSYFGKTMGRKIEHGPLPLINMAVGIPDGETPKG
FT                   IVDEFADALRLPENQKYGAFHGKETFKQAIVDFYQRQYGVELDKDDEVCILYGTKNGLV
FT                   GLPNCIVNPEDYVLLPDPGYTDYLAGVLFADAHPYALELEPPNYQPDWDKVPEDILKQT
FT                   KLIYLTYPNNPTGSTVTQEVFDEAIQKFKGTQTKIVHDFAYAAFGFDHKNPSILQSKDG
FT                   KDVAIEVYSLSKGYNMSGYRVGFALGNKDVIQALKKYHTHHHAGMFGALQDAATFALNN
FT                   YDDFLEQQSEVFRKRRDRFTAILDEGAIPYEPMTGGIFLWLKTPESYTGEQFVEFLLQD
FT                   QSILVAPGIPFGDNGNHYVRVSLALDDEQLDEAAKRLKSLSPMYKK"
FT   CDS_pept        complement(9943..10692)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0011"
FT                   /product="conserved hypothetical protein, putative cyclase"
FT                   /function="predicted metal-dependent hydrolase"
FT                   /note="conserved hypothetical protein,InterPro: Putative
FT                   cyclase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0011"
FT                   /db_xref="GOA:B9DIA3"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIA3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26926.1"
FT                   /translation="MSYPLWDQLKALKENKWVDLTHTFDSKSPHFSALEEAYIDTISTV
FT                   PEDGFFVQRWSVATQYGTHIDAPIHFVEHKRYLHELDLKELVLPLIVLDYSKEVAENPD
FT                   FRLTRQDLLEWEDQHGRIEPDSFVAFRSDWSKRWPNVEQFENKDAEGNPHAPGWALDAL
FT                   QFLLEERGVKSVGHETFDTDASVDVAKHGDLIGERYVLGQDTFQIELLTNLDQLPERGA
FT                   VIYTISPKPADAPGFPVRAFAITPEKQ"
FT   CDS_pept        complement(10871..13114)
FT                   /transl_table=11
FT                   /gene="metE"
FT                   /locus_tag="SCA_0012"
FT                   /product="5-methyltetrahydropteroyltriglutamate-homocystei
FT                   ne methyltransferase"
FT                   /function="Methionine synthase II (cobalamin-independent)"
FT                   /EC_number="2.1.1.14"
FT                   /note="(Q8CMP5)
FT                   5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   methyltransferase (EC 2.1.1.14) (Methionine synthase
FT                   vitamin-B12 independent isozyme) (Cobalamin-independent
FT                   methionine synthase),InterPro:
FT                   5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   S-methyltransferase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0012"
FT                   /db_xref="GOA:B9DIA4"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR006276"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIA4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26927.1"
FT                   /translation="MTIKTANIGFPRLGRKREWKKAIESYWAGKTNYDELTTTLNDLHK
FT                   ENLLLQKNYNIDSVPVGDFSLYDHVLDTSLLFNIIPERFQGQEVNDDLLFDIARGTKEH
FT                   VASALIKWFNTNYHYIVPEWDNAEPKLNRNVLLERFQFAQQLNVPAHPVILGPVSFVQL
FT                   SRGGDQSFEEKVETLLPLYKEVLQSLVDAGAEYIQIDEPVLVTDNAKELEDITRHVYDY
FT                   FEKAGLADKLVIQTYFEHVDLEFVNSLPVKGFGLDFVHDRGVNLQQIRDGKLSKDKALY
FT                   AGIIDGRNVWAADIEAKKDLIEELQQYTDELVIQPSSSLLHVPVSLDDEVLDETIEEGL
FT                   SFATEKLDELDALKRLINNGDAEKYDQLKAQYERFQNQAFKNLEYDFDSVRTHRESAFP
FT                   ERKKVQDARLKLPELPTTTIGSFPQTKEVRKKRADWKNHRISDEEYNQFLRDEIARWIQ
FT                   IQEDISLDVFVHGEFERNDMVEFFGERLQGFLVTKYGWVQSYGSRAVKPPVIYGDVKWT
FT                   KPITVEETAYAQSLTDHPVKGMLTGPVTILNWSFERVDIPRQEVQDQIALAINEEVLAL
FT                   EDAGIKVIQVDEPALREGLPLRKEYHEEYLKQALRSFRLATSSVADATQIHTHMCYSQF
FT                   GEIIHTIHDLDADVISIETSRSHGALIKDFEDITYDLGIGLGVYDIHSPRIPTEEEITV
FT                   AINRGLKEIDRSLFWVNPDCGLKTRNEDQVKEALSVLVSAVKKLRQEQGQETA"
FT   CDS_pept        complement(13111..14952)
FT                   /transl_table=11
FT                   /gene="metH"
FT                   /locus_tag="SCA_0013"
FT                   /product="putative homocysteine methyltransferase"
FT                   /function="Methionine synthase I (cobalamin-dependent)
FT                   methyltransferase domain"
FT                   /EC_number="2.1.1.13"
FT                   /note="(Q49775) Methionine synthase (EC 2.1.1.13)
FT                   (5-methyltetrahydrofolate--homocysteine methyltransferase)
FT                   (Methionine synthase vitamin-B12 dependent isozyme)
FT                   (MS),InterPro: Homocysteine S-methyltransferase"
FT                   /note="High confidence in function and specificity"
FT                   /note="Sca_0013"
FT                   /db_xref="GOA:B9DIA5"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIA5"
FT                   /inference="similar to AA sequence:UniProtKB:Q49775"
FT                   /protein_id="CAL26928.1"
FT                   /translation="MSRFLQTLKENVLVADGAIGTILYSEGIDTCPEAYNITHPKKIEQ
FT                   IHRSYIQAGADVIQTNTYGANFEKLQTFGLEHQVKDITRAAVRIAKKAANEDTFILGTV
FT                   GGFKGVKQNELSLSTILYHTDIQIDTLIDEGVDALLFETYYDLNELLQVIRATKKKYDI
FT                   PVIAQLTASNTNYLQDGTEINEALKQVEAEGADVIGLNCHHGPHHMQQSFTHIELPQHA
FT                   LLSCYPNASLLDFENSSIKYSDNASYFGKIAKSLVKEGVHLIGGCCGTTPEHIHYIKEA
FT                   VEGLEPINEKKVIPIRRKSNHPSIPVQKDNLTTKVKSGPTVIVELDTPKHLDTTKFFVN
FT                   VTKLDKANVDAITLADNSLATVRVSNIAAASIIKQNYNIEPLVHITCRDRNLIGLQSHL
FT                   LGLSLLGINEILAITGDPSKVGHLPGANNVYDVNSKGLTELAVRFNQGLNIDGGALKTT
FT                   TNFNIAGAFNPNVRKMEAAVRRLDKKLDSGMNYFITQPVYTVEKIQEIAEKTAHLDSPF
FT                   FIGIMPITSYRNAQFLHNEVPGITLPEDVLEQFEAVKDDKQKTKELSLRICRKLVDEVT
FT                   KHFNGLYLITPFEQVDYSLELATYFKTKTENNQEAII"
FT   CDS_pept        complement(14906..16078)
FT                   /transl_table=11
FT                   /gene="metC"
FT                   /locus_tag="SCA_0014"
FT                   /product="putative cystathionine beta-lyase"
FT                   /function="Cystathionine beta-lyases/cystathionine
FT                   gamma-synthases"
FT                   /EC_number="4.4.1.8"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0014"
FT                   /db_xref="GOA:B9DIA6"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIA6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26929.1"
FT                   /translation="MSLSSETNLIKHHQFPHILAANPPLYDSSTFPTELIGSEVSYDYA
FT                   RSGHPNREVLEEKIAALENADYGIAYNSGIGAISAVFFLLESGDHLIIPNDVYGGTYRL
FT                   CTQFLPGLNIEVTTVDTTKPEEVEKAIKENTKLIHIETPSNPLFKVTDIKAIADVAKAH
FT                   NLLLSVDNTFLTPLSQKPLELGADIVSHSATKFLSGHSDLIAGIVVTNNAEVAEQLRFI
FT                   QNTLGSGLSAQDSWTLTKHLKTLHVRWNQSVQNTQKIIEFLKTRPEITEVYYPGNDEIN
FT                   KKQAENGGAVLSFRLSDPEKVPEFARALKIPQIAVSLGGIQTIVSHPATMSHASVPEDV
FT                   RNERGITFDLLRLSVGLEDPDELIADFEAALEETYYEPISTNFERERLSS"
FT   CDS_pept        16830..17666
FT                   /transl_table=11
FT                   /locus_tag="SCA_0015"
FT                   /product="putative DNA-binding protein"
FT                   /function="predicted transcriptional regulators"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0015"
FT                   /db_xref="GOA:B9DIA7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIA7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26930.1"
FT                   /translation="MRKVGCDMSDDIHDQQAQVEEISLEDIRPNPYQPRKHFEETKLED
FT                   LAASISEHGVLQPIILRKTVRGYHIVVGERRFRASQKAGKTHIPAIVKEMTEADMMELA
FT                   IIENLQREDLNAVEEAESYRKLMDDLKLTQKEVATRLGKSRPYIANMLRLLNLPTDITQ
FT                   YIKDGKLSGAHGRTLLMLKDEKIMKRTAKQAIHEAWSVRYLENYVSELTSDQNKEKQEK
FT                   QQTKKPRLIQREERRLKERYGTNVAITTKRNKGQVTFEFTSEEEFMRLIEALNSES"
FT   CDS_pept        17755..18654
FT                   /transl_table=11
FT                   /locus_tag="SCA_0016"
FT                   /product="putative membrane protein with mechanosensitive
FT                   ion channel domain"
FT                   /function="Small-conductance mechanosensitive channel"
FT                   /note="emb|CAG39381.1| putative membrane protein ,InterPro:
FT                   Mechanosensitive (MS) ion channel"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0016"
FT                   /db_xref="GOA:B9DIA8"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIA8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26931.1"
FT                   /translation="MKTFWNTLHGVFNSLIEPFTKSETYADLLNKLIMILIYIIVAIIV
FT                   IKVLNKSIEQFFKLQNRSSHGRKRSVTLTALVKNVVRYVVWFIVLTTILGKFGISVTGL
FT                   LAGAGVVGLAIGFGAQTIVKDIITGFFIIFENQFDVGDYVKINMNGTPITEGTVQTIGL
FT                   RSTRIHAYTGELTVLPNSVMSEITNFSISNAKALVEVPIAMDEDVDKVEEKLSDFLATL
FT                   HSNYYIFVSKPEILGIEDLTGNAYILKVAAETTPNNAVPGSRILRKEIANFLNKEGIKS
FT                   PAPVMMQYNGQFGQNDNS"
FT   CDS_pept        18673..18885
FT                   /transl_table=11
FT                   /locus_tag="SCA_0017"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0017"
FT                   /db_xref="InterPro:IPR009296"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIA9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26932.1"
FT                   /translation="MAIQYGLNDIVEMKKAHACGENRFKIIRMGADIRIKCEKCHRSIM
FT                   MPRTEFNKKLKKVLVSNDAKKKENE"
FT   CDS_pept        18885..19982
FT                   /transl_table=11
FT                   /locus_tag="SCA_0018"
FT                   /product="putative GTP-binding protein"
FT                   /function="predicted GTPase probable translation factor"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0018"
FT                   /db_xref="GOA:B9DIB0"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIB0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26933.1"
FT                   /translation="MALTAGIVGLPNVGKSTLFNAITKAGALAANYPFATIDPNVGIVE
FT                   VPDSRLQALSDIVNPKKVIPTTFEFTDIAGIVKGASKGEGLGNKFLSHIREVDAICQVV
FT                   RAFDDDNVTHVSGRVDPLDDIEVINMELVLADLESVDKRLPRLEKMARQKDKDAVNEVR
FT                   ILERIKEALEAGDPVRSLEFNEEDAKYVKQAQLLTSKPMIYIANVGEDEINEADNEKVT
FT                   TIKEYADKEGSEVIVISAKIEEEIATLDEEDKEMFLEDLGITEPGLDRLIRSTYDLLGL
FT                   ATYFTAGVQEVRAWTFRKGMTAPQCAGIIHTDFERGFIRAEVTSFKDYVENNGEHGAKE
FT                   AGKMRLEGKDYIMQDGDVVHFRFNV"
FT   CDS_pept        complement(20051..20761)
FT                   /transl_table=11
FT                   /gene="ribD"
FT                   /locus_tag="SCA_0019"
FT                   /product="putative 5-amino-6-(5-phosphoribosylamino)uracil
FT                   reductase"
FT                   /function="Pyrimidine reductase riboflavin biosynthesis"
FT                   /EC_number="1.1.1.193"
FT                   /note="COG1985: Pyrimidine reductase, riboflavin
FT                   biosynthesis [Desulfitobacterium hafniense]"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0019"
FT                   /db_xref="GOA:B9DIB1"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIB1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26934.1"
FT                   /translation="MTRPKIILHMSESINGNITGPYNKVAGSNLGKAYEYADEKINSNA
FT                   MILGRKTIEENFTSKEMPNLPEDPKSYSRNEDFVANTDLDHYVISIDPSGKAAWEQNYI
FT                   KFRDRPKMHIIEVLSENVSDAYLEHLRNLNISYVFGGPNKNLDLKSVVSKLNQLFNLDK
FT                   LTLSGGGGVNWSFFEQGLVDEISVIIAPVVDDHFNRPNLFDNNDKDQSDVIQKYKIHHV
FT                   EQLDGDIVWLYYKI"
FT   CDS_pept        21143..25450
FT                   /transl_table=11
FT                   /locus_tag="SCA_0020"
FT                   /product="putative surface associated protein with
FT                   similarity to proteases"
FT                   /note="(ref|NP_991886.1| enhancing factor (viral) [Yersinia
FT                   pestis biovar Medievalis str. 91001],InterPro: Peptidase
FT                   M60 viral enhancin protein,YSIRK Gram-positive signal
FT                   peptide,Surface protein from Gram-positive cocci,anchor
FT                   region"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0020"
FT                   /db_xref="GOA:B9DIB2"
FT                   /db_xref="InterPro:IPR004954"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR031161"
FT                   /db_xref="InterPro:IPR041498"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIB2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26935.1"
FT                   /translation="MMKYMTKQQKKNNVFQPQSKNRYRIRKFSVGLASVLFGTFLIYAN
FT                   PANHAEAAETEAASSPQIEKVNQPSTATPENIDQASKNNQPETSENSQLQNQQPKANAT
FT                   DQPLIQNEIQTTPENNVVTREAQPEAPTSETTNTPNQNEIQQPNYHAPSPEAKAKPIES
FT                   IQGIKEQVYSKSVTVYPASTVAKTAGEKRGINQARESLGLIVPQNKKLYIRQAKGSNEA
FT                   DLRVDLMTDDSKQIKNATVSKNGAWNSISTGIDSAAFLRIPVGLNHNPIVEYYVEDDAG
FT                   ITLPTFRKEGDQQAFLDDWKKRDTPYGYVDGDKIAFLIPKIDLPRVEQFGVNPTNLSYK
FT                   NIDDMINYYEDIIKHYDEWVGLNDDINSVHYNVPQKYFTIADKNGFGLAYYSSNLMGSN
FT                   NPSMYGYLVKGWLALHEVGHGYDGIMVNDEDMNLMEVENNILANQYQTTVMGIDNGWLY
FT                   EGHQESTQRDIHNRIINANGTFKFGNIGYRERLDFMTKMVRLTGIDGFTEMWKGIREEE
FT                   AAADKLHNPFIQDVPKWINTYWLADQGVNGTAYFDLYNIDLSQVLKDKLASYNNSFAYP
FT                   LAMLIQDKAELERIKQKLNLATEYELVKSSDLADISIFSNAEITLNLNGQTLPENVKVS
FT                   LLENGKEVAQATVKDGKAVFPHIRAGVYQIAAPLSLENALPRSQYLIVKEAGNNTATLD
FT                   YPTYEGTQSNVTQQLSLRGLSNREFAFVDYDPDKKTIKFVENPGQPHFYFNDEYVHVKI
FT                   EKADGTVVLDESLVGSKNLPYKVQEFNLDYGDKIIVRHREPAARRKVVRKETNQDLVFP
FT                   YASNETVTYTLTDKGFIINDETEADANRRYSTAITSDVDKIADEIKANPNRNYRTQLFH
FT                   VLQGTKFVNGAIKAELEGILQPLVEKYYVIEPIVNHIERGATTITGEGQLESTIIVTFP
FT                   NQISSMVEVDTERKWKVDVPEGLILEHNDVTLIKAIGELGSVSNEVIGKVEDSISPEAP
FT                   HINEIEAGANEIKGTSEPNSTVVITLPGGTIVEVETDNNGNWKLETNDKLSNGSTIEAA
FT                   AKDLAGNVSEKVSIIVKDTIPPAPPTVNPLKSTDTELSGTAEPNSKITIKLNDRIVTVE
FT                   TNAAGQWKYILDEHTQLKGDTVVIVTATDKADNQSLNTEAIVENIITPIPDNAEKTPEA
FT                   VEEPNESDEIEEDTWGLIDGKGNAEAIKNSNLDYEFNDTKTEESTDDCDIEETEKEESD
FT                   KVVAPLPESEDKALEVPTDQTKDEESHESNGATVNRVGTKAGSKNLPVNTNNQQVQVEK
FT                   VEKSYKYKKEVTHTIQPLPREEIVIDEPEIITVTSNPVHTEETVLKEKHPSTKSNIFGS
FT                   KIGEVKEKLNNTSVNSKPFIANEKIKNNQLHISNTIENNYSIYKPKKEDVVQSKLPMTG
FT                   ISNKDDISPLKGLVLISGLVLLGIATNRRKDEY"
FT   CDS_pept        complement(25664..26431)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0021"
FT                   /product="putative oxidoreductase"
FT                   /function="Short-chain dehydrogenases of various substrate
FT                   specificities"
FT                   /note="oxidoreductase, short-chain dehydrogenase/reductase
FT                   family [Bacillus cereus ATCC 10987] gb|AAS39853.1|
FT                   oxidoreductase, short-chain dehydrogenase/reductase family
FT                   [Bacillus cereus ATCC 10987],InterPro: Short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0021"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIB3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26936.1"
FT                   /translation="MKYTLITGASSGIGYETALKFAERENNLILVARNEDNLQALRAKI
FT                   QSQHPKLDVVIKSVDLSEPKKVHQLYEELNDYELQTLINNAGFGDFNQISDQDFDKTEK
FT                   MIRLNVEALTILTSLFVRDYENVEGTQVINLSSVAGYEIFPVSLTYTATKYYVSAYTEG
FT                   LNVLLKNKDAKMRAKVLAPAPTDTKFMQRSLDKDNFEYQGNVENYNTPEEMASYLLELY
FT                   DSDKTIGLVNAETLKLELKDQFYPINNLSGDYD"
FT   CDS_pept        complement(26633..27637)
FT                   /transl_table=11
FT                   /gene="argF"
FT                   /locus_tag="SCA_0022"
FT                   /product="putative ornithine carbamoyltransferase"
FT                   /function="Ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="(Q9K3A1) Ornithine carbamoyltransferase (EC 2.1.3.3)
FT                   (OTCase),InterPro: Ornithine carbamoyltransferase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0022"
FT                   /db_xref="GOA:B9DIB4"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIB4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26937.1"
FT                   /translation="MQNLRNRNFLTLLDFSQKEVEFLLNLSEDLKRAKYAGIEQPTMKG
FT                   KNIALIFEKDSTRTRCAFEVAAYDQGAHVTYLGPTGSQMGKKETAADTARVLGGMYDGI
FT                   EYRGFSQRTVETLAKESGVPVWNGLTDEDHPTQVLADFLTAKETLKKPYHEINFTYVGD
FT                   GRNNVANALMAGAAIMGMRFHLVCPKELNPTDELLSRCRELAEENGGEILVTDDIDKGV
FT                   KGSDVLYTDVWVSMGEPDDVWKERIELLKPYQVNQEMIEKTGNPRVIFEHCLPSFHNTD
FT                   TKIGKEIYDKYGLKEMEVTDEVFEGKHSVVFQEAENRMHTIKAVMVATLGDIG"
FT   CDS_pept        complement(27878..28228)
FT                   /transl_table=11
FT                   /gene="pemK"
FT                   /locus_tag="SCA_0023"
FT                   /product="putative cell growth inhibitor, pemK-like
FT                   protein"
FT                   /function="Growth inhibitor"
FT                   /note="(P13976) Protein pemK,gi|24195434|gb|AAN48980.1|
FT                   probable ppGpp-regulated growth inhibitor ChpA/MazF
FT                   [Leptospira interrogans serovar lai str. 56601],InterPro:
FT                   PemK-like protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0023"
FT                   /db_xref="GOA:B9DIB5"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIB5"
FT                   /inference="similar to AA sequence:UniProtKB:P13976"
FT                   /protein_id="CAL26938.1"
FT                   /translation="MVEQYKIIDVNLDPILGREKGKYRPCVVLSRTSFNDKTSLVWVSP
FT                   ITSRPVKYPTDVALKTMEHHIKGTIDVGQIRTLDLSTRHYRVVDSVSHEVMHKIDDIIT
FT                   NILKIESPQRHL"
FT   CDS_pept        complement(28222..28479)
FT                   /transl_table=11
FT                   /gene="pemI"
FT                   /locus_tag="SCA_0024"
FT                   /product="hypothetical protein with similarity to PemI-like
FT                   protein suppressor of ChpA"
FT                   /note="gi|16130690|ref|NP_417263.1| suppressor of
FT                   inhibitory function of ChpA, PemI-like,autoregulated; part
FT                   of proteic killer gene system,suppressor of inhibitory
FT                   function of ChpA [Escherichia coli
FT                   K12],pfam04014,SpoVT_AbrB, SpoVT / AbrB like domain. One
FT                   member of this family is AbrB from Bacillus subtilis. The
FT                   product of the abrB gene is an ambiactive repressor and
FT                   activator or the transcription of genes expressed during
FT                   the transition state between vegetative growth and the
FT                   onset of stationary phase and sporulation. AbrB is thought
FT                   to interact directly with the transcription initiation
FT                   regions of genes under its control. AbrB contains a
FT                   helix-turn-helix structure, but this domain ends before the
FT                   helix-turn-helix begins. The product of the Bacillus
FT                   subtilis gene spoVT is another member of this family and is
FT                   also a transcriptional regulator. DNA binding activity in
FT                   the Bacillus 0 AbrB homologue requires hexamerisation.
FT                   Another family member has been isolated from the archaeon
FT                   Sulfolobus solfataricus and has been identified as a
FT                   homologue of bacterial repressor-like proteins. The E.coli
FT                   family member SohA or Prl1F appears to be bifunctional and
FT                   is able to regulate its own expression as well as relieve
FT                   the export block imposed by high-level synthesis of
FT                   beta-galactosidase hybrid proteins.,only 75% aligned"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0024"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIB6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26939.1"
FT                   /translation="MTENRAYIFKSGQDHAVTLSESVIKSLNLKPGDVLVQEIVDGQII
FT                   LKKENHQSFSEEWNQFFEQGGNYDDYETHQWGEASEREKW"
FT   CDS_pept        28637..29671
FT                   /transl_table=11
FT                   /gene="nuc"
FT                   /locus_tag="SCA_0025"
FT                   /product="thermonuclease precursor"
FT                   /function="Micrococcal nuclease (thermonuclease) homologs"
FT                   /EC_number="3.1.31.1"
FT                   /note="(P00644) Thermonuclease precursor (EC 3.1.31.1)
FT                   (TNase) (Micrococcal nuclease) (Staphylococcal
FT                   nuclease),InterPro: Staphylococcus nuclease (SNase-like)"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0025"
FT                   /db_xref="GOA:B9DIB7"
FT                   /db_xref="InterPro:IPR002071"
FT                   /db_xref="InterPro:IPR008613"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIB7"
FT                   /inference="similar to AA sequence:UniProtKB:P00644"
FT                   /protein_id="CAL26940.1"
FT                   /translation="MQFLGGICFIVFFIFLIRLIYLAIKGKPKKSAAITLVASLFLGIL
FT                   LTGLGGEDDESSKHEQKTAHQTKEKAKKAPEKDSDAENNKEKEFKAAPTKKSETEDTSN
FT                   KKDKEKPETKSETEKEANGLVKEEATYARAVDGDTVRLMYDGKEAVFRLLLIDTPETKH
FT                   PTKGVQPYGKEASAYTKNMLENASKIEVEFDKGGKTDKYGRYLAYVYADGKMVNDALVR
FT                   QGLAKVAYIYPPNITYLDQLKESQRLAQEEHLNIWSGEVPADTETQSSTPKETQTPQQT
FT                   QGQSEGSVPSSGGTSQSTSGTASESYPNCTALRQVHPGGVPQGHPAYQAKMDRDKDGYA
FT                   CEIN"
FT   CDS_pept        29812..30108
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="SCA_0026"
FT                   /product="30S ribosomal protein S6"
FT                   /function="Ribosomal protein S6"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0026"
FT                   /db_xref="GOA:B9DIB8"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DIB8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26941.1"
FT                   /translation="MRTYEIMYVVRPNIEDEARKALVERFNGILTNDGAEIIEEKDWGK
FT                   RRLAYEIEDFKEGYYYIVRINTENSEATDEFQRLAKINDDIIRYIVIREDEDK"
FT   CDS_pept        30130..30651
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="SCA_0027"
FT                   /product="putative single-strand DNA-binding protein"
FT                   /function="Single-stranded DNA-binding protein"
FT                   /note="(Q814G6) Single-strand binding protein (SSB)
FT                   (Helix-destabilizing protein),InterPro: Single-strand
FT                   binding protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0027"
FT                   /db_xref="GOA:B9DIB9"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIB9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26942.1"
FT                   /translation="MLNRVVLVGRLTRDPEYRTTPSGVSVATFTLAVNRTFTNAQGERE
FT                   ADFINCVVFRKQAENVNNYLFKGSLAGVDGRLQSRSYENQEGRRIFVTEVVCDSVQFLE
FT                   PKSQNQRHGGQQSGGGNQFQDYGQSYGGQQQGQNTSSYQNQNSSKSGQSDNPFANANGP
FT                   IDISDDDLPF"
FT   CDS_pept        30708..30950
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="SCA_0028"
FT                   /product="30S ribosomal protein S18"
FT                   /function="Ribosomal protein S18"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0028"
FT                   /db_xref="GOA:B9DIC0"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DIC0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26943.1"
FT                   /translation="MAGGPRRGGRRRKKVCYFTANGITHIDYKDTDLLKRFISERGKIL
FT                   PRRVTGTSAKYQRMLTTAIKRARHMALLPYVKEEN"
FT   CDS_pept        31246..31464
FT                   /transl_table=11
FT                   /locus_tag="SCA_0029"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0029"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIC1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26944.1"
FT                   /translation="MNDERRYELLKMFLRPTEDDGETTSQKQLEELKDDIITLSHEGYV
FT                   DIDYIDGEIDSWKVTDEGKKFVNEHGK"
FT   CDS_pept        31751..32074
FT                   /transl_table=11
FT                   /locus_tag="SCA_0030"
FT                   /product="conserved hypothetical protein with monooxygenase
FT                   domain"
FT                   /function="uncharacterized enzyme involved in biosynthesis
FT                   of extracellular polysaccharides"
FT                   /note="conserved hypothetical protein [Staphylococcus
FT                   aureus subsp. aureus N315] ref|NP_644955.1|,InterPro:
FT                   Antibiotic biosynthesis monooxygenase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0030"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIC2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26945.1"
FT                   /translation="MFMAENKLKLDKGTAEGIVERFYKRQGIETIDGFKEMFVTKTNDV
FT                   DDYDEVKILTIWDAESCFKNWLKSDVFKNAHKNVRHQSQDEKSPIQNNEVFTYSIGYHY
FT                   VNQ"
FT   CDS_pept        32535..33128
FT                   /transl_table=11
FT                   /locus_tag="SCA_0031"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0031"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIC3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26946.1"
FT                   /translation="MSKEDIKKNDQNYYDHLDQSEHDESHFDLHKAKDLLQEYKDNRDK
FT                   WNKEERAKELELIEEEIKKQKELVKDRVKPDNIPEKERLSNISEKVTDQVFGIFEHTDS
FT                   FDEAKKFLESYYQRGKVDMTYGRAFILVCEDSLLSKAKDEYGNNEENEKLIDFISEKNI
FT                   ELSKEVMSDDYVHLLEVEREFLLILMKNNKLDLL"
FT   CDS_pept        33360..33953
FT                   /transl_table=11
FT                   /gene="gpm3"
FT                   /locus_tag="SCA_0032"
FT                   /product="putative phosphoglycerate mutase"
FT                   /function="Fructose-26-bisphosphatase"
FT                   /EC_number="5.4.2.1"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0032"
FT                   /db_xref="GOA:B9DIC4"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIC4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26947.1"
FT                   /translation="MEIYLIRHGESTANYDNKHGQDYFCGQLNVALTETGIKSAKKLKE
FT                   YFSDIPIDHIYVSDLKRTVQTYENGFDNTIPVTITALLRERSLGKFEGHSQKELIQNPE
FT                   YRPYFENPLMSDFRHSFTQRAPGGDNYNDVLARVDQFFKEIFDKKDSVVVIVAHIIWIR
FT                   CCLYYSGVITEEELFNKKIANTTPILVNTEHDIY"
FT   CDS_pept        complement(34001..35167)
FT                   /transl_table=11
FT                   /gene="dapE"
FT                   /locus_tag="SCA_0033"
FT                   /product="putative succinyl-diaminopimelate desuccinylase"
FT                   /function="Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylases"
FT                   /EC_number="3.5.1.18"
FT                   /note="(Q8CQC2) Probable succinyl-diaminopimelate
FT                   desuccinylase (EC 3.5.1.18) (SDAP),InterPro: Peptidase
FT                   M20/M25/M40"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0033"
FT                   /db_xref="GOA:B9DIC5"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIC5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26948.1"
FT                   /translation="MGKLSSEEKVEILADLVGIESVNDNELDVANYLHDLFQKHHIDSK
FT                   IIKLTDTRANLVAEIGSGSPVLAVSGHMDVVSPGDSSKWQTPPFKLTEDSEGHLHGRGA
FT                   SDMKSGLAAFVISMIELHEQGLPKHGTVRLLATAGEEIEGHGAKAFYKDGYMNDVDALV
FT                   IAEPSKDKIIYAHKGSMDIRVTSNGKSVHSSMPSLGYNAINPLVDFVNRINQAYNSITE
FT                   SNDLLGDSVVSATIINGGSQVNSIPDYAEAEFNVRTIPEADNDSYQKLFEQIAKNVKVD
FT                   APDSYLNIDTYMSRPPVFTKGDNRLVDIAQSLSKKYLGKEVPKKASPGVTDASDLVVDK
FT                   GEDFPFIMFGPGETSQAHVIDEYVDKKDYLNFIDLFEDLLVEYLDENE"
FT   CDS_pept        35442..35882
FT                   /transl_table=11
FT                   /gene="ydfG"
FT                   /locus_tag="SCA_0034"
FT                   /product="conserved hypothetical protein"
FT                   /function="uncharacterized conserved protein"
FT                   /note="ydfG; similar to hypothetical proteins,InterPro:
FT                   Carboxymuconolactone decarboxylase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0034"
FT                   /db_xref="GOA:B9DIC6"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIC6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26949.1"
FT                   /translation="MDNRIAYNEVAPEEIELMYQMEKQLKKANVDRRLRELIKIRASQI
FT                   NGCAYCLAMHTSDARKLGVSEEEIFLLNAWEDTNIYSKKDKLALELTEAITLIASAGVP
FT                   DALYESVREEFSEEEYTGLVLTINQINMWNRLSISMGNQHNV"
FT   CDS_pept        complement(35935..36558)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0035"
FT                   /product="putative lipoprotein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0035"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIC7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26950.1"
FT                   /translation="MKLKQFISVALVLVLTVVLSACGQNQDEQQSHNGKYAPKNATPLS
FT                   KIQIFKSDEKNKKLTEKEMDAHLKAYLKANNDIIDNKYVLQHRLDDQYDGNQKVSKKLD
FT                   SDLRDLANIATKNQMNFDSFIKDNEVPAKEKEDITRISKYFKAVNHKAAQADQQLEALS
FT                   YSPNNTVNVVDVPTNYAGDVNHKQQKKIKAFLKTHHLDTKPIDK"
FT   CDS_pept        complement(36632..37261)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0036"
FT                   /product="putative phosphatase with similarity to PAP2
FT                   family protein"
FT                   /function="Membrane-associated phospholipid phosphatase"
FT                   /note="b|AAN00897.1| PAP2 family protein [Streptococcus
FT                   agalactiae 2603V/R],InterPro: PA-phosphatase related
FT                   phosphoesterase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0036"
FT                   /db_xref="GOA:B9DIC8"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIC8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26951.1"
FT                   /translation="MSAIHRKYIASTLIILIALMVLVKSNLILFIDEPVYRLVRLLRNI
FT                   PFANTFLSYYSDIFSPWHMVGVMVVILTILLFKNRRLAYITSIWATSTLLLGIGLKYFI
FT                   HRPRPVDYISGYSFPSLHTLTIAVAGVVFLMLFRRFYWHILVYLMVFIMMISRIYLHAH
FT                   YFSDTIASIVFEVLCLQVAHHYLAKYQLDIPFTTYLSHPRQKRLDI"
FT   CDS_pept        37565..37684
FT                   /transl_table=11
FT                   /locus_tag="SCA_0037"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0037"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIC9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26952.1"
FT                   /translation="MNVIPADILIGAMAAKSNKKITRICRGFGNLSDMNNGNK"
FT   CDS_pept        complement(37836..39359)
FT                   /transl_table=11
FT                   /gene="ahpF"
FT                   /locus_tag="SCA_0038"
FT                   /product="alkyl hydroperoxide reductase subunit F"
FT                   /function="Alkyl hydroperoxide reductase large subunit"
FT                   /note="(Q99WJ7) Alkyl hydroperoxide reductase subunit F (EC
FT                   1.6.4.-),InterPro: FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0038"
FT                   /db_xref="GOA:B9DID0"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR012081"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B9DID0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26953.1"
FT                   /translation="MLKKELKSQLSQLLKLMEGDVVLTASYDDSEKSKELKDLLDEIAD
FT                   MSSHITVKEDTLERTPSFSVDRPDERTGVVFAGVPLGHEFNSLVLALLQVSGRPPKEEQ
FT                   SVIDQIKALDKPLHFETFISLSCHKCPDVVQALNLMSVLNPNISHTMIDGAVFKEESKD
FT                   IMAVPAVFLNGEEFGNGRMSISDILNMLGSKADPAEYDNKEPFDVLVIGGGPASGTAAI
FT                   YTARKGLRTGIVADRIGGQVNETADIENFITVKETTGPEFSSALEQHINEYDIDVMDGM
FT                   RATNIEKTEDGIVVTLDNDAKLKSKTVIISTGARFKNLDIPGEDELRNKGVAYCPHCDG
FT                   PLFEGKDVAVVGGGNSGAEAAIDLAGIVKHVTLVEYKDFLRADEILQERLQELPNVTIL
FT                   KNAQSSEIVGDDHVTGLKYTDNKTGEKHQIDVEGVFVQIGLLPNTEWLEGAIDTNDGGE
FT                   IIVDRKQSTSMPGVFAAGDVTDDRFKQIIIAMGSGADAALNAFDYIIRN"
FT   CDS_pept        complement(39376..39945)
FT                   /transl_table=11
FT                   /gene="ahpC"
FT                   /locus_tag="SCA_0039"
FT                   /product="alkyl hydroperoxide reductase subunit C"
FT                   /function="Peroxiredoxin"
FT                   /note="(Q8CMQ2) Alkyl hydroperoxide reductase subunit C (EC
FT                   1.6.4.-),InterPro: Alkyl hydroperoxide reductase/ Thiol
FT                   specific antioxidant/ Mal allergen"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0039"
FT                   /db_xref="GOA:B9DLM8"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLM8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26954.1"
FT                   /translation="MSLINKEILPFTADAYNPKEDEFIEVSDETLRGAWNVIVFYPADF
FT                   SFVCPTELEDVQNQYDELQKLGVNVYSVSTDTHFVHKAWHDHSDAISKLQYTMIGDPSQ
FT                   TITRNFDVLDEEKGLAQRGTFIVDPDGVVQAAEINADGIGRDASTLVHKIKAAQYVRQH
FT                   PGEVCPAKWEEGGETLEPGLDLVGKI"
FT   CDS_pept        complement(40351..41130)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0040"
FT                   /product="putative 2-keto-4-pentenoate hydratase"
FT                   /function="2-keto-4-pentenoate hydratase"
FT                   /EC_number="4.2.1.-"
FT                   /note="(P42270) 2-oxo-hepta-3-ene-17-dioic acid hydratase
FT                   (EC 4.2.-.-) (OHED hydratase),InterPro:
FT                   Hydratase/decarboxylase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0040"
FT                   /db_xref="GOA:B9DLM9"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLM9"
FT                   /inference="similar to AA sequence:UniProtKB:P42270"
FT                   /protein_id="CAL26955.1"
FT                   /translation="MTQYKKEIINTLFKAQQNHEPVEFISKTYEVEEPVAYHIQDELIS
FT                   ELKKANNSEVAGYKVSMTSDETQAYADTDEPAYGTILSDKVVESGDTVSFSQLFAPLIE
FT                   PELVFILTEDLTVDASDEEILKSIKVAPGIEIPDARYIDWFPNFTLGDLISDNTASGLV
FT                   AVGEAADPVSYKDFEKITLKLSHNDEEIATGVSSDVLDNPIESLKWLIRKLDTQGKQLH
FT                   KGEIVSSGTFVPPVPAKEGTYKAEYSYPGAIQVTFKP"
FT   CDS_pept        41290..42045
FT                   /transl_table=11
FT                   /locus_tag="SCA_0041"
FT                   /product="nitroreductase family protein"
FT                   /function="Nitroreductase"
FT                   /note="(P39605) Nitro/flavin reductase (EC
FT                   1.-.-.-),InterPro: Nitroreductase family"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0041"
FT                   /db_xref="GOA:B9DLN0"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR016446"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLN0"
FT                   /inference="similar to AA sequence:UniProtKB:P39605"
FT                   /protein_id="CAL26956.1"
FT                   /translation="MSDVVEQLMNRHHSVRKFKQEPLSKETVKQLVQAGQSASTSSYLQ
FT                   TYSVIGITDPEIKKALREVSGQAYVEENGYLFIFVMDYHRHELINEQIDGDMEKSFQSA
FT                   EGLLVGTIDVALLAQNVAVAAESLGLGIVYLGSMRNDVARVKELLKLPEYTFPLFGMAV
FT                   GVPADDENGAPKPRLPFESVFHENEYNQDKAEELAYLKEFDDEVSEYYKKRTGGKRSET
FT                   WSQQIAGFLSSKQRADMLDELHKSGFIER"
FT   CDS_pept        complement(42155..43480)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0042"
FT                   /product="putative sodium:dicarboxylate symporter"
FT                   /function="predicted Na+/dicarboxylate symporter"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0042"
FT                   /db_xref="GOA:B9DLN1"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLN1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26957.1"
FT                   /translation="MAKKHVAFSKRVFAALGIGIVSGTILHLAYGSDSKIITTTTDWFS
FT                   IVGDGYVALLQMIVMPLIFISIVAAFTKIQLGEKFAKIGFFIFVFLIGTVAVAAIIGII
FT                   SALVFGLDASSIDLGSAEHARGTEISQKAKEMTASTLPQQILELLPSNPFLDFTGQRTT
FT                   STIAVVIFATFIGFAYLRVARKQPDNGHIIKRAIEAVYAVIMSVVTFVLRLTPYGILAI
FT                   MASTIATSDFGAIWTLGKFVLASYAALITMFIIHLIIVGLLGLNPWRYLRKTAEVLIFA
FT                   FTSRSSAGALPLNVQTQKSRLGVPEGIANLSASFGLSIGQNGCAGIYPAMLAVMVAPVA
FT                   HVQVDFQFIITLVAVVVICSFGVAGVGGGATFAAILVLSTLNLPVALAGVLISVEPLID
FT                   MGRTALNVNDSMLAGTGTAKLTNNLDKEKFNSNQYGDLSTDY"
FT   CDS_pept        complement(43845..44816)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0043"
FT                   /product="putative DNA-binding protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0043"
FT                   /db_xref="GOA:B9DLN2"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLN2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26958.1"
FT                   /translation="MLTKEFAQRVDLSEKQVRKIVQHLEERGYHLNKTEYRGREATDFQ
FT                   EEDIELFKEIADKVKKTNSYELAFEELEKENDFLQIVVKEDNEKLPSDQNFAKILNDLH
FT                   NDISKMREERQMLGQMISQVHQQQKDLQTLQQQMTDKLDQHAETLKAIETAQQEHAKAV
FT                   ADNTKAVESNTAKVLAQPQESKKEEQKAPSATVEKTEPAKTVNSDDKQNSTADFKGAAV
FT                   SAQPEKKEENKSATAQSEAKPEASATASSNKEESSSTENKTSSDKPEQKEQKSVPAAEM
FT                   QETPETTTPEPEIPVDAPRNEHQPTAQHKQEKKGFFARLFGM"
FT   CDS_pept        complement(44934..45245)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0044"
FT                   /product="conserved hypothetical protein (fragment)"
FT                   /note="similar to C-terminal part (aa 119..220) of
FT                   gi|73663636|ref|YP_302417.1| Gene info hypothetical protein
FT                   SSP2327 [Staphylococcus saprophyticus subsp. saprophyticus
FT                   ATCC 15305] Length=221"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0044"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLZ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26959.1"
FT                   /translation="MMEALPLPESTEEKDADLLFKRHRFLNDHGFEEQTEIDYKRPGLD
FT                   KEMPPIPLNLFLHARIPLTKDIYATSVKSCYILKYVFANHLSRKRVYPLLEEMDLRKS"
FT   CDS_pept        complement(45327..45599)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0045"
FT                   /product="conserved hypothetical protein (fragment)"
FT                   /note="similar to N-terminal part (aa 1..90) of
FT                   gi|73663636|ref|YP_302417.1| Gene info hypothetical protein
FT                   SSP2327 [Staphylococcus saprophyticus subsp. saprophyticus
FT                   ATCC 15305] Length=221"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0045"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLZ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26960.1"
FT                   /translation="MEFKLIKKTSDPLYEAALNLYDNYQFGNVMQQHHVFKQSLENKRT
FT                   KNDYVFLVGLDNDKVVSLATAHYEATTNAAFIIYLVAVDTPEREQ"
FT   CDS_pept        complement(45707..46087)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0046"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0046"
FT                   /db_xref="InterPro:IPR025889"
FT                   /db_xref="UniProtKB/TrEMBL:B9DM00"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26961.1"
FT                   /translation="MADILILTSQDEIFDALKRKLDEGYTKDELSVISKNKLHIDSVES
FT                   TDMKVQSTSGTFSDRVARLLTGEDGEEAVLAHYDLTETERKVCKREILNGNIIILAGKH
FT                   PHSRKEFKKEFDEKKPEKEYEI"
FT   CDS_pept        46819..47397
FT                   /transl_table=11
FT                   /gene="xprT"
FT                   /locus_tag="SCA_0047"
FT                   /product="putative xanthine phosphoribosyltransferase"
FT                   /function="Adenine/guanine phosphoribosyltransferases and
FT                   related PRPP-binding proteins"
FT                   /EC_number="2.4.2.-"
FT                   /note="(P42085) Xanthine phosphoribosyltransferase (EC
FT                   2.4.2.-),InterPro: Phosphoribosyltransferase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0047"
FT                   /db_xref="GOA:B9DM01"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010079"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DM01"
FT                   /inference="similar to AA sequence:UniProtKB:P42085"
FT                   /protein_id="CAL26962.1"
FT                   /translation="MEALRQKVKEDGVVIGEKILKVDGFLNHQIDAQLMYDIGETFYEQ
FT                   FKDQKVTKILTVEASGIAPAIMVAYKFGVPCLFAKKAKPNTLNKGFYQTDIHSFTKDKT
FT                   NSVIISEEFLDEHDRVLIIDDFLANGDASLGLNRLVHQAGAETVGVGIVVEKSFQQGRT
FT                   RLEEAGLKVSSLCEVASLSGNKVTLVGEE"
FT   CDS_pept        47399..48667
FT                   /transl_table=11
FT                   /gene="pbuX"
FT                   /locus_tag="SCA_0048"
FT                   /product="putative xanthine permease"
FT                   /function="Xanthine/uracil permeases"
FT                   /note="(P42086) Xanthine permease ,InterPro:
FT                   Xanthine/uracil permease family"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0048"
FT                   /db_xref="GOA:B9DM02"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:B9DM02"
FT                   /inference="similar to AA sequence:UniProtKB:P42086"
FT                   /protein_id="CAL26963.1"
FT                   /translation="MKNFILSLQHLLAMYAGAILVPIIVGTSLKFTPEEIAYLVTVDIF
FT                   MCGVATFLEANKITGTGLPIVLGCTFTAVAPMILIGQTKGLDVLYGSLFISGILVVLIA
FT                   PVFSYVVKFFPPVVTGSVVTIIGINLMPVAMNYVAGGQGSKDYGDMKNIILGFATLLII
FT                   LILQRFTRGFLKSIAILIGLIAGTALAGAFGIVDLNQVGTAHWFELPRPFRFAGFGFDL
FT                   DATLVFFIVALVSLIESTGVYTALSKITGRTLERKDYRKGYTAEGLAIILGSIFNAFPY
FT                   TAYSQNVGLVSLSGVKKNNVIYGMVILLLICGCIPKLGALANVIPLPVLGGAMIAMFGM
FT                   VMAYGVSILGGIDFKNQNNLLIIAVSVGLGTGISAVPEAFKAMGEQFAWLTQNGIVLGA
FT                   ISAIILNFFFNGLKYQQNEENVK"
FT   CDS_pept        48701..50167
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="SCA_0049"
FT                   /product="putative inositol-monophosphate dehydrogenase"
FT                   /function="IMP dehydrogenase/GMP reductase"
FT                   /EC_number="1.1.1.205"
FT                   /note="(Q8CMQ7) Inosine-5-monophosphate dehydrogenase (EC
FT                   1.1.1.205) (IMP dehydrogenase) (IMPDH) (IMPD),InterPro: IMP
FT                   dehydrogenase/GMP reductase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0049"
FT                   /db_xref="GOA:B9DM03"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:B9DM03"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26964.1"
FT                   /translation="MWENKFAKESLTFDDVLLIPAESNVLPKEVDLSVELSDRIKLNIP
FT                   VVSAGMDTVTESKMAIAMARQGGLGVVHKNMNIEDQADEVQKVKRSENGVISNPFFLTP
FT                   DEKVYEAEALMGKYRISGVPIVDNKEDRNLVGILTNRDLRFIEDFSIKISDVMTKEDLI
FT                   TAPVGTTLDEAEAILQKHKIEKLPLTENGKLKGLITIKDIEKVHEYPFAAKDSLGRLLC
FT                   AAAIGISKDTDIRAEKLVEAGVDALVIDTAHGHSQGVIDQVKHIKATYPEVTVIAGNVA
FT                   TGEATKALFEAGADVVKVGIGPGSICTTRIVAGVGVPQITAVYDCATEARKQGKAIIAD
FT                   GGIKFSGDIVKALAAGGHAVMLGSLLAGTEESPGETEIFQGRQYKTYRGMGSLGAMESG
FT                   SNDRYFQEDKVPKKYVPEGIEGRIAYKGLLQDNIYQLMGGVRSGMGYTGSHNLKELREE
FT                   AMFTRMGSAGLAESHPHNIQITKESPNYSR"
FT   CDS_pept        50184..51725
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="SCA_0050"
FT                   /product="putative GMP synthase"
FT                   /function="GMP synthase PP-ATPase domain/subunit"
FT                   /EC_number="6.3.5.2"
FT                   /note="(Q99WI8) GMP synthase [glutamine-hydrolyzing] (EC
FT                   6.3.5.2) (Glutamine amidotransferase) (GMP
FT                   synthetase),InterPro: GMP synthase, N-terminal,InterPro:
FT                   GMP synthase, C-terminal"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0050"
FT                   /db_xref="GOA:B9DLM7"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DLM7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26965.1"
FT                   /translation="MEMAKEQEMILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEE
FT                   IKKMNPKGIILSGGPNSVYEEGSYTIDPEIYNLGVPVLGICYGMQLTTKLLGGKVERAN
FT                   EREYGKAIIHAKADELFFGLPEEQTVWMSHSDKVIEIPEGFESIADSPSTPYAAIEDKE
FT                   RRIYGVQFHPEVRHTEYGNDILRNFVRRICDCTGEWTMENFIDLEIEKIREQVGDRKVL
FT                   CAMSGGVDSSVVAVLLHKAIGDQLTCIFVDHGLLRKGEGDMVMEQFGEGFNMNIIRVNA
FT                   KDRFMDKLKGVSDPEQKRKIIGNEFVYVFDDEASKLEGVDFLAQGTLYTDVIESGTKTA
FT                   QTIKSHHNVGGLPEDMQFELIEPINTLFKDEVRALGIELGIPEHLVWRQPFPGPGLGIR
FT                   VLGEITEEKLEIVRESDAILREVIREEGLEREIWQYFTVLPGMRSVGVMGDYRTYDYTI
FT                   GIRAVTSIDGMTSDFARIDWEVLQKISSRIVNEVDHVNRVVYDVTSKPPSTIEWE"
FT   CDS_pept        51990..52766
FT                   /transl_table=11
FT                   /locus_tag="SCA_0051"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase superfamily protein"
FT                   /function="predicted ring-cleavage extradiol dioxygenase"
FT                   /note="(P54721) Hypothetical protein yfiE,PSI BLAST COG:
FT                   Predicted ring-cleavage extradiol dioxygenase,COG0346,GloA,
FT                   Lactoylglutathione lyase and related lyases [Amino acid
FT                   transport and metabolism],InterPro: Glyoxalase/Bleomycin
FT                   resistance protein/dioxygenase domain"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0051"
FT                   /db_xref="GOA:B9DLL6"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLL6"
FT                   /inference="similar to AA sequence:UniProtKB:P54721"
FT                   /protein_id="CAL26966.1"
FT                   /translation="MNFHQSSIKHVNRIELNVADIDRQTDFYHNILGLQVLKTAPTQTT
FT                   LIIGEEDEIVLNKIENGRFAQMTEAGLFHIAILLDDVTDLGALIKHLFQHNIAISGGDH
FT                   LVSEAIYFSDPEGNGIEVYIDRPADLWHWENEHVNMDTLPLDVSRILADSGNTEWTDMP
FT                   KNAKIGHLHLKAYDLKASSQFYKQMGFQITSVLPKALFLSEQKYHHHIAINTWQSNQPL
FT                   RNPEQTYGLTAFNIIDENKKSEVYTTLEGLKLTINE"
FT   CDS_pept        52903..53454
FT                   /transl_table=11
FT                   /locus_tag="SCA_0052"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0052"
FT                   /db_xref="InterPro:IPR025568"
FT                   /db_xref="InterPro:IPR025951"
FT                   /db_xref="InterPro:IPR036404"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLL7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26967.1"
FT                   /translation="MENQKLLHDLLNKKYTQPRIFEIFDSLATVDINDLWGFWKGSEIK
FT                   TGHPMEGILSVTGWYGKRFVNSEQIDPLVFRTEKGKLFYVNPGLIPLELPIEKLPKKIL
FT                   SMTMKWFGFVVKTNKSRARVRRVKFRGKTSASMIYDQKAIIDVFRKINDDTLLGVMDIK
FT                   DKHPEKYYFFVLQRVTEQSK"
FT   CDS_pept        complement(53494..53898)
FT                   /transl_table=11
FT                   /gene="mutT"
FT                   /locus_tag="SCA_0053"
FT                   /product="mutT/nudix family protein"
FT                   /function="ADP-ribose pyrophosphatase"
FT                   /EC_number="3.6.1.-"
FT                   /note="(P32091) MutT-like protein (ORF154),InterPro: NUDIX
FT                   hydrolase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0053"
FT                   /db_xref="GOA:B9DLL8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLL8"
FT                   /inference="similar to AA sequence:UniProtKB:P32091"
FT                   /protein_id="CAL26968.1"
FT                   /translation="MPPKHIISASCVVLNDENQILLIKSPLRGWEIPGGQIENGETIRE
FT                   GVIREVKEESGVDVELTEFCGVFQNTEHSIINNLFKGEYIGGQLTTSDESLEVGFFTYA
FT                   EAMEKVTWGNFTERIRLCFSEKEKPFLISF"
FT   CDS_pept        54059..54574
FT                   /transl_table=11
FT                   /locus_tag="SCA_0054"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0054"
FT                   /db_xref="InterPro:IPR021612"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLL9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26969.1"
FT                   /translation="MNFKQFLLSGLAVALLGSAGASVFSNQAEAASYGAYEFRNYDITA
FT                   KENLKNLLDASSYYKAMAKESGATLYQNKLNQAIYFAKKQQDASNDSQVVTAINRLSTV
FT                   YNEVFQIHLQTEKGSSNVQSKKTELQNLIIKANGLLTESHHSMNQDEAQLKKSRTSTSC
FT                   IEPSATRL"
FT   CDS_pept        54861..56759
FT                   /transl_table=11
FT                   /locus_tag="SCA_0056"
FT                   /product="putative glycosyl transferase"
FT                   /function="Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /note="(O34319) Putative glycosyl transferase ykcC (EC
FT                   2.-.-.-),InterPro: Glycosyl transferase family 2"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0056"
FT                   /db_xref="GOA:B9DLM0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLM0"
FT                   /inference="similar to AA sequence:UniProtKB:O34319"
FT                   /protein_id="CAL26970.1"
FT                   /translation="MTKDLATIVPVYNKELFLDDTMNSINNLDIDKSEIEVIFVDDVST
FT                   DQSLEKLKAYENEYDYVKVVELEENTGSPSTPRNVGIDVLDSKYITFLDADDWLDAEGF
FT                   PKLLQQALDTQNDILFGQSLRHKDRSIRKIARFSSYETASDLVPYEIDKIFRAVGPPGK
FT                   IIKASIIKENDIKFEHMKYGVDKLFFTEVIGKAHSAGMNDAVVYHVNRYGANQSLIGET
FT                   DIFEKTACNLEVLKKLFELDIPETARRNAISRIIEMDYLSRLFINKRFLKSEDKQLFYD
FT                   AFAEMETVLDRHHLNIKDYLTEDKYEKVYQLLSQSNKERVVKLIKILIKGERAPRYVSN
FT                   GLVHFLLPEELREVAPLTEDFFAVYGGTEEADGQFYEVIHLYKKMAAQISRVQLVKLKD
FT                   EAAAIDVGYQVRGGKLRIPTKELEDADFNFNIQITYNHYRPCIVNMNLPSVSKQPALKR
FT                   QHFKVEFKDKRFKDEKNQTKFVDTTKYYDENPGMVFSAQRFKVYEDVEFQKEAAREIEV
FT                   GELFTVEDIQYTEKGTPRLVLKDGSFVTANKKFVTTIDDRLTEQYLVKVPRSVKVLKKC
FT                   KAYNDRNFKDEAGSNFEEGDIVNIVKIVFSSNGTPRLKTDKGVYMTANRDFVKSIT"
FT   CDS_pept        complement(56876..58462)
FT                   /transl_table=11
FT                   /gene="vba"
FT                   /locus_tag="SCA_0057"
FT                   /product="ABC transporter ATP-binding protein (antibiotic
FT                   resistance)"
FT                   /function="ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /note="(P39115) Nucleotide binding protein
FT                   expZ,btk:BT9727_4858 (KEGG) vba; probable MDR-type ABC
FT                   transporter, ATP-binding protein,InterPro: AAA ATPase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0057"
FT                   /db_xref="GOA:B9DLM1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLM1"
FT                   /inference="similar to AA sequence:UniProtKB:P39115"
FT                   /protein_id="CAL26971.1"
FT                   /translation="MGRIEVDQIEYNIGPRQLFKIPHLSIQPHVRIGIVGKNGSGKSTL
FT                   LKILSGILEPDFGHVNREGIIAHIPQFSQWTSHLSGGEMMRKYISEALEKKAEFLFADE
FT                   PTTHLDVEGIKLLESEIKNFAGACLIISHDRTFLKQTCQTIWEISDQTVSVFNGGYDAY
FT                   VQQKEDREKQAWEDYHQYEQKKKQLEQAIKNKQQRAQGATKVPKGIGAHEAANFKHHYQ
FT                   GKQKKLDQNAKTMQKRLDQLEVKHRPKSAESIQLSLPFADKLKNKPVIHADYFSKSIKD
FT                   EVLWKDAYFYINGGDKIGLVGANGSGKSTLLKAIVEGEKNLNLSSSLRIGYLSQKLNEL
FT                   DEEKDILDFIKDHSEHEETLIRTVLARMHFRGDAVYKKIAVLSGGEKVKVALCQLILSP
FT                   FNLLILDEPTNSLDIESIEALEQLLKDYTGTNIIVSHDHEFLANVTNKILYLANHQLKL
FT                   FNEDYAHFVKTLEQPESTKDKTQLRNQLMLVENRISDILSRLSIAPSEELDAQFQAYLK
FT                   EKRAILKELEE"
FT   CDS_pept        58773..59498
FT                   /transl_table=11
FT                   /gene="cysH"
FT                   /locus_tag="SCA_0058"
FT                   /product="putative phosphoadenosine phosphosulfate
FT                   reductase"
FT                   /function="3-phosphoadenosine 5-phosphosulfate
FT                   sulfotransferase (PAPS reductase)/FAD synthetase and
FT                   related enzymes"
FT                   /EC_number="1.8.4.8"
FT                   /note="(Q8CMX3) Phosphoadenosine phosphosulfate reductase
FT                   (EC 1.8.4.8) (PAPS reductase thioredoxin dependent) (PAdoPS
FT                   reductase) (3-phosphoadenylylsulfate reductase) (PAPS
FT                   sulfotransferase),InterPro: Phosphoadenosine phosphosulfate
FT                   reductase CysH-type"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0058"
FT                   /db_xref="GOA:B9DLM2"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004511"
FT                   /db_xref="InterPro:IPR011798"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLM2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26972.1"
FT                   /translation="MDSKITYTNFASNPFDSLNIFDETKGAYHVLKWAYDTYGDEIVYA
FT                   CSFGAEGIVLIDLISQVKPDARIVFLDTGLHFEETYDLINRVKAKYPELNIELKKPDLT
FT                   VDEQAEHYGDNLWNRDPNQCCYIRKVKPLEEVLTGQTAWVSGLRREQSPTRANTDFLNK
FT                   DERFQSIKVCPLIHWTWDNVWDYIKSNELPYNILHDQNYPSIGCAPCTSPVAAGGDSRE
FT                   GRWSNNMKTECGLHVGRKS"
FT   CDS_pept        59662..61506
FT                   /transl_table=11
FT                   /gene="cysJ"
FT                   /locus_tag="SCA_0059"
FT                   /product="putative sulfite reductase (NADPH) flavoprotein
FT                   alpha-component"
FT                   /function="Sulfite reductase alpha subunit (flavoprotein)"
FT                   /EC_number="1.8.1.2"
FT                   /note="(P38039) Sulfite reductase [NADPH] flavoprotein
FT                   alpha-component (EC 1.8.1.2) (SIR-FP),InterPro:
FT                   FAD-binding"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0059"
FT                   /db_xref="GOA:B9DLM3"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010199"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLM3"
FT                   /inference="similar to AA sequence:UniProtKB:P38039"
FT                   /protein_id="CAL26973.1"
FT                   /translation="MSLSSTNSPFNDEQAQLINQALSTLSNDQKLWLSGYLTANMQGGA
FT                   ARTVPASGAVQVPEAAGAQAAQPQVVEPRKITVLFGSESGNAQWVAELLESKLKEKDFD
FT                   VTLSEMDQYKTKDLKKVEDLLIVTSTHGEGDPPDNAVTFYDFLYGRKAPNLEGARFSVL
FT                   ALGDQSYEFFCQTGKDFDARLEELGADRILPRVDCDIDFEELANEWIDNIINELGDQEV
FT                   KQVVQDAQNEPIQNDVAAPVYSRTNPFEAEVLENEKITGRGSNKEVRHLELSLEGYGDE
FT                   YAPGDSINILPENDPELVNELIDMLDWDSEQEIEVDTQGTKMTLSDALTSYFEITKLTK
FT                   PLLESAAQIFDNEELMDRLSDNAWVKEYVYGRDLLDLLDDFPTESLQPDQLHQVLRKIP
FT                   ARSYSISSSNQANPDEVHITVCAVRYEAHDRDRSGVCSVQLAERVEPGDKLKVYLKKNP
FT                   NFKFPFDETTPVIMIGPGTGIAPFRAVLQEREELDLTGKTWLFFGNQHFTTDFLYQTEI
FT                   KDWLDNGVLEKADVAFSRDQEEKRYVQHLIDENSEEFYDWLRNGAAVYVCGDEKNMAKD
FT                   VHQAIVHVLEKEGGLTEEESENYLAELKKEKRYQRDVY"
FT   CDS_pept        61530..63239
FT                   /transl_table=11
FT                   /gene="cysI"
FT                   /locus_tag="SCA_0060"
FT                   /product="putative sulfite reductase (NADPH) hemoprotein
FT                   beta-component"
FT                   /function="Sulfite reductase beta subunit (hemoprotein)"
FT                   /EC_number="1.8.1.2"
FT                   /note="(P17845) Sulfite reductase [NADPH] hemoprotein
FT                   beta-component (EC 1.8.1.2) (SIR-HP) (SIRHP),InterPro:
FT                   Nitrite/sulfite reductase ferredoxin-like half domain"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0060"
FT                   /db_xref="GOA:B9DLM4"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR011786"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DLM4"
FT                   /inference="similar to AA sequence:UniProtKB:P17845"
FT                   /protein_id="CAL26974.1"
FT                   /translation="MAKNDNELYKGLDDLERNKGESNYLRGTIVEGLNDPITGAIAEDD
FT                   TKLLKFHGSYMQDDRDLRQERRKQKLEPLYAFMIRVRIPGGKVSTDQWLKLDALADNYA
FT                   GEQIRLTTRQTMQYHGILKRNLKKSMQSIHDAVLDSIAACGDVTRNVMCNPNPYQSDIY
FT                   AEVNRAADSISEHLLPKTTAYHEIWLDGEKVVDTKKEDHEPMYGKTYLPRKFKIGIAVP
FT                   PSNDIDVYSQDIGLIGIVENDELIGYNVSVGGGMGMKHDDLRTYPQVGKVIGFIPKDKA
FT                   EEVCEKILTIQRDYGDRSDRMQARFKYTVDRKGLDWIKQELNDRLGWELEEAKSFEFED
FT                   NGDRLGWTEGSGKHHYTLFIQNGRIKDTEDFKLKTAIKELAKVHKGDFRMTPNQNLIIA
FT                   NVDEKDKPEIQKIIDNYGLTDGKNYSGLRRNSMACVAFPTCGLAMAESERYLPSLVGKI
FT                   EDLLDEFGLSEEEITIRMTGCPNGCARPALAEISFIGKAPGKYNFYLGGSFKGDRLNKL
FT                   YKENIGEKEILESLRPILEQYSKEREKGEHFGDFVVRKGIVEKVTDGRDFRG"
FT   CDS_pept        63264..64037
FT                   /transl_table=11
FT                   /gene="cysG"
FT                   /locus_tag="SCA_0061"
FT                   /product="putative uroporphyrin-III C-methyltransferase"
FT                   /function="Uroporphyrinogen-III methylase"
FT                   /EC_number="2.1.1.107"
FT                   /note="(P11098) Siroheme synthase [Includes:
FT                   Uroporphyrin-III C-methyltransferase (EC 2.1.1.107) (Urogen
FT                   III methylase) (SUMT) (Uroporphyrinogen III methylase)
FT                   (UROM); Precorrin-2 dehydrogenase (EC 1.3.1.76);
FT                   Sirohydrochlorin ferrochelatase (EC 4.99,InterPro:
FT                   Uroporphyrin-III C-methyltransferase C-terminal"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0061"
FT                   /db_xref="GOA:B9DLM5"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLM5"
FT                   /inference="similar to AA sequence:UniProtKB:P11098"
FT                   /protein_id="CAL26975.1"
FT                   /translation="MGKVYIVGAGPGDPDLITVKGMKAIEKADVILYDRLVNKALLEYA
FT                   KPNTRLIYCGKDPNGPSIPQAEINHLLVSLASKGHIVTRLKGGDPFLFGRGAEEAEVLA
FT                   DQNLPFEIVPGITSGIAAPAYAGIPVTHRDYSSSVAFVTGVNKSKTFKQEYWKHLARGP
FT                   ETLCIYMGVSRLPEISRLLIENGRAADTPVALVYQGTSEVQETAVGTLETIVEDAKHFK
FT                   NPSMIIVGEVVRMNRKINWFQEFAQHQQLTEAALH"
FT   CDS_pept        64197..65099
FT                   /transl_table=11
FT                   /locus_tag="SCA_0062"
FT                   /product="putative permease"
FT                   /function="predicted permeases"
FT                   /note="(P46490) Hypothetical protein
FT                   HI0198,pfam01925,DUF81, Domain of unknown function DUF81.
FT                   This integral membrane protein family has no known
FT                   function. The alignment appears to contain two duplicated
FT                   modules of three transmembrane helices.,InterPro: Protein
FT                   of unknown function DUF81"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0062"
FT                   /db_xref="GOA:B9DLM6"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLM6"
FT                   /inference="similar to AA sequence:UniProtKB:P46490"
FT                   /protein_id="CAL26976.1"
FT                   /translation="MKKLLIIAFVGFFAQLIDGSLGMGFGVTSSSILLTLGLTPAIVSA
FT                   TIHFSEIATTAASGISHMSFANADKKLILRLAVPGSMFAFIGAALVSHLHANIVKPAVA
FT                   LFLISIGIYILYQFAFKGKRSYTDGPPPSNKLLIPLSSVAGFLTAIGGGGWGPVNTSVL
FT                   VSRRNANVRHVIGSVSVSEFFVTIAASVSFLIFLRLDQINWGLVAALSIGGVAAAPFAA
FT                   WMVKVIPVEVLGIFVGGLIIFTNSNTLMNAFGADASMATIVRITVVVAWLGLLLYTLNK
FT                   AGKLPNFFQKKQTHKVGKN"
FT   CDS_pept        65118..66317
FT                   /transl_table=11
FT                   /gene="cysD"
FT                   /locus_tag="SCA_0063"
FT                   /product="putative sulfate adenylyltransferase"
FT                   /function="ATP sulfurylase (sulfate adenylyltransferase)"
FT                   /EC_number="2.7.7.4"
FT                   /note="(O34764) Sulfate adenylyltransferase (EC 2.7.7.4)
FT                   (Sulfate adenylate transferase) (SAT)
FT                   (ATP-sulfurylase),InterPro: ATP-sulfurylase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0063"
FT                   /db_xref="GOA:B9DLL5"
FT                   /db_xref="InterPro:IPR002650"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020792"
FT                   /db_xref="InterPro:IPR024951"
FT                   /db_xref="InterPro:IPR025980"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DLL5"
FT                   /inference="similar to AA sequence:UniProtKB:O34764"
FT                   /protein_id="CAL26977.1"
FT                   /translation="MATATQIINYTSTPHGGELINRQLEGAEREALIKEAEAFPKLTLN
FT                   AWSLSDLELIAIGGFSPLTGFMGEADYTNVVENLHLADGTLWSIPITLPVTEEQADAYE
FT                   LGSKIALYGEDDKLYGVLDLQEKFTYDKEKEAENVYGTTEEAHPGVKKVYEKGNVYLAG
FT                   PIQLVNRPDHSEFEEFELDPIEVRQMFHDLGWKTVVGFQTRNPVHRAHEYIQKSALETV
FT                   DGLLLNPLVGETKADDIPADVRMESYQVILKNYFPENRARLAIYPAAMRYAGPREAILH
FT                   AIVRLNYGCTHFIVGRDHAGVGDYYGTYEAQELISQYEDELGINIMKFEHAFYCTKCEN
FT                   MATAKTCPHDKKYHVHLSGTKVREKLRNGEPLPKEFSRPEVAEVLIRGLRRHREQNGEG
FT                   "
FT   CDS_pept        66323..66922
FT                   /transl_table=11
FT                   /gene="cysC"
FT                   /locus_tag="SCA_0064"
FT                   /product="putative adenylylsulfate kinase"
FT                   /function="Adenylylsulfate kinase and related kinases"
FT                   /EC_number="2.7.1.25"
FT                   /note="(Q88X60) Adenylylsulfate kinase (EC 2.7.1.25) (APS
FT                   kinase) (Adenosine-5phosphosulfate kinase) (ATP
FT                   adenosine-5-phosphosulfate 3-phosphotransferase),InterPro:
FT                   Adenylylsulfate kinase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0064"
FT                   /db_xref="GOA:B9DLK2"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DLK2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26978.1"
FT                   /translation="MVKSQNITWHDSEVTKNERQEKNGHKSVVLWFTGLSGSGKSTISV
FT                   ALEKALFERGVRSYRLDGDNIRHGLNNNLGFSPEDRKENIRRIGEVSKLLSDAGLITLT
FT                   AFISPYREDRDHVREILEDGEFVEVYTKASVAACEERDPKQLYKKVRAGEIKNFTGIDA
FT                   PYEAPEDPEIIVDTEENSVEEAVEQIIQYLEDQKVI"
FT   CDS_pept        67060..67842
FT                   /transl_table=11
FT                   /locus_tag="SCA_0065"
FT                   /product="putative short chain dehydrogenase SDR"
FT                   /function="Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /note="(Q48436) Acetoin(diacetyl) reductase (EC 1.1.1.5)
FT                   (Acetoin dehydrogenase) (AR) (Meso-23-butanediol
FT                   dehydrogenase),InterPro: Short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0065"
FT                   /db_xref="GOA:B9DLK3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014007"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLK3"
FT                   /inference="similar to AA sequence:UniProtKB:Q48436"
FT                   /protein_id="CAL26979.1"
FT                   /translation="MTKVEGQVALVTGGGQGIGEAICRRLAEDGFKVGVADYNIETAEN
FT                   VAQSLRDAGHEAVAVKVDVADRDQVFAAVKEVKDKFGDFNVIVNNAGLGPQTPLDTITY
FT                   EQYRQVFDVNVGSIFWGIQAAVEAFESLGHGGKIISASSQAGQVGNPGLALYGATKFAI
FT                   RGITQTAARDLADKGITVNAYCPGIVKTPMMEDIAQKTADEAGKPYEWGMEQFSKNIAL
FT                   KRLSEPSDVAACVSYLAGPDSDYMTGQALIIDGGMVFN"
FT   CDS_pept        complement(67895..68368)
FT                   /transl_table=11
FT                   /gene="fcbC"
FT                   /locus_tag="SCA_0066"
FT                   /product="putative thioesterase"
FT                   /function="predicted thioesterase"
FT                   /note="gi|49242692|emb|CAG41415.1| hypothetical protein
FT                   [Staphylococcus aureus subsp. aureus MRSA252]"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0066"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLK4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26980.1"
FT                   /translation="MSSIYTYEDKVHPSWIDHNHHLHDAQYFSIFSDAVVGFFASLGFS
FT                   IDYRQNHDTTIFNLEAHITFLKEMVLDESFKVDVYVYDFDHKRVHFFLKMFNQEGVQTA
FT                   AYEVIMMCINNKERRSAEFPEFVYENIEKYYKEQGDFEIPKQLGHQIGIRRKK"
FT   CDS_pept        68712..68879
FT                   /transl_table=11
FT                   /locus_tag="SCA_0067"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0067"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLK5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26981.1"
FT                   /translation="MKQFSKQQIREKMDELEHWENYKPMNMASSMGRKAQINNLKATIR
FT                   EMVPMEAVKE"
FT   CDS_pept        69022..69606
FT                   /transl_table=11
FT                   /locus_tag="SCA_0068"
FT                   /product="putative lipoprotein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0068"
FT                   /db_xref="InterPro:IPR029050"
FT                   /db_xref="InterPro:IPR031989"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLK6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26982.1"
FT                   /translation="MRKLTMIFILLSVILSGCNSSKTSEIDSEKVKEENQSKKLRTKEL
FT                   KNNTAVLHDLEIKVLNTEYLPMNTYEGQEKPQLVVTYEAKNKVDKEIDPIGAWFTAFEA
FT                   YQDTSDSMKKIDVGPLPNMEKYNYVLDNQDDLIKKGKSVRCAIAYDIYDVNKPVILKAH
FT                   KGYDNIYLGEIKVNIKKYRGYWSFINNRHLF"
FT   CDS_pept        70060..71187
FT                   /transl_table=11
FT                   /gene="metE"
FT                   /locus_tag="SCA_0069"
FT                   /product="putative methionine synthase"
FT                   /function="Methionine synthase II (cobalamin-independent)"
FT                   /EC_number="2.1.1.14"
FT                   /note="(P42318) Hypothetical protein yxjG,InterPro:
FT                   Methionine synthase vitamin-B12 independent"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0069"
FT                   /db_xref="GOA:B9DLK7"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLK7"
FT                   /inference="similar to AA sequence:UniProtKB:P42318"
FT                   /protein_id="CAL26983.1"
FT                   /translation="MTELLRYDIVGSFLRPEALKKARAQFEQGTIDQEALSKAEDEEIK
FT                   QLITKQVENGLQSITDGEFRRSWWHLDFFWGLNGVEAIKDAGGFEFENVQSRFETARLS
FT                   NYISGENHPFVEHYKFLKAHTPEGIEARQTVPAPARLFSELTRKENLEATRKFYSTDDE
FT                   LIDAIAEAYQTVIQDLYDEGLRTIQFDDTTWGRLVGDQTEINGKNGDAKEKERLKEVFV
FT                   KANNKAIEGLPEDLTVQTHVCRGNYRSTWFAEGAYDSVASPLFDRENVDNYLLEYDTDR
FT                   SGGFEPLAHVSEGKNVVLGLITSKDGQLEDRDEVIARIKEASQYIPLENLALSTQCGFA
FT                   STEEGNNLTEEAQWAKIRLVKSIAEEVWNTEKVEG"
FT   CDS_pept        71424..71747
FT                   /transl_table=11
FT                   /locus_tag="SCA_0070"
FT                   /product="putative transcriptional regulator"
FT                   /function="predicted transcriptional regulators"
FT                   /note="(P39044) Hypothetical protein X,InterPro:
FT                   Transcriptional regulator PadR-like family"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0070"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLK8"
FT                   /inference="similar to AA sequence:UniProtKB:P39044"
FT                   /protein_id="CAL26984.1"
FT                   /translation="MNIQFKKGALEFLVLLIIKGEDQYGYSLVQKITPRISIAEGTVYP
FT                   LMRRLVKEGYLTTYFKPSTEGPARKYYKITEEGRERLKSLLAEWKDFTDAVNLFIEESE
FT                   VDE"
FT   CDS_pept        71740..72300
FT                   /transl_table=11
FT                   /locus_tag="SCA_0071"
FT                   /product="conserved hypothetical membrane protein"
FT                   /function="predicted membrane protein"
FT                   /note="gi|27468839|ref|NP_765476.1| (REFSEQ)
FT                   gi|27316387|gb|AAO05562.1| conserved hypothetical protein
FT                   [Staphylococcus epidermidis ATCC 12228]"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0071"
FT                   /db_xref="GOA:B9DLK9"
FT                   /db_xref="InterPro:IPR012963"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLK9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26985.1"
FT                   /translation="MNKQEYLRLLDRYLTRVTPEERRDILDEYETHFISGKEAGKTEEE
FT                   ISKELGNPKSIGREMSATSAMDKVEDSKNPNNVTNAILAVMGLSILNFFVVFGVLTTLI
FT                   GLLFGLITTTVTLLVSPVLLLVKGIIDGASAIMPVETYSVFAMFGVGLILLVVTYLACK
FT                   WSFVLFMKYLRWNINVVKGSARS"
FT   CDS_pept        72297..72677
FT                   /transl_table=11
FT                   /locus_tag="SCA_0072"
FT                   /product="truncated conserved hypothetical protein"
FT                   /note="similarity to N-terminal part (aa 1..111) of
FT                   gi|27468838|ref|NP_765475.1| hypothetical protein SE1920
FT                   [Staphylococcus epidermidis ATCC 12228] Length =267"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0072"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLL0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26986.1"
FT                   /translation="MKKVLIILFTIGLLMFIGFGLATYFEMKKVSNTPSHPLNYEKDYQ
FT                   KEDDSIKKLQVNGQLADIKVKHGKHFSVKAKSGDKAHTEITSEIKNSTLIVKEAQKGPR
FT                   INFNFKGTKPADSRYHDYCARP"
FT   CDS_pept        72694..72783
FT                   /transl_table=11
FT                   /locus_tag="SCA_0073"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0073"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLL1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26987.1"
FT                   /translation="MHNDTSDITIEGLKAEQVEAVTNTGDIPF"
FT   CDS_pept        73310..74302
FT                   /transl_table=11
FT                   /gene="gloA"
FT                   /locus_tag="SCA_0074"
FT                   /product="glyoxylase family protein"
FT                   /function="Lactoylglutathione lyase and related lyases"
FT                   /EC_number="4.4.1.5"
FT                   /note="(Q9WXE6) Chlorohydroquinone/hydroquinone
FT                   12-dioxygenase (EC 1.13.11.-) (Hydroquinone meta-cleavage
FT                   dioxygenase),InterPro: Glyoxalase/Bleomycin resistance
FT                   protein/dioxygenase domain"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0074"
FT                   /db_xref="GOA:B9DLL2"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLL2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26988.1"
FT                   /translation="MKMQNLKGMHHVTAITSDAVKIYDFYTDVLGLRLVKKTVNQDDIH
FT                   TYHLFFADDEGNAGTDVTFFDFPGIPKGTHGTDEIARISLRVPSDAAIEYWADRFDKLN
FT                   IEHSDVETLLGKKIIRFEDFDGQQYNLISDETDKEGSVEPGVAWKNGPVPEEYAIVGLG
FT                   PIELNVSRYEAFKAVFEEVYGYKEVDSEGDYHLFETGQGGNGGQVIVHKQGGNPGMQGY
FT                   GTIHHTAFRVNDKEGLDEWIDRLNSYNIGNSGFVERYYFKSLYSKFYPGILVEIATDGP
FT                   GFTGDEPYETLGEILSLPPFLEPKREAIEGEVRHIDTTRHNQPDRKAQQ"
FT   CDS_pept        74324..74926
FT                   /transl_table=11
FT                   /locus_tag="SCA_0075"
FT                   /product="putative phospholipase/carboxylesterase"
FT                   /function="predicted esterase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0075"
FT                   /db_xref="GOA:B9DLL3"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLL3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26989.1"
FT                   /translation="MDMKHIFRKGKDSNQPTFIMFHGTGGDETDLIPVALRLNPDYNVL
FT                   SVKGNVSEGGTARFFKRVGEGQYDWEDLAERSDELNDFLREAAEHYNFDLNKAVLVGFS
FT                   NGSNMAINLLLREDTTFAKALLFAPLYPADIENVRDLSNMTIFLSMGTQDPIVPVSESE
FT                   RVIDIFKRSGAKVETHWTVSHGITEAALNDAAKALED"
FT   CDS_pept        complement(75001..76146)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0076"
FT                   /product="putative oxidoreductase"
FT                   /function="2-polyprenyl-6-methoxyphenol hydroxylase and
FT                   related FAD-dependent oxidoreductases"
FT                   /note="(Q01911) Tetracycline resistance protein from
FT                   transposon Tn4351/Tn4400,InterPro: Flavoprotein
FT                   monooxygenase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0076"
FT                   /db_xref="GOA:B9DLL4"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLL4"
FT                   /inference="similar to AA sequence:UniProtKB:Q01911"
FT                   /protein_id="CAL26990.1"
FT                   /translation="MVQNTEFETPITIIGGGIGGLTLARVLQVNGIPTKVYESDTSRDA
FT                   RTQGGQLDIHEYNGQVALKKAQLTEAFQSIIQKGADAARIVGENGDILLDVPDDESNGR
FT                   PEVLRGDLRNILIDSLKEDTIAWSKKVDHVEKTDNNQYKVVFRDETSIVTDKLIGADGA
FT                   WSKVRKLLTNITPHYSGTTFIETYLYDVDYNYPKTAQEVGKGAMYALTHNKGIVAHREA
FT                   NNIIHTYVQMNCSEEWIDHIDFSNGNQAVQTVAAEFEGWASEIKALITETDSHIIPRKI
FT                   YALPDEHRWAPQSGVTLIGDAAHLMAPSGEGANLAMLDGAELAELIAAHKGNFDTAIRK
FT                   YEEQMFPRSEEEAKESHELLEICLGPDSPDSLIKLFQSADQ"
FT   CDS_pept        complement(76430..77134)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0077"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0077"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLK1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26991.1"
FT                   /translation="MKKAFIILFACILIPALTGCEKDFKDKKEVSIKDIINDEHEHVIW
FT                   ATGGGGEDAGYVSQIIFTKNGKVKSVPIDQSAEVPTSFIESHTPSELEDKMKKDGPPEY
FT                   KESKWQEPAYIVIENSEEKPLVTMVINNKKGMKDHDKKSVDRVMEDLGNTEAHVMYSET
FT                   SSGGTQYPTDKPKTYGTFTFDPSIIIGNDDAERTISFTTLLEKGQKLVQLSKDDLKNDD
FT                   HVYNFSRSELEN"
FT   CDS_pept        complement(77137..77676)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0078"
FT                   /product="putative membrane protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0078"
FT                   /db_xref="GOA:B9DLI9"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="InterPro:IPR026870"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLI9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26992.1"
FT                   /translation="MYCSKCGAELNPSDAFCARCGKPITSNSNTTASANATNQLNIWQN
FT                   YQAFWQNFINFNGKTKRTPFWVSTVLNILITTILLIIGIAGRDELTGQASPILYIAILF
FT                   IIVTFCPQLAITYRRFNDAKKRKWSIWANLILPIDPIMEIVNGTGSPISSLLLFITIGL
FT                   FIYNSIILISPSKESI"
FT   CDS_pept        complement(77691..78533)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0079"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0079"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLJ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26993.1"
FT                   /translation="MKKLIPALLIATPLLIAGCGQNNDDGNETKHNTNTESTTKPKETT
FT                   SEQNYKDITLSDIFADGKPHILYRANPMVENGGEDDKHQSVKVTDTSIDESSVSQVIYV
FT                   KNNQARQFFIDSSDDLRLGKFLKLSPDEILKKMNHLAEIQEKEGDNLAPSMTTTDNFTN
FT                   IEKFIYQKNHKIEGTGYNFSPATDGKFETDPENPNLKLRTKEFKPDFTAKVKPFKYNGK
FT                   TYAGISPYDGEILITEVPADTEIELDTKKDKDVHVIDYKDSEDGQKEADEKEKDFDNL"
FT   CDS_pept        complement(78530..79054)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0080"
FT                   /product="putative DNA binding protein"
FT                   /note="similar to gi|38142387|dbj|BAD00991.1| hypothetical
FT                   protein [Staphylococcus warneri]"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0080"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLJ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26994.1"
FT                   /translation="MEQAFRILNIYTRLVQQQTVNKSDLAERFNVNKRTIQRDIDNLRN
FT                   YLYENGSWHTQILYDTKTESYYLNLPDLINPKTFYNQNQIPVTFEMTQEVFRILRPYYT
FT                   SEIIQNINSEVIRVRMNISEQNARTLAFIYHSKIRVIAPDNLLQKVIDDMMEMQKTYLK
FT                   QEIKTNSGGTT"
FT   CDS_pept        complement(79441..80133)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0081"
FT                   /product="Putative intracellular protease/amidase"
FT                   /function="putative intracellular protease/amidase"
FT                   /EC_number="3.4.-.-"
FT                   /note="gi|17989361|ref|NP_541994.1| (REFSEQ) PROTEASE I
FT                   [Brucella melitensis 16M],InterPro: Protein of unknown
FT                   function ThiJ/PfpI"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0081"
FT                   /db_xref="GOA:B9DLJ2"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLJ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26995.1"
FT                   /translation="MVKKVLIVNTSTDHFADSDVPTGLWLGELVHFYDLMHQNHVQIDI
FT                   VNTKGGLTPIDPVSTSRFMLDKLTKKYLNDDTFMTLLKNSPSIKEITPTDYNAVYFTGG
FT                   HGVMYDFPGNPDIQRVISAVRENGGVVSAVCHGICAFLNFKGLDGRYYVDGKRLTGFSN
FT                   LEEKLANRKKLVPFMLEDKLKEEGADYSRAFLPFRPYVVEDGHLVTGQNPQSPKGVAEK
FT                   VLYLLNVK"
FT   CDS_pept        80762..81262
FT                   /transl_table=11
FT                   /locus_tag="SCA_0082"
FT                   /product="putative membrane protein"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /note="(P43984) Hypothetical protein HI0318,InterPro:
FT                   Isoprenylcysteine carboxyl methyltransferase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0082"
FT                   /db_xref="GOA:B9DLJ3"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLJ3"
FT                   /inference="similar to AA sequence:UniProtKB:P43984"
FT                   /protein_id="CAL26996.1"
FT                   /translation="MITFILLIFFAIRLYTLYISIQHERALKAEGAKQHGVKNSKYLAI
FT                   THTLIYVSAIITAIIQHPRFDFISLVGLILLVFSYIVLFMVIRTLGSIWTLKIYILKKH
FT                   RIVEQGIFKYIKHPNYFLNIIPELIGVVLLTHAYSTALLFIPYALFLYIRIQQEEQAMA
FT                   HLY"
FT   CDS_pept        81388..82122
FT                   /transl_table=11
FT                   /locus_tag="SCA_0083"
FT                   /product="putative esterase/lipase"
FT                   /function="Esterase/lipase"
FT                   /EC_number="3.1.1.1"
FT                   /note="(Q06174) Carboxylesterase precursor (EC
FT                   3.1.1.1),InterPro: Esterase/lipase/thioesterase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0083"
FT                   /db_xref="GOA:B9DLJ4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR012354"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLJ4"
FT                   /inference="similar to AA sequence:UniProtKB:Q06174"
FT                   /protein_id="CAL26997.1"
FT                   /translation="MLKVKAPKNLYLKGGERAVLLLHSFTGTIQDIKEVAEALNEEGFT
FT                   CYAPCYTGHGLPVSEFVKYDIQDWWKDVEAAYHFLQAEGYQEIDVIGVSLGGIFSLKLA
FT                   EQFEVGRVVGMSIPYEKREKGVIERLNTYGERLQHYILCTDDEQTEEMARIRDYETGAQ
FT                   RFEAFTDATMKELKNITAPTLLMYGGQDDPSYRESAFKVAEALTKVDDKEVVCFENAGH
FT                   LMPRSEDKSAIIERIVDFLCKA"
FT   CDS_pept        82387..82974
FT                   /transl_table=11
FT                   /locus_tag="SCA_0084"
FT                   /product="similar to ica operon transcriptional regulator"
FT                   /function="Transcriptional regulator"
FT                   /note="gi|13309880|gb|AAK18070.1| (GenBank (NCBI Entrez))
FT                   IcaR [Staphylococcus caprae],InterPro: Bacterial regulatory
FT                   protein TetR HTH motif"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0084"
FT                   /db_xref="GOA:B9DLJ5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLJ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL26998.1"
FT                   /translation="MKNEIIDNAIELFAQKSYYGCTLDELAKSVDIKKASLYYYFPSKA
FT                   AIYRECAQRCFNFFERVIEIENKKNPDTLHLGNLKKFILKTVFDTDINYLRLYLQFTQA
FT                   PEEFKEELYEGVASLHKALDVTFKRYYDANDIEISFESFRELVLDVMESGFIRTTFINY
FT                   FDELSYRRKTLQLDVANMLDSLFELKEAAKGH"
FT   CDS_pept        83302..84636
FT                   /transl_table=11
FT                   /locus_tag="SCA_0085"
FT                   /product="putative sodium-dependent transporter"
FT                   /function="Na+-dependent transporters of the SNF family"
FT                   /note="(P45320) Hypothetical sodium-dependent transporter
FT                   HI1690,InterPro: Sodium:neurotransmitter symporter"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0085"
FT                   /db_xref="GOA:B9DLJ6"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLJ6"
FT                   /inference="similar to AA sequence:UniProtKB:P45320"
FT                   /protein_id="CAL26999.1"
FT                   /translation="MSKQSQWKTSTGFILASAGSAIGLGAMWKFPYMAGVYGGGAFLLM
FT                   FLVFTIFIGLPLLIMEFTIGKLGRTYTTAIFGKLSGKKWTNIIGWSGNLAVFVLFGFYS
FT                   VVGGWIIIYIAQVAMQLVGLGSGTLGSIHFDQVISNPVYTIIGQGIFILITMVIVMLGV
FT                   EHGLEKASKVMMPLLFVFLILIVIKSLSLDGAAEGVRFILEPRMEDLSMQGVLFALGQS
FT                   FFALSLGTTGMITYASYAPKEMTIKTSALSIVIMNIIVSLLAGLAIFPAINAFGYKPEE
FT                   GPGLLFKVLPRVFEQMSFGARFLLDFPLSYSYLRALTSSISLLELNVSIFTKNDNRKRT
FT                   KVAVIGSVLVFLISIPATLSFSSLSGIHFGAGSIFDNMDFLVSNILMPLGAFATTLFVG
FT                   QLLKMKDLEKVFGRDRLKLFVPWYYLVKYVLPVVILLVFVMQLFK"
FT   CDS_pept        84836..85732
FT                   /transl_table=11
FT                   /gene="cysM"
FT                   /locus_tag="SCA_0086"
FT                   /product="Pyridoxal-5'-phosphate-dependent enzyme, beta
FT                   family"
FT                   /function="Cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /note="(P56067) Cysteine synthase (EC 2.5.1.47)
FT                   (O-acetylserine sulfhydrylase) (O-acetylserine
FT                   (Thiol)-lyase) (CSase),InterPro:
FT                   Pyridoxal-5-phosphate-dependent enzyme beta family"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0086"
FT                   /db_xref="GOA:B9DLJ7"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLJ7"
FT                   /inference="similar to AA sequence:UniProtKB:P56067"
FT                   /protein_id="CAL27000.1"
FT                   /translation="MIAFDLIGNTPLVKLESFSDDNVEIYAKLEQYNPGGSVKDRLGKY
FT                   LVEQALERGQIKRGDTIVEASAGNTGIGLTIAANHYGLRCVIYAPEGFAAEKISIMEAL
FT                   GAEVIRTPQNGGMMGAQKAAKAYAEEHGAYYTNQFETEDNPGAYRETLAQEILNELPEI
FT                   DYFVAGVGSGGTFTGTAEGLAERKAKNILIEPEGSILNGGPRHLHDTEGIGSEKWPDFL
FT                   EKDIVSEILTISDADAFKNVKRLALQEGILAGSSSGAALQGALEMKARLDKGVIVTIFP
FT                   DGSDRYMSKSIFNYQSK"
FT   CDS_pept        85775..86920
FT                   /transl_table=11
FT                   /gene="metC"
FT                   /locus_tag="SCA_0087"
FT                   /product="putative Cys/Met metabolism
FT                   pyridoxal-5'-phosphate dependent enzyme"
FT                   /function="Cystathionine beta-lyases/cystathionine
FT                   gamma-synthases"
FT                   /EC_number="2.5.1.48"
FT                   /note="(P56069) Cystathionine gamma-synthase (EC 2.5.1.48)
FT                   (CGS) (O-succinylhomoserine (Thiol)-lyase),InterPro:
FT                   Cys/Met metabolism pyridoxal-phosphate-dependent enzymes"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0087"
FT                   /db_xref="GOA:B9DLJ8"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLJ8"
FT                   /inference="similar to AA sequence:UniProtKB:P56069"
FT                   /protein_id="CAL27001.1"
FT                   /translation="MKKKTQMVHGGHTTDDYTGAVTTPIYQTSTYLQDDIGDLREGYEY
FT                   SRSGNPTRTALESTIADLEGARFGFAFGSGVAAISAVVMLLDKGDHIVVNSDVYGGTFR
FT                   VLTKVFKRLGIDADFVDTTHTENIESAIKPETKMLFIETPSNPLLRITDIQASADIARK
FT                   HNLISVVDNTFMSPYFQNPLALGADIVLHSASKYIGGHSDVIAGLVATDNEELAERIGF
FT                   IQNSTGGVLGPQDSYLLIRGIKTLGLRMEQVSSNAVAVTEMLSEHPNVEAVYHPSLKDH
FT                   LNHDVQERQASGHTGVISFVVKDVDAAKAVIRETEYFTLAESLGAVESLISVPALMTHA
FT                   SIPKDVREKEGIADGLIRLSVGIEDTDDLVADLKQALDKLN"
FT   CDS_pept        87078..87698
FT                   /transl_table=11
FT                   /locus_tag="SCA_0088"
FT                   /product="putative LysE type translocator"
FT                   /function="Lysine efflux permease"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0088"
FT                   /db_xref="GOA:B9DLJ9"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLJ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27002.1"
FT                   /translation="MLQPIIHGFLLALGLILPLGAQNVFVFNQGANQKKLIGALPVIIT
FT                   AGLCDTLLIVLAILGMSLILMSLPILQLIIYIIGLVFLLYMAWSLWKEKPDKLQNFEPM
FT                   SAKKQIGFALSVSLLNPHAIMDTIGVIGTSASVYNGLDKVLFTAATVSVSWLWFIFLAI
FT                   AGRLLGSVDKTGRYIVILNKVSSIIILIVSFVIIKNIFKILIP"
FT   CDS_pept        complement(87808..88278)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0089"
FT                   /product="putative thioesterase"
FT                   /function="predicted thioesterase"
FT                   /note="gi|27314681|gb|AAO03818.1| conserved hypothetical
FT                   protein [Staphylococcus epidermidis ATCC 12228]"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0089"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLK0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27003.1"
FT                   /translation="MSEHFTYNVTVQDAWLDHNQHMNDAEYNRVFSDTTDAWLAHLGLD
FT                   TDTIAEIGYTVFTLENHLIYKKEVPQNEKLSVKVRLIDYDAKRCHVFMELSDSKEDICA
FT                   TYEVMLMGIDTASGRPAPFPDNIMKKVEEESTLEESAENPKELGRQIGIKHK"
FT   CDS_pept        complement(88282..89250)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0090"
FT                   /product="putative 3-hydroxyacyl-CoA dehydrogenase"
FT                   /function="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /note="(Q99KP3) Lambda-crystallin homolog,InterPro:
FT                   3-hydroxyacyl-CoA dehydrogenase NAD binding domain"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0090"
FT                   /db_xref="GOA:B9DLI8"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR026578"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLI8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27004.1"
FT                   /translation="MKFAVVGTGVIGSGWITRMLAHGHEVIATDPGEGAYETMLAQVKQ
FT                   NWPYAERMGLAPGASIDNLTFTPHLDEAVKDADLIQENVPEVEEIKDKVLTEIDFYAKP
FT                   DAIIGSSTSGIMPTELQQNLKHPERLVVAHPFHPVYILPLVEIVPGAQTSEATVAKAEE
FT                   IYESIGSDVLHVRNEIEGHIADRLMEALWRESLHIVNEGIATTEEVDKAFTHAAGLRYA
FT                   QYGPFMTFHLAGGNGGMRHMLKQFGPALKKPWTKLIAPELTTDLYNAVVEGCEQSSAGH
FT                   TMSELDQKRNEFLVRVKELAQEYWPENSAYMKKRTAGYAEV"
FT   CDS_pept        complement(89252..90142)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0091"
FT                   /product="conserved hypothetical protein"
FT                   /function="uncharacterized conserved protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0091"
FT                   /db_xref="GOA:B9DLH5"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLH5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27005.1"
FT                   /translation="MKKVMLTAAITGAGDTTEKNKSVPVTPEEMADSAIKCARAGATVV
FT                   HLHARDPETGGISHDTEMFREAVRLIREAEEDIVINITSGGGGDFIPNQADPYTAGEGS
FT                   DMQTPAERHEPIGALLPEMCTLDCGSTNFGDMVYISPADWLREQAKLVQEAGVKPELEC
FT                   FDSGHIRFARQLIEEGLIDGEPMFQFCLGIPWGADNDPETIEYFKTRLPENAHWSGFGI
FT                   GIMQLPTVEEVAKRGGNVRVGLEDNIYLSKGVKATNEQLVEKAVEILKDLDIEPMTPVE
FT                   AREKYNLRDPKGGQN"
FT   CDS_pept        complement(90262..90795)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0092"
FT                   /product="putative transcriptional regulator"
FT                   /function="Transcriptional regulator"
FT                   /note="(P17446) HTH-type transcriptional regulator
FT                   betI,InterPro: Bacterial regulatory protein TetR HTH motif"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0092"
FT                   /db_xref="GOA:B9DLH6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041479"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLH6"
FT                   /inference="similar to AA sequence:UniProtKB:P17446"
FT                   /protein_id="CAL27006.1"
FT                   /translation="MDKSKKRADLLQAAIDIVNEQGTNYLTLDAVAKRAGVSKGGLLYH
FT                   FESKQALIQGLVDYANTQYRENVDKNIRESEDSGALLRGYIEATRKHRDENAAVTSAIL
FT                   AAHSNNKALLSPLQETYQEWQSDIASDQQDNVDATIIRLAIDGLWLSEIFGLDAIDEKT
FT                   REAVLDRLIEYTRK"
FT   CDS_pept        90962..91750
FT                   /transl_table=11
FT                   /locus_tag="SCA_0093"
FT                   /product="putative N-acetyltransferase"
FT                   /function="Arylamine N-acetyltransferase"
FT                   /EC_number="2.3.1.5"
FT                   /note="(O06977) Hypothetical protein yvcN; Belongs to the
FT                   arylamine N-acetyltransferase family,InterPro:
FT                   N-acetyltransferase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0093"
FT                   /db_xref="GOA:B9DLH7"
FT                   /db_xref="InterPro:IPR001447"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLH7"
FT                   /inference="similar to AA sequence:UniProtKB:O06977"
FT                   /protein_id="CAL27007.1"
FT                   /translation="MADFQRLDQYLEVEIGKEAVDLTTLNHLIRHYMLHVPFEDINVQN
FT                   GWPLALTDDAMMHKVVDEHRGGFCYEMNYFFKHYLEYKGFKAEAMSATVMSPNGWALEG
FT                   SHMSLIVTIDKVEYVVDIGFGDMPKFALLLHDCPKKGMHDVIGDYRVVFVDEAHYDVEK
FT                   WSETEDEWKIQYRALYEPKTLDDFAKGIDFNQHNPKSPFVKGLLITKATEAGRHTMTER
FT                   HLTVLSEGKKTILDVNAGNYETFLSKYFGIPKMKISTFDT"
FT   CDS_pept        complement(91831..94515)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0094"
FT                   /product="putative 5'-nucleotidase"
FT                   /function="5-nucleotidase/23-cyclic phosphodiesterase and
FT                   related esterases"
FT                   /note="(Q9KQ30) 5-nucleotidase precursor (EC
FT                   3.1.3.5),InterPro: Metallo-phosphoesterase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0094"
FT                   /db_xref="GOA:B9DLH8"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLH8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27008.1"
FT                   /translation="MHKTLLKTLFFVLAFFVLFHVSAFAAEIPAKTANQATVENTAEPP
FT                   QQNTVQTTATTDSKSNTDSTQTGTSDGQTHATPSAPSTTSSKALVATSDNNGTQSATTD
FT                   TTNPTIANKDVQTEGNNALSQEKNTAATQLKAPQPNQQAVGQQTAKAQSAPSANQVQTQ
FT                   QLSAPASQQPAASSNQAAETPAQTQQAPQQAKILHTNDMHGRILGEDGRVIGMSKLKTI
FT                   KEQEHPDLMLDSGDAFQGLPISNNTKGADMAKAMNSVGYDAMAVGNHEFDFGLDQAVKY
FT                   KDQLNFPILSTNTYKDNKLLFDPYTIVKKNGIRYGIVGVTTPETAVKTHPDNIKGVTFT
FT                   DPIPAVQNTLNQMNNQADIFIVLSHLGVDPSTQTAWRGDTLANTLAQDPLFKDKEIFVL
FT                   DGHSHTVIQNGKINQNTLLAQTGTALENIGKITFDYTNGKVENVHDSLINVKDTADVQP
FT                   DAELQKMMDEAKAKFDNQVSEVVIPNNPIQFEGERDDVRSHETNLGDAITDAMEAYSQN
FT                   GFSHPADFAVTNGGGIRASIEKGKDVTLGDIITVLPFGNTISQIQVKGTNVQKMFEHSL
FT                   SAPVQDGKLGANGGFLHISKSIRVYYDMNKAPGSRVLKIEVLNKQTNQFEALDPERTYY
FT                   MTTNDFTASGGDGYDMLGGPREEGVSLDKVFADYLKQADLSQYASNDASRIINGKPPVA
FT                   ETGDKSESNTVDNKTNNDTKVDSSENTLINNPNEAAVGEEVVSNNSNSTLIEDDKNVSH
FT                   NDMVAEGAMIDNNTAINQLAVIHSSLPEKDNNQTDNSVYSNNINQNNAPTANTQYHDMS
FT                   DIKYTNAFSDTKAPAAEPAKQTQQYVANSKVIAFSSQQKQHKNSELPNSGHSEPHNSPI
FT                   IPISLILLGAGTLYYNRKKDAAA"
FT   CDS_pept        94983..95999
FT                   /transl_table=11
FT                   /locus_tag="SCA_0095"
FT                   /product="putative autolysin with LysM domain"
FT                   /function="FOG: LysM repeat"
FT                   /note="putative exported protein [Staphylococcus aureus
FT                   subsp. aureus MRSA252] gi|49240818|emb|CAG39485.1| putative
FT                   exported protein [Staphylococcus aureus subsp. aureus
FT                   MRSA252],InterPro: CHAP; CHAP domain. This domain
FT                   corresponds to an amidase function. Many of these proteins
FT                   are involved in cell wall metabolism of bacteria. This
FT                   domain is found at the N-terminus of proteins, where is
FT                   functions as a glutathionylspermidine amidase EC:3.5.1.78."
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0095"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLH9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27009.1"
FT                   /translation="MQKKIIAAVIGTGAVSAIATAGAADAATYRVQSGDSLWSIAQRHN
FT                   TSIANLKSLNNLNSNLIFPNQVLKVSGSSASTSRNTSNSSAVSGGSTYTVRAGDSLSLI
FT                   ASKYGTSYQNIMKLNGLNSFLIHPGQVLKVSGTAPASSNTSTTRTQTTTTATSSTYTVQ
FT                   PGDSLSLIASKYNTTYQNIMNLNGLNSFLIFPGQKLKVTGSTATVTNSPSPAASTGTGG
FT                   YYTPVFNHSNLYDWGQCTWHAFNRRAQIGKGISTYWWNANNWDDGARADGYTVDHNATV
FT                   GSILQSDAGYYGHVAFVERINGDGSILISEMNYTSSPGILTYRTIPASQKGYFNYIH"
FT   CDS_pept        complement(96104..96400)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0096"
FT                   /product="conserved hypothetical protein"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /note="PFAM: Protein of unknown function
FT                   (DUF1369),InterPro: TPR repeat,No homologs in
FT                   staphylococcal species"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0096"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLI0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27010.1"
FT                   /translation="MKIEVTDQALKWFRDELDLEPGDKINFYVQTYVHTGLHEHFTTAF
FT                   KIEPHDNNASASVTIDRITFYINESDEWFFKGLDLLVEYNPETDEIEYKNTQL"
FT   CDS_pept        96570..96938
FT                   /transl_table=11
FT                   /locus_tag="SCA_0097"
FT                   /product="conserved hypothetical protein with MutT domain"
FT                   /function="NTP pyrophosphohydrolases including oxidative
FT                   damage repair enzymes"
FT                   /note="InterPro: NUDIX hydrolase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0097"
FT                   /db_xref="GOA:B9DLI1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLI1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27011.1"
FT                   /translation="MIRCVCLVAETEKQILLVQAHHRAKYYFPGGKIDALIREISEELN
FT                   LDLIPSELEYIDTVIGPAYPQKNEETELNCYRVLCEVDWETLRPASEITDLGWVDKKDT
FT                   EKIAPTVLKWIEKHKKDM"
FT   CDS_pept        complement(97005..97295)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0098"
FT                   /product="conserved hypothetical protein"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /note="No homolog in other staphylococcal species"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0098"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLI2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27012.1"
FT                   /translation="MKIHITDDALKWFKEEVDLEPGGKINFFVQTYGSSKLHDNFTLGF
FT                   KFDPNDKNASAETTVEDISFYVNESDEWFFKGFDLYIEYDAQKDEIDYDFK"
FT   CDS_pept        complement(97384..98229)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0099"
FT                   /product="putative esterase of the alpha-beta hydrolase
FT                   superfamily"
FT                   /function="predicted esterase of the alpha-beta hydrolase
FT                   superfamily"
FT                   /note="InterPro: Patatin"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0099"
FT                   /db_xref="GOA:B9DLI3"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLI3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27013.1"
FT                   /translation="MKNTLVLGGGGQFGIAWELGLLYGLNTKDINLRKMDAIIGTSAGS
FT                   QVGAAIASNWNWDKIWQNQIELTINEENPEPNMHKVFEKYNQISKQAKDGDEWVALLCQ
FT                   YAKTHVTRLDENVHIQQIKNRFQQINWGANLHITGTNIDTYTRKVWKAEDNVDIYKALS
FT                   ASSSLPGVWPPTTINEKLYSDGGSYSMENADLAIEAEKVIILSPHLPVDTPLSLEDQIN
FT                   ILKQHNTEVLAITPSSEVLQKLKVLGGNTVDPSIRRGIAEAAIQQGIAIKDKVKQFIEK
FT                   "
FT   CDS_pept        complement(98322..98912)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0100"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0100"
FT                   /db_xref="GOA:B9DLI4"
FT                   /db_xref="InterPro:IPR004927"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLI4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27014.1"
FT                   /translation="MKTFNFKAKLNSEEQQLRNELIQHILKNPTTAIPFEPKYIPLLEK
FT                   HVLNIEGDQITCLYPFSLNPTHFKVTIPDYDQTVDAMCAIDAIGVCDTLRVPIKINAVC
FT                   AETNTPIQLSVDNNEIKNLTNYPNLRVLYKDLCSDSQCSVNCCPYIQFFKDEEALEAYY
FT                   VKHIGNASTISQDASYHSLSLQQAREVAQKLFV"
FT   CDS_pept        complement(99039..99311)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0101"
FT                   /product="conserved hypothetical protein"
FT                   /note="Putative membrane protein (TMHMM)"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0101"
FT                   /db_xref="GOA:B9DLI5"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLI5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27015.1"
FT                   /translation="MMAKQPKSNLRRLSNVLNVVGFGIEIYNNVSHTKSRKLSQVGLAI
FT                   NVIGGILDFYTALKSGRFLTKVFSFSNLIAVFATSYNRFKALRSK"
FT   CDS_pept        complement(99422..100213)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0102"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative membrane protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0102"
FT                   /db_xref="GOA:B9DLI6"
FT                   /db_xref="InterPro:IPR012507"
FT                   /db_xref="InterPro:IPR014564"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLI6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27016.1"
FT                   /translation="MNAVLILALILLILMVIFGGKKGAVSYGMLFLNFLMVLIALVAIV
FT                   LKLPIPIVAILFCITVASLNLFGLNGYNVKTQAAFIGTCITTAILLGVIYFAVATGHLQ
FT                   GFATEQQDETYVYSMNIGINMIQFMVFTTVLAVIAAVVDLAITISSPMYELHETNPNLG
FT                   RTELFQSGMRVGREILATSANTIYLAYFGGQLTLFFWFFKLNYSFGHIINAKIFTEEFV
FT                   SILFGGIAVALSIPITAWITAWLIHRHPDKTAAQSTSDKQL"
FT   CDS_pept        complement(100210..101322)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0103"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative membrane protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0103"
FT                   /db_xref="GOA:B9DLI7"
FT                   /db_xref="InterPro:IPR012507"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLI7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27017.1"
FT                   /translation="MSYKNKLNQPFTWVLLIFIALFIGSLLFTLNNARFYHMPIGEVTK
FT                   VKHLNTEQVTDEHHNKDTKHSDELTIRVLNGKFEGQIGHINNTYYASQADSEKFNTHDK
FT                   ILLHINKHPSDANIIEKKRDTLVVAMTGLFIFIVLWVGRKVGIQSILSLVFNTAAVIGA
FT                   IAIHNTFPNTSLFLLMSIAVILATAVTLLLVTGWHWRTAITIASTLVGTFLCVGIAEIV
FT                   IRSTGGSGIKYETMSFLTLPPKEVFLASVIVGTLGAVMDVAITIASGMYEIWRRTPEID
FT                   MTRWALAGRNIGQDIMGTMTNILLFSYLAGSLPMMLIYLRNANTITYTISMNWSLEIAR
FT                   ALIGGIGIVLTIPITIVLMQLWAKLRGERV"
FT   CDS_pept        complement(101542..102426)
FT                   /transl_table=11
FT                   /gene="gltC"
FT                   /locus_tag="SCA_0104"
FT                   /product="putative transcription activator of glutamate
FT                   synthase operon"
FT                   /function="Transcriptional regulator"
FT                   /note="InterPro: LysR substrate binding domain,HTH motif"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0104"
FT                   /db_xref="GOA:B9DLH4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLH4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27018.1"
FT                   /translation="MEFKQLKYFIEVAKREHLSEAALELNIAQSAISRQISQLEDELNV
FT                   SLFRREGRHIYLTETGQRFLAEASKIVEQSEQTLKMFQKEQEIESKHIKIGYIESYVSE
FT                   LLTLLIQKFENEYTTTLLPLMKDNKELLHMLLTRDIDVAFMDLSSDLKRNNDLIITPLF
FT                   EDSYVLYVPKQDPLASATHPPLNQLNQSTLFSLSEMPDALIQQIEHATRNHVYRISSTR
FT                   LASYLLKKNRGYVLAPQYALLKENDAWARLSLNHTELKRTICAVIHKDNHKPELKALQD
FT                   EINALLSHTSVYH"
FT   CDS_pept        102568..107061
FT                   /transl_table=11
FT                   /gene="gltB"
FT                   /locus_tag="SCA_0105"
FT                   /product="glutamate synthase large subunit"
FT                   /function="Glutamate synthase domain 2"
FT                   /EC_number="1.4.1.13"
FT                   /note="(P39812) Glutamate synthase [NADPH] large chain (EC
FT                   1.4.1.13) (NADPH-GOGAT),InterPro: Glutamate synthase
FT                   amidotransferase domain"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0105"
FT                   /db_xref="GOA:B9DLG3"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLG3"
FT                   /inference="similar to AA sequence:UniProtKB:P39812"
FT                   /protein_id="CAL27019.1"
FT                   /translation="MGRETQNQGLYDPRNEHDACGIGFYANMDNLRSHDIVIQSLEMLR
FT                   RLDHRGGIGADGMTGDGAGIMTEIPFDYFEKHTDFKLPEEGNYAVGLFFTNSPIEGSRH
FT                   ETVFRAYFESEGLKVIGYRDVPVEVSAVPPHVAETMPYIQQIFIDLKHSADAEKRLYLA
FT                   RKQIEFYGAEQELELYFTSLSSKTIVYKGWLRSDQIKSLFIDLNHPDYVSKLGLVHSRF
FT                   STNTFPSWKRAHPNRLLMHNGEINTIRGNINWMRARQKRLIQTLFDESDQQKVHEILDV
FT                   DGSDSSIVDNALEFLSLAMEPEKAAILLVPEPWQYSKANQSSVRAFYEYYSYLMEPWDG
FT                   PTMIAFCNGDKIGALTDRNGLRPGRYTITNDNHIIFSSEVGVIDVDEKDVAFKGRLNPG
FT                   RLLLVDFEKHEVVHNHILKKEIADELPYEDWLEKHKVNLNLDVPFESKGWNAEKLQQLQ
FT                   KQFSYTREEIHKYMKELVEGKKDPIGAMGYDAPLAVLNERPESLFNYFKQLFAQVTNPP
FT                   IDAYREKIVTSELSYLGKEGNLLVPGTDALNRLQLKHPVLTEAQLKAAESGPFNIKCLS
FT                   TIYTGDLESALENLKEEAIKAVKQGHDILVLDDSKLQDEPGYAIPILLAISYLHQALII
FT                   ENLRQETSLVAKGGEIREVHHVACLLGYGANAVVPYLAQETIAALVSQGELSGDVAEQV
FT                   KVYTDVLAEGVIKVMAKMGISTVQSYQGAQIFEAVGLSKEVIDKYFTGTQSKLSGLTIE
FT                   LIDQENKKRQSREEAHLDSGSTFQWRQQGQYHAFNPTTIRLLQQACRENDYNLFKEYSQ
FT                   SVNEHRTDHIRQLMKFKSRSAINIDEVEPVEAIVHRFNTGAMSYGSISTEAHSTLAEAM
FT                   NQIGGKSNSGEGGEEPERYISGPHGENYTSSIKQVASGRFGVISDYLQHATEIQIKVAQ
FT                   GAKPGEGGQLPGTKVYPWIAEIRGSTPGIGLISPPPHHDIYSIEDLAQLIHDLKNANPK
FT                   ANIAVKLVSKSGVGTIAAGVAKAFADKIVISGYDGGTGASPKTSIQHAGLPWEIGLAET
FT                   HQTLMMNNLRSRVRLETDGKLLTGHDVAYACALGAEEFGFATAPLIVLGCVMMRVCHKD
FT                   TCPVGVATQNEDLRALFTGRADHVVNFMHFIAHELREILAELGLRTVDELIGRSDLLEP
FT                   SSEVHSEKARSLNVAPLLHQEQGPRFKEIEQLHHLEEGFDAAELIPDAEASILSGTKFR
FT                   GHYNLCNEQRDVGVTAGSLITQAHGAEGLPEDTIYVETTGHAGQSIGAFTPSGLTIHHT
FT                   GDANDYVGKGLSGGKIIINAPNEEREENIIAGNVCFYGASSGKAFINGYAGERFCIRNS
FT                   GVHAVVEGIGNHGLEYMTGGRVVVLGNVGDNFGQGMSGGVAYIFPDDVEQFKAYHALET
FT                   LDFDALSHPEEFETLKNMLEEHAAYTGSKKAKAILADFDNIVDYVVKVIPKDYKLMMHK
FT                   LELHHRQTENSEQAVLNAFYDSSTEVTSDEPFSAVY"
FT   CDS_pept        107084..108556
FT                   /transl_table=11
FT                   /gene="gltD"
FT                   /locus_tag="SCA_0106"
FT                   /product="NADH-glutamate synthase small subunit"
FT                   /function="NADPH-dependent glutamate synthase beta chain
FT                   and related oxidoreductases"
FT                   /EC_number="1.4.1.13"
FT                   /note="(Q9C102) Putative glutamate synthase [NADPH] (EC
FT                   1.4.1.13) (NADPH-GOGAT),InterPro: Glutamate synthase
FT                   NADH/NADPH small subunit 1"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0106"
FT                   /db_xref="GOA:B9DLG4"
FT                   /db_xref="InterPro:IPR006005"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLG4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27020.1"
FT                   /translation="MGEFKGFMKYDRQALPELSLAERLTSHVAFQQCFSKEDAALQGAR
FT                   CMDCGTPFCQTGQLVERDTVGCPIGNYIPEWNDLVYHQDYKAAYERLSETNNFPDFTGS
FT                   VCPAPCEQSCVMNINRDPVAIKGIERTIIDEAFENGWVEPRVPSQRIAQRVAIVGSGPA
FT                   GLTAADELNAKGYEVTVYERAREAGGLLMYGIPNMKLDKEVVRRRIRLMEEAGIRFVTN
FT                   TEIGKDISKEALESEYDAIIVCTGSQQARDLPLEGRMGYGIHFAMDYLTEQTQIANGEL
FT                   KPEDAEICAEGKNVIVIGSGDTGADCVATALRENCKTVVQFNYRTKLPERYEIEGNPYW
FT                   PLSMPVFKMDYAHKEAEERFGFEPRAYGAQTMRYDVDRIGNVRGVYTQTLRKIPDGSTK
FT                   IDDTEKHWPADLILLAIGFIGTENTVPNTFDLPTEQNKIVANEVDYTTNQPHIFTAGDA
FT                   RRGQSLVVWAIKEGRGVAKSVHRYLQKQLVLS"
FT   tRNA            108696..108788
FT                   /gene="tRNA-Ser (TGA)"
FT                   /locus_tag="SCA_t0001"
FT                   /product="transfer RNA-Ser (TGA)"
FT                   /anticodon="(pos:108732..108734,aa:Ser)"
FT                   /note="tRNA-Sca_0001"
FT                   /inference="nucleotide motif:tRNAscan"
FT   CDS_pept        108983..109384
FT                   /transl_table=11
FT                   /locus_tag="SCA_0107"
FT                   /product="putative lyase"
FT                   /function="Lactoylglutathione lyase and related lyases"
FT                   /note="(Q55595) Probable lactoylglutathione lyase (EC
FT                   4.4.1.5) (Methylglyoxalase) (Aldoketomutase) (Glyoxalase I)
FT                   (Glx I) (Ketone-aldehyde mutase) (S-D-lactoylglutathione
FT                   methylglyoxal lyase),InterPro: Glyoxalase/Bleomycin
FT                   resistance protein/dioxygenase domain"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0107"
FT                   /db_xref="GOA:B9DLG5"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLG5"
FT                   /inference="similar to AA sequence:UniProtKB:Q55595"
FT                   /protein_id="CAL27021.1"
FT                   /translation="MEIKVASIFVDNQDQALKFYTEILGFQKKADEPAGEYRWITVVSP
FT                   ENPDGTELLLEPNNHPVAKAYQEGLKEEGIPCTMFDVEDVQAEYQRLKEQGVGFTMAPM
FT                   DYGSGVKFAIFDDTCGNLVQIIERKKLEK"
FT   CDS_pept        109544..110230
FT                   /transl_table=11
FT                   /locus_tag="SCA_0108"
FT                   /product="truncated PTS system sugar-specific IIBC
FT                   component (fragment 1)"
FT                   /function="Phosphotransferase system IIC components
FT                   glucose/maltose/N-acetylglucosamine-specific"
FT                   /note="similar to N-terminal part (aa 1-227) of
FT                   phosphotransferase system trehalose-specific enzyme IIBC
FT                   component [Staphylococcus saprophyticus subsp.
FT                   saprophyticus ATCC (YP_302372): 475 aa,InterPro:
FT                   Phosphotransferase system PTS EIIB domain"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0108"
FT                   /db_xref="GOA:B9DLG6"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLG6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27022.1"
FT                   /translation="MAVKDKDVKQIVEAIGGAENVETATHCVTRLRLVLKDDDKVNKDK
FT                   LNDNPLVKGQFKADNQYQIVIGPGTVDEVYKKFMDDIGKEGASKDDVKAAAAKKGNPIQ
FT                   RLVKLLGDIFIPILPAIVTAGLLMGIYNLLTMKDLFGPKPLTEQFPQIHDFADIVNVIA
FT                   TTAFIFLPALIGWSSMRVFGGNPVLGLVLGLVLMHPQLVSQYDLNQGSKIPVWHIFGLD
FT                   IKQLNY"
FT   CDS_pept        110297..110971
FT                   /transl_table=11
FT                   /locus_tag="SCA_0109"
FT                   /product="truncated PTS system sugar-specific IIBC
FT                   component (fragment 2)"
FT                   /function="Phosphotransferase system IIC components
FT                   glucose/maltose/N-acetylglucosamine-specific"
FT                   /note="similar to C-terminal part (aa 229-474) of
FT                   phosphotransferase system trehalose-specific enzyme IIBC
FT                   component [Staphylococcus saprophyticus subsp.
FT                   saprophyticus ATCC (YP_302372): 475 aa"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0109"
FT                   /db_xref="GOA:B9DLG7"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLG7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27023.1"
FT                   /translation="MVHDSIKMLVGGPIALLVTGFLAFLVIGPIALWIGTGITDVVTFL
FT                   FNRAGWLGGAIYGLFYAPLVITGLHHMFLAVDFQLMGSSLKGTYLWPILAISNICQGSA
FT                   AFGAWFVYKRRKMAKEEGLALTSGISGLLGVTEPAMFGVNIPLKYPFVAAILTSCVLGS
FT                   IIGASKVLGNVGVGGVPAIISIQKEYWMVYAICTIIAVIVPAVLTVIFSKFAKNKAKEM
FT                   VD"
FT   CDS_pept        111107..112744
FT                   /transl_table=11
FT                   /gene="treC"
FT                   /locus_tag="SCA_0110"
FT                   /product="trehalose-6-phosphate hydrolase"
FT                   /function="Glycosidases"
FT                   /EC_number="3.2.1.93"
FT                   /note="(P39795) Trehalose-6-phosphate hydrolase (EC
FT                   3.2.1.93) (Alphaalpha-phosphotrehalase),InterPro: Alpha
FT                   amylase catalytic domain,Alpha amylase catalytic subdomain"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0110"
FT                   /db_xref="GOA:B9DLG8"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012769"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLG8"
FT                   /inference="similar to AA sequence:UniProtKB:P39795"
FT                   /protein_id="CAL27024.1"
FT                   /translation="MQQNDWRKSVVYQIYPKSFNDTTGNGVGDLNGIIEKMDYLEYLGV
FT                   GYLWLTPVYQSPMNDNGYDISDYLSINEDFGTKEELKQLLDEAHQHNLKVMMDIVINHT
FT                   STEHEWFKAAISEPDNPYRDYYFFRKSAKEGVPPTNWESKFGGNAWKYDEKSDEYYLHL
FT                   FDVTQADLNWENPKVREALYDMINYWIDFGVDGFRFDVINLISKGEFRDSDKIGKEFYT
FT                   DGPRVHEFIHEMNRNTFGNKDLMTVGEMSSTTIDNCIKYTNPEREELSSVFNFHHLKVD
FT                   YADGEKWTYADFDFIELKRILMEWQIGIHDGNGWNAIFWCNHDQPRVVSRFGDDSTEAL
FT                   RQKSAKMLAVALHLLQGTPYIYQGEEIGMTNPHFTSINQYRDVESLNAYDNLKAQGYAD
FT                   KEIMQILDQKSRDNSRTPMQWTAGENAGFTSGTPWIDIPSNYQHINVEDEVENEHSILQ
FT                   TYRELIRLRHEHDIITYGDILPLYMDDPNLMIYQRSYEGKKWLVIANFSKEAVMVPEDL
FT                   DTDGEVILERGTINNGEIEGYGAIVIEQ"
FT   CDS_pept        112771..113493
FT                   /transl_table=11
FT                   /locus_tag="SCA_0111"
FT                   /product="putative trehalose operon transcriptional
FT                   regulator"
FT                   /function="Transcriptional regulators"
FT                   /note="(P39796) Trehalose operon transcriptional
FT                   repressor,InterPro: Bacterial regulatory protein GntR
FT                   family"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0111"
FT                   /db_xref="GOA:B9DLG9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR012770"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLG9"
FT                   /inference="similar to AA sequence:UniProtKB:P39796"
FT                   /protein_id="CAL27025.1"
FT                   /translation="MITKPKKFTKIYDDLKANILNEEIGYGEQLPSENDLVATYKASRE
FT                   TVRRALNLLVGEGMIQKIRGKGSIVIYQGVTEFPFSKLTSFKEVQERLGVELETEVKLL
FT                   AKENAGAVPKVKEALNLKSEDKLWHLIRYRKADGRVKIIDEDYLVETVVPNLTEDIVSD
FT                   SLYDYIEQELGLDISYSRKAITFEPFTEQEYAAFGTINPPYTATVRGVVHLRDMTKFQY
FT                   NVAKHIATDFRFIDFSRR"
FT   CDS_pept        113623..113898
FT                   /transl_table=11
FT                   /locus_tag="SCA_0113"
FT                   /product="similar to transcriptional regulator (ArsR
FT                   family)"
FT                   /function="predicted transcriptional regulators"
FT                   /note="(P30338) Arsenical resistance operon
FT                   repressor,InterPro: Bacterial regulatory protein ArsR
FT                   family"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0113"
FT                   /db_xref="GOA:B9DLH0"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLH0"
FT                   /inference="similar to AA sequence:UniProtKB:P30338"
FT                   /protein_id="CAL27026.1"
FT                   /translation="MKAGNLMKDIFKALSDSTRRSILEMLKEQKLTASEIAEHFDMSQA
FT                   SVSQHLKILRLNDLIYSERKGKYLYYHLNLSVFEEVIKWIVQFKQD"
FT   CDS_pept        113912..114583
FT                   /transl_table=11
FT                   /locus_tag="SCA_0114"
FT                   /product="putative membrane protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0114"
FT                   /db_xref="GOA:B9DLH1"
FT                   /db_xref="InterPro:IPR025962"
FT                   /db_xref="InterPro:IPR026272"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLH1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27027.1"
FT                   /translation="MSEVEVGTKKFDRFSIVAIVLTAITWVVFIPFLPWTIPLHYDNQN
FT                   QLDLYLNKVTAPIVIMLVMIVSYIVIKRKAQRDKQHKKLGNVSFNTAFWNPMAQSFIYL
FT                   ISLLMIFHAQGYNIINNFIGILILSFLLILWGNYLQIIPVNSKNIGIRNQWTSANEAVW
FT                   KRTHRFVSRLFIATGFVLLVLALLQVINSVTALLVFALVGGAAPFIYSKYAYQKIVHGK
FT                   S"
FT   CDS_pept        complement(115096..116004)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0115"
FT                   /product="putative transcriptional regulator of LysR type"
FT                   /function="Transcriptional regulator"
FT                   /note="(P37499) Putative HTH-type transcriptional regulator
FT                   yybE,InterPro: LysR substrate binding domain"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0115"
FT                   /db_xref="GOA:B9DLH2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLH2"
FT                   /inference="similar to AA sequence:UniProtKB:P37499"
FT                   /protein_id="CAL27028.1"
FT                   /translation="MNFIQLHHIKTIHETGSITKAAHILHITQSALSQSILNLETELNI
FT                   QLFKRQKSGTTLTEQGHQIFPIMMDLIDQESLLYDKIQSLNAEMEGSLSIATIPSLFMT
FT                   IVPSVLSSFKKDNPNIDVQIIEAENNEIKQLVSSGEVDIGLYTILNEDDLDVTGAQYTP
FT                   LFSSAFTAIVPKDSKLAYLKNLSLEDIKAFPFILYDRNFYKKNIQKFEAANGPINLLFS
FT                   TDNVGVLFNSVAEGLGISILSDLMVQNTPFYQRSMIKTVPIGAPFNQMIEFGVLHMKHS
FT                   DKEKLIGEFKNYLAEAADKLV"
FT   CDS_pept        116135..117325
FT                   /transl_table=11
FT                   /locus_tag="SCA_0116"
FT                   /product="putative transporter protein"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /note="TMHMM: TMHelix ,InterPro: General substrate
FT                   transporter"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0116"
FT                   /db_xref="GOA:B9DLH3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLH3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27029.1"
FT                   /translation="MYRNLWTKDFIFITVINFLMYIIHYALIVTVTTFTIDTFHANEAM
FT                   GGLAAGIFIIGMLFGRLFTGKYIDQLNLKKTLFFGLVFSFIAIGLYFLIHSLLVLMIVR
FT                   LIHGLAFGMSSTTTGTYSSTIVPEDRKGEGIGYYALSTTVASAIGPFLGILINQKLNFQ
FT                   SNFVVCLICILLSAVLALFISNIKQPSLNKEKEEKVEAAKPKGLAQLFQKQAVPISIVI
FT                   VFVGIAYSSVLAFLDSYAAHIGLASAASFFFVVYAVSTFVVRPITGKVFDNYGANKVVY
FT                   PVLIAFILGLVLLGVAHSSWLLLISAIFIGIGYGTLIPSFQTIAIQASPPEKIGLATST
FT                   FYIFADLGAGAGPTLLGIVIGSFGYRNLYFAMAVLLVLVIGLYYLLHGRKHKTMEY"
FT   CDS_pept        complement(117369..117575)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0117"
FT                   /product="putative membrane protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0117"
FT                   /db_xref="GOA:B9DLG2"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLG2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27030.1"
FT                   /translation="MVIKNKSYTILGIVFMVLCLASFATMHNIWMIIPGFVCGVLFLAF
FT                   GLHFKDRTELQKSRLHKKELQSE"
FT   CDS_pept        117812..118336
FT                   /transl_table=11
FT                   /locus_tag="SCA_0118"
FT                   /product="putative acetyltransferase (GNAT) family protein"
FT                   /function="predicted acetyltransferase"
FT                   /note="(P39368) Hypothetical acetyltransferase yjhQ (EC
FT                   2.3.1.-),InterPro: GCN5-related N-acetyltransferase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0118"
FT                   /db_xref="GOA:B9DLF4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLF4"
FT                   /inference="similar to AA sequence:UniProtKB:P39368"
FT                   /protein_id="CAL27031.1"
FT                   /translation="MQILLGTVTENDYAIIAHLKNKKDSEGLFEGEYYEDSLRRLRRIP
FT                   NYNPDFEMIARTDEDEIVGHILLMEEMIINGEDLQRPLMIKSLSVKEDYREYGIGKALV
FT                   EAVESRAKEAGYNEIIVEGEPEYFRSLGFVPLSNYSVEVPDDEDIDQFSIFLLWDSLDA
FT                   CPQGKLVLENI"
FT   CDS_pept        118417..120168
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="SCA_0119"
FT                   /product="DNA polymerase III gamma and tau subunits"
FT                   /function="DNA polymerase III gamma/tau subunits"
FT                   /EC_number="2.7.7.7"
FT                   /note="(P09122) DNA polymerase III subunit gamma/tau (EC
FT                   2.7.7.7),InterPro: AAA ATPase central region"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0119"
FT                   /db_xref="GOA:B9DLF5"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLF5"
FT                   /inference="similar to AA sequence:UniProtKB:P09122"
FT                   /protein_id="CAL27032.1"
FT                   /translation="MNYQALYRMYRPQSFDDVVGQEHVTKTLRNAIAKGKQSHAYIFSG
FT                   PRGTGKTSIAKVFAKAINCPNSVDGEPCNECDICKSITQGSNSDVIEIDAASNNGVDEI
FT                   RNIRDKVKYAPSQSKYKVYIIDEVHMLTTGAFNALLKTLEEPPAHAIFILATTEPHKIP
FT                   PTIISRAQRFDFKAIGLDQIIERLRYVAESQHIEYDDEAIAFIAKASEGGMRDALSIMD
FT                   QAIAFGDEHLTLQDALNVTGSVDEASLNALLNDVANGQVKDAFARYHQFIAEGKEVNRL
FT                   INDLIYFVRDTIMNKTAQRETEYDALMAFDLDTLYKMIDLINDTLVSVRFSVNQNVHFE
FT                   VLLVKMAELIKEGDAPVANPDMHSANAHQAPSAPQPAQQNNDVSSALLQRLEHLEQELN
FT                   ALKQQGVTSTNTPPKQKSNSRGRRRSKNSYSMTQIAKVLDSANKEDIKLLKDHWQEVID
FT                   HAKNHNQKALVSLLQNSIPVAASEKSVLVQFEAEIHCEIVNDDDEKRSNLEEVVRSIIN
FT                   KNVSVVGVPADQWLQVRSEYIQNRKKGGANNASQESANEPEQQEVDIVQKAKDMFGEDT
FT                   VHITDED"
FT   CDS_pept        120372..120689
FT                   /transl_table=11
FT                   /locus_tag="SCA_0120"
FT                   /product="conserved hypothetical protein"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /note="(P17577) Hypothetical UPF0133 protein ybaB,InterPro:
FT                   Conserved hypothetical protein 103"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0120"
FT                   /db_xref="GOA:B9DLF6"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DLF6"
FT                   /inference="similar to AA sequence:UniProtKB:P17577"
FT                   /protein_id="CAL27033.1"
FT                   /translation="MRGGGNMQQMMKQMQKMQKKMAEEQEKLKDEKVEGSAGGGMVKVV
FT                   VTGHKEVVDVVIDEEAVDPDDVEMLQDLVLAATNEAMNKADELTSERLGKHTKGLNIPG
FT                   M"
FT   CDS_pept        120696..121292
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="SCA_0121"
FT                   /product="putative recombination protein"
FT                   /function="Recombinational DNA repair protein (RecF
FT                   pathway)"
FT                   /note="(Q8Y3X7) Recombination protein recR,InterPro: RecR
FT                   protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0121"
FT                   /db_xref="GOA:B9DLF7"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DLF7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27034.1"
FT                   /translation="MHYPEPISKLIDSFMKLPGIGPKTAQRLAFHVLDMKEDDVVQFAK
FT                   ALVDVKRELTYCSVCGHITEEDPCYICNDKQRDRSVICVVEDDKDVIAMEKMREYKGLY
FT                   HVLHGAISPMDGIGPEDINIPSLIERLKDEEVKELILAMNPNLEGESTAMYISRLVKPI
FT                   GIKVTRLAQGLSVGGDLEYADEVTLSRAIEGRTEM"
FT   rRNA            121792..123346
FT                   /gene="16S rRNA A"
FT                   /locus_tag="SCA_16S_rRNA_A"
FT                   /product="16S rRNA"
FT                   /note="Sca_16S_rRNA_A"
FT   rRNA            123589..126512
FT                   /gene="23S rRNA A"
FT                   /locus_tag="SCA_23S_rRNA_A"
FT                   /product="23S rRNA"
FT                   /note="Sca_23S_rRNA_A"
FT   rRNA            126583..126697
FT                   /gene="5S rRNA A"
FT                   /locus_tag="SCA_5S_rRNA_A"
FT                   /product="5S rRNA"
FT                   /note="Sca_5S_rRNA_A"
FT   CDS_pept        126795..128144
FT                   /transl_table=11
FT                   /locus_tag="SCA_0122"
FT                   /product="putative Orn/Lys/Arg decarboxylase"
FT                   /function="Arginine/lysine/ornithine decarboxylases"
FT                   /note="InterPro: Orn/Lys/Arg decarboxylase major region"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0122"
FT                   /db_xref="GOA:B9DLF8"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLF8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27035.1"
FT                   /translation="MNLPLNDKLKTFLDKTPISFHVPGHKNMTIGDLKEIELAMDITEI
FT                   TDFDDLHHPEEVLEESMKQLAKHPDYEAFYLVNGTTSGILSVIQAAAQSTEPMLISRNV
FT                   HKSVFHGLDLAQQKAQIMPMNVSKLTNQYLGPEISKTSQMMNQQLLSIITYPNYYGETF
FT                   DVQRFIQESHAHQIPVLVDEAHGAHFGIKRFPESSLEYGADYVVQSYHKTLPAFTMSSV
FT                   IFIHKDAPYYNQVRQYLTYFQSSSPSYLLMAGLERAQGFYQNYEASTFFEKRDIVINEL
FT                   RQRGFVVNEMDDALKITVQYPGYSGYHVQEWLEKQEIYIELSDNDQTLLILPLWHEHDT
FT                   FPFELLKERITQIILPEAQKISKNKNKNVLPTESSDYQPVQLRHTIEIPIQQAVGKRLA
FT                   QHLVPYPPGIPSFFKGEQVTATTVKKLESWIKQGIRVEGLKDNKIRIEDN"
FT   CDS_pept        128146..128760
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="SCA_0123"
FT                   /product="thymidylate kinase"
FT                   /function="Thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="(Q8NY05) Thymidylate kinase (EC 2.7.4.9) (dTMP
FT                   kinase),InterPro: Thymidylate kinase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0123"
FT                   /db_xref="GOA:B9DLF9"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLF9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27036.1"
FT                   /translation="MSAFITFEGPEGSGKTTVLQRVAERLSQDYDVLKTREPGGVPAAE
FT                   QIREILLDGEAVDDRTEALLFAASRREHLVEKVLPALKEDKVVLCDRYIDSSLAYQGFA
FT                   RGIGVEEVRAINEFAINGLYPDLTIYLDITAETGRERIENNDRNMNRLDHESIAFHQRV
FT                   IKGYHDLIDKEPERFKVIDANQELEAVVEDTYTAIKMFLGK"
FT   CDS_pept        128971..129300
FT                   /transl_table=11
FT                   /locus_tag="SCA_0124"
FT                   /product="conserved hypothetical protein"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /note="(P37538) Hypothetical protein yaaQ"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0124"
FT                   /db_xref="InterPro:IPR010375"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLG0"
FT                   /inference="similar to AA sequence:UniProtKB:P37538"
FT                   /protein_id="CAL27037.1"
FT                   /translation="MKMVIAIVQDQDSQELSDQLVKNNFRATKLATTGGFLRAGNTTFL
FT                   CGVDDDKVDDLLSVINKTCGNREQLVSPITPMGGSADSYIPYPVEVEVGGATVFVMPVD
FT                   AFHRF"
FT   CDS_pept        129474..130400
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="SCA_0125"
FT                   /product="putative DNA polymerase III, delta' subunit"
FT                   /function="ATPase involved in DNA replication"
FT                   /EC_number="2.7.7.7"
FT                   /note="(P37540) DNA polymerase III delta subunit (EC
FT                   2.7.7.7),InterPro: Replication factor C conserved domain"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0125"
FT                   /db_xref="GOA:B9DLG1"
FT                   /db_xref="InterPro:IPR015199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLG1"
FT                   /inference="similar to AA sequence:UniProtKB:P37540"
FT                   /protein_id="CAL27038.1"
FT                   /translation="MDELSRLTNAYQSGKLSHAYLFEGDDGQTMQQTAMAFAKLILCND
FT                   NEICQAKVDELNHPDFRYVSTEESNIKKEKIEALVHAMNQLPVEGTHKVYIIDGFEKLT
FT                   VQGENSILKFLEEPPENTIAILLSTKPEQILSTIHSRCQHVYFRPMSQEKLIERLEEQD
FT                   ISKPIAEMLSTYTTQIEEARALNEEYDLVALRKNIVNWCQLLLSNRSMALIALVDLMKT
FT                   AKNKKLQQLTLSVVNAFFQDIMHEKAETSGHLVFSEMETDIKHYAEHLSYTQLTHMYDH
FT                   ITEAHKKLTQNVNPMLVFEQIVIKGVG"
FT   CDS_pept        130401..131207
FT                   /transl_table=11
FT                   /locus_tag="SCA_0126"
FT                   /product="putative homolog of PSP1"
FT                   /function="uncharacterized homolog of PSP1"
FT                   /note="(P37541) Hypothetical protein yaaT,InterPro: PSP1
FT                   C-terminal conserved region"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0126"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLF3"
FT                   /inference="similar to AA sequence:UniProtKB:P37541"
FT                   /protein_id="CAL27039.1"
FT                   /translation="MPQVIGVQFQKAGKLEYYAPIQNITLCCGDRVVVESKRGVEIGAV
FT                   KDGALDVEAEDVTLPLKPIIRVATEQDLEKHACNEEEADEAMQFCKEAIEQLELEMRLV
FT                   NCEYTLDQSKVIFNFTADDRIDFRKLVKILASRLRTRIELRQIGVRDEAKLLGGIGPCG
FT                   RSLCCSTFLGDFEPVSIKMAKDQNLSLNPTKISGACGRLMCCLKYENDYYEAAREQLPD
FT                   VGTKIETPDGKGTVVGLNMLDISMQVKVDGLEQPLEYSVEDLEEIY"
FT   CDS_pept        131222..131611
FT                   /transl_table=11
FT                   /locus_tag="SCA_0127"
FT                   /product="conserved hypothetical protein"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /note="(P37542) Hypothetical protein yabA"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0127"
FT                   /db_xref="GOA:B9DLE1"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLE1"
FT                   /inference="similar to AA sequence:UniProtKB:P37542"
FT                   /protein_id="CAL27040.1"
FT                   /translation="MDRRDLMERLMRLESNVQNLYQEMAELKTIAMELVEENVALEVEN
FT                   NHLKRLIGRSEEGGLHSDIQDNTETHESKEEQEEHQQRKHRLSSKENLAILYQEGFHIC
FT                   KGDLFGKHRHGEDCLFCLQTLEEQS"
FT   CDS_pept        131700..132491
FT                   /transl_table=11
FT                   /locus_tag="SCA_0128"
FT                   /product="conserved hypothetical protein with SAM binding
FT                   motif"
FT                   /function="predicted O-methyltransferase"
FT                   /note="(P37543) Hypothetical protein yabB,InterPro: SAM
FT                   (and some other nucleotide) binding motif"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0128"
FT                   /db_xref="GOA:B9DLE2"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLE2"
FT                   /inference="similar to AA sequence:UniProtKB:P37543"
FT                   /protein_id="CAL27041.1"
FT                   /translation="MKHSNRFLSRSLYILMKVEMNMLEENERLDSLLKEDLEIIQNDEV
FT                   FSFSTDALLLGHFTHLRKNDKVMDLCSGNGVIPLLLSHKGQHPIDAIEIQPQLVNMAER
FT                   SIQHNQLSERIQIYEMDLKNVRQDFIPSQYTVVTCNPPYFKTAQMHQHQKEAHKIARHE
FT                   VLCTLEDCVEAARHLLKQGGRLIMVHRAERLMDVLSTYRAARIEPKKLTLIYSKKSKDA
FT                   HAIIVEGRKDGKPGLDIQPSFYMYQDDGEYTLEMRAIYYGE"
FT   CDS_pept        132481..132741
FT                   /transl_table=11
FT                   /locus_tag="SCA_0129"
FT                   /product="putative nuclease"
FT                   /function="predicted endonuclease containing a URI domain"
FT                   /note="(Q9KLK4) Hypothetical UPF0213 protein
FT                   VCA0739,InterPro: Excinuclease ABC C subunit N-terminal"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0129"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLE3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27042.1"
FT                   /translation="MENKYFIYIVRCRDGSLYTGYTNDVIARVEKHNSGKGAKYTKTRR
FT                   PVKLVYQEAFETKSEAMKREYQIKTYTRMQKLQLIERGVIS"
FT   CDS_pept        132738..133577
FT                   /transl_table=11
FT                   /locus_tag="SCA_0130"
FT                   /product="tetrapyrrole (corrin/porphyrin) methylase family
FT                   protein"
FT                   /function="predicted methyltransferases"
FT                   /note="(Q9KGL2) Hypothetical UPF0011 protein
FT                   BH0049,InterPro: Protein of unknown function UPF0011"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0130"
FT                   /db_xref="GOA:B9DLE4"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLE4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27043.1"
FT                   /translation="MTGTLYLVGTPIGNLSDITYRAVDTLKHVDLIACEDTRVTKKLCN
FT                   HYEIHAPLKSYHEHNKEQQTEPLVHTLLEGQNVALVSDAGLPLISDPGYELVVSARAAD
FT                   IPVVPIPGPNAGLTALMASGLPSYIYTFLGFLPRKSKEKTAVLEKRMFEDSTLIVYESP
FT                   YRIADTLKAIEAVDATRPVTLGRELTKKFEQIQTASVSELAAAVEKGEVPLKGEFVVLI
FT                   EGAERVAETEWFEELDIPEHVEHYIRQDMKPKKAIKQVAEDRNMKTGEVYDIYHQIR"
FT   CDS_pept        133755..135101
FT                   /transl_table=11
FT                   /gene="geh'"
FT                   /locus_tag="SCA_0131"
FT                   /product="truncated lipase (fragment 1)"
FT                   /note="(P10335) Lipase precursor (EC 3.1.1.3) (Glycerol
FT                   ester hydrolase),InterPro: YSIRK Gram-positive signal
FT                   peptide,Fragment 1 and 2 (Sca_0132) are similar to N- and
FT                   C-terminal part of lipase gene gehWC of S. warneri
FT                   (BAD90561)."
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0131"
FT                   /db_xref="GOA:B9DLE5"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLE5"
FT                   /inference="similar to AA sequence:UniProtKB:P10335"
FT                   /protein_id="CAL27044.1"
FT                   /translation="MKRNNLSRNRYAIRKYTVGTASALVASVAFLTVSHSADAAEQNGE
FT                   NNVEAISKAQVQTANSFQPETSLQNTSQTPESDNLNQSPSQNVLQSNHQPSKSLTSQQP
FT                   TSLEMQNTTKESTQNETSVKAPKSNTASEEQTQNSVPAPKAPEKDSISPSATEKTTEQQ
FT                   TEQPAPEVQVAPGVLTPAQGQIAEKGTEIEDTATKKPQPIEPAQNDKKREEPITEKATK
FT                   QQKEQPAPEVQVAPEVLTPAQGQIAEKGTEIEDTATKKPQPIEPSHKTESIEPSIIEEP
FT                   VTKQAETIQPAEKNADESSQSKAASESTSSEKTIPTTDAAASTDSSKNTSTESSTEKEA
FT                   VAGSQNVIKDVPEKSAHVTTTSTPGNPLEKPQPQKNQQPQSSTPANTTASQRTSSQTDG
FT                   QSTTKEAKAAQEQAINKYPVIFVHGFMGFVGDIKPDLYPNYWGGDKYHL"
FT   CDS_pept        135326..136129
FT                   /transl_table=11
FT                   /gene="geh''"
FT                   /locus_tag="SCA_0132"
FT                   /product="truncated lipase (fragment 2)"
FT                   /function="predicted acetyltransferases and hydrolases with
FT                   the alpha/beta hydrolase fold"
FT                   /note="(Q02510) Lipase precursor (EC 3.1.1.3) (Glycerol
FT                   ester hydrolase),Fragment 1 (Sca_0131) and 2 are similar to
FT                   N- and C-terminal part of lipase gene gehWC of S. warneri
FT                   (BAD90561)."
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0132"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLE6"
FT                   /inference="similar to AA sequence:UniProtKB:Q02510"
FT                   /protein_id="CAL27045.1"
FT                   /translation="MGGQTIRLMEHFLRFGNQEEIDYQRTHGGTISPLFEGGQDNMISS
FT                   ITTLGTPHNGSAAADRVGNQQAFKDIVYALGRMGGGKLANIDFGFEKWGFKQGANESYI
FT                   DYMKRVAESALWKTDDNAMYDLTSKGSEALNENTPLNPNITYTTYTGLASHEGITGNYV
FT                   PDIGQFFLFDTTSRIIGSEPDKTLRPNDGIVSVVSSLYPTGQAFTDFTDGLKKGIWQVT
FT                   PVMQGWDHLDFVGLDALDFKHTGIELQQFYAGLINNMMKVEEAEV"
FT   CDS_pept        137310..138026
FT                   /transl_table=11
FT                   /locus_tag="SCA_0133"
FT                   /product="putative membrane protein"
FT                   /note="TMHMM: TM helix"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0133"
FT                   /db_xref="GOA:B9DLE7"
FT                   /db_xref="InterPro:IPR031690"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLE7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27046.1"
FT                   /translation="MTKQTEENIYENLRKPGTQAISLITLFFVLFTGLIFAFGLKLENA
FT                   PNYLLASTAFQIIIALIGFIPLLYKTKPNNYGKFVKRLTGFSALCIISVYNLTFTVYNI
FT                   YFYLAAQHGVYLFKFWIIGTLTMIICYGFQLMQQFTLLREPEKFKGESENDKFLRKMIF
FT                   LFMFKVLSYIVFIQKIIEYFTIPNIAESRFTIIVVGVLIYAAMVFCSNVLYQSVLAYIE
FT                   FKEEGKSNEAGHANYA"
FT   CDS_pept        138076..138171
FT                   /transl_table=11
FT                   /locus_tag="SCA_0134"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0134"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLE8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27047.1"
FT                   /translation="MLEVKHIFIDEDIYTTGPIVFTKEIMGWVKI"
FT   CDS_pept        138156..138392
FT                   /transl_table=11
FT                   /locus_tag="SCA_0135"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0135"
FT                   /db_xref="InterPro:IPR031664"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLE9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27048.1"
FT                   /translation="MGEDLGFRTYLYIELMLEGGLKTNQYETKDIEVLNEIEYLEKQHQ
FT                   LQRISPYYHIIHEVDEMNCVDTKVKVRNIGERI"
FT   CDS_pept        138389..138865
FT                   /transl_table=11
FT                   /locus_tag="SCA_0136"
FT                   /product="truncated putative membrane protein"
FT                   /note="TMHMM: TM helix,According to BlastX comparison,this
FT                   ORF could be elongated by about 40aa encoded by adjacent
FT                   frame-shifted ORF."
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0136"
FT                   /db_xref="GOA:B9DLF0"
FT                   /db_xref="InterPro:IPR031689"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLF0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27049.1"
FT                   /translation="MTYLLLFLMAGLYYVVYITSVIYTEGIKLLQWIAYGICAIVFLIT
FT                   FLFVDSSFSTLQNYIFVLTIGFVVYGWLAIKSFCTRPYQVKIESMESNPNHPLIKEKYE
FT                   EVESLQINLASAKYKGVISGIISVICMIAIKLKLTPILKEDLAGGLFTIGLILF"
FT   CDS_pept        139012..139383
FT                   /transl_table=11
FT                   /locus_tag="SCA_0137"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0137"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLF1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27050.1"
FT                   /translation="MKKISLLSLCLLMIIVMGCTKGDRLPGSVKNDLHKADRKLEAVKI
FT                   FEIDHKKVIYEKEDRKLIMPLHFKEDVELPPKLVGSMATTPLSGNEDVDDVVVKYELKN
FT                   HKHELHYKRDKHGMLKRVN"
FT   CDS_pept        139741..140397
FT                   /transl_table=11
FT                   /locus_tag="SCA_0138"
FT                   /product="putative ABC transporter, ATP-binding protein"
FT                   /function="ABC-type uncharacterized transport system ATPase
FT                   component"
FT                   /note="(P26946) Hypothetical ABC transporter ATP-binding
FT                   protein,InterPro: ABC transporter"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0138"
FT                   /db_xref="GOA:B9DLF2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLF2"
FT                   /inference="similar to AA sequence:UniProtKB:P26946"
FT                   /protein_id="CAL27051.1"
FT                   /translation="MLLKLIAGLYQPTLGTRTANISSLSFAPDYLPEELSLTVQEYIDT
FT                   IYLMNKKSITLKEMNLQIQYLDLKPYLLYKIKDCSKGTRQKLNILQALVKPCDVLILDE
FT                   PFSGLDKNTKSYLANKLSELAETKTIILTNHEADVTFKQTLQTYNIETQHEEYQNIDNP
FT                   LYKTIIFESQTIPRFKEGKLTTLPDNRYSIQTEAAQLNKILFYLIQQNSTIIEVK"
FT   CDS_pept        140407..141084
FT                   /transl_table=11
FT                   /locus_tag="SCA_0139"
FT                   /product="putative ABC transporter, permease"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0139"
FT                   /db_xref="GOA:B9DLE0"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLE0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27052.1"
FT                   /translation="MLAFLKYQRYKAKHKPQFLIPYFFYILFIVFVYSYSGAESLSSYT
FT                   LTSIGLFAISVWLGIQNSKSELLNEKYIVLIQLTRASTYVIGKLIFIITLNLPLIFIAL
FT                   IYPLIFNKFIPTASLNEVLLGLYAHISAIILGTLIGSFALVPKIKHLKYLYLMAFLLIV
FT                   LTILKPVFINLYPFTKYVLWILPTLPDLEGSAVQLLFSAVTISFYSFIIFLILVYLFKH
FT                   SEE"
FT   CDS_pept        141353..143356
FT                   /transl_table=11
FT                   /gene="metS"
FT                   /locus_tag="SCA_0140"
FT                   /product="Methionyl-tRNA synthetase"
FT                   /function="Methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /note="(Q99WB3) Methionyl-tRNA synthetase (EC 6.1.1.10)
FT                   (Methionine--tRNA ligase) (MetRS),InterPro: Methionyl-tRNA
FT                   synthetase dimer-forming"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0140"
FT                   /db_xref="GOA:B9DLC7"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLC7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27053.1"
FT                   /translation="MAKDTFYITTPIYYPSGKLHIGHAYSTVAGDVIARYKRMQGYDVR
FT                   YLTGTDEHGQKIQEKAHKAGVSELEYLDEMISGIKSLWEKLEISNDDFIRTTEKRHEEV
FT                   VAKVFERLLEQGDIYLGEYEGWYSVPDETYYTESQLEEPVYDDNGKIIGGKSPDSGHEV
FT                   ELVKEESYFFNISKYADRLLAFYDEHPEFIQPPSRKNEMINNFIKPGLTDLAVSRTTFD
FT                   WGVQVPSNPKHVVYVWIDALVNYISALGYLSEDDSLFKKYWPADLHLMAKEIVRFHSIV
FT                   WPILLMALDLPLPKRVFAHGWILMKDGKMSKSKGNVVDPNVLIDRYGLDATRYYLMREL
FT                   PFGSDGVFTPEAFVDRTNFDLANDLGNLVNRTIAMINKYFDGELPAYEGPKHELDAEME
FT                   QFALDTVKEYHENMENLQFSVALSTVWKFISRTNKYIDETTPWVLAKDDSQKEMLGNVM
FT                   AHLVENIRFATVLLRPFITHAPRQIFEQLNINSPELFGFDSLNEYGALKAPISVTEKPQ
FT                   PIFPRLDTEKEVAFIKDSMQGSAPKPEAQAESAEEEKEEVPAKAQITIKDFDKVEIKAA
FT                   TIIDAENMKKSDKLLKIQVDLGEEQRQIVSGIAKFYEPDDIIGKKVAVVTNLKPAKLMG
FT                   RKSEGMILSAEKDGVLTLVSLPNAIPNGAVIK"
FT   CDS_pept        143564..144337
FT                   /transl_table=11
FT                   /locus_tag="SCA_0141"
FT                   /product="putative TatD-related deoxyribonuclease"
FT                   /function="Mg-dependent DNase"
FT                   /EC_number="3.1.21.-"
FT                   /note="(P37545) Putative deoxyribonuclease yabD (EC
FT                   3.1.21.-),InterPro: TatD-related deoxyribonuclease"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0141"
FT                   /db_xref="GOA:B9DLC8"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLC8"
FT                   /inference="similar to AA sequence:UniProtKB:P37545"
FT                   /protein_id="CAL27054.1"
FT                   /translation="MLIDTHVHLNDEQYDEDLEEVIDRAREARVDRMFVVGFDTPTIER
FT                   AMKLIDQYDFLYAIIGWHPVDAIDYTEECEQWIEELSKHPKVIGIGEMGLDYHWDKSPK
FT                   DIQKEVFRKQIALAKRVNLPIVIHNREATQDCIDILMEEHAEEVGGIMHSFSGSPEIAD
FT                   VVINKLGFYISLGGPVTFKNAKQPKEVAKHVPLDRLLVETDAPYLSPHPYRGKRNEPMR
FT                   VTLVAEQIAELRGISYEEVAEQTTENAERLFNLKK"
FT   CDS_pept        145136..145687
FT                   /transl_table=11
FT                   /locus_tag="SCA_0142"
FT                   /product="putative Primase-related protein (Toprim domain)"
FT                   /function="Small primase-like proteins (Toprim domain)"
FT                   /note="(P37547) Hypothetical protein yabF,InterPro:
FT                   Primase-related protein,contains helix-turn-helix motif"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0142"
FT                   /db_xref="GOA:B9DLC9"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLC9"
FT                   /inference="similar to AA sequence:UniProtKB:P37547"
FT                   /protein_id="CAL27055.1"
FT                   /translation="MKINEFIVVEGRDDTERVQRAVECDTIETNGSAINQEILEVIRNA
FT                   QATRGVIVLTDPDFPGDKIRNTIREHVSGVKHAYIDREKAKNKRGKIGVEHAALEDIRD
FT                   ALLHVSSPFEEGMESISKDTLINLGLIVGPGARHKREVLGRKLHIGHSNGKQLLKKLNA
FT                   FGYTEADVRDALNEDKGSEG"
FT   CDS_pept        145689..146579
FT                   /transl_table=11
FT                   /locus_tag="SCA_0143"
FT                   /product="ribosomal RNA adenine dimethylase"
FT                   /function="Dimethyladenosine transferase (rRNA
FT                   methylation)"
FT                   /note="(Q8CQU5) Dimethyladenosine transferase (EC 2.1.1.-)
FT                   (S-adenosylmethionine-6-N N-adenosyl(rRNA)
FT                   dimethyltransferase) (16S rRNA dimethylase) (High level
FT                   kasugamycin resistance protein ksgA) (Kasugamycin
FT                   dimethyltransferase),InterPro: Ribosomal RNA adenine
FT                   dimethylase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0143"
FT                   /db_xref="GOA:B9DLD0"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DLD0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27056.1"
FT                   /translation="MNKKDIATPTRTRALLDKYQFDFKKSLGQNFLIDVNIIQKIIDAS
FT                   NIDERTGVIEVGPGMGSLTEQLAKHAKKVVAFEIDQRLIPVLEDTLSDYDNVTVINEDI
FT                   LKADVVEAVQTHLSDCDKIMVVANLPYYITTPILLNLMSKSLPIDGYVVMMQKEVGERL
FT                   NAEIGTKAYGSLSIVAQYYTETSKVLTVPKTVFMPPPNVDSIVVKLMKRQAPIVAVDDE
FT                   DQFFKMTKAAFSQRRKTIANNYQSLFFDGKQKKYIIKTWLEDGGIDPRRRGETLSIKEF
FT                   ANLFNNLKKFPELEF"
FT   CDS_pept        146679..146942
FT                   /transl_table=11
FT                   /locus_tag="SCA_0144"
FT                   /product="conserved hypothetical protein"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /note="(P37466) Veg protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0144"
FT                   /db_xref="GOA:B9DLD1"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLD1"
FT                   /inference="similar to AA sequence:UniProtKB:P37466"
FT                   /protein_id="CAL27057.1"
FT                   /translation="MPKSIWDIKNALDGHLGNRIVLKANGGRKKTIERCAVLAETYPAV
FT                   FIVELDQDKHNFERVSYTYTDVLTENVQVSFVDDNHHEAVAH"
FT   CDS_pept        147402..148172
FT                   /transl_table=11
FT                   /locus_tag="SCA_0145"
FT                   /product="GHMP kinase family protein"
FT                   /function="4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   2-phosphate synthase"
FT                   /EC_number="2.7.1.-"
FT                   /note="(Q8CQU6) 4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase (EC 2.7.1.148) (CMK)
FT                   (4-(cytidine-5-diphospho)-2-C-methyl-D-erythritol
FT                   kinase),InterPro: 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   kinase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0145"
FT                   /db_xref="GOA:B9DLD2"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLD2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27058.1"
FT                   /translation="MVMTTVDLNDRVTVEKRQDQRIVVQVDYNFVPENAKNLASQAALL
FT                   MQETYDLKEGVTITLEKEIPVSAGLGGGSADAAATMRAMNKLFDLQLSLDELSALGADV
FT                   GSDVPFCIYSKTAICTGHGEKVHLLNEMPKAWVVIAKPNVGISTACVFQELEIGEECNQ
FT                   QENTQKCIEAIENGDYETICATLSNCLESISMEMHPNIRKLKQNMLNSGADAALMSGSG
FT                   PTVYSLAKHYKQAQNIYNAVHGCCNEVYLVRLLG"
FT   CDS_pept        148189..149013
FT                   /transl_table=11
FT                   /gene="purR"
FT                   /locus_tag="SCA_0146"
FT                   /product="pur operon repressor"
FT                   /function="Adenine/guanine phosphoribosyltransferases and
FT                   related PRPP-binding proteins"
FT                   /note="(P37551) Pur operon repressor,InterPro:
FT                   Phosphoribosyltransferase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0146"
FT                   /db_xref="GOA:B9DLD3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010078"
FT                   /db_xref="InterPro:IPR015265"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLD3"
FT                   /inference="similar to AA sequence:UniProtKB:P37551"
FT                   /protein_id="CAL27059.1"
FT                   /translation="MRYKRSERIVYMTHYLMSHPNKLIPLTHFVKKFKQAKSSISEDIH
FT                   IVRETLQKEKLGTVITTAGASGGVTYRPTMSKEEAEEVIDEVIGLLQEKERLLPGGYLF
FT                   LSDLMGNPELLNKVGRLIATIYMDEDLDAIVTIATKGISLANSVANILNLPVVVIRKDN
FT                   KVTEGSTVSINYVSGSSRKIETMVLSKRTLQENSNVLIVDDFMRAGGSINGVMNLMNEF
FT                   KAHVKGVSVLVESKEVKQRLIEDYTSLVRLSDVDEYNQDFKVEQGNVLSKFS"
FT   CDS_pept        149032..149412
FT                   /transl_table=11
FT                   /locus_tag="SCA_0147"
FT                   /product="putative purine regulatory protein"
FT                   /function="putative translation initiation inhibitor yjgF
FT                   family"
FT                   /note="(P37552) UPF0076 protein yabJ (purine regulatory
FT                   protein),InterPro: YjgF-like protein,Interpro:
FT                   Endoribonuclease L-PSP"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0147"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLD4"
FT                   /inference="similar to AA sequence:UniProtKB:P37552"
FT                   /protein_id="CAL27060.1"
FT                   /translation="MKTIHTNKAPEALGPYSQAIVLNDMVYASGQIPLNEFGELVSEEI
FT                   AVQTKQVLNNLSHVLEEAGSDLDSVVKTTIFIADMNDFQYINEVYGQFFNAHRPARSCV
FT                   EVARLPKDVKIEIEAIAQVKGK"
FT   CDS_pept        149479..149802
FT                   /transl_table=11
FT                   /gene="spoVG"
FT                   /locus_tag="SCA_0148"
FT                   /product="stage V sporulation protein G"
FT                   /function="uncharacterized protein involved in the
FT                   regulation of septum location"
FT                   /note="(P28016) Stage V sporulation protein G,InterPro:
FT                   SpoVG"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0148"
FT                   /db_xref="GOA:B9DLD5"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DLD5"
FT                   /inference="similar to AA sequence:UniProtKB:P28016"
FT                   /protein_id="CAL27061.1"
FT                   /translation="MKVTDVRLRKIQTDGRMKALVSITLDDAFVVHDLRVIEGNSGLFV
FT                   AMPSKRTPDGEFRDIAHPINSDMRQEIQDAVMKVYDETDEVIPDKNAQPSSDSEDNGSE
FT                   EEA"
FT   CDS_pept        150051..151415
FT                   /transl_table=11
FT                   /gene="gcaD"
FT                   /locus_tag="SCA_0149"
FT                   /product="putative UDP-N-acetylglucosamine
FT                   pyrophosphorylase"
FT                   /function="N-acetylglucosamine-1-phosphate
FT                   uridyltransferase (contains nucleotidyltransferase and
FT                   I-patch acetyltransferase domains)"
FT                   /EC_number="2.7.7.23"
FT                   /note="(P14192) Bifunctional gcaD protein (TMS protein)
FT                   [Includes: UDP-N-acetylglucosamine pyrophosphorylase (EC
FT                   2.7.7.23) (N-acetylglucosamine-1-phosphate
FT                   uridyltransferase); Glucosamine-1-phosphate
FT                   N-acetyltransferase (EC 2.3.1.157)],InterPro:
FT                   UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0149"
FT                   /db_xref="GOA:B9DLD6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DLD6"
FT                   /inference="similar to AA sequence:UniProtKB:P14192"
FT                   /protein_id="CAL27062.1"
FT                   /translation="MQRYAVVLAAGKGTRMKSKLYKVLHKVADKTMIEHVVNSVQQSGA
FT                   DQIVTIVGHGAERVKDTLGDQSAYGFQEEQLGTAHAVKMAADELKDREGTTLVVCGDTP
FT                   LITADTLNALVKHHEDNQADATVLSATAPNPFGYGRIVRDEEGRLSNIVEQKDASEAEQ
FT                   QIDEISSGIFAFDNQTLFRLLDKVKNDNAQGEYYLPDVLSLILEEGGKAEVYHTNDFDE
FT                   IMGVNDRVALSKAEQAMRQRINEYHMRNGVTLIDPSSTYIASDVIIGMDTVIEPGVHIG
FT                   SGTQIGEDTVIGQYSDINRSTIGDRTTVKQSVINDATVGDDTTVGPFAQLRPNAHLGNE
FT                   VKVGNFVEVKKADIKDGAKVSHLSYIGDAEIGERTNIGCGSITVNYDGKNKFKTIIGKD
FT                   SFIGCNTNLVAPVILGDDVLIAAGSTITDDVPNDSLALARSRQTTKPGYLNKNKE"
FT   CDS_pept        151519..152484
FT                   /transl_table=11
FT                   /gene="prs"
FT                   /locus_tag="SCA_0150"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /function="Phosphoribosylpyrophosphate synthetase"
FT                   /EC_number="2.7.6.1"
FT                   /note="(Q81VZ0) Ribose-phosphate pyrophosphokinase (EC
FT                   2.7.6.1) (RPPK) (Phosphoribosyl pyrophosphate synthetase)
FT                   (P-Rib-PP synthetase) (PRPP synthetase),InterPro:
FT                   Ribose-phosphate pyrophosphokinase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0150"
FT                   /db_xref="GOA:B9DLD7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLD7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27063.1"
FT                   /translation="MLANEYKNSSLKIFSLKGNEPLAHEVADDIGIELGKCSVKRFSDG
FT                   EIQINIEESIRGCDVFIIQPTSYPVNVHLMELLIMIDACKRASAATINIVVPYYGYARQ
FT                   DRKARSREPITAKLVANLIQVAGADRMIALDLHAPQIQGFFDIPIDHLMGVPILAKYFK
FT                   ENPDIDPEETVVVSPDHGGVTRARKLADILKTPIAIIDKRRPKPNVAEVMNIVGEIDGR
FT                   TAIIIDDIIDTAGTITLAAQALKDKGAKEVYACCTHPVLSGPAKERIENSAIKELIVTN
FT                   SIRLDEERKPENTTELSVAGLIAQAIVRVYERESVSVLFD"
FT   CDS_pept        152742..153386
FT                   /transl_table=11
FT                   /gene="rplY"
FT                   /locus_tag="SCA_0151"
FT                   /product="50S ribosomal protein L25"
FT                   /function="Ribosomal protein L25 (general stress protein
FT                   Ctc)"
FT                   /note="(P14194) General stress protein ctc,InterPro:
FT                   Ribosomal protein L25"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0151"
FT                   /db_xref="GOA:B9DLD8"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DLD8"
FT                   /inference="similar to AA sequence:UniProtKB:P14194"
FT                   /protein_id="CAL27064.1"
FT                   /translation="MASLKSIIRQGKQRRSDLTAIRNSGKVPAVMYGYGQKNVSVKVDE
FT                   VEFIKVIREVGRNGVIDLGVGSKTIKVMVADYQFDPLKNQITHIDFLAINMSEERTVEV
FT                   PVHLVGEAVGAKEGGVVDQPLFNLEVTATPENIPEYLEVEISGLEIGDSLSVADLNTTG
FT                   DFTIENEPEATVVTVVPPTQGPSEAEIEEVEAGDADTPEPEVVGEKEEDEE"
FT   CDS_pept        153873..154445
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="SCA_0152"
FT                   /function="Peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="(Q8CQU9) Peptidyl-tRNA hydrolase (EC 3.1.1.29)
FT                   (PTH),(P37470) Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)
FT                   (Stage V sporulation protein C),InterPro: Peptidyl-tRNA
FT                   hydrolase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0152"
FT                   /db_xref="GOA:B9DLD9"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DLD9"
FT                   /inference="similar to AA sequence:UniProtKB:P37470"
FT                   /protein_id="CAL27065.1"
FT                   /translation="MKCIVGLGNIGKRFEQTKHNIGFEVIDYLLESNQFKLDKQKFRGA
FT                   YTIERLGGEKVLLIEPMTMMNLSGEAVGPLMDYYNVDPEDLLVLYDDLDLPQGQVRLRQ
FT                   KGSAGGHNGMKSIIQHLGTDNFKRIRIGIGRPTNGMSVPDYVLQKFSKQEMETMNKVIE
FT                   HSAHAVEDYVSNSRFDHVMNEYNGEVS"
FT   CDS_pept        154442..157960
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="SCA_0153"
FT                   /product="putative transcription-repair coupling factor"
FT                   /function="Transcription-repair coupling factor
FT                   (superfamily II helicase)"
FT                   /note="(P37474) Transcription-repair coupling factor
FT                   (TRCF),InterPro: Transcription-repair coupling factor"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0153"
FT                   /db_xref="GOA:B9DLC6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLC6"
FT                   /inference="similar to AA sequence:UniProtKB:P37474"
FT                   /protein_id="CAL27066.1"
FT                   /translation="MKSIITDYINKDKRYEELNDAFGQENVLVTGLSGAVKATMMAEKY
FT                   LSSDRPLVVVTNNLYQADKLEADIQQYINDDEIYKYPLQDIMTEEFSTQSPQLMSERVR
FT                   TLTGLAEGQRGFFIIPLNGLKKLQTPVDIWQSHQLKLSVGDDIDVDDFLNKLVDMGYRR
FT                   ETAVSHIGEFSLRGGIIDIYPLIGAPVRIELFDTEVDSIRQFDIESQRSEENQETVEIT
FT                   SASDYIITDDVLKRIKTQLKEAYENTRPKIDKSVRNDVKDTYESFLQFDSNFVDHQVIR
FT                   RLVTFMYEQPATLVDYISNNAIIAVDEYNRVKDTEETLTTEVNDFMTQLIESGKGFIGQ
FT                   QFMNDKAFEELINTRNITYFTLFTTSMPVKLNNIIKFSSKPVQQFYGQYDIMRSEFQRY
FT                   VNNGYTVVVLVETETKKERVKSMMNEMHIPVVEGTAGEHMEGGHAVIVEGSLSEGFELP
FT                   YMQLAVVTERELFKSKQKKAKKRTQTMSNAERIKSYQDLKIGDYVVHVHHGVGRYLGVE
FT                   TLEVGDVHRDYIKIQYKGTDQLFVPVDQMDQVQKYVASEDKTPRLNKLGGTEWKKTKAK
FT                   VQQSVEDIADELIELYREREMAQGYQYGADSEQQHEFEMDFPYDLTADQSKSIVEIKDD
FT                   MEKERPMDRLLCGDVGYGKTEVALRAAFKAVMEGKQVAFLVPTTILAQQHYETLIERMQ
FT                   DFPVNIELMSRFRTPKEVKETKKGLEDGTVDIVVGTHKLLAKDVKYKDLGLLVVDEEQR
FT                   FGVRHKERIKSLKTNVDVLTLTATPIPRTLHMSMLGVRDLSVIETPPENRFPVQTYVLE
FT                   QNSNFIKEALERELSRGGQAFYLYNKVQSIYEKKEQLQMLMPEANIGVAHGRMTERELE
FT                   DTMIGFVDGEYDILVTTTIIETGVDVPNANTLIIEDADRFGLSQLYQLRGRVGRSSRVG
FT                   YAYFLHPTNKVLSETAEERLQAIKEFTELGSGFKIAMRDLNIRGAGNLLGKQQHGFIDS
FT                   VGFDLYSQMLEEAVNEKRGIKEETTTPEIEIDLNMDVYLPTEYIPNEQSKIEIYKKLRQ
FT                   IENEEQLMDIKDELIDRFNEYPIQVERLLDIVEMRIHALNVGVLHIKDTGKAVEVQLSE
FT                   KGTEDINGEALFKQTLPLGRDMKVGVEDGAMKVTLAKNKRAGAWFDRLKFLMKSLEESM
FT                   VIPDEA"
FT   CDS_pept        157950..159488
FT                   /transl_table=11
FT                   /locus_tag="SCA_0154"
FT                   /product="putative polysaccharide biosynthesis protein"
FT                   /function="Membrane protein involved in the export of
FT                   O-antigen and teichoic acid"
FT                   /note="(P37555) Hypothetical protein yabM,InterPro:
FT                   Polysaccharide biosynthesis protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0154"
FT                   /db_xref="GOA:B9DKZ1"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR024923"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKZ1"
FT                   /inference="similar to AA sequence:UniProtKB:P37555"
FT                   /protein_id="CAL27067.1"
FT                   /translation="MKRKSAFNGVVILTLALIAVKILSAIYRVPYQNVLGDAGLYAYQQ
FT                   VYPFLSLATILSMNAIPSAVTQNFGAHWTDKRISQVAIGIQTACFAIFLIVFSGASVIA
FT                   RIMGDMHLTPMIQMASCSFLVVGVLGVLRGSYQSRQQMELPAYSQVIEQIVRVGIILAM
FT                   IVVFAVGHGTIYQIGKWSILASALGFLAASLFLIWKRPFRFQWQWRENDIESQVWKRLT
FT                   AAIIIFSASHLIVTTWQLMDSFSVIRELQHYGLSFKESIVQKGIYDRGASFIQIGLIVT
FT                   TTFCFVLIPLLTNAFREGRFERMNRYANASLKITVTISVAAGVGLMNLLPLMNRVFFKN
FT                   DVLTATLVIYMLTVICVSLIMVNIALLEVRRQSRLILITFAAGALLKLVLNVLLIPRIG
FT                   IIGASISTVLSLCLFAGVLQWRAFRFYRFRHLRTFVMKLIISMVGMTLTVQVVMWLLPT
FT                   TERLSGMLELLVAAIAGVAVVVAAIIGLNLLTYKELQHMPFGDKLYHFKKGRKR"
FT   CDS_pept        159485..160681
FT                   /transl_table=11
FT                   /locus_tag="SCA_0155"
FT                   /product="Protein containing tetrapyrrole methyltransferase
FT                   domain and MazG-like (predicted pyrophosphatase) domain"
FT                   /function="Protein containing tetrapyrrole
FT                   methyltransferase domain and MazG-like (predicted
FT                   pyrophosphatase) domain"
FT                   /note="InterPro: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase,InterPro: MazG family
FT                   protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0155"
FT                   /db_xref="GOA:B9DKZ2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR024180"
FT                   /db_xref="InterPro:IPR035013"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKZ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27068.1"
FT                   /translation="MTHTITIAGLGNYGLDELPLGVYRYLINTPKVYARTLDHPVIQEL
FT                   RDTEQAEIEWMSFDDVYEAHDEFSEVYEEIVARLVEAAQSEDIVYAVPGHPRVAETTTA
FT                   LLTAYAASHDDVKVRVLGGKSFIDDVFEAVQADPNDGFTLLDGTALEASQLNIRTHTLI
FT                   TQVYSAMTAGDLKLTLMERYPDDYTVWIVDGARSTGAALIETPLFELDHHDIFSNLTSV
FT                   FVPRIEDTDLMHRDFDFAESVIDTLVDDEKGCPWDKEQTHDSLKRYLLEETFELFEAID
FT                   NEDDWHMIEELGDILLQVMLHTSIGKKEGYMDVHEVIESMNDKMIRRHPHVFGEAHAEN
FT                   VEDLKAIWSEAKAEEGKQERVKFEKVFADHFMALYDDIKNKDYNEAELSAFLEKKEGK"
FT   CDS_pept        160683..160949
FT                   /transl_table=11
FT                   /locus_tag="SCA_0156"
FT                   /product="hypothetical protein with S4 domain"
FT                   /function="Ribosome-associated heat shock protein
FT                   implicated in the recycling of the 50S subunit (S4
FT                   paralog)"
FT                   /note="InterPro: RNA-binding S4"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0156"
FT                   /db_xref="GOA:B9DKZ3"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKZ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27069.1"
FT                   /translation="MRLDKYLKVSRLIKRRTLAKEVSDQGRVQVNGNTAKAGTDVKVGE
FT                   KIVITLPSRIVTVRTRIAVLSFIKNKDYNEAELSAFLEKKEGK"
FT   CDS_pept        160951..161217
FT                   /transl_table=11
FT                   /locus_tag="SCA_0157"
FT                   /product="protein with S4 domain"
FT                   /function="Ribosome-associated heat shock protein
FT                   implicated in the recycling of the 50S subunit (S4
FT                   paralog)"
FT                   /note="(P37557) Hypothetical protein yabO,InterPro:
FT                   RNA-binding S4"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0157"
FT                   /db_xref="GOA:B9DKZ4"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKZ4"
FT                   /inference="similar to AA sequence:UniProtKB:P37557"
FT                   /protein_id="CAL27070.1"
FT                   /translation="MRLDKYLKVSRLIKRRTLAKEVSDQGRVQVNGNTAKAGTDVKVGD
FT                   EIVIRFGQRVVTIKVTGLNEHASKENAKGMYELVKEERINEND"
FT   CDS_pept        161232..161603
FT                   /transl_table=11
FT                   /locus_tag="SCA_0158"
FT                   /product="putative cell division protein"
FT                   /function="Septum formation initiator"
FT                   /note="(P37471) Cell division protein divIC,InterPro:
FT                   Septum formation initiator"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0158"
FT                   /db_xref="GOA:B9DKZ5"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR039076"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKZ5"
FT                   /inference="similar to AA sequence:UniProtKB:P37471"
FT                   /protein_id="CAL27071.1"
FT                   /translation="MNRKVEHMENRYIENENRKKKRHEMRKRVVKRRIMLFAGILLAII
FT                   LILSIMVFTQIRSNADDAKERKAKEEKFQKQQDEEIALKEQLNNLNNKDYIEKIARDDY
FT                   YLSNDGEVIFKLPKDKGKK"
FT   CDS_pept        161738..162148
FT                   /transl_table=11
FT                   /locus_tag="SCA_0159"
FT                   /product="putative RNA binding protein with S1 domain"
FT                   /function="predicted RNA binding protein (contains
FT                   ribosomal protein S1 domain)"
FT                   /note="(P37560) Hypothetical protein yabR,InterPro: RNA
FT                   binding S1"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0159"
FT                   /db_xref="GOA:B9DKZ6"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKZ6"
FT                   /inference="similar to AA sequence:UniProtKB:P37560"
FT                   /protein_id="CAL27072.1"
FT                   /translation="MSIEVGSKLKGKVTGIKKFGAFVELPEGKSGLVHISEVADKYVEN
FT                   VEEHLSVGDEVEVKVLSIADDGKISLSIKKAKDRPKRQHHRGGNNHHGKPAQSKPEDFE
FT                   KKLSNFLKDSEEKMTSIKRQTESRRGGRGSRR"
FT   CDS_pept        162400..163680
FT                   /transl_table=11
FT                   /locus_tag="SCA_0160"
FT                   /product="putative PP-loop family protein"
FT                   /function="predicted ATPase of the PP-loop superfamily
FT                   implicated in cell cycle control"
FT                   /note="(P37563) Hypothetical UPF0072 protein yacA,InterPro:
FT                   Protein of unknown function UPF0021,Pfam: PP-loop family"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0160"
FT                   /db_xref="GOA:B9DLB8"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLB8"
FT                   /inference="similar to AA sequence:UniProtKB:P37563"
FT                   /protein_id="CAL27073.1"
FT                   /translation="MNIYTQGWTENDHLAIAVSTGVDSMVLLDVLTTEFAHTYQKLTVL
FT                   HVNHGIREASKEEEQFIRDYCEKHQIPLAVHHLDLSELTAQGKSIQHTAREQRYDWFET
FT                   HMKTIGANVLVTAHHQDDQLETIFYRIMTGRSTRSPLGMSVQETRPGFKLVRPLLNVTK
FT                   RVIRQYQVTNEVPYYEDASNTDNHYVRNDIRNRILPEIDENPQLDVSQLLKLKQWHDAQ
FT                   FQQLQDTADRFIQENTETEQERINIDRNAFNQLMHSQKTTVMDKLLNKWTKNQPISEHA
FT                   YHEWFAQLESSAAQAVIYATDKWNIQIVYDKFIIMGYTDTDLTPKRITQSGHYQFGTYQ
FT                   IIIDETIEDADLPIVVRVRQAGDRFVLPQNRGHQKVNRLMINRKVPGYERDRLPILLNK
FT                   QGEIVAVGTLFTAPNYEKKLEITNLGV"
FT   CDS_pept        163683..164228
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="SCA_0161"
FT                   /product="putative hypoxanthine-guanine
FT                   phosphoribosyltransferase"
FT                   /function="Hypoxanthine-guanine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="(Q8CQV4) Hypoxanthine-guanine
FT                   phosphoribosyltransferase (EC 2.4.2.8) (HGPRT)
FT                   (HGPRTase),InterPro: Hypoxanthine phosphoribosyl
FT                   transferase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0161"
FT                   /db_xref="GOA:B9DLB9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLB9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27074.1"
FT                   /translation="MMKDDLKEILLTEDEIQQICRQLGAEITKDYRGKDLVCIGILKGS
FT                   AMFMSDLIKRIDTHLSIDFMDVSSYHGGTESTGEVKILKDLGSSIENKDVLIIEDILET
FT                   GTTLKSITELLKSRRVNSLKIVTLLDKPNRRKADIEAKYVGRKIPDEFVVGYGLDYAEF
FT                   YRNLPYVGTLKPEVYQNK"
FT   CDS_pept        164345..166447
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="SCA_0162"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /function="ATP-dependent Zn proteases"
FT                   /EC_number="3.4.24.-"
FT                   /note="(P37476) Cell division protein ftsH homolog (EC
FT                   3.4.24.-),InterPro: ATP-dependent metalloprotease FtsH"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0162"
FT                   /db_xref="GOA:B9DLC0"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLC0"
FT                   /inference="similar to AA sequence:UniProtKB:P37476"
FT                   /protein_id="CAL27075.1"
FT                   /translation="MQKAFRNVLVIAIIGVFIFGLFSWLNGNGNMPKQLSYTQFTNKLE
FT                   KGDLKTLEIQPEQNVYLVSGKTKSGEDYSSTMLYNNEKDLQKVTDEAHKQKDLKFTVKE
FT                   EEKQSVFVSILSTLIPVLVIALLFIFFLSQAQGGGGGGRMMNFGKSKAKMYDNQKRRVR
FT                   FSDVAGADEEKQELIEIVDFLKDNKKFKDMGSRIPKGVLLVGPPGTGKTLLARAVAGEA
FT                   GVPFFSISGSDFVEMFVGVGASRVRDLFENAKKNAPCIIFIDEIDAVGRQRGAGVGGGH
FT                   DEREQTLNQLLVEMDGFGENEGIIMIAATNRPDILDPALLRPGRFDRQIQVGRPDVKGR
FT                   EAILYVHARNKPLDETVDLKAIAQRTPGFSGADLENLLNEASLIAVRDGKKKIDMRDIE
FT                   EATDRVIAGPAKKSRVISEKERNIVAHHEAGHTIIGMVLDEAEVVHKVTIVPRGQAGGY
FT                   AMMLPKQDRFLMTEPELLDKICGLLGGRVSEDINFNEVSTGASNDFERATQIARSMVTE
FT                   YGMSKKLGPMQFTKGSGQVFLGKDMQGDPEYSGQIAYEIDKEVQRIIKEQYERCKQILL
FT                   EHQEQLRLIAKTLLTEETLVREQIHSLFYDGKLPEVNYDDAKVVNHGDEDFAEGKFGKS
FT                   YDEILDEVQDEDKKYQEEEAEVDKEEENQKEYEARKREDAQRDNDSSSDDHDNNQSDRN
FT                   NDRRND"
FT   CDS_pept        166601..167485
FT                   /transl_table=11
FT                   /gene="hsp33"
FT                   /locus_tag="SCA_0163"
FT                   /product="heat-shock protein HSP33 (33 kDa chaperonin)"
FT                   /function="Disulfide bond chaperones of the HSP33 family"
FT                   /note="(Q99W91) 33 kDa chaperonin (Heat shock protein 33
FT                   homolog) (HSP33),InterPro: Hsp33 protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0163"
FT                   /db_xref="GOA:B9DLC1"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DLC1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27076.1"
FT                   /translation="MTQDYIVKALAFDGDIRAYAAVTTNAVQEAQTRHYTWPTASAALG
FT                   RTMTATAMMGAMLKGDQKLTVTVDGHGPIGRIVADADAKGDIRGYVTNPQTHFPLNDQG
FT                   KLDVRRAVGTDGTLTVVKDVGLKDYFSGSSPIVSGELGDDFTYYYATSEQVPSSVGLGV
FT                   LVNPDNSIKAAGGFIIQVMPNAKEETIDKVEKAIGNMTPVSKLIDQGLSPEELLTEILG
FT                   KENVKFLETVPVKFECNCSHEKFLNAIKGLGEAEIQAMIDEDHGAEAECHFCRAKYQYS
FT                   EAELKGLIEELNA"
FT   CDS_pept        167770..168705
FT                   /transl_table=11
FT                   /gene="cysK"
FT                   /locus_tag="SCA_0164"
FT                   /product="cysteine synthase (O-acetylserine sulfhydrylase)"
FT                   /function="Cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /note="(Q8CMT6) Cysteine synthase (EC 2.5.1.47)
FT                   (O-acetylserine sulfhydrylase) (O-acetylserine
FT                   (Thiol)-lyase) (CSase),InterPro: Cysteine synthase
FT                   K/M,Cysteine synthase K"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0164"
FT                   /db_xref="GOA:B9DLC2"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLC2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27077.1"
FT                   /translation="MAKKPVDNIVQIIGDTPVVKLRNVVPEDAADVYVKLEYQNPGGSV
FT                   KDRIALAMIEKAEREGKIKPGDTIVEPTSGNTGIGLAFVAAAKGYKAVFTMPETMSIER
FT                   RNLLKAYGAEVVLTPGSEAMKGAIKKAKELKEEYGYYEPQQFENPANPLVHELTTGPEL
FT                   IEQFEDRTIDAFLAGVGTGGTLTGVGKVLKKQYPDIDIVAIEPEDSPVLSGGEPGPHKL
FT                   QGLGAGFVPDTLDTKIYDEVIKVGNEIAMETSRRVAKEEGILAGISSGAAIHAAIQKAK
FT                   QLGKGKTVVTVLPSNGERYLSTPLYSFEDK"
FT   CDS_pept        168847..169632
FT                   /transl_table=11
FT                   /gene="folP"
FT                   /locus_tag="SCA_0165"
FT                   /product="dihydropteroate synthase chain A synthetase"
FT                   /function="Dihydropteroate synthase and related enzymes"
FT                   /EC_number="2.5.1.15"
FT                   /note="(Q8NXZ2) Dihydropteroate synthase (EC 2.5.1.15)
FT                   (Dihydropteroate pyrophosphorylase) (DHPS),InterPro:
FT                   Dihydropteroate synthase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0165"
FT                   /db_xref="GOA:B9DLC3"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLC3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27078.1"
FT                   /translation="MAHTKIMGILNVTPDSFSDGGKYNSVETAVARGKEMMDEGVDIID
FT                   IGGVSTRPGHQEVALEDELERVIPVVRALSEFNVQLSIDTFRSEVAEQALEAGATMIND
FT                   QWAGLYDPKMFETVARYDAEIVLMHNGDGERDEPIMDEMLLYLLKQANRAEEAGIKHDN
FT                   IWIDPGIGFAKSRAEERIVMDRLDELVATEYPVLLATSRKRFIKEMIGTDSRPEDRDEA
FT                   TAATTAYGIMKGVKAVRVHNVELNARIAHGIDYLKENER"
FT   CDS_pept        169629..170003
FT                   /transl_table=11
FT                   /gene="folB"
FT                   /locus_tag="SCA_0166"
FT                   /product="7,8-dihydroneopterin aldolase"
FT                   /function="Dihydroneopterin aldolase"
FT                   /EC_number="4.1.2.25"
FT                   /note="(Q8CMT8) Dihydroneopterin aldolase (EC 4.1.2.25)
FT                   (DHNA),InterPro: Dihydroneopterin aldolase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0166"
FT                   /db_xref="GOA:B9DLC4"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLC4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27079.1"
FT                   /translation="MTDTIFLNGMRFYGFHGVLEAENDIGQIFVVDVVLKVDLSAAGKS
FT                   DSVDDTVNYAEVYADVKEIMEGEPKNLLEHLATLIAKRINSHYNRVLETKVRITKETPP
FT                   IPGHYDGVGIEISRVNSEHD"
FT   CDS_pept        169996..170478
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="SCA_0167"
FT                   /product="7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokin
FT                   a se"
FT                   /function="78-dihydro-6-hydroxymethylpterin-pyrophosphokin
FT                   a se"
FT                   /EC_number="2.7.6.3"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0167"
FT                   /db_xref="GOA:B9DLC5"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:B9DLC5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27080.1"
FT                   /translation="MTKVYLGLGSNVGDREHQLKEALRLLDAQQSIKVTRVSSLYETAP
FT                   VGYVDQPDFLNLCAEIETDLTPQAVLKNGLDIEQQLHRVRKERWGPRTLDIDILLYGNK
FT                   IIEDQDLSIPHPRMAERAFVLIPLQEIAPEAINPRTQTKIKDIEVPDETVNKYHKR"
FT   CDS_pept        170502..171497
FT                   /transl_table=11
FT                   /gene="dus1"
FT                   /locus_tag="SCA_0168"
FT                   /product="putative tRNA-dihydrouridine synthase 1"
FT                   /function="tRNA-dihydrouridine synthase"
FT                   /note="(P37567) Probable tRNA-dihydrouridine synthase 1 (EC
FT                   1.-.-.-),InterPro: Putative TIM-barrel protein nifR3"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0168"
FT                   /db_xref="GOA:B9DKZ0"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKZ0"
FT                   /inference="similar to AA sequence:UniProtKB:P37567"
FT                   /protein_id="CAL27081.1"
FT                   /translation="MWKIGDVEIDNRVVLAPMAGVCNSAFRLTVKEFGAGLVCAEMVSD
FT                   KAILFNNPKTMNMLYIDENERPLSLQIFGGEKESLVEAAVYVDQNTTADIIDINMGCPV
FT                   NKIIRCEAGARWLLDPNKIYEMVSAVTEKVSKPVTCKMRIGWDEDHIYAVENAKAAERA
FT                   GAAAISLHGRTRVQMYEGHADWDIIRQVKEAVNIPVIGNGDVTSPELAQKMLDETGVDA
FT                   VMIGREALGNPWMIYRTVHYLETGELMDEPTVKEKVEIALLHLRRLVELKGEKIGVMEM
FT                   RKHASWYLKGVKGNGKARKALNQANTEQEMIDILQNFQAESTAATATQQA"
FT   CDS_pept        171510..173003
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="SCA_0169"
FT                   /product="lysyl-tRNA synthetase"
FT                   /function="Lysyl-tRNA synthetase class II"
FT                   /EC_number="6.1.1.6"
FT                   /note="(Q8CQV5) Lysyl-tRNA synthetase (EC 6.1.1.6)
FT                   (Lysine--tRNA ligase) (LysRS),InterPro: Lysyl-tRNA
FT                   synthetase class-2"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0169"
FT                   /db_xref="GOA:B9DKY9"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKY9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27082.1"
FT                   /translation="MSEEMNDQMQVRRQKLQELIDLGIDPFGKRFDRTASAEELKEEWD
FT                   QYSKEELHEKEDEEAAHVAIAGRLMTKRGKGKAGFAHIQDLSGQIQIYVRKDQVGEEQF
FT                   AIWKMADLGDIVGIEGVMFKTNTGELSVKAKSFTLLSKSLRPLPDKFHGLQDVEQRYRQ
FT                   RYLDLITNQESTQTFINRSKIIQEMRNYLNSKGFLEVETPMMHQIAGGAAARPFVTHHN
FT                   ALDATLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADF
FT                   HDIMDLTEGTIRHISKKVLGTAVVPYGEYEVDLDSPWKRVHIVDAVKEATGVNFFDVKS
FT                   DEEARELAKEHGIEITDHMTYGHILNEFFEQKVEETLIQPTFVYGHPIEISPLAKKNPE
FT                   DPRFTDRFELFIVGREHANAFTELNDPIDQRERFEAQLKEKEQGNDEAHEMDEDYIEAL
FT                   EYGMPPTGGLGIGIDRLVMLLTNSPSIRDVLLFPYMRQK"
FT   rRNA            173443..173557
FT                   /gene="5S rRNA B2"
FT                   /locus_tag="SCA_5S_rRNA_B2"
FT                   /product="5S rRNA"
FT                   /note="Sca_5S_rRNA_B2"
FT   tRNA            173568..173643
FT                   /gene="tRNA-Val (TAC)"
FT                   /locus_tag="SCA_t0002"
FT                   /product="transfer RNA-Val (TAC)"
FT                   /anticodon="(pos:173601..173603,aa:Val)"
FT                   /note="tRNA-Sca_0002"
FT                   /inference="nucleotide motif:tRNAscan"
FT   tRNA            173651..173726
FT                   /gene="tRNA-Thr (TGT)"
FT                   /locus_tag="SCA_t0003"
FT                   /product="transfer RNA-Thr (TGT)"
FT                   /anticodon="(pos:173684..173686,aa:Thr)"
FT                   /note="tRNA-Sca_0003"
FT                   /inference="nucleotide motif:tRNAscan"
FT   tRNA            173740..173815
FT                   /gene="tRNA-Lys (TTT)"
FT                   /locus_tag="SCA_t0004"
FT                   /product="transfer RNA-Lys (TTT)"
FT                   /anticodon="(pos:173773..173775,aa:Lys)"
FT                   /note="tRNA-Sca_0004"
FT                   /inference="nucleotide motif:tRNAscan"
FT   tRNA            173833..173907
FT                   /gene="tRNA-Gly (GCC)"
FT                   /locus_tag="SCA_t0005"
FT                   /product="transfer RNA-Gly (GCC)"
FT                   /anticodon="(pos:173865..173867,aa:Gly)"
FT                   /note="tRNA-Sca_0005"
FT                   /inference="nucleotide motif:tRNAscan"
FT   tRNA            173916..174004
FT                   /gene="tRNA-Leu (TAA)"
FT                   /locus_tag="SCA_t0006"
FT                   /product="transfer RNA-Leu (TAA)"
FT                   /anticodon="(pos:173950..173952,aa:Leu)"
FT                   /note="tRNA-Sca_0006"
FT                   /inference="nucleotide motif:tRNAscan"
FT   tRNA            174016..174092
FT                   /gene="tRNA-Arg (ACG)"
FT                   /locus_tag="SCA_t0007"
FT                   /product="transfer RNA-Arg (ACG)"
FT                   /anticodon="(pos:174050..174052,aa:Arg)"
FT                   /note="tRNA-Sca_0007"
FT                   /inference="nucleotide motif:tRNAscan"
FT   tRNA            174125..174198
FT                   /gene="tRNA-Pro (TGG)"
FT                   /locus_tag="SCA_t0008"
FT                   /product="transfer RNA-Pro (TGG)"
FT                   /anticodon="(pos:174159..174161,aa:Pro)"
FT                   /note="tRNA-Sca_0008"
FT                   /inference="nucleotide motif:tRNAscan"
FT   tRNA            174221..174296
FT                   /gene="tRNA-Ala (TGC)"
FT                   /locus_tag="SCA_t0009"
FT                   /product="transfer RNA-Ala (TGC)"
FT                   /anticodon="(pos:174254..174256,aa:Ala)"
FT                   /note="tRNA-Sca_0009"
FT                   /inference="nucleotide motif:tRNAscan"
FT   rRNA            174420..175973
FT                   /gene="16S rRNA B"
FT                   /locus_tag="SCA_16S_rRNA_B"
FT                   /product="16S rRNA"
FT                   /note="Sca_16S_rRNA_B"
FT   rRNA            176216..179140
FT                   /gene="23S rRNA B"
FT                   /locus_tag="SCA_23S_rRNA_B"
FT                   /product="23S rRNA"
FT                   /note="Sca_23S_rRNA_B"
FT   rRNA            179211..179325
FT                   /gene="5S rRNA B"
FT                   /locus_tag="SCA_5S_rRNA_B"
FT                   /product="5S rRNA"
FT                   /note="Sca_5S_rRNA_B"
FT   CDS_pept        complement(179440..180606)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0170"
FT                   /product="putative sugar transport protein"
FT                   /function="Arabinose efflux permease"
FT                   /note="(P77389) Hypothetical transport protein
FT                   ydhP,InterPro: Major facilitator superfamily"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0170"
FT                   /db_xref="GOA:B9DKY8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKY8"
FT                   /inference="similar to AA sequence:UniProtKB:P77389"
FT                   /protein_id="CAL27083.1"
FT                   /translation="MKKYPIAIWMLAIGAFAIGMTEFVIMGLLPNIARDFHVSVSQAGQ
FT                   LITGYALGVAIGGPILVMLTIKLNRKYLLILLMIIFMIGNIAASLSPTYGFMMTSRIIT
FT                   SLAHGSFFGIGSILAASMVQPAYRASAMALMFMGLSLSNILGVPFGTLIGQNFGWSMTF
FT                   VIIAIIGGLALIGIIIFVPNRKETHKSSVMNELKILKEKQLWLTLAITLFGFSSVFAYF
FT                   TYISSILVDVSHIKENLISYMLIIFGIGVTLGNVIGGKLADWNLNKALKIIFTTFIIYF
FT                   VLLYFIQMNGILMVGGIFLFGVIGFSMSPSLQFKSTLISQDAPTLASTLNQSAFNLGNA
FT                   LGAFVGGLVVTNLPLASLSLVAPLLTLIGLVFLLVSIYIDKRNKTVYN"
FT   CDS_pept        complement(180835..181314)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0171"
FT                   /product="putative acetyltransferase, GNAT family"
FT                   /function="Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /note="InterPro: GCN5-related N-acetyltransferase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0171"
FT                   /db_xref="GOA:B9DKX5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKX5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27084.1"
FT                   /translation="MSTITLKPYHSKYDAEIEKLSIADKDSDYALTPLNALKDLADTED
FT                   PVLIFSDDNLAGFLRLNFNDERFGLTDNEHSVLVKSFSVTEQMQGNKIAQKALFELPNY
FT                   ISCHYSNIDEIILSVNFKNSKAIYVYEKCGFIDTNRVIGGPAGNQHVMSLKIQQA"
FT   CDS_pept        complement(181329..182699)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0172"
FT                   /product="GntR family regulatory protein"
FT                   /function="Transcriptional regulators containing a
FT                   DNA-binding HTH domain and an aminotransferase domain (MocR
FT                   family) and their eukaryotic orthologs"
FT                   /note="(P49309) Probable rhizopine catabolism regulatory
FT                   protein mocR,InterPro: Bacterial regulatory protein GntR
FT                   family"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0172"
FT                   /db_xref="GOA:B9DKX6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKX6"
FT                   /inference="similar to AA sequence:UniProtKB:P49309"
FT                   /protein_id="CAL27085.1"
FT                   /translation="MSQPLYMQLYQTLKEQIIEGQYKSGDRFPSKRRLAEHHSLSNTTI
FT                   EHAYQYLLDEGYIYSKPRSGYYVSDIESLPIVTKETASSFPENKKNKDHQARFHFDLAR
FT                   IDTEHFPWQQFRKYSRDVFDKSLPDILQPGAQQGEYKLRQAIAHYLFNSRGVNCHPDQI
FT                   IIGSSTEQLINQVTDILTERSYIIEYPSYPPIKQVLDKKGLNYKRVAVKKNGIDMQKVQ
FT                   KSKHQVVYVTPSHQFPTGYVMNLKTRTQLINWAQQHPERYIIEDDYDSEFRYFSKPIPA
FT                   LQSLDTTGKVIYISTFSKSLFPSCRIAFMVLPQNLMQRYHHLPDKEGTTVPAPMQYMVA
FT                   EFMENGSFERHLNKMRKVYRYKLTYIIDALSSYKDQLLIEGATTGMHFTITVQNGLTLN
FT                   EILERANSNHVKLTPLNKYMKKNSQNKDIPKFIIGFGGIKDEALKSHTDALIKTLTI"
FT   CDS_pept        182797..183684
FT                   /transl_table=11
FT                   /gene="pdx1"
FT                   /locus_tag="SCA_0173"
FT                   /product="putative Vitamin B6 biosynthesis protein"
FT                   /function="Pyridoxine biosynthesis enzyme"
FT                   /note="(Q8CQV7) Pyridoxine biosynthesis protein
FT                   pdx1,InterPro: Vitamin B6 biosynthesis protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0173"
FT                   /db_xref="GOA:B9DKX7"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DKX7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27086.1"
FT                   /translation="MSKQVGSDRVKRGMAEMQKGGVIMDVVNAEQAKIAEEAGAVAVMA
FT                   LERVPSDIRAAGGVARACNPKIVQEVMDAVSIPVMAKCRIGHITEARVLESMGVDYIDE
FT                   SEVLTPADEEYHLLKSDYTVPFVCGCRNLGEAARRIGEGAAMLRTKGEPGTGNIVEAVR
FT                   HMRQVNSEVAKLTVMPDDEIMTFAKEIGAPYEVLKSIKDNGRLPVVNFAAGGVATPQDA
FT                   ALMMQLGADGVFVGSGIFKSEDPEKFAKAIVQATTHYTDYELIGKLAQELGEAMRGLDV
FT                   NQLSLEERMQERGW"
FT   CDS_pept        183686..184264
FT                   /transl_table=11
FT                   /locus_tag="SCA_0174"
FT                   /product="SNO glutamine amidotransferase family protein"
FT                   /function="predicted glutamine amidotransferase involved in
FT                   pyridoxine biosynthesis"
FT                   /note="(P37528) Hypothetical UPF0030 protein yaaE,InterPro:
FT                   SNO glutamine amidotransferase (Members of this family are
FT                   involved in the pyridoxine biosynthetic pathway)"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0174"
FT                   /db_xref="GOA:B9DKX8"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DKX8"
FT                   /inference="similar to AA sequence:UniProtKB:P37528"
FT                   /protein_id="CAL27087.1"
FT                   /translation="MKIGVLALQGAVREHLRHIELSGHEGVSVKRVEQLEEIDGLILPG
FT                   GESTTLRRLMNLYGFKEALVNSDLPMFGTCAGLIVLAQDIVGEEGYLQKLDITVERNSF
FT                   GRQVDSFEAELDIKGIANDIEAVFIRAPHIEKVNSDNVEILSTVDDKIVAVKEGNYLGV
FT                   SFHPELTDDYRVTQYFIDHIVAEHKHAAV"
FT   CDS_pept        complement(184294..184791)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0175"
FT                   /product="putative acetyltransferase, GNAT family"
FT                   /function="Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /note="(Q47158) Hypothetical acetyltransferase yafP (EC
FT                   2.3.1.-),InterPro: GCN5-related N-acetyltransferase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0175"
FT                   /db_xref="GOA:B9DKX9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKX9"
FT                   /inference="similar to AA sequence:UniProtKB:Q47158"
FT                   /protein_id="CAL27088.1"
FT                   /translation="MDINQIQINKFQESDTQTVVELIIHTLRTTNIQDEPAEDIESYVK
FT                   DITPESIQYKAENLNFYVFKFNNELIATGAIGPYYGSKTESCFFSIFVSPDYQEHGIGT
FT                   LIMDTLEDDYYYHRAERLEIPASITGVNFYRKRGYDYKNGIKEPDNEGLIFLEKFKKAS
FT                   TL"
FT   CDS_pept        complement(184812..185255)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0176"
FT                   /product="Hypothetical protein"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0176"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR009326"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKY0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27089.1"
FT                   /translation="MAIEDYWKTFVSHYPKYQNKPYTAWQFGVDPNKLADLVKRGIKTA
FT                   TTSGLAFYIADQEPLPKVGDLSMVLDAQNNPICIIKNTKVYQTPFSEVSEMHAYKEGEG
FT                   DRTLNYWRTVHTDFFMKEFNSINQSFSEEEIMVCEEFECIHTF"
FT   CDS_pept        complement(185426..186637)
FT                   /transl_table=11
FT                   /gene="nupC"
FT                   /locus_tag="SCA_0177"
FT                   /product="pyrimidine nucleoside transport protein"
FT                   /function="Nucleoside permease"
FT                   /note="(O00337) Sodium/nucleoside cotransporter 1
FT                   (Na(+)/nucleoside cotransporter 1) (Sodium-coupled
FT                   nucleoside transporter 1) (Concentrative nucleoside
FT                   transporter 1) (CNT 1) (hCNT1),InterPro: Na+ dependent
FT                   nucleoside transporter,TMHMM: TM helix"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0177"
FT                   /db_xref="GOA:B9DKY1"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKY1"
FT                   /inference="similar to AA sequence:UniProtKB:O00337"
FT                   /protein_id="CAL27090.1"
FT                   /translation="MHIIIALIGIIFFLALAFVFSSDKKNVKWKYVGILLVIQFIFAFL
FT                   LLKTNVGITVIGGIANGFSYLLAKAADGVNFVFGGFKYVDPKNPPFFFSVLLPIVFISA
FT                   IIGILQYTKILPWIINVLGFLISKINGMGRLESYNAVAAAILGQSEVFISLKKQLPYIP
FT                   KQRLYTLTASAMSTVSASIVGAYFTLLEPKYVVTAIVLNLFGGFIIASIINPYTVDEKD
FT                   DKLLVEETENKQSFFEMLGEYILDGFKVAVIVGAMLIGYIAIIALLNGIVSGIFTMVSG
FT                   GHIKWDFQTLIGFVFAPFAFLTGVPWHEAVKSGSLMATKLLSNEFVAMQGLGKMHGLSD
FT                   RAVGITSVFLVSFANFSSIGIISGAIKSLNNEKGDVVARFGLKLLFGATLVSFISAAIT
FT                   GFFM"
FT   CDS_pept        186810..187271
FT                   /transl_table=11
FT                   /gene="ctsR"
FT                   /locus_tag="SCA_0178"
FT                   /product="transcription repressor of class III stress
FT                   genes"
FT                   /function="Transcriptional repressor of class III stress
FT                   genes"
FT                   /note="(P37568) Transcriptional regulator ctsR,InterPro:
FT                   Firmicute transcriptional repressor of class III stress
FT                   genes,contains helix turn helix motif"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0178"
FT                   /db_xref="GOA:B9DKY2"
FT                   /db_xref="InterPro:IPR008463"
FT                   /db_xref="InterPro:IPR040465"
FT                   /db_xref="InterPro:IPR041473"
FT                   /db_xref="InterPro:IPR041902"
FT                   /db_xref="InterPro:IPR041908"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKY2"
FT                   /inference="similar to AA sequence:UniProtKB:P37568"
FT                   /protein_id="CAL27091.1"
FT                   /translation="MHNMSDIIEQYIKHLFEESNKDVVEIQRANIAQRFDCVPSQLNYV
FT                   IKTRFTNEHGYEIESKRGGGGYIRITKVETKDTKGYIDHLLQIIGDSISQQQAHYVIEG
FT                   LLDNQYITIREAKMILAVVDRDTLRMDVAARDIVRANILKQLLPVINYY"
FT   CDS_pept        187290..187814
FT                   /transl_table=11
FT                   /locus_tag="SCA_0179"
FT                   /product="Hypothetical protein"
FT                   /function="uncharacterized protein with conserved CXXC
FT                   pairs"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0179"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR025542"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKY3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27092.1"
FT                   /translation="MPDDKLDAKASEKYNGMLKEAHPERVEPIKAEHQEEPSWENNQED
FT                   MEGSFVIKQILQHLASKHGIHLEELNVREEKRCPNCHMTIKDIAYKGKFGCAQCYTTFK
FT                   EDIVDIVRRVQGGQFEHVGKTPASSTHKIALKKLIESKNKYLQQLVDKQLFEEAAVVRD
FT                   EIKALQEESEG"
FT   CDS_pept        187819..188823
FT                   /transl_table=11
FT                   /locus_tag="SCA_0180"
FT                   /product="putative phosphotransferase"
FT                   /function="Arginine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="(Q8CTU5) Hypothetical ATP:guanido phosphotransferase
FT                   SE0286 (EC 2.7.3.-),InterPro: ATP:guanido
FT                   phosphotransferase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0180"
FT                   /db_xref="GOA:B9DKY4"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR022415"
FT                   /db_xref="InterPro:IPR023660"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKY4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27093.1"
FT                   /translation="MNEHSMYMSEWMEHGEETPVVMSSRIRLARNLDNHVHPLMFTSDI
FT                   EGQKVINEVQDALPDMQTLQLSNMEQRDKLKLVAKHLISSELIKQPASAVLLNEDESLS
FT                   IMVNEEDHIRIQAMSTDMNLASLFEKASEVDDELDRKLSISFDETLGYLTTCPTNIGTG
FT                   MRASVMLHLPGLSITKRMNRIAQTINRFGFTIRGIYGEGSQVYGHVFQVSNQLTLGRTE
FT                   EQIIEILIEIVQQIITEELNVRKQLDQHSSVEMEDRIYRSLGLLRYSRLMSVEEAAMRL
FT                   SEVKLGVDLGYIELSDFNFNEMMVAIQSPFLINETDEISINEQRANVIREHIN"
FT   CDS_pept        188835..191300
FT                   /transl_table=11
FT                   /gene="clpC"
FT                   /locus_tag="SCA_0181"
FT                   /product="ClpC ATPase family protein"
FT                   /function="ATPases with chaperone activity ATP-binding
FT                   subunit"
FT                   /note="(P37571) Negative regulator of genetic competence
FT                   clpC/mecB,InterPro: AAA ATPase central region"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0181"
FT                   /db_xref="GOA:B9DKY5"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKY5"
FT                   /inference="similar to AA sequence:UniProtKB:P37571"
FT                   /protein_id="CAL27094.1"
FT                   /translation="MLFGRLTERAQRVLAHAQEEAIRLNHSNIGTEHLLLGLMKEPEGI
FT                   AAKVLESFGITEDLVVAEVEKLIGQGQEQVGTLHYTPRAKKVIELSMDEARKLHHNFVG
FT                   TEHILLGLIRENEGVAARVFANLDLNITKARAQVVKALGSPEMSNKNAQATKSNNTPTL
FT                   DGLARDLTVIAKDGTLDPVVGRDTEITRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGLA
FT                   QAIVNNEVPETLKDKRVMSLDMGTVVAGTKYRGEFEERLKKVMEEIHQVGDVILFIDEL
FT                   HTLIGAGGAEGAIDASNILKPALARGELQAIGATTLDEYRKHIEKDAALERRFQPVQVD
FT                   EPTVEDTVSILKGLRDRYEAHHRINISDEAIEAAARLSDRYVSDRFLPDKAIDLIDEAS
FT                   SKVRLKSHTTPTNLKEIEQEIEKVKNEKDAAVHSQEFENAANLRDKQTKLEKQYEDAKN
FT                   EWKNAQGGSNTTLSENDIAEVIAGWTGIPLTRLNETESERLLNLEDTLHERVIGQKDAV
FT                   TSISKAVRRARAGLKDPKRPIGSFIFLGPTGVGKTELARALAESMFGDEDAMIRVDMSE
FT                   FMEKHAVSRLVGAPPGYVGHDDGGQLTEKVRRKPYSVILFDEIEKAHPDVFNILLQVLD
FT                   DGFLTDTKGRRVDFRNTVIVMTSNVGAQELQDQRFTGFGGGSSEGQDYETIRSTMLKEL
FT                   KNAFRPEFLNRVDDIIVFHKLNKDELKEIVTKMVNKLTDRLSEQDINISVTEKAKEKIA
FT                   EEGYDPQYGARPLIRAIQKTVEDNLSELILDGNQLEGKDVVVDHNGEKFEYNINDRETE
FT                   ETVETATKA"
FT   CDS_pept        191563..192933
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="SCA_0182"
FT                   /product="DNA repair protein radA"
FT                   /function="predicted ATP-dependent serine protease"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0182"
FT                   /db_xref="GOA:B9DKY6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKY6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27095.1"
FT                   /translation="MAKKKVIFECMACGYQSPKWMGKCPNCGAWNQMEEIIEKKEAPSG
FT                   RGMRTREQTAKVTKLNQVQNETTPRIKTSSPEFDRVLGGGIVQGSLVLIGGDPGIGKST
FT                   LLLQICSALSQNKKVLYITGEESLNQTKLRADRLDEDSSNLNVFAETDLEVIKEAVKQT
FT                   EPDLVVVDSIQTIYHPDINSAPGSVSQVRESTQILMGIAKQMNIATFIVGHVTKEGQIA
FT                   GPRLLEHMVDTVLYFEGDEHHAYRILRAVKNRFGSTNEMGIFEMKHSGLKGVKNPSEMF
FT                   LEERSTNVAGSTIVPTMEGTRPLLIEVQALVTPTTFNNPRRMATGIDHNRLNLLMAVLE
FT                   KKESYLLQQQDAYIKVAGGVRLTEPAVDLALIAAIASSFKDQPVNGMDCYVGEVGLTGE
FT                   VRRVSRIEQRVQEAAKLGFKRVIIPKTNSGGWDFPEGIQVIGVTSVHEALDFALMKR"
FT   CDS_pept        192964..194022
FT                   /transl_table=11
FT                   /locus_tag="SCA_0183"
FT                   /product="putative membrane domain of (PIN domain
FT                   superfamily)"
FT                   /function="Integral membrane protein (PIN domain
FT                   superfamily)"
FT                   /note="(Q06754) Hypothetical protein yacL,InterPro: PilT
FT                   protein N-terminal"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0183"
FT                   /db_xref="GOA:B9DKY7"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKY7"
FT                   /inference="similar to AA sequence:UniProtKB:Q06754"
FT                   /protein_id="CAL27096.1"
FT                   /translation="MNIIKMIVVASYAILGAALGVVIIPSVARDTGVLNAYPWLTNKYI
FT                   ISLIGIVLFFIIFGVFIPRVIKSLRKLEYFIMRHSAIEILFAAIGLIMGLLISVMISFI
FT                   LNLIGSSLFLHVLPIIITVFLSYLGFQFGLKKRDEMLMFLPEKMARSAHLNTYSAAPKI
FT                   IDTSAVIDGRILDVIKCGFLDGEILIPQGVINELQIVADSTDSVKRDKGQHGLDILNQI
FT                   HDASYPTRIIHPQKSYNDIDALLIKLAHKYKADVITTDFNLNKICHVQGVKVLNVNDLS
FT                   EAVKPTVRQGDQLNLLLTKMGKEPGQGVGYLEDGTMVVIDDAKAYVGKHVDIEITSILQ
FT                   TSSGRIIFAKLI"
FT   CDS_pept        194316..195770
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="SCA_0184"
FT                   /product="putative glutamyl-tRNA synthetase"
FT                   /function="Glutamyl- and glutaminyl-tRNA synthetases"
FT                   /EC_number="6.1.1.17"
FT                   /note="(Q99W75) Glutamyl-tRNA synthetase (EC 6.1.1.17)
FT                   (Glutamate--tRNA ligase) (GluRS),InterPro: Glutamyl-tRNA
FT                   synthetase bacterial/mitochondrial"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0184"
FT                   /db_xref="GOA:B9DKX4"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKX4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27097.1"
FT                   /translation="MSERVRVRYAPSPTGYLHIGNARTALFNYLYAKHYDGDFIVRIED
FT                   TDKKRNLDDGESSQFSNLEWLGLEWDESVDKDKGYGPYRQSERAKFYDPLVEQLLAEDK
FT                   AYKCYMTEEELEQEREEQITRGETPRYAGKHAHLTAEEQAAFEAEGRQPSIRFRVPKGK
FT                   VYKFDDMVKGEVSFESDNIGDWVIVKKDGVPTYNFAVAADDHYMEISDVIRGDDHVSNT
FT                   PKQLMIYEAFGWEPPRFGHISLIVNEQRKKLSKRDGQILQFIEQYRDLGYLPEALFNFI
FT                   TLLGWSPEGEEEIFSKEEFIKIFDENRLQKSPAFFDKKKLAWVNNQYMKQKDSEKVFEL
FT                   ALPHLINAGLIPESPSEADLEWGRKLIGLYQKEMSYAGEIVPLSEMFFRDEIELDEEEK
FT                   EVINGEQVPELMNHLYGKLEALEPFEAAEIKKTIKEVQKETGIKGKQLFMPIRVAVTGE
FT                   MHGPELPNTIEVLGKEKVLTRLKKYL"
FT   CDS_pept        196061..196702
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="SCA_0185"
FT                   /product="serine acetyltransferase"
FT                   /function="Serine acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="(Q8CTU2) Serine acetyltransferase (EC 2.3.1.30)
FT                   (SAT),InterPro: Serine O-acetyltransferase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0185"
FT                   /db_xref="GOA:B9DKW2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKW2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27098.1"
FT                   /translation="MFKRMRDDIKMVFEQDPAARTSFEVATTYAGLHAVWSHLVAHKLY
FT                   NKQHYVAARIISQVSRFFTGIEIHPGAKIGKRLFIDHGMGVVIGETCTIGDNVTIYQGV
FT                   TLGGTGKEKGKRHPDIGDNVLIAAGSKILGNIKVDSNVNIGANSVVLQNVPSYTTVVGI
FT                   PGHIVKQHGKRIGKNFDHLNLPDPIYEQMKQLEKQLEQVKNGEIQDDYII"
FT   CDS_pept        196686..198086
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="SCA_0186"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /function="Cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="(Q8NXY7) Cysteinyl-tRNA synthetase (EC 6.1.1.16)
FT                   (Cysteine--tRNA ligase) (CysRS),InterPro: Cysteinyl-tRNA
FT                   synthetase class Ia"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0186"
FT                   /db_xref="GOA:B9DKW3"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DKW3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27099.1"
FT                   /translation="MITLYNTLTRQKEPFEPLEPGKVKMYVCGPTVYNYIHIGNARPAI
FT                   NYDVVRRYFEYKGYDVNYVSNFTDVDDKLIKRSKELNESVPEIADRYIQAFYEDTGALN
FT                   VKKATSNPRVMNHMDDIIEFIKDLVDKGYAYESGGDVYFRTRKFEGYGKLSHQSIDDLK
FT                   VGARIESGEQKEDALDFTLWKKAKPGEISWDSPFGKGRPGWHIECSVMAYNELGETIDI
FT                   HAGGSDLQFPHHENEIAQSEAHNHAPFANYWMHNGFINIDNEKMSKSLGNFVLVHDIIK
FT                   EVDPDVLRFFMISVHYRSPINYNMELVESAKSGLERIRNSYQAIEEREAIATDIEDQSE
FT                   YIEQIDQLLAQFEKVMDDDFNTANAITTWYDLAKLANKYVLENTTSKKVIERFKEVFQI
FT                   FSDVLGIPLKGKQQDELLDEDIEALIEERNEARKNKDFARADEIRDQLKAQNIILEDTA
FT                   QGVRFKRG"
FT   CDS_pept        198079..198480
FT                   /transl_table=11
FT                   /locus_tag="SCA_0187"
FT                   /product="conserved hypothetical protein"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /EC_number="6.1.1.16"
FT                   /note="(Q05370) Hypothetical 16.3 kDa protein in atpI
FT                   5region (URF4),InterPro: Uncharacterised conserved protein
FT                   UCP005520"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0187"
FT                   /db_xref="GOA:B9DKW4"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR008226"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKW4"
FT                   /inference="similar to AA sequence:UniProtKB:Q05370"
FT                   /protein_id="CAL27100.1"
FT                   /translation="MDNTNQVKLLNPLSLAYMGDAVLDQFVRKHIILKLRAKPNRLHQQ
FT                   AKRYVSAKSQAATLDQLNDEDWFTEEEQEIVRRGRNAKSHTKAKNTDVQTYRKSSGLEA
FT                   VLGFLYLENREDRLQALLEAIVAAVEERE"
FT   CDS_pept        198480..199229
FT                   /transl_table=11
FT                   /gene="spoU"
FT                   /locus_tag="SCA_0188"
FT                   /product="putative rRNA methyltransferase"
FT                   /function="rRNA methylases"
FT                   /note="(Q06753) Hypothetical tRNA/rRNA methyltransferase
FT                   yacO (EC 2.1.1.-),InterPro: RNA methyltransferase TrmH
FT                   group 3"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0188"
FT                   /db_xref="GOA:B9DKW5"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKW5"
FT                   /inference="similar to AA sequence:UniProtKB:Q06753"
FT                   /protein_id="CAL27101.1"
FT                   /translation="MDVEDSVIVGRHAVKEAITTGHPINKILIQDGVKKQQLEEILKHA
FT                   KNQKIVVQTVPKSKLDHLAEAPHQGVAALVAPYEYADLDKLLAQLKDKDGLPTLVILDG
FT                   LEDPHNLGSILRTADAAGVDGVIIPKRRSVALTQTVAKASAGAIQHVPVVRVTNLSQTM
FT                   DQLKDEGYWIAGTAADNATDYRQMAADMPLAIVIGNEGHGMSRLVKEKCDFYIKIPMVG
FT                   HINSLNASVAASLMMYEIYRKRHPAGE"
FT   CDS_pept        199233..199757
FT                   /transl_table=11
FT                   /locus_tag="SCA_0189"
FT                   /product="conserved hypothetical protein"
FT                   /function="predicted RNA-binding protein containing a PIN
FT                   domain"
FT                   /note="(P37574) Hypothetical protein yacP"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0189"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKW6"
FT                   /inference="similar to AA sequence:UniProtKB:P37574"
FT                   /protein_id="CAL27102.1"
FT                   /translation="MKDRYLIIDGYNMIGQSDYLTHLAKDSLEEAREKLLLSIGNYNAA
FT                   VADEIICVFDAYEQEGNESVSYYHGIKTVFTKENETADSYIERLVYDLYDKHTTHIAVV
FT                   TSDLSEQHAIFGTGAYRIPSREMWQNIKLNEAHVNTSMKTFDNNKPRTRIQLSDDVLTE
FT                   FEKIRRGDHEK"
FT   CDS_pept        199829..200413
FT                   /transl_table=11
FT                   /gene="sigH"
FT                   /locus_tag="SCA_0190"
FT                   /product="putative RNA polymerase sigma-H factor"
FT                   /function="DNA-directed RNA polymerase specialized sigma
FT                   subunit sigma24"
FT                   /note="(P17869) RNA polymerase sigma-H factor
FT                   (Sigma-30),InterPro: Sigma-70 region 2"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0190"
FT                   /db_xref="GOA:B9DKW7"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKW7"
FT                   /inference="similar to AA sequence:UniProtKB:P17869"
FT                   /protein_id="CAL27103.1"
FT                   /translation="MPQQQDDISSKITLLISRAQADDADAINQLLILLQPLIRQRIQNR
FT                   SIAVSDCDDLLQDIFLRICRSIDRYKLSARIPFDHFLNRLIKTSKYDYYRKQTRLDKQR
FT                   QCLIEEAVSQYHVSVSERSIEEKLIMEEKCKDIMTYCKKLSKLEQEVVQYTLDDYSPKE
FT                   IANKIGINEKAVYNALHRCKKKLLRQFEHYR"
FT   CDS_pept        200720..200917
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="SCA_0191"
FT                   /function="Preprotein translocase subunit SecE"
FT                   /note="(P36253) Preprotein translocase secE
FT                   subunit,InterPro: Protein secE/sec61-gamma protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0191"
FT                   /db_xref="GOA:P36253"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/Swiss-Prot:P36253"
FT                   /inference="similar to AA sequence:UniProtKB:P36253"
FT                   /protein_id="CAL27104.1"
FT                   /translation="MAEDKKKAPKDSFFKGVISEMEKTSWPTKEEILKYTTIVIVTVVF
FT                   FLIFFYALDLGIGKLIELIS"
FT   CDS_pept        200938..201486
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="SCA_0192"
FT                   /product="transcription antitermination protein"
FT                   /function="Transcription antiterminator"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0192"
FT                   /db_xref="GOA:P36264"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/Swiss-Prot:P36264"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27105.1"
FT                   /translation="MSEEVGAKRWYAVHTYSGYENKVKKNLEKRVESMNMTEQIFRVVI
FT                   PEEEETQVKDGKAKKLTKKTFPGYVLVELVMTDESWYVVRNTPGVTGFVGSAGAGSKPN
FT                   PLLPDEVRFILKQMGMKEKTIDVEVEVGEQVRIKSGPFANQVGEVQEIEADKFKLTVLV
FT                   DMFGRETPVEVEFDQIEKL"
FT   CDS_pept        201669..202091
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="SCA_0193"
FT                   /product="50S ribosomal protein L11"
FT                   /function="Ribosomal protein L11"
FT                   /note="(Q8ETZ3) 50S ribosomal protein L11,InterPro:
FT                   Ribosomal protein L11 bacterial"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0193"
FT                   /db_xref="GOA:P36254"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:P36254"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27106.1"
FT                   /translation="MAKKVEKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNAR
FT                   TQEQAGLIIPVEISVYEDRSFTFITKTPPAPVLLKKAAGVEKGSGEPNKNKVATVTKDQ
FT                   VREIAQTKMPDLNAADEEAAMRIIEGTARSMGITVE"
FT   CDS_pept        202297..202992
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="SCA_0194"
FT                   /product="50S ribosomal protein L1"
FT                   /function="Ribosomal protein L1"
FT                   /note="(Q8CTT4) 50S ribosomal protein L1,InterPro:
FT                   Ribosomal protein L1 bacterial and chloroplast form"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0194"
FT                   /db_xref="GOA:B9DKX1"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DKX1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27107.1"
FT                   /translation="MAKKGKKYLDAASKVDRNEHYSVEDAISLAKETSVANFDATVEVA
FT                   FRLVIDTRKNDQQIRGAVVLPHGTGKTQRVLVFAKGDKASEAEAAGADYVGESEYATKI
FT                   QQGWFDFDVVVATPDMMGEVGKLGRVLGPKGLMPNPKTGTVTMDVKKAVEEIKAGKVEY
FT                   RAEKAGIIHASIGKVSFSTEDLVENFNTLQDVIAKAKPASAKGTYFKSVAVTTTMGPGV
FT                   KVDTSNFKL"
FT   CDS_pept        203332..203832
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="SCA_0195"
FT                   /product="50S ribosomal protein L10"
FT                   /function="Ribosomal protein L10"
FT                   /note="(Q8CTT2) 50S ribosomal protein L10,InterPro:
FT                   Ribosomal protein L10"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0195"
FT                   /db_xref="GOA:B9DKX2"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DKX2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27108.1"
FT                   /translation="MSGIIEAKKQLVEQIADQLKNSVSTVIVNYRGLTVAEVTELRKQL
FT                   REAGVEYKVYKNTMMRRAAEQAGLEGLDEFLTGPTAVATSTEDVVAPAKVIAGFAKEHE
FT                   ALEIKTGVMDGSIISAEEVKTVGSLPSHDGLVSMLLSVLQAPVRNFAYAVKAVGESKEE
FT                   SAE"
FT   CDS_pept        203873..204238
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="SCA_0196"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /function="Ribosomal protein L7/L12"
FT                   /note="(Q8CTT1) 50S ribosomal protein L7/L12,InterPro:
FT                   Ribosomal protein L7/L12"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0196"
FT                   /db_xref="GOA:B9DKX3"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKX3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27109.1"
FT                   /translation="MANQEQIIEAIKEMSVLELNDLVKAIEEEFGVTAAAPVAAAGAAG
FT                   GGEAAEKTEFDVELTSAGSSKIKVVKAVKDATGLGLKDAKELVDNAPKVIKEALPKEEA
FT                   EKLKEQLEEVGASVELK"
FT   CDS_pept        204499..205104
FT                   /transl_table=11
FT                   /locus_tag="SCA_0197"
FT                   /product="putative rRNA methylase"
FT                   /function="16S RNA G1207 methylase RsmC"
FT                   /note="(P37872) Hypothetical protein ybxB (P23)
FT                   (ORF23),InterPro: SAM (and some other nucleotide) binding
FT                   motif"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0197"
FT                   /db_xref="GOA:B9DKW1"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKW1"
FT                   /inference="similar to AA sequence:UniProtKB:P37872"
FT                   /protein_id="CAL27110.1"
FT                   /translation="MSHYYDEDPEVASQREDFKYRYQQNELKLATDSGVFSKGKIDYGS
FT                   DLLLRTFLKEHPPGPSKTIIDVGCGYGPIGLMIAKVSPHHKVILLDVNHRALDLAKENS
FT                   EKNHIDNAVIQESDGLAEIPDDSADMIVTNPPIRAGKSVVHGILEDAYSKLKKDGELYV
FT                   VIQKKQGMPSAKKKMEAVFGNVETLAKDKGYYILKSKH"
FT   CDS_pept        complement(205159..205296)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0198"
FT                   /product="putative membrane protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0198"
FT                   /db_xref="GOA:B9DKU9"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKU9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27111.1"
FT                   /translation="MSFTVQIIQNPTRQKENGSTPDDTIFYSALLMIYFVILYVKVHTY
FT                   "
FT   CDS_pept        205325..208876
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="SCA_0199"
FT                   /product="RNA polymerase beta chain"
FT                   /function="DNA-directed RNA polymerase beta subunit/140 kD
FT                   subunit (split gene in Mjan Mthe Aful)"
FT                   /EC_number="2.7.7.6"
FT                   /note="(Q8CQ84) DNA-directed RNA polymerase beta chain (EC
FT                   2.7.7.6) (RNAP beta subunit) (Transcriptase beta chain)
FT                   (RNA polymerase beta subunit),InterPro: RNA polymerase beta
FT                   subunit"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0199"
FT                   /db_xref="GOA:B9DKV0"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DKV0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27112.1"
FT                   /translation="MAGKFVQYGRHRKRRNYARISEVLELPNLIEIQTKSYDWFLKEGL
FT                   LEMFRDISPIEDFTGNLSLEFVDYRLGEPKYDLEESKNRDATYAAPLRVKVRLINKETG
FT                   EVKDQEVFMGDFPLMTDTGTFVINGAERVIVSQLVRSPSVYFNEKIDKNGRENYDATVI
FT                   PNRGAWLEFETDAKDIVYVRIDRTRKLPLTVLLRALGYSTDQSIIDLLGDNEYLRNTLE
FT                   KDSTENTEQALLEIYERLRPGEPPTVENAKSLLYSRFFDPKRYDLASVGRYKMNKKLHL
FT                   KHRLFNQKLAEPIVNSDTGEIVAEEGTVLDRRKLDEIMDVLESNANIEVDELDDSIVNE
FT                   PVEIQSIKVYVPNDEEGRTTTVIGNAFPDSEVKCITPADIVASMSYFFNLLHGIGQTDD
FT                   IDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMSIQDTDSITPQQLINIRPVIASIK
FT                   EFFGSSQLSQFMDQANPLAELTHKRRLSALGPGGLTRERAQMEVRDVHYSHYGRMCPIE
FT                   TPEGPNIGLINSLSSYARVNEFGFIETPYRKVDLETNTVTDQIDYLTADEEDSYVVAQA
FT                   NSRLDDEGHFISEEVVCRFRGNNTMMDRDKMDYMDVSPKQVVSAATACIPFLENDDSNR
FT                   ALMGANMQRQAVPLMNPESPFVGTGMEHATARDSGAAVINKHFGRVEHVESNEIKVRRI
FT                   IEEDGQQYDGELDTYRLAKFKRSNSGTCYNQRPIVKDGDIVSQGEILADGPSMELGEMA
FT                   LGRNVVVGFMTWDGYNYEDAVIMSERLVKDDVYTSIHIEEYESEARDTKLGPEEITRDI
FT                   PNVAESALKNLDERGIVYVGAEVKDGDILVGKVTPKGVTELTAEERLLHAIFGEKAREV
FT                   RDTSLRVPHGAGGIVLDVKVFNREDGDDSLSPGVNQLVRVYIVQKRKIHVGDKMCGRHG
FT                   NKGVISKIVPEEDMPYLPDGTPIDIMLNPLGVPSRMNIGQVLELHLGMAAKNLGIHVAS
FT                   PVFDGANDDDVWSTIEEAGMARDGKTVLYDGRTGEPFDNRISVGVMYMLKLAHMVDDKL
FT                   HARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTYKSDDTVGRV
FT                   KTYEAIVKGENISKPSVPESFRVLMKELQSLGLDVKVMDEDDKEIEMADVDEDDVNEHK
FT                   VNIQQSSIPESQKETTD"
FT   CDS_pept        209058..212696
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="SCA_0200"
FT                   /product="RNA polymerase beta-prime chain"
FT                   /function="DNA-directed RNA polymerase beta subunit/160 kD
FT                   subunit (split gene in archaea and Syn)"
FT                   /EC_number="2.7.7.6"
FT                   /note="(Q8CQ83) DNA-directed RNA polymerase beta chain (EC
FT                   2.7.7.6) (RNAP beta subunit) (Transcriptase beta chain)
FT                   (RNA polymerase beta subunit),InterPro: RNA polymerase Rpb1
FT                   domain 5"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0200"
FT                   /db_xref="GOA:B9DKV1"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKV1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27113.1"
FT                   /translation="MIDVNNFHYMKIGLASPEKIRSWSYGEVKKPETINYRTLKPEKDG
FT                   LFCERIFGPTKDWECSCGKYKRVRYKGMVCDRCGVEVTKSKVRRERMGHIELAAPVSHI
FT                   WYFKGIPSRMGLLLDMSPRSLEEVIYFASYVVVDPGPTGLEKKSLLSEAEYREYYDKYP
FT                   GQFVAKMGAEGIKDLLSEIDLDEELKELRTELESATGQRLTRAIKRLEVVESFRNSGND
FT                   PSWMILDVLPIIPPEIRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPGIIV
FT                   QNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSG
FT                   RSVIAVGPSLKMYQCGLPKEMALELFKPFVMKELVQREIATNIKNAKSKIERMEDEVWD
FT                   VLEDVIKEHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVTTAYNADFDGDQMAVH
FT                   VPLSKEAQAEARMLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERKDAVNTGAIFN
FT                   NTNEVLKAYQNGYVHLHTRIGLHAGSLNNPTFTEEQNNKILTTSVGKVIFNEIIPDSFA
FT                   YINEPTQSNLEDKTPDKYFVSATELGEGGLKEYFAEQELVEPFNKKFLGNIIAEVFNRF
FT                   SITDTSMMLDRMKDLGFKYSSKAGITVGVSDIIVLPDKQEILDEHEKLVERVQKQYNRG
FT                   LITEDERYNAVIEIWTDAKDEIQSRLMKSLDKTNPIFMMSDSGARGNASNFTQLAGMRG
FT                   LMAAPSGKIIEMPITSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVA
FT                   QDVIVREEDCGTDRGLLVSDIKEGTEMIEPFIERIEGRYSKETVRHPETDEVLVEPDQL
FT                   ITPEIAKRITDAGIEQMYIRSAFTCNTRHGVCEKCYGKNLATGEKVEVGEAVGTIAAQS
FT                   IGEPGTQLTMRTFHTGGVAGSDITQGLPRIQEIFEARNPKGQAVITDIEGTVEDIKLAK
FT                   DRQQEIVIKGANETRSYLASGTSRLKVEKGQHVERGEVLTEGSIEPKNYLSVAGLNATE
FT                   SYLLKEVQKVYRMQGVEIDDKHVEVMVRQMLRKVRIIEAGDTKLLPGSLVDIHNFTDAN
FT                   REAFKERKRPATAKPVLLGITKASLETESFLSAASFQETTRVLTDAAIKGKRDDLLGLK
FT                   ENVIIGKLIPAGTGMRRYSDAKYEKHVDPMVEEAIEEIAATDTPQQ"
FT   CDS_pept        212879..213043
FT                   /transl_table=11
FT                   /locus_tag="SCA_0201"
FT                   /product="putative membrane protein"
FT                   /note="TMHMM: TM helix"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0201"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKV2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27114.1"
FT                   /translation="MKKLLGLSLLLVILLAACGNKVGGTYVNKKEHVTLVANNEKKQLV
FT                   LAWHLLGRH"
FT   CDS_pept        213019..213201
FT                   /transl_table=11
FT                   /locus_tag="SCA_0202"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0202"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKV3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27115.1"
FT                   /translation="MAPFGAPLEINGKIDTDKKTITFKEDSESLKFNYEFDKKQLILYE
FT                   GKDGKKKGIKLDKEE"
FT   CDS_pept        213403..213657
FT                   /transl_table=11
FT                   /locus_tag="SCA_0203"
FT                   /product="putative ribosomal protein"
FT                   /function="Ribosomal protein HS6-type (S12/L30/L7a)"
FT                   /note="(Q53602) Putative ribosomal protein
FT                   L7Ae-like,InterPro: Ribosomal protein
FT                   L7Ae/L30e/S12e/Gadd45"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0203"
FT                   /db_xref="GOA:B9DKV4"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKV4"
FT                   /inference="similar to AA sequence:UniProtKB:Q53602"
FT                   /protein_id="CAL27116.1"
FT                   /translation="MSNEKVARFNKHHSVVGLRETLKALNKNQVTSLIIAQDVEVYLLS
FT                   DVLSKINHSEIPVSFFESKKALGEYAGINVDAAIVALLK"
FT   CDS_pept        213753..214166
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="SCA_0204"
FT                   /product="30S ribosomal protein S12"
FT                   /function="Ribosomal protein S12"
FT                   /note="(Q927I3) 30S ribosomal protein S12,InterPro:
FT                   Ribosomal protein S12 bacterial and chloroplast form"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0204"
FT                   /db_xref="GOA:B9DKV5"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DKV5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27117.1"
FT                   /translation="MPTINQLVRKPRKSKAKKSDSPALNKGFNSMKKQFTDLNSPQKRG
FT                   VCTRVGTMTPKKPNSALRKYARVRLSNNIEINAYIPGIGHNLQEHSVVLVRGGRVKDLP
FT                   GVRYHIVRGALDTSGVEGRMQSRSLYGTKRPKK"
FT   CDS_pept        214237..214707
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="SCA_0205"
FT                   /product="30S ribosomal protein S7"
FT                   /function="Ribosomal protein S7"
FT                   /note="(Q8R7V0) 30S ribosomal protein S7,InterPro:
FT                   Ribosomal protein S7"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0205"
FT                   /db_xref="GOA:B9DKV6"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DKV6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27118.1"
FT                   /translation="MPRKGSVPKRDVLPDPIHNSKLVTKLINKIMLDGKRGTAQRILYS
FT                   AFDIVQERSGRDAIEVFEEAINNIMPVLEVKARRVGGSNYQVPVEVRPERRTTLGLRWL
FT                   VNYSRLRGEKTMEERLANEILDAANNTGGAVKKREDTHKMAEANKAFAHYRW"
FT   CDS_pept        214821..216902
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="SCA_0206"
FT                   /product="elongation factor EF-G"
FT                   /function="Translation elongation factors (GTPases)"
FT                   /EC_number="3.6.5.3"
FT                   /note="(Q8CQ82) Elongation factor G (EF-G),InterPro:
FT                   Translation elongation factor G"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0206"
FT                   /db_xref="GOA:B9DKV7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DKV7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27119.1"
FT                   /translation="MARDFSLEKTRNIGIMAHIDAGKTTTTERILYYTGRIHKIGETHE
FT                   GASQMDWMEQEQDRGITITSAATTAQWHDYRVNIIDTPGHVDFTVEVERSLRVLDGAVT
FT                   VLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKLGANFEYSVSTLHDRLQANAQPIQ
FT                   LPIGAEDEFEAIIDLVTMKCYQYNGDFGEEVVEIEIPDDYKDKAAEARESLIEAVAEAN
FT                   EDLMEKYLEGEEITIDELKAAIRQATLDIEFYPVLCGTAFKNKGVQLMLDAVIDYLPSP
FT                   LDVKPIVGHHADNPDEEVIAPADDDADFAALAFKVMTDPYVGKLTFFRVYSGTLNSGSY
FT                   VKNSTKDKRERVGRLLQMHANTRKEISTVYSGDIAAAVGLKETGTGDTLCGEKNDIILE
FT                   SMEFPEPVIHLSVEPKSKADQDKMTQALVKLQEEDPTFHAHTDEETGQVIIGGMGELHL
FT                   DILVDRMKKEFNVEANVGAPMVSYRETFKTPAKVQGKFSRQSGGRGQYGDVHIEFTPNE
FT                   VGAGFEFENAIVGGVVPREYIPSVEAGLKDAMENGVVAGYPLIDVKAKLYDGSYHDVDS
FT                   SEMAFKIAASLALKEAAKVADPVILEPMMKVEILMPEEYMGDIMGDVTSRRGRVDGMEA
FT                   RGNAQMVRAFVPLSEMFGYATSLRSNTQGRGTYTMYFDHYEEVPKSIAEDIIKKNKGE"
FT   CDS_pept        217092..218279
FT                   /transl_table=11
FT                   /gene="tufA"
FT                   /locus_tag="SCA_0207"
FT                   /product="translational elongation factor TU"
FT                   /function="GTPases - translation elongation factors"
FT                   /EC_number="3.6.5.3"
FT                   /note="(Q99W61) Elongation factor Tu (EF-Tu),InterPro:
FT                   Translation elongation factor Tu"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0207"
FT                   /db_xref="GOA:B9DKV8"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DKV8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27120.1"
FT                   /translation="MAKEKFDRSKEHANIGTIGHVDHGKTTLTAAIATVLAKNGDTVAQ
FT                   SYDMIDNAPEEKERGITINTSHIEYQTDKRHYAHVDCPGHADYVKNMITGAAQMDGGIL
FT                   VVSAADGPMPQTREHILLSRNVGVPALVVFLNKADMVDDEELLELVEMEVRDLLSEYDF
FT                   PGDDVPVIVGSALKALEGDAEYEQKILDLMQAVDDYIPTPERDSDKPFMMPVEDVFSIT
FT                   GRGTVATGRVERGQIKVGEEVEIIGITEESMKTTVTGVEMFRKLLDYAEAGDNIGALLR
FT                   GVAREDVQRGQVLAAPGSITPHTKFKADVYVLSKDEGGRHTPFFTNYRPQFYFRTTDVT
FT                   GVVNLPEGTEMVMPGDNVEMTVELIAPIAIEDGTRFSIREGGRTVGSGVVTEIQQ"
FT   CDS_pept        complement(218561..219577)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0208"
FT                   /product="putative peptidase"
FT                   /function="Metal-dependent
FT                   amidase/aminoacylase/carboxypeptidase"
FT                   /note="(P37112) N-acyl-L-amino acid amidohydrolase (EC
FT                   3.5.1.14) (L-aminoacylase),InterPro: Peptidase M20/M25/M40"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0208"
FT                   /db_xref="GOA:B9DKV9"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKV9"
FT                   /inference="similar to AA sequence:UniProtKB:P37112"
FT                   /protein_id="CAL27121.1"
FT                   /translation="MINWYQLAHDKEKTMIQIRRHLHQYPELSFEESHTHDYIVNQLEQ
FT                   LSCEIRRPVGKNGIVATFKGQGDGPTVALRADFDALPITELNDKPYRSKNEGCMHACGH
FT                   DGHTAILLGVAEVINEHLAYLNGNVVLIFQYGEEIVPGGAQQMIDDGCLDGVDRVYGNH
FT                   LWSGYPTGIIYSRPGAMMASPDEFTVKITGKGGHGAKPHETIDPIVILAEFILSAQKIV
FT                   SRTVDPIKQAVVTFGMIQAGASDSVIPDSAICKGTVRTFDPDIQTHIMNKLDKLLQGLA
FT                   VANDIEYDLDYERGYVPVHNNPQAYEIVKEAANDLNFRFTEADMMMVGEDFSAYQRV"
FT   CDS_pept        219773..220960
FT                   /transl_table=11
FT                   /gene="kbl"
FT                   /locus_tag="SCA_0209"
FT                   /product="putative 2-amino-3-ketobutyrate coenzyme A
FT                   ligase"
FT                   /function="7-keto-8-aminopelargonate synthetase and related
FT                   enzymes"
FT                   /EC_number="2.3.1.29"
FT                   /note="(P60121) 2-amino-3-ketobutyrate coenzyme A ligase
FT                   (EC 2.3.1.29) (AKB ligase) (Glycine
FT                   C-acetyltransferase),InterPro: Aminotransferase class I and
FT                   II"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0209"
FT                   /db_xref="GOA:B9DKW0"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR010962"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKW0"
FT                   /inference="similar to AA sequence:UniProtKB:P60121"
FT                   /protein_id="CAL27122.1"
FT                   /translation="MVQSLHSFLDENIQYLKDNGLYNEIDTVEGANGPEITIAGKRYIN
FT                   LSSNNYLGLATNEDLKQVAKDAVDKYGVGAGAVRTINGTLDIHDELEETLAEFKGTEAA
FT                   VAYQSGFNCNMAAISAVMNKNDAILSDELNHASIIDGCRLSKAKIIRVNHSDMDDLRQK
FT                   AKEAVESGQYNKVMYITDGVFSMDGDVAKLPEIVEIAEEYGLITYVDDAHGSGVMGKGA
FT                   GTVKHFGLQDKIDFQIGTLSKAIGVVGGYVAGTQELIDWLKVQSRPFLFSTSLTPESSA
FT                   AIIAAVRKLMNSTELHDKLWDNANYLKDGLKKLGYDIGDSETPITPVIIGDEKKTQEFS
FT                   KRLKDEGVYVKSIVFPTVPRGTGRVRNMPTAAHTKEMLDEALAAYEKVGKELGVI"
FT   CDS_pept        complement(221074..222072)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0210"
FT                   /product="Choloylglycine hydrolase family protein"
FT                   /function="Penicillin V acylase and related amidases"
FT                   /EC_number="3.5.1.-"
FT                   /note="(P54948) Hypothetical protein yxeI,InterPro:
FT                   Choloylglycine hydrolase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0210"
FT                   /db_xref="GOA:B9DKU8"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029132"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKU8"
FT                   /inference="similar to AA sequence:UniProtKB:P54948"
FT                   /protein_id="CAL27123.1"
FT                   /translation="MCTSFTFTSQYDADYLGRTMDFSFQLNSFPKVMPRGYEWETSNGR
FT                   SFNLEYGFVGTAMTTNGVVFADGLNEQGLSIAVLYYSGEASYATSTSSNNINLEPEEFI
FT                   MWFLGMNESIADVKENIDKVRILKQVNPALDRVPPLHFLVTDQTGQSIVITPIDGQLIV
FT                   QDNPVQVLTNNPSLEWHYQNLRQHTTFNVEAPAPQLLGMKHIEPIGVEAGTENLPGGYT
FT                   SPARFVRAAYFRQYIEDAENENKRLNNMFKLLDTVSVPRGIVLDEGLPHYTQYQCVMNC
FT                   SNLKYYYRDYYGSDVYTIELTDDLVTAEEPKSYTVKPSLQFVNLNEEEADA"
FT   CDS_pept        222170..222673
FT                   /transl_table=11
FT                   /locus_tag="SCA_0211"
FT                   /product="putative acetyltransferase, GNAT family"
FT                   /function="predicted acetyltransferase"
FT                   /note="InterPro: GCN5-related N-acetyltransferase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0211"
FT                   /db_xref="GOA:B9DKT6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKT6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27124.1"
FT                   /translation="MTVEIRELELTDEFIFNAYIKSWETEQIIPTAINPKRYTSYSELV
FT                   SELKQRTLNKEWVPNTTLFLFNNEKIIGSVNIRHHLNEHLKRIGGHIGYGVRPDYRGHG
FT                   YAKKLLKAGLEFLNQRDVVDALVTCDKSNIASAKTILAFHPKELESVVIDGKTLRRFLV
FT                   STDQ"
FT   CDS_pept        222688..223149
FT                   /transl_table=11
FT                   /locus_tag="SCA_0212"
FT                   /product="putative acetyltransferase, GNAT family"
FT                   /note="(Q58604) Hypothetical acetyltransferase MJ1207 (EC
FT                   2.3.1.-),InterPro: GCN5-related N-acetyltransferase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0212"
FT                   /db_xref="GOA:B9DKT7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKT7"
FT                   /inference="similar to AA sequence:UniProtKB:Q58604"
FT                   /protein_id="CAL27125.1"
FT                   /translation="MEIKVCRDAAVLARLNEAVHSLHAKAYPDIFKPFNYLDSLDFFQK
FT                   LLEREEQYFYAVYQGDEAVGYIWFQIISLMETPFRYGMKSLYIHQLSIESNHRQQGHGH
FT                   ALMAFAEHFAEQHGCETVELDYWDKNLSAAFFYEKEGYENLRQYARKKL"
FT   CDS_pept        223359..224321
FT                   /transl_table=11
FT                   /locus_tag="SCA_0213"
FT                   /product="NAD dependent epimerase/dehydratase family
FT                   protein"
FT                   /function="Nucleoside-diphosphate-sugar epimerases"
FT                   /EC_number="5.1.3.-"
FT                   /note="(P44094) Hypothetical protein HI1014"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0213"
FT                   /db_xref="GOA:B9DKT8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKT8"
FT                   /inference="similar to AA sequence:UniProtKB:P44094"
FT                   /protein_id="CAL27126.1"
FT                   /translation="MERIMITGALGQIGTELVLKCREIYGEENVLATDIREPEADSPIK
FT                   DGPFALLDVTDITRMEEIVSEFKPDALMHMAALLSATAEKNPLLAWNINMGGLVNALEV
FT                   SREYNLQFFTPSSIGAFGPTTPKDKTPALTIQRPTSMYGVNKVSGELLCEYYNSKFGVD
FT                   TRSVRFPGLISYVKEPGGGTTDYAVEIYFDALRKGEYTSFIDKGTYMDMMFMDDAIEAI
FT                   IKLMEADGDKIKHRCAYNLSGMSFEPEEIAESIRKHIPDFVLKYDVDPVRQGIADSWPD
FT                   RIDVSCSTDEWGFSPQYDLDAMTVAMLEGIKAKDAATQH"
FT   CDS_pept        224510..225547
FT                   /transl_table=11
FT                   /locus_tag="SCA_0214"
FT                   /product="Peptidase_U61, LD-carboxypeptidase family
FT                   protein"
FT                   /function="uncharacterized proteins homologs of microcin C7
FT                   resistance protein MccF"
FT                   /note="(O31020) Hypothetical protein VCA0337,InterPro:
FT                   Protein of unknow function UPF0094"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0214"
FT                   /db_xref="GOA:B9DKT9"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKT9"
FT                   /inference="similar to AA sequence:UniProtKB:O31020"
FT                   /protein_id="CAL27127.1"
FT                   /translation="MKNLIKPNHLQSGDTVAFVSPSSGLAGEEFVSHRVELAKQRMENI
FT                   FGLKVKVMKHALDGIDTLYNHPQYRAEDIHDALLDDEIKGVFSFIGGEESMRIVPYLDE
FT                   NIIREHPKIFMGYSDVTSIHLKFYKAGVMSYYGPAVLTDFAENVEMDDYTIKNIKKVLF
FT                   TNNTIGNIPTSNYYRKFGLKWSESNKNVSREKINNQTYEVLSGKGKATGTLIGGCFEVL
FT                   NNLRGTEVFPNEDAFKGKILFVENSESQLPIYFLKQALRSLGYMGILKNIEGIIVGKPQ
FT                   NDENIKEIKETWIQVLKEHHLEDKILFFNASFGHNEPKCILPYGVVATLDAEQLKFEIN
FT                   ESGCS"
FT   CDS_pept        225769..226848
FT                   /transl_table=11
FT                   /gene="ilvE"
FT                   /locus_tag="SCA_0215"
FT                   /product="branched-chain amino acid aminotroansferase"
FT                   /function="Branched-chain amino acid
FT                   aminotransferase/4-amino-4-deoxychorismate lyase"
FT                   /EC_number="2.6.1.42"
FT                   /note="(Q8CQ78) Probable branched-chain amino acid
FT                   aminotransferase (EC 2.6.1.42) (BCAT),InterPro:
FT                   Branched-chain amino acid aminotransferase II"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0215"
FT                   /db_xref="GOA:B9DKU0"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKU0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27128.1"
FT                   /translation="MSEKVKFEKREDLKQKPDPKNLGFGQYFTDYMLSYDYDSEKGGWH
FT                   DLKITPYAPIELDPAAQGLHYGQLVFEGLKAYKHNGEVVLFRPDQNFARINQSLDRLEM
FT                   PQIDEEELLEGLKQLVDVERDWVPEGEGQSLYIRPFVFATEAGLGVHPAHNYKLLIILS
FT                   PSGSYYGGDSLKPTRIYVEDEYVRAVRGGVGFAKVAGNYAASLLSQSNANEQGYDQVLW
FT                   LDGVERKYIEEVGSMNIFFVENGKLVTPKLNGSILPGITRKTVIALAKELGYEVEERHI
FT                   SIDELLESYDKGELEEVFGTGTAAVISPVGTLKYEDREITINNNETGPITQRLYDEYTG
FT                   IQSGKLDDPQGWRVVVPEY"
FT   CDS_pept        227003..227392
FT                   /transl_table=11
FT                   /locus_tag="SCA_0216"
FT                   /product="putative membrane protein"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /note="(P45808) Hypothetical protein ybaN,InterPro: Protein
FT                   of unknown function DUF454"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0216"
FT                   /db_xref="GOA:B9DKU1"
FT                   /db_xref="InterPro:IPR007401"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKU1"
FT                   /inference="similar to AA sequence:UniProtKB:P45808"
FT                   /protein_id="CAL27129.1"
FT                   /translation="MKYVLMTLGLIFAGIGFVGIVVPLLPTTPFLLLAAICFSRSSKKF
FT                   NRWLVNTKIHDEYVESFKRDKGFTLKKKFKLLTSLYILMGISIFIIDNLYIRITLLIML
FT                   FVQTVVLFTFVRTLPDNTKTKEQEE"
FT   CDS_pept        227536..228255
FT                   /transl_table=11
FT                   /locus_tag="SCA_0217"
FT                   /product="putative haloacid dehalogenase-like hydrolase"
FT                   /function="predicted phosphatases"
FT                   /note="(Q8DCT7) Phosphoglycolate phosphatase (EC 3.1.3.18)
FT                   (PGP),InterPro: Haloacid dehalogenase-like hydrolase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0217"
FT                   /db_xref="GOA:B9DKU2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKU2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27130.1"
FT                   /translation="MALKWILFDKDGTLIDFDMSWMKVDIQMVDEFVEKYISQENVEHA
FT                   YKTLGVDKEKDQVLPGTPMACGSLDEIIQNFNALAGEDVSEWTRQTSQYLIDHRIPEIK
FT                   CIEGMTDALDALKHAGYQIGILTSDTKKGTEQFVEATDTEAFFDFIISTEANAAEKPNP
FT                   EVLCPLFEHVSDLRAEEIAIVGDSPNDIQTAINSGLGLSIAVLTGVGQEHELQHADYIF
FT                   QSAPEAVNLLVDKKNEK"
FT   CDS_pept        228296..228703
FT                   /transl_table=11
FT                   /locus_tag="SCA_0218"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0218"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKU3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27131.1"
FT                   /translation="MADQRTIVDGRYAEYQGEIFRVINEFSPKLKLVTENPKAEAWGFK
FT                   AQTTKHTNHTLYYKEVKRTEVDALYEIKHEARYGGTLFDLYYDAQGQSYIGTSEADKAE
FT                   AFGLKETDEDYYSKPVEDDEYEPVIYRNDLE"
FT   CDS_pept        228726..229544
FT                   /transl_table=11
FT                   /locus_tag="SCA_0219"
FT                   /product="predicted hydrolase of the HAD superfamily"
FT                   /function="predicted hydrolases of the HAD superfamily"
FT                   /note="(P44447) Protein HI0003,InterPro: HAD-superfamily
FT                   hydrolase subfamily IIB"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0219"
FT                   /db_xref="GOA:B9DKU4"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR006380"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKU4"
FT                   /inference="similar to AA sequence:UniProtKB:P44447"
FT                   /protein_id="CAL27132.1"
FT                   /translation="MKHHLILFDFDETYYKHATTKEDIPDLRKLEETLEQAVKNDNVIT
FT                   AFLSGSIFPNIMKKMEKAEMKFKPQYIFSDLCSQMYQLDDSGEYHEYKDYEEAVSETPF
FT                   TKEKVDEIIHNFEKKYDVTLYPQREYREKETLYEFYFYSQGSQNEDIKMLEDLQKEAAS
FT                   FDYAVHFNKTNPLAGDPENAYDVNFTPKNAGKLFAVKYLLDLFDVPATEVLGFGDSGND
FT                   ETYLSYIGHPFVMSNSTDDEMKEQFPNTKYDYYKGLDDEVKKYLKKIKND"
FT   CDS_pept        complement(229586..230248)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0220"
FT                   /product="putative deoxynucleoside kinase"
FT                   /function="Deoxynucleoside kinases"
FT                   /note="(P37529) Hypothetical protein yaaF,InterPro:
FT                   Deoxynucleoside kinase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0220"
FT                   /db_xref="GOA:B9DKU5"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKU5"
FT                   /inference="similar to AA sequence:UniProtKB:P37529"
FT                   /protein_id="CAL27133.1"
FT                   /translation="MNNYGIPQDAVITIAGTVGVGKSSLTRALAKKLNFRTSFENVDHN
FT                   PYLDKFYDDFERWSFHLQIYFLAERFKEQKRMFEYGGGFIQDRSIYEDVDIFAKMHEEQ
FT                   GTMSKEDFETYSQLFDAMVMTPYFPKPDVLVYLECDYDEVIDRIHQRGRQMEIDTDPEY
FT                   WKKLFRRYDEWIYNFNACPVVRVNINEYDLHESLDTLDPVLDKIANIIKIHREVDPR"
FT   CDS_pept        complement(230241..230858)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0221"
FT                   /product="putative deoxynucleoside kinase"
FT                   /function="Deoxynucleoside kinases"
FT                   /note="(P37530) Hypothetical protein yaaG,InterPro:
FT                   Deoxynucleoside kinase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0221"
FT                   /db_xref="GOA:B9DKU6"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKU6"
FT                   /inference="similar to AA sequence:UniProtKB:P37530"
FT                   /protein_id="CAL27134.1"
FT                   /translation="MNQPYIAIEGPIGVGKSTLAHYLSETLQYHEAQEIVDENPFLSDF
FT                   YEDISTWSFQTEMFFLCNRYKQVQDLEQQSSGIVSDYHIFKNKIFARQTLTDTEFDKFS
FT                   RIYNILTEDLMMPNVVIFLDADLEVLKQRIAKRNRSFEHQIEDDYLLNLKQAYWEFYQS
FT                   LKAQGKKAKWIDTTELDFVNHPDDYAQILNIVQTMIGGTKHE"
FT   CDS_pept        230924..231403
FT                   /transl_table=11
FT                   /locus_tag="SCA_0222"
FT                   /product="putative deaminase"
FT                   /function="Cytosine/adenosine deaminases"
FT                   /note="(P30134) Hypothetical protein yfhC,InterPro:
FT                   Cytidine/deoxycytidylate deaminase zinc-binding region"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0222"
FT                   /db_xref="GOA:B9DKU7"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKU7"
FT                   /inference="similar to AA sequence:UniProtKB:P30134"
FT                   /protein_id="CAL27135.1"
FT                   /translation="MATDENYMKLALEEAKKAERIGEVPIGAIVVKEGEVIARAHNLRE
FT                   TVQQPTAHAEHIAIEKAAEAVGSWRLEDCTLYVTLEPCVMCSGAIVMSRIPRVVYGASD
FT                   PKGGCSGSLMDLLQEPRFNHRAEVVSGVLENECGAILKSFFKQLREKKKAAKNSD"
FT   CDS_pept        231618..232496
FT                   /transl_table=11
FT                   /locus_tag="SCA_0223"
FT                   /product="putative haloacid dehalogenase-like hydrolase"
FT                   /function="predicted hydrolases of the HAD superfamily"
FT                   /note="(P42962) Hypothetical protein ycsE,InterPro: Cof
FT                   protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0223"
FT                   /db_xref="GOA:B9DKT5"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKT5"
FT                   /inference="similar to AA sequence:UniProtKB:P42962"
FT                   /protein_id="CAL27136.1"
FT                   /translation="MIKLIATDMDGTLLNAGHEVSEENIQAIKAAQDQGITVVIATGRA
FT                   FYEASSPIEPTGLKVPYICLNGAEVRDESFDIMHTSSLNREMIEQITNILNSEDVYYQV
FT                   YTNFGIYTEDPQKDLDIYIDIAEHAGQKADVEKIRNHIQHRIDQGTLKVVDNYDDITGR
FT                   RGEIVMKILAYDADVEKIERVSKQLEQHSNLAISSSARGNIEITNAYAQKGIALEEIAN
FT                   QLGIDMKDVMAIGDNMNDVSMLERVGYPVAMENAIPEVKEYAKEITDTNEHSGVGKAIN
FT                   KMLIENQKHEG"
FT   CDS_pept        232563..233129
FT                   /transl_table=11
FT                   /locus_tag="SCA_0224"
FT                   /function="predicted flavoprotein"
FT                   /note="(O31038) FMN reductase (EC 1.5.1.29),InterPro:
FT                   NADPH-dependent FMN reductase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0224"
FT                   /db_xref="GOA:B9DKS4"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKS4"
FT                   /inference="similar to AA sequence:UniProtKB:O31038"
FT                   /protein_id="CAL27137.1"
FT                   /translation="MKGLIIVGSARVNSHTKALAQYLKGQLEEKGVETDIFDLADQPIH
FT                   TLDVSGASNPPDEYKKNVEELQSKAREADFIILGTPNYHGSYSGILKNALDHLTMDDFK
FT                   MKPVGLMGNSGGIVSAEPLSHLRLIVRTLLGIAVPTQIATHDSDYGKLDDGSFYLQDEE
FT                   FQLRSRLFVEQIVSFAESRPYEHLK"
FT   CDS_pept        complement(233277..233822)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0225"
FT                   /product="putative sugar phosphate isomerase"
FT                   /function="predicted sugar phosphate isomerase involved in
FT                   capsule formation"
FT                   /note="(P42404) Hypothetical protein yckF,InterPro: Sugar
FT                   isomerase (SIS)"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0225"
FT                   /db_xref="GOA:B9DKS5"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR017552"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKS5"
FT                   /inference="similar to AA sequence:UniProtKB:P42404"
FT                   /protein_id="CAL27138.1"
FT                   /translation="MTELRYQLILDELKNTLGHVKNEEVEQFENEVRDAKNIFTAGKGR
FT                   SGYVANSFAMRLNQLGKASHVIGGATTPSIHKGDLFIVISGSGSTEHLRLLADKAKGED
FT                   AKVVLITTKPDSKIGEIADTVIELPAGTKYDAEGSEQPLGSLFEQSAQIFLDAVVLDLM
FT                   EIFNIDETAMQQNHANLE"
FT   CDS_pept        complement(233824..234456)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0226"
FT                   /product="putative hexulose-6-phosphate synthase"
FT                   /function="3-hexulose-6-phosphate synthase and related
FT                   proteins"
FT                   /EC_number="4.1.2.-"
FT                   /note="(P39304) Probable hexulose-6-phosphate synthase (EC
FT                   4.1.2.-) (HUMPS) (D-arabino 3-hexulose 6-phosphate
FT                   formaldehyde lyase),InterPro: Orotidine 5-phosphate
FT                   decarboxylase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0226"
FT                   /db_xref="GOA:B9DKS6"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017553"
FT                   /db_xref="InterPro:IPR041710"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKS6"
FT                   /inference="similar to AA sequence:UniProtKB:P39304"
FT                   /protein_id="CAL27139.1"
FT                   /translation="MELQLAIDLLNKEEAAELANKVKDYVDIVEIGTPIIYNEGLPSVQ
FT                   YMDEHIDGVKVLADMKIMDAADYEVSQAVKFGADVVTILGVAEDASIKAAIEEAHKNDK
FT                   QLLVDMIAVQDIEKRAKELDEMGADYIAVHIGYDLQAEGKSPLEDLHKVKSVIKNSKVA
FT                   VAGGIKPDTIKDIVAEGPDLVIVGGGIANADDPVEAAKACRDAVKGE"
FT   CDS_pept        complement(234548..235291)
FT                   /transl_table=11
FT                   /gene="nagB"
FT                   /locus_tag="SCA_0227"
FT                   /product="putative glucosamine-6-phosphate isomerase"
FT                   /function="6-phosphogluconolactonase/Glucosamine-6-phospha
FT                   te isomerase/deaminase"
FT                   /EC_number="3.5.99.6"
FT                   /note="(Q8R5T0) Glucosamine-6-phosphate deaminase (EC
FT                   3.5.99.6) (Glucosamine-6-phosphate isomerase) (GNPDA)
FT                   (GlcN6P deaminase),InterPro: Glucosamine-6-phosphate
FT                   isomerase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0227"
FT                   /db_xref="GOA:B9DKS7"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR018321"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKS7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27140.1"
FT                   /translation="MKIINLGNRHDASFYAACELFNQITRNPKSKLGLATGGTMVDVYA
FT                   NFVNLLKMNDVDVSNVETFNLDEYVGLSQTHPESYHHYMQKVLFEQYPYFTANNIHVPI
FT                   GDAADLDDEAKRYEAMVRERGPVDIQILGIGENGHIGFNEPGTSKESETRVVDLTESTI
FT                   RANSRYFDTEEEVPKQAVSMGLSTIMSAKRIILLAFGEKKKDAITKLASGIEDADVPAT
FT                   ILYEHPNVEIYVDEAAAPDDMGRED"
FT   CDS_pept        235961..236320
FT                   /transl_table=11
FT                   /locus_tag="SCA_0228"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0228"
FT                   /db_xref="InterPro:IPR014934"
FT                   /db_xref="InterPro:IPR036492"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKS8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27141.1"
FT                   /translation="MEPIEYEKVQGLLESYVDQPVYLHVETTNGAYANHFDQRVFNAGT
FT                   FLRNIKVVFEHAKLKGGGKDPFRVGLKLQDNGWVYVQGLTHYEVNENNEFLLAGFNYEG
FT                   QLAATLEISTVPFQL"
FT   CDS_pept        236333..236998
FT                   /transl_table=11
FT                   /locus_tag="SCA_0229"
FT                   /product="putative LmbE-like protein family protein"
FT                   /function="uncharacterized proteins LmbE homologs"
FT                   /note="(P42981) Hypothetical protein ypjG,InterPro:
FT                   LmbE-like protein (Although most of the proteins in this
FT                   group are of unknown function one, from Schizosaccharomyces
FT                   pombe, has been characterised as a probable
FT                   N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase.)"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0229"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR023841"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKS9"
FT                   /inference="similar to AA sequence:UniProtKB:P42981"
FT                   /protein_id="CAL27142.1"
FT                   /translation="MSEESQVLVIFPHPDDETFSSAGTLARYIDNGVPVTYACLTLGQM
FT                   GRNLGNPPFATRESLPEIREHELEEAAKAIGIKDLRKMGYRDKTVEFEPYEKIDGMVQS
FT                   LIEELRPSLIISFYPGYAVHPDHEATADAVVRTVGRMPKDERPRLQLVAFSNDAIDELG
FT                   EPDVVNDISEYRDTKLNAFKAHASQSGPFLQQLAEPQVPDEAKGFLEQEAYWTYKFES"
FT   CDS_pept        237015..237893
FT                   /transl_table=11
FT                   /locus_tag="SCA_0230"
FT                   /product="conserved hypothetical protein"
FT                   /function="uncharacterized conserved protein"
FT                   /note="(Q58185) Hypothetical protein MJ0775,InterPro:
FT                   Protein of unknown function DUF198"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0230"
FT                   /db_xref="GOA:B9DKT0"
FT                   /db_xref="InterPro:IPR003801"
FT                   /db_xref="InterPro:IPR022838"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DKT0"
FT                   /inference="similar to AA sequence:UniProtKB:Q58185"
FT                   /protein_id="CAL27143.1"
FT                   /translation="MSEFDLTTREGRWRHFGSVDPIEGTKPTVKEEMTDLQSTHKDFLF
FT                   EIEEVGIKNLVYPVVIDNYQTAGTFAFSTSLTREEKGINMSRILESVEKHYDNGLELSF
FT                   NNLEAVLHTLEKHMKQSSAGVDVSGKWFFNRYSPVTNIKAVGNADVTYGLAVAGDQVTR
FT                   KELTVQATVTTLCPCSKEISEYSAHNQRGVITVKMYIDPSATLPTDYKEVILDAMEANA
FT                   SSILYPILKRPDEKRVTERAYENPRFVEDLIRLIAADLVELDWAEGFDIECRNEESIHQ
FT                   HDAFAKLKYRK"
FT   CDS_pept        238382..239821
FT                   /transl_table=11
FT                   /gene="proP"
FT                   /locus_tag="SCA_0231"
FT                   /product="proline/betaine transporter"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /note="(P30848) Proline/betaine transporter (Proline porter
FT                   II) (PPII),InterPro: General substrate transporter"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0231"
FT                   /db_xref="GOA:B9DKT1"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKT1"
FT                   /inference="similar to AA sequence:UniProtKB:P30848"
FT                   /protein_id="CAL27144.1"
FT                   /translation="MRFDKNKINRVDASVAKRSVVATGIGNAMEWFDFGLYSYLAVIIS
FT                   KNFFSDVQNDQLKLVFTFATFAIAFLLRPVGGIIFGIIGDKFGRKIVLTITIVMMAIST
FT                   VLIGCLPTYDQIGIWAPILLLIGRIIQGFSTGGEYAGAMVYVAETSPDNRRNSLGSGLE
FT                   IGTLSGYIAASVLCGVLFFSLNDQQMAAWGWRIPFFFGLILGFVGLYLRTHLEETPIYE
FT                   NELSKQDERDKIGFWTSVRFYYKDIIVCFVMVVFFNVTNYMVTSYLPSYLEEVIGVKNG
FT                   LVTVLITCIMAIMIPLALFYGKTADKIGDKKVMLFGLGGIILFSILAFWLINLKAIFPV
FT                   AIGILILGIFLATYEGTMPGTLPTIFFTHIRYRTLAITFNVSVSLFGGTTPLIATALVA
FT                   KTGNPLMPAFYLTAVSIVGFLVVLFMHTNTASRSLKGSYPNVDSDEDFKKAAENPKKSL
FT                   WWVQEKRKREHESGIDMEGIN"
FT   CDS_pept        complement(240464..241294)
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="SCA_0232"
FT                   /product="putative phosphomethylpyrimidine kinase"
FT                   /function="Hydroxymethylpyrimidine/phosphomethylpyrimidine
FT                   kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="(Q8CTQ7) Phosphomethylpyrimidine kinase (EC 2.7.4.7)
FT                   (HMP-phosphate kinase) (HMP-P kinase),InterPro:
FT                   Phosphomethylpyrimidine kinase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0232"
FT                   /db_xref="GOA:B9DKT2"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKT2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27145.1"
FT                   /translation="MALKKVLTIAGSDTSAGAGMQADLKTFQELDTYGMVALAAVVTMD
FT                   PKTWSHDVTPLPFDLFNKQLETAISIGPDAVKTGMLGSEEIIKRAGEAFTESGAKYFVV
FT                   DPVMVCKGEDEVLNPGNTDAMIKYLLPKATVTTPNLFEAGQLSGLGTLKSIDDMKKAAK
FT                   IIHDQGAENVIIKGGKALDQDKSYDLYYDGDKYYQLTTDMFQQSYNHGAGCTFAAATTA
FT                   NLANGQSPKDAVVNAKAFVASAIKNGWKMNEFVGPVDHGAYNRIEKIDVDVKEV"
FT   CDS_pept        241485..242150
FT                   /transl_table=11
FT                   /gene="ung"
FT                   /locus_tag="SCA_0233"
FT                   /product="putative uracil-DNA glycosylase"
FT                   /function="Uracil DNA glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /note="(Q99W30) Uracil-DNA glycosylase (EC 3.2.2.-)
FT                   (UDG),InterPro: Uracil-DNA glycosylase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0233"
FT                   /db_xref="GOA:B9DKT3"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DKT3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27146.1"
FT                   /translation="MNWSEVFHDITNRHDFKEMHDFLDKEYSTKTVYPDKENIYQAFDL
FT                   TPFDKVKVVIIGQDPYHGPKQAHGLAFSVQPEGKFPPSLRNMYKELEDDIGCKRTVSHL
FT                   QDWAREGVLLLNTVLTVRKGEAASHRNIGWEVFTDEIIKAVSEYRDHVVFILWGKPAQQ
FT                   KERLIDTSKHDVIKSVHPSPLSAYRGFFGSKPYSRANTYLEAHGETPIDWCGEEAQRG"
FT   CDS_pept        242143..242532
FT                   /transl_table=11
FT                   /locus_tag="SCA_0234"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0234"
FT                   /db_xref="InterPro:IPR035218"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKT4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27147.1"
FT                   /translation="MDKDKIISLIEQELVQANEAESEADFQKHIYAIHTLTSLYADTRP
FT                   KSDNNQNVKSRYNKTYQTSSSNKTGIKNTASHTVHSGITAAEIEAMGGKVSHSNSTSNT
FT                   STPPGNSNKMVTDDELGNGDSIFDF"
FT   CDS_pept        242617..243000
FT                   /transl_table=11
FT                   /locus_tag="SCA_0235"
FT                   /product="putative membrane protein"
FT                   /function="uncharacterized small membrane protein"
FT                   /note="(P45019) Hypothetical protein HI1073,InterPro:
FT                   Protein of unknown function DUF423"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0235"
FT                   /db_xref="GOA:B9DKS3"
FT                   /db_xref="InterPro:IPR006696"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKS3"
FT                   /inference="similar to AA sequence:UniProtKB:P45019"
FT                   /protein_id="CAL27148.1"
FT                   /translation="MNLKSMKTFLALGAGAAALSIATGAFGAHALEGKLSEHYLDVWQK
FT                   ATQYEMYHSLGLIGIGILSGTTKMKLKAAGWMMFGGIVIFSGSLYVLSLTQIKPLGAIT
FT                   PIGGVLFIASWVTLLVQALKIKK"
FT   CDS_pept        243067..244590
FT                   /transl_table=11
FT                   /locus_tag="SCA_0236"
FT                   /product="putative amino acid permease"
FT                   /function="Amino acid transporters"
FT                   /note="(O60170) Probable amino-acid permease meu22 (Meiotic
FT                   expression up-regulated protein 22),InterPro: Amino acid
FT                   permease-associated region"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0236"
FT                   /db_xref="GOA:B9DKR0"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKR0"
FT                   /inference="similar to AA sequence:UniProtKB:O60170"
FT                   /protein_id="CAL27149.1"
FT                   /translation="MGQKNKENIHKKVDRGDLQQNLSEKFVWAIAYGSCIGWGSFILPG
FT                   DWIKQSGSISAAIGITIGALLMIIIAVSYGALVEHFPVSGGAFAFSYLSFGRYVSFFSS
FT                   WFLTFGYICVVALNATAFSLLLKFMMPSVLEHGKLYTIAGWDVYLTEIIIATVLLLVFM
FT                   LITIRGAHVSGSLQYYFCVAMVIVVLLMFFGSFFGKDFSFSNLQPLTAKHEGWFTSIIM
FT                   IVAVAPWAYVGFDNIPQTAEEFSFSPNKTFKLIVYSLLAAAGTYVLMILYTAWLGKSGS
FT                   SLNGNLWVTGAVTKQAFGYVGLSVLAIAIIMGIFTGLNGFLMSASRLLFSMGRSGIMPR
FT                   VFSKLHPVYKTPYVAIIFLVALTLIAPWLGRTALTWIVDMSSTGVSVAYLITCLSAAKL
FT                   FSYNKASNTYAPVYKTFAIIGSVFAAIFLGLLLIPGSPAALSMPSYIALAGWLILGLIF
FT                   FIVRYPKLKRINKDELSRLILDTSQAKVESMIDEPDSDKEASTKQSEIK"
FT   CDS_pept        244893..245516
FT                   /transl_table=11
FT                   /gene="apl"
FT                   /locus_tag="SCA_0237"
FT                   /product="alkaline phosphatase like protein"
FT                   /function="uncharacterized membrane-associated protein"
FT                   /EC_number="3.1.3.1"
FT                   /note="(Q48630) Alkaline phosphatase like protein,InterPro:
FT                   DedA family"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0237"
FT                   /db_xref="GOA:B9DKR1"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKR1"
FT                   /inference="similar to AA sequence:UniProtKB:Q48630"
FT                   /protein_id="CAL27150.1"
FT                   /translation="MEKMVEQFIDQFGYLGVFLLIALENIFPPIPSELILTFSGFLTLH
FT                   SNMNIIGVIIAATLGSVFGAIVLYFIGRFLSIERLQKLANGKTGKILRFKASDLDKATG
FT                   WFDNHGKKIVFFARFIPVIRSLISIPAGTTNMPLISFLILTTLGTLIWNTVLVILGQQA
FT                   GEAWPKISAAFDSFSSIVLIVLIILLIIGIIYFVKKRFSKSKYD"
FT   CDS_pept        complement(245690..246481)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0238"
FT                   /product="putative membrane protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0238"
FT                   /db_xref="GOA:B9DKR2"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKR2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27151.1"
FT                   /translation="MKKQLKLYFKGSPSEIRYLEEQQKDGYMLTNIKNGIYTFEENSTV
FT                   SDTKLQVTFVRSEDLKEPNTKVEKSPFLSVLAKQLNYSKYTVLYSYLKEKDNPIYNLAD
FT                   TKAAEHEYLSFFKRIIFSLAVLTMFVCVAFWSYFTAIGKPSSTLLMPMQIMISIFIILS
FT                   PFNILINRRIRKNCPKIEDELYLSYSVSVKSPESQPDIDSLKFLGAWRYQTDKEGKYYY
FT                   NLFSKEPKDVILKNVSAKLHLPEEDVYVYSRFYLFPITMHF"
FT   CDS_pept        complement(246671..247135)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0239"
FT                   /product="putative membrane protein"
FT                   /function="uncharacterized conserved protein"
FT                   /note="(P44520) Hypothetical protein HI0108"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0239"
FT                   /db_xref="GOA:B9DKR3"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKR3"
FT                   /inference="similar to AA sequence:UniProtKB:P44520"
FT                   /protein_id="CAL27152.1"
FT                   /translation="MFWLLNFIFSCIASLFFCVIFDAPKRMYIWAGLVGACGWMVYIVL
FT                   FRGLELHTIYASFFGSLALGLLSHVMARFKKEPVIIFMVPGIIPLVPGGLAFDATKSLV
FT                   ILQFGNAVKTMLEVTLIAGAIAAGLLFSDQIARLVITGKSTFLKKRNLNN"
FT   CDS_pept        complement(247146..247928)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0240"
FT                   /product="putative membrane protein"
FT                   /function="uncharacterized conserved protein"
FT                   /note="(P39402) Hypothetical protein yjjP"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0240"
FT                   /db_xref="GOA:B9DKR4"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKR4"
FT                   /inference="similar to AA sequence:UniProtKB:P39402"
FT                   /protein_id="CAL27153.1"
FT                   /translation="MILGNRNSYIEDTPEEKLAKDAIMLAGRILLESGAEGTRVEGTMN
FT                   RMAETLGYKESNSFVTNTVINFLLDNQTTPRMYRIESRDTNLIKISQTNSVSRQLSAGQ
FT                   ITLKEAYAQLRQIYKDKQTHDLLYKGIAAAIISISFLYLQTGNFIDILATIFAGSLGYL
FT                   VVESLYRANLKTLFIPEFLGSAVIGAIAIFGHSMVPDGSLSAIIIASVMPIVPGVLITN
FT                   AIQDLFGGHMMMFTTKSLEALVTSFGIGAGVGTMLLIF"
FT   CDS_pept        complement(249347..250096)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0241"
FT                   /product="conserved hypothetical protein"
FT                   /function="uncharacterized conserved protein"
FT                   /note="(P39645) Hypothetical protein
FT                   ywfI,pfam06778,Chlor_dismutase, Chlorite dismutase. This
FT                   family contains chlorite dismutase enzymes of bacterial and
FT                   archaeal origin. This enzyme catalyses the
FT                   disproportionation of chlorite into chloride and oxygen.
FT                   Note that many family members are hypothetical proteins."
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0241"
FT                   /db_xref="GOA:B9DKR5"
FT                   /db_xref="InterPro:IPR010644"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR031332"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DKR5"
FT                   /inference="similar to AA sequence:UniProtKB:P39645"
FT                   /protein_id="CAL27154.1"
FT                   /translation="MSQAAETLDGWYSLHLFYAVDWPTLRLVPDEDRIQIVQEFHDFLD
FT                   KLASVRDDHNGDHALYNITGQKADILLWVLRPEMQELNSIELALNKLRIADYLVPTYSY
FT                   VSIIELSNYLAGKSDEDPYENPHVKARLYPELPHSDYICFYPMNKRRNETYNWYMLSME
FT                   ERQKLMYDHGMIGRKYAGKIKQFITGSVGFDDYEWGVTLFAQDPLQFKKIVYEMRFDET
FT                   TARYGDFGSFFVGHVLPEETLETFFRI"
FT   CDS_pept        250258..251247
FT                   /transl_table=11
FT                   /gene="pta"
FT                   /locus_tag="SCA_0242"
FT                   /product="putative phosphotransacetylase"
FT                   /function="Phosphotransacetylase"
FT                   /EC_number="2.3.1.8"
FT                   /note="(Q8CQ62) Phosphate acetyltransferase (EC 2.3.1.8)
FT                   (Phosphotransacetylase),InterPro: Phosphate acetyl/butaryl
FT                   transferase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0242"
FT                   /db_xref="GOA:B9DKR6"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKR6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27155.1"
FT                   /translation="MPSLLNVLQDKLSGKNVKIVLPEGEDERVLTAAVKLHSTDYVEPI
FT                   VLGDAEKVQSLADDKGLDISGIEIITPETSDLKPELVDAFVERRKGKATKEQAEDMLNN
FT                   VNYFGTMLVYTGKADGLVSGAAHSTGDTVRPALQIIKTKPGVSKTSGVFFMIKGDEQYV
FT                   FGDCAINPTLEAADLAEIAVESAKTAKSFGMDPRVALLSFSTKGSAKSDDVEKVESATK
FT                   LAQEKTEEEGLTDVVIDGEFQFDAAIVPKVAAKKAPDAKIKGDANVFIFPSLEAGNIGY
FT                   KIAQRLGGYEAIGPVLQGLNSPVNDLSRGCSTEDVYNLSIITAAQTLQ"
FT   CDS_pept        251247..252086
FT                   /transl_table=11
FT                   /gene="lplA"
FT                   /locus_tag="SCA_0243"
FT                   /product="putative lipoate protein ligase"
FT                   /function="Lipoate-protein ligase A"
FT                   /EC_number="6.3.2.-"
FT                   /note="(P39648) Hypothetical protein ywfL,InterPro:
FT                   Biotin/lipoate A/B protein ligase domain"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0243"
FT                   /db_xref="GOA:B9DKR7"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR024897"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKR7"
FT                   /inference="similar to AA sequence:UniProtKB:P39648"
FT                   /protein_id="CAL27156.1"
FT                   /translation="MDLRQEYFNGSDWRYIDHSTGLAPMQSFAFDDTFSESAGKDLSCS
FT                   VVRTWIHQHTVILGTHDARLPHLKDGIRYLVDECGYNVIVRNSGGLGVVLDQGILNISL
FT                   IFKGKTEVSIDKAFNLMYELICKMFEDENVQIDTKEIERSYCPGKFDLSIDGKKFAGIS
FT                   QRRVRGGIAVQIYLCVEGSGEERAEMMRNFYNHALQGEETKFKYPDIDPSCMASLETLL
FT                   GHDLTVNDVMFKLLHSLKDLGATLNMDPVTDEEWTRFEKYFDRMIERNAKINAKMDD"
FT   CDS_pept        252521..253444
FT                   /transl_table=11
FT                   /gene="mvaK1"
FT                   /locus_tag="SCA_0244"
FT                   /product="mevalonate kinase"
FT                   /function="Mevalonate kinase"
FT                   /EC_number="2.7.1.36"
FT                   /note="(Q9V187) Mevalonate kinase (EC 2.7.1.36)
FT                   (MK),InterPro: GHMP kinase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0244"
FT                   /db_xref="GOA:B9DKR8"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006205"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKR8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27157.1"
FT                   /translation="MTRTGYGESNGKIILVGEHAVTFGEPAIAIPFSSGKVKVEIAEMP
FT                   ELAVSTMISDVYEGEVEHAPEHLHALISRFEAESHIESPIMIKIEAKLPPSRGLGSSAA
FT                   VAVAFTRAAFDFLDKPLSDEELIEHVNWAEMIAHGKPSGIDAQTIVSNQPTWFQKGVFT
FT                   SLESLRIPGYMVVLDTGIKGNTKEAVRDVHELVNNNKENKQFIDRIGQLVYSANQAINM
FT                   RNFDALAEIFNECQSYLATLTVSHPKIDKLLNAAKQAGAVAGKLTGSGRGGSVITLVKD
FT                   YATAEKVVNAVTKAGAHHTWIESLGG"
FT   CDS_pept        253451..254446
FT                   /transl_table=11
FT                   /gene="mvaD"
FT                   /locus_tag="SCA_0245"
FT                   /product="mevalonate diphosphate decarboxylase"
FT                   /function="Mevalonate pyrophosphate decarboxylase"
FT                   /EC_number="4.1.1.33"
FT                   /note="(Q99JF5) Diphosphomevalonate decarboxylase (EC
FT                   4.1.1.33) (Mevalonate pyrophosphate decarboxylase)
FT                   (Mevalonate (diphospho)decarboxylase),InterPro:
FT                   Diphosphomevalonate decarboxylase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0245"
FT                   /db_xref="GOA:B9DKR9"
FT                   /db_xref="InterPro:IPR005935"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR029765"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="InterPro:IPR041431"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKR9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27158.1"
FT                   /translation="MAKTGKARAHTNIALIKYWGKADETLIIPMNNSISLTLDKFYTET
FT                   RVTFDPTFEEDTFFLNGEKANEKETQKISAYLDIVRKQAGTHTKASIDSTNFVPTAAGL
FT                   ASSASAFAALAAACNEALEMRLSDKDLSRLARRGSGSACRSIFGGFAEWEKGHDDASSY
FT                   SHPIDAEHWEDELSMIFVVINNKSKKVKSRAGMSLTRNTSRFYQYWLDRVEADIEEAKA
FT                   AIKDKDFKRLGEVFEANGLRMHATNLGAEPPFTYLVSDSYEAMSLVHDCREAGIPAYFT
FT                   MDAGPNVKVLVQKKDQQAVIDKLTSYFDPEQIIASNIGTGVEILNEEDAL"
FT   CDS_pept        254443..255519
FT                   /transl_table=11
FT                   /gene="mvaK2"
FT                   /locus_tag="SCA_0246"
FT                   /product="phosphomevalonate kinase"
FT                   /function="Mevalonate kinase"
FT                   /EC_number="2.7.4.2"
FT                   /note="(Q9V187) Mevalonate kinase (EC 2.7.1.36)
FT                   (MK),InterPro: Gram positive phosphomevalonate kinase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0246"
FT                   /db_xref="GOA:B9DKS0"
FT                   /db_xref="InterPro:IPR005917"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR035102"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKS0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27159.1"
FT                   /translation="MIQVKAPGKLYIAGEYAVTEPGYKSVLIAVDRFVTATIEEASVAE
FT                   GTIHSKTLHHEPISFQREEDHIVVSDTNAANQLKYVITAVEVFEQYAKSCGKALKHFDL
FT                   VIDSNLDDVSGHKYGLGSSAAVLVSVIKVLNEFYELDLANLNIYKLAVIANMKLQSLSS
FT                   CGDIAVSVFTGWLAYSTFDHDWVMQQIETSSVAEVVKKNWPGLYTEPLQAPENMEVLIG
FT                   WTGSPASSPYLVSEVKRLKSDPDFYGRFLEQSQSCVERLIYAFKTNNLKGVQSMIRRNR
FT                   SIIQQMDKEANVDIETPQLKLLCDIAETYGAAAKTSGAGGGDCGIAITGDHTERASIYK
FT                   SWRASEIKPLPFHVYQGQ"
FT   CDS_pept        255730..256074
FT                   /transl_table=11
FT                   /locus_tag="SCA_0247"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0247"
FT                   /db_xref="InterPro:IPR009910"
FT                   /db_xref="InterPro:IPR020880"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DKS1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27160.1"
FT                   /translation="MQNKFLICDDCQAVNCKSLERKLKKLDPEAEIEIGCQSYCGPGRR
FT                   KTFAFVNNRPLAALTEDELMEKVEKQLQKPRDPEEEERLRKRNEERKRRKEEQDRKLKE
FT                   KLAKRKQTKA"
FT   CDS_pept        complement(256342..256575)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0248"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0248"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKS2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27161.1"
FT                   /translation="MDDTSFGNIYIDSQPVTLDWDTLVTDESEMEVDGIPPSLIDMWVS
FT                   KKQLIPSYTKDNLRHFYTKDVLNACRSYVKVY"
FT   CDS_pept        256846..257412
FT                   /transl_table=11
FT                   /locus_tag="SCA_0249"
FT                   /product="putative multimeric flavodoxin WrbA family
FT                   protein"
FT                   /function="Multimeric flavodoxin WrbA"
FT                   /note="(P43340) Putative NAD(P)H oxidoreductase ycaK (EC
FT                   1.6.99.-)"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0249"
FT                   /db_xref="GOA:B9DKQ9"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKQ9"
FT                   /inference="similar to AA sequence:UniProtKB:P43340"
FT                   /protein_id="CAL27162.1"
FT                   /translation="MITVLFGGSRPEGNSAELAKIVLKDLDYNWIDLTKYHFDPVRDVR
FT                   HNGEVITDYTDDYKQIIDQVLKSDTVLFVSPVYWYSVSASMKAFIDHWSETLRDKNYKD
FT                   FKEKMAQIEFRLILVGGDCPKIKARPCMHQMEYSLEFLGAALKDYLIGNANAPGDILKD
FT                   TYAVNIAEKWNAELKSKEEKLQKTK"
FT   CDS_pept        257624..258100
FT                   /transl_table=11
FT                   /locus_tag="SCA_0250"
FT                   /product="putative acetyltransferase"
FT                   /function="Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /note="InterPro: GCN5-related N-acetyltransferase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0250"
FT                   /db_xref="GOA:B9DKP8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKP8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27163.1"
FT                   /translation="MRKVREATPADVVGIRDVATKAWYNTYLNIYAARTVNELLAASYN
FT                   EQHLTKRLNDQLFLVAEEDGEIVGFANFINGSELFLSAHYVRPASQRKGYGTDLLNAGL
FT                   EHFKGQYDAVYLEVDNQNTEGVEYYRQQGFELVRAYHHEMYGEVMNLALMKKAF"
FT   CDS_pept        258143..259441
FT                   /transl_table=11
FT                   /locus_tag="SCA_0251"
FT                   /product="putative phosphohydrolase"
FT                   /function="HD superfamily phosphohydrolases"
FT                   /note="(P39651) Hypothetical protein ywfO,InterPro:
FT                   Metal-dependent phosphohydrolase HD region"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0251"
FT                   /db_xref="GOA:B9DKP9"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKP9"
FT                   /inference="similar to AA sequence:UniProtKB:P39651"
FT                   /protein_id="CAL27164.1"
FT                   /translation="MAETNYGTKKLFEEKVFKDPIHRYIHVKDQVIWDLIKTKEFQRLR
FT                   RIKQLGTLYLSFHTAEHSRFGHSLGVYEIVRRIIDESFRGREAWDDADRPLALCAALLH
FT                   DLGHGPFSHSFEKIFDTDHEAFTQAIITGDTEVNEVLSRVSPTFPQEVADVINKTHQNK
FT                   LVISMISSQIDADRMDYLQRDAYFTGVSYGKFDMERILRLMRPTKDEVLIKESGMHAVE
FT                   NFIMSRYQMYWQIYFHPVSRGGEVLLNNTLKRAKELYQDGYEFERFPTDFIPFFEGTMT
FT                   IEQYVDLDEAVVLYYLKEWIKERDPILSDLARRFINRDLFKFLPFDGSIITMNELRELF
FT                   EEAGINPDSYFVSESFSDLPYDYDRPGSNRQPIHLLQRNGKIREISSQSMVIQSITGIN
FT                   RQDYKLYFPKELIYNIEDDVIRERILSILNELN"
FT   CDS_pept        259510..260022
FT                   /transl_table=11
FT                   /locus_tag="SCA_0252"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0252"
FT                   /db_xref="InterPro:IPR014852"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKQ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27165.1"
FT                   /translation="MSENKGFKFNIIKNDPLDGHKGTNIGAISLDNVAPVFIDLQSKEA
FT                   FIDIGAMHARADVEKGVKWITDKETVEGPEAKEYWLCWVTTERGEQGAYYAGLTACYLM
FT                   VNKKIRRGYKSMPEHVNMMDKSMKHKVVIDHIGDENIEIIREFLKNHDIEMWNNSSDEL
FT                   KSALHEK"
FT   CDS_pept        complement(260206..260823)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0253"
FT                   /product="putative LysE type translocator protein"
FT                   /function="Lysine efflux permease"
FT                   /note="(P70775) Hypothetical protein yggA,InterPro: Lysine
FT                   exporter protein (LYSE/YGGA)"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0253"
FT                   /db_xref="GOA:B9DKQ1"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKQ1"
FT                   /inference="similar to AA sequence:UniProtKB:P70775"
FT                   /protein_id="CAL27166.1"
FT                   /translation="MLQPIVHGILLALGLILPLGAQNVFVFNQGANQTKFAKALPVIIT
FT                   AGLCDTFLITIAVLGVSLILMSLPILQLVIYIIGLIFLLYMAWSLWNEKPNNLENHNSM
FT                   SAKKQIGFALSVSLLNPHAIMDTIGVIGTSASVYSGTEKLLFSISTIMVSWIWFISLAI
FT                   LGKTLGSIDKTGKYIIILNKISSVIVIIVSLIIVKNILHLIF"
FT   CDS_pept        261573..262985
FT                   /transl_table=11
FT                   /locus_tag="SCA_0254"
FT                   /product="putative GntR family transcriptional regulator"
FT                   /function="Transcriptional regulators containing a
FT                   DNA-binding HTH domain and an aminotransferase domain (MocR
FT                   family) and their eukaryotic orthologs"
FT                   /note="(P77730) Hypothetical protein ydcR,InterPro:
FT                   Bacterial regulatory protein GntR family"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0254"
FT                   /db_xref="GOA:B9DKQ2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKQ2"
FT                   /inference="similar to AA sequence:UniProtKB:P77730"
FT                   /protein_id="CAL27167.1"
FT                   /translation="MNKFQYKMIMDDIINKIDNGVLSPGDKLPSQREISKYYNVNRSTV
FT                   IQAIDILKSYGILESIEKKGGYVSRYKWNAHITSNIQWQNYIENSMSKNNQYYIQRINE
FT                   LEFNPDILRLGTGELSPKLIPNHLFKEIISNSIEDSIQTNYEEPKGKIALRLEIVEYMK
FT                   KRGVTCDIDNICITSGAIQGLKLIADGLLIPQSKIIIETPSYINSIHTWHNIRSQMVPL
FT                   SINYIKRNINNIFKMSRDYKNSIFYCIPTLHNPTQNTYTKEQKQKIIDQCQKNGIPIVE
FT                   DGVYSDLWFNANKQVPMKSLKNSDNVLYLGSLSKTVSPGLRIGWIVANKNVIRHLSDLK
FT                   MQNDYGASSISQHIATKWLNTYHEKHINELKVKLEMRKHIFTEALKEHLSMYGSWDDPR
FT                   GSFYIWFEFSISINVKTLFNEAVKENLLIQPGEIYDSNYKNYIRFSYSYIDESDINRSL
FT                   KKLSNIINKIRD"
FT   CDS_pept        263325..263573
FT                   /transl_table=11
FT                   /locus_tag="SCA_0255"
FT                   /product="conserved hypothetical protein"
FT                   /function="Antitoxin of toxin-antitoxin stability system"
FT                   /note="(Q9Z4V7) Hypothetical protein SCO2235
FT                   (ORFU1E),InterPro: Protein of unknown function DUF172"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0255"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKQ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27168.1"
FT                   /translation="MAVETYSNARKNFRSLIKQVNENSEAITITTNEENAVLMSETDYN
FT                   AIMETLYLQQNPANAAHLKRSIEQLEKGDSVQVEIDE"
FT   CDS_pept        263566..263835
FT                   /transl_table=11
FT                   /locus_tag="SCA_0256"
FT                   /product="conserved hypothetical protein"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /note="(P56605) Hypothetical protein yoeB"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0256"
FT                   /db_xref="GOA:B9DKQ4"
FT                   /db_xref="InterPro:IPR009614"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKQ4"
FT                   /inference="similar to AA sequence:UniProtKB:P56605"
FT                   /protein_id="CAL27169.1"
FT                   /translation="MSKLNISFSPEAFEDYKNWQTQDKKVWKKINQLIKSIDRDGMLDG
FT                   IGKPERLKGGFSGWYSRRITQDHRLVYKVTSESILAASCKYHYQ"
FT   CDS_pept        264322..265512
FT                   /transl_table=11
FT                   /locus_tag="SCA_0257"
FT                   /product="putative peptidase"
FT                   /function="Metal-dependent
FT                   amidase/aminoacylase/carboxypeptidase"
FT                   /note="(P54970) IAA-amino acid hydrolase homolog 2
FT                   precursor,InterPro: Peptidase M20/M25/M40"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0257"
FT                   /db_xref="GOA:B9DKQ5"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKQ5"
FT                   /inference="similar to AA sequence:UniProtKB:P54970"
FT                   /protein_id="CAL27170.1"
FT                   /translation="MSSELIRRLKEKEDKMVEMRRYLHAHPELSFKEVETPKYIADFYK
FT                   GKDCEVETNVGDNGVKVTIDSGKPGKTIAIRADFDALPIEEDTGLPFASENPGVMHACG
FT                   HDAHTAYMLTLADTLIDMKDQFKGKVVVIHQPAEEMPPGGALGMIRDGVLDGVDHVLGV
FT                   HVMSNGERGTIYYREGYVQTGRAYFKLTIHGQGGHGSSPHAANDAIVAGANFVTTVQTV
FT                   ISRRLSPFETGVVSIGSFDAKGQFNVIKDKVEIEGDVRGLNDETKHKIADELERIVDGL
FT                   EHTFGVTCDYEFVDDYPALYNDPDFTEYVADTLKDSEHDAIKKVERCAPWPPSEDFAYY
FT                   AKELPSAFIFAGAEPEEGDVYPHHHPKFNISETSMMSAAEAVGTVVLDYLNQEDEK"
FT   CDS_pept        265673..266089
FT                   /transl_table=11
FT                   /locus_tag="SCA_0258"
FT                   /product="conserved hypothetical protein"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0258"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR015231"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKQ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27171.1"
FT                   /translation="MDQNIRIQTLQVIKRDGETDEFEYETNGTWQEKRQVEYIRYDEQI
FT                   EDITIHVTLKIQDGEVKLMRSGVIKQNLHFVEGKDTVSLYEIPAGKIPLTVRTLSINHF
FT                   IQPEMSKLKIRYELFQDEEKMDTYLYQITYKELT"
FT   CDS_pept        266091..267755
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="SCA_0259"
FT                   /product="putative arginyl-tRNA synthetase"
FT                   /function="Arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="(Q8CTN9) Arginyl-tRNA synthetase (EC 6.1.1.19)
FT                   (Arginine--tRNA ligase) (ArgRS),InterPro: Arginyl-tRNA
FT                   synthetase class Ic"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0259"
FT                   /db_xref="GOA:B9DKQ7"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DKQ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27172.1"
FT                   /translation="MNIIDQVKQTLIEEITASVKAAGLAEEVPEVKVEIPKDPKNGDYS
FT                   TNIAMVLTKIAKRNPHEIAQAIVDHLDKSKANVEKIEIAGPGFINFYLNNQYLTAVIPE
FT                   ALEKDKDFGRNEDPKHQKVLVEYVSANPTGDLHIGHARNAAVGDTLSNILDAAGYDVTR
FT                   EYYINDAGNQITNLAHSIEARYDQAMGKETELPADGYYGKDIINIGKDLAEKRPELKDL
FT                   PEDERLKVFRQLGVDYEMEKLKKDLADFNTHFDGWFSETTLYDKGEIKKVLELMKENGY
FT                   TYEADGATWLRTTDFNDDKDRVIIKKDGSYTYFLPDVAYHYDKFHRDGGQDILINLFGA
FT                   DHHGYINRLKASVETYGIDADRLEIQIMQMVRLMQDGEEVKMSKRTGNAITLREIMDEV
FT                   GIDAARYFLTMRSPDTHFDFDMELAKENSAENPVYYAQYAHARISSILKQAGERGITPS
FT                   ENADFSVITNDKAIDLLKKVAEFEPMIESAAEHRAPHRVTNYIQELASAFHKFYNADKV
FT                   LTDDEKKTQAYVSMIAAVQITLRNALALVGVSAPHNM"
FT   CDS_pept        267887..268789
FT                   /transl_table=11
FT                   /locus_tag="SCA_0260"
FT                   /product="putative lipoprotein involved in iron transport"
FT                   /function="ABC-type Fe3+-hydroxamate transport system
FT                   periplasmic component"
FT                   /note="(Q8ZRP7) Vitamin B12 transport protein btuF
FT                   precursor,InterPro: Periplasmic binding protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0260"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKQ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27173.1"
FT                   /translation="MKQKLWVFLIVIILIAAGCSAPTKTDKKDNQDKAENAQKSKPKYH
FT                   RIISLMPSNTEILYQLGLGDDIVGVSTVDDYPNDVKHKQKFDAMKLNKEQLLKAKPDLI
FT                   VAHESQKGMDGKVLQSLKDKGVKVVYIKDAKTLDEIYDTFKQVGKVTGRESQASTLVYD
FT                   TKHRVDAVLKDVPKHEKKPTVFLEVSHEPEIYTAGKSTFFNYMLEKLNAENSFKDITGW
FT                   KKVSKESIIKKNPNVLITTEGISRSEYLKVIRKRGGFEDLEAVKKGRVEAVDGDKISRP
FT                   GPRIDQGLKELRDAIYRYE"
FT   CDS_pept        268795..269733
FT                   /transl_table=11
FT                   /locus_tag="SCA_0261"
FT                   /product="FecCD transport family protein"
FT                   /function="ABC-type Fe3+-siderophore transport system
FT                   permease component"
FT                   /note="(Q57552) Putative ABC transporter permease protein
FT                   MJ0087,InterPro: FecCD transport family"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0261"
FT                   /db_xref="GOA:B9DKP7"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKP7"
FT                   /inference="similar to AA sequence:UniProtKB:Q57552"
FT                   /protein_id="CAL27174.1"
FT                   /translation="MRDKKIILGWMIALICSIAISLLWHLGSWSDPLNNSILFEVRLPR
FT                   MLEALLAGIGLSIAGQMFQTVLNNPLADSLTLGLASGSVLGSAIAVFVGLTSLWIPLAS
FT                   MIASVLTLIIVLVLTTIMSKGYPMRALILSGIMIGALFNAFLYLLVLLDERRLKNIVMY
FT                   MFGGFSAAEMREVAVIAPVIAVCIVLLVLLLPKIKLLQVGTLKAQSLSLNVTQVMYSVL
FT                   AIASIMTAVIISYTGIIGFIGMIVPQLIRRTYHFKFGGQLLLNGMIGGTVMVLADSLGA
FT                   QLLVPTEIPASIILALLGIPVLGYLLATQPR"
FT   CDS_pept        269813..270556
FT                   /transl_table=11
FT                   /locus_tag="SCA_0262"
FT                   /product="haloacid dehalogenase-like hydrolase family
FT                   protein"
FT                   /function="predicted hydrolase (HAD superfamily)"
FT                   /note="(Q9V1B3) Putative HAD-hydrolase PYRAB05140 (EC
FT                   3.-.-.-),InterPro: Haloacid dehalogenase-like hydrolase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0262"
FT                   /db_xref="GOA:B9DKC4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKC4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27175.1"
FT                   /translation="MSLEGIKAVVFDLEGTLLDRKKSRDKFIEEQYERFHDYLVHVQAQ
FT                   DYKKQFIELDDDEDHDKPELYKAIIKRFHIDRLSWKDLFSDFEMHFYRYVFPYHDTQYT
FT                   LERLVQRGYLIGVIANGKSHIKQYRLDSLGILSYINFLSTSEMVGFRKPHPRIFEDIIE
FT                   QLGVKAEEVMYVGDDALNDVAPARAMGMVSVWFNHEDEEVELAPEEHEVDYEISTLEEL
FT                   LELLPDEAPNPEESEEANGTIYDER"
FT   CDS_pept        270531..271358
FT                   /transl_table=11
FT                   /locus_tag="SCA_0263"
FT                   /product="putative alpha/beta hydrolase"
FT                   /function="predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily)"
FT                   /note="(P47229) 2-hydroxy-6-oxo-6-phenylhexa-24-dienoate
FT                   hydrolase (EC 3.7.1.-),InterPro: Alpha/beta hydrolase fold"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0263"
FT                   /db_xref="GOA:B9DKC5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKC5"
FT                   /inference="similar to AA sequence:UniProtKB:P47229"
FT                   /protein_id="CAL27176.1"
FT                   /translation="MELYTTKDDTALNYETMGSGQPIVMIHSAFENYSIFNQIAEKLSS
FT                   SYQIVLIDLRGHGFSDKPLHIDFETYASDVKELMDFLYIRHAFFIGQELGASIAADFAV
FT                   KHPEYTDGLVLVNPTTVQKELPAERLFKKYADKIRTWEDEKQEKFLDKHTYGSLKKIKK
FT                   FSKNIADTTGLMTDYEKNAVKQSFTRDHIGLELNEVKAPTLIIAGKYDERSTSEDIETF
FT                   LHEIPDAQLETFKQSGLYPMAEEMRSFLEVVTAFFNVKEVMNDEQKRLHTSNK"
FT   CDS_pept        271524..272030
FT                   /transl_table=11
FT                   /locus_tag="SCA_0264"
FT                   /product="putative exported protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0264"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKC6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27177.1"
FT                   /translation="MKKILSAAIVSATVITGLGMSQADAASGNTIQNVQQIHHGDQSLE
FT                   GVRLGENIQDVLKTQKATGYSYKPDKTEHYYEFKTSKGFMIVTADGQKDHGVIKRISME
FT                   YNKPDGPTFKEVRHQLGNTVKWRYHYDDRTGNFGYVKDGKTVYQFGTESPKDRNLKLYR
FT                   IDIEK"
FT   CDS_pept        272152..272865
FT                   /transl_table=11
FT                   /locus_tag="SCA_0265"
FT                   /product="putative membrane protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0265"
FT                   /db_xref="GOA:B9DKC7"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKC7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27178.1"
FT                   /translation="MRPNDKILLENIGDYFNYKGLSPNMIDDIKENLREDLHKSEAKDE
FT                   DYIEYRRKAPAEIILTIQRNLFGLQLNPILFFIVNFLLISYLYDKQFVPFQAATGLSII
FT                   YCLLVLPATVMIYFRIVKKNYLYSNRIDVLLGWMIIIIAAVLVGLHAFNIDLGVFVVTK
FT                   YAHIFVFFAGIIISIAGLYYKRLEFTGIGLLLTQKTIDAVIVNPNAAQIGTVLIWVLIL
FT                   AVIIYYSIRLSTRDK"
FT   CDS_pept        complement(272966..273340)
FT                   /transl_table=11
FT                   /gene="sarA"
FT                   /locus_tag="SCA_0266"
FT                   /product="staphylococcal accessory regulator A"
FT                   /function="Transcriptional regulators"
FT                   /note="(P35861) 60 kDa chaperonin 2 (Protein Cpn60 2)
FT                   (groEL protein 2)"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0266"
FT                   /db_xref="GOA:B9DKC8"
FT                   /db_xref="InterPro:IPR010166"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKC8"
FT                   /inference="similar to AA sequence:UniProtKB:P35861"
FT                   /protein_id="CAL27179.1"
FT                   /translation="MAVSKIKNSSDLLVMVTYADKMKSIIKKEFSISFEEFAVLTFISQ
FT                   SDDSEYYLKDIINHLNYKQPQVVKAVKNLSQEDYFDKKRNEQDERTVLILVNSKQREKI
FT                   NELLNRINERIVKANKEVKI"
FT   CDS_pept        complement(273671..274588)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0267"
FT                   /product="hypothetical protein"
FT                   /function="Membrane-fusion protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0267"
FT                   /db_xref="GOA:B9DKC9"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKC9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27180.1"
FT                   /translation="MKYSLRLIVLISILLLTLISVGIYAVFRHQHLQAQKPSKTYTVAY
FT                   NHPLTFTGNQQAQYTQTLIYHSEYGKIHDWFIQSDKAVKKNAPVLEYYNFKAEQKLTAL
FT                   RKQLVALDKKPDQLPLRTFLEQQFYLTQTALRIQENSIFEGKLHIIEPYPSLNNEVFAE
FT                   IYSNKRIIQCTIDEKIRHQLKNNQEVEIQPHSGSSFKGRIIKIDTFPTTSTFNSDAPAK
FT                   YKVAISTDASYPIGTHFKISVSTHLISLPKDVLYDKNSVIIKKDKKMVKRIIKYREKSG
FT                   MVIISEGLLPGEKVIAQSKNFTFN"
FT   CDS_pept        complement(274708..275640)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0268"
FT                   /product="putative membrane protein"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /note="InterPro: Protein of unknown function DUF606"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0268"
FT                   /db_xref="GOA:B9DKD0"
FT                   /db_xref="InterPro:IPR006750"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKD0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27181.1"
FT                   /translation="MILLLLLGLVAGTMVPIQTSINSRLIEYTRSSFYASTISFAVGSL
FT                   FLVIVNLIVNPSVFNVNYYHFDFNYTWITGGILGVIFLTGNLILFPRLGASLTVIITIA
FT                   GQIVMGVLIDTFGWFGANTEPFTFLKLCGIILLFFGIFIMNYTKQKAATETQSNPLALI
FT                   LWLAIGFSFGFAPPIQTAINSQLGQTVQSPFLASFISFFVGTIALFIITLIMNRSLKMR
FT                   AHSPESGKIKWFYFIGGILGVVFVTANIILMPHLGAALTTIIAMLGQMLMGVLIDHFAL
FT                   LGAPRNRISVRKCVGIVCIIIGIVILRLF"
FT   CDS_pept        275884..276114
FT                   /transl_table=11
FT                   /locus_tag="SCA_0269"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0269"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKP2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27182.1"
FT                   /translation="MRNISIIRVLDEDTFFIDAGQNAQIQTQQFIEVLNPKLAYKNLAQ
FT                   VIDVYDDYSICKKLGDKRILFGDIVKPREVE"
FT   CDS_pept        complement(276159..276371)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0270"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0270"
FT                   /db_xref="InterPro:IPR021321"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKP3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27183.1"
FT                   /translation="MSKTLELIFLNAANKPVKLQIPDLTQDVSEESARNAMNTLLETNA
FT                   LNPTAGKPVAVKSAQIIEKETHIIF"
FT   CDS_pept        complement(276386..276589)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0271"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0271"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKP4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27184.1"
FT                   /translation="MKKIKDVAITLIHEELGENSKVVQKRRKFSRLNPEITSKELLTFK
FT                   NVIEKLTGETYINVEVTTVETL"
FT   CDS_pept        276957..278996
FT                   /transl_table=11
FT                   /locus_tag="SCA_0272"
FT                   /product="sodium/hydrogen exchanger family protein"
FT                   /function="NhaP-type Na+/H+ and K+/H+ antiporters"
FT                   /note="(P32703) Putative Na(+)/H(+) exchanger
FT                   yjcE,InterPro: Sodium/hydrogen exchanger"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0272"
FT                   /db_xref="GOA:B9DKP5"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKP5"
FT                   /inference="similar to AA sequence:UniProtKB:P32703"
FT                   /protein_id="CAL27185.1"
FT                   /translation="MEIVEGLLIFLAAIIVSSLIHSLFLPKVPLAFIQIILGALLFLTP
FT                   IPVSFDFDTEVFMVALIAPLLFVEGVQVSRVSLRRYIKPVMLMALGLVFTTVVGVGFFI
FT                   HWVWPNLPMPAGFALAAILCPTDAVAVSAITRGKILPKGAMTILEGESLLNDAAGIISF
FT                   KIAVTALITGTFSITHAVGEFLIAAIGGLIVGMIIGVALVRLRVTLSRRGVESNNMFIF
FT                   IQLLTPFVTYLIAEVFHASGIIAAVVAGLVHGFERDRITHVSTQLQLSYTQTWNVLSYA
FT                   LNGFVFVILGYMVPEVVVNILKTEPQNLVFLLTTTGVIALAVYVFRFVWVYVLYPYFYL
FT                   PVSPFERAMNEGGPQKPSEKPKRSMYALIMTLCGVHGTISLAIALTLPFILGENESFIY
FT                   RNDLLFISSGMVILSLVIAQVFLPLVTPAMKKAKQEGMTFKQTRVYILEHVVEYLRQHA
FT                   TPETSFKYGNVIKDYHDRIAFLKVLDDDDEDSKELERLQGIAFDTETKTLDDLAKEGRI
FT                   SQSDFDNYMRYAERTQVYRQASLLRRIWIRIKASFLRRRVRIQTNASSSLDIKENLKEI
FT                   SKIMRIVHYNVVKRLSKEANSDNQLEISTIADSYLLRTDNLTPSNFFNTKNNESMSKIK
FT                   LNALREQRHILNELVDEGEVSEKTALKVREAINYDEMILVDRLT"
FT   CDS_pept        complement(279254..280177)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0273"
FT                   /product="putative lipoprotein, AdhesinB family protein"
FT                   /function="ABC-type metal ion transport system periplasmic
FT                   component/surface adhesin"
FT                   /note="(Q8Y653) Manganese-binding lipoprotein mntA
FT                   precursor,InterPro: Periplasmic solute binding protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0273"
FT                   /db_xref="GOA:B9DKP6"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKP6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27186.1"
FT                   /translation="MKKLVPLLMAVLLFLAACGGGHSQSSSDHKLKIVTTNSILYDMTK
FT                   NITGDHAEIHSIVPVGQDPHEYEVKPKDIKALTDADIILYNGLNLETGNGWFDKALEQA
FT                   GKNTKDKSVVRVSKDVKPIYLNGAEGDKSKQDPHAWLSLENGLKYVKTIQHAVIQHDKA
FT                   HQDDYQKRGDDYLSKLEKLNKDSHDKFDDIPKNQRAMITSEGAFKYFSKQYGITPGYIW
FT                   EINTEKQGTPKQMKQAIQFVKSHHLKHLLVETSVDHKSMQSLSEETGVPISGEVYTDSI
FT                   GKKGSKGDSYYKMMESNIETVHNSMK"
FT   CDS_pept        complement(280174..281010)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0274"
FT                   /product="putative ABC transporter, permease component"
FT                   /function="ABC-type Mn2+/Zn2+ transport systems permease
FT                   components"
FT                   /note="(Q92AG0) Manganese transport system membrane protein
FT                   mntC,InterPro: ABC transporter family 3"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0274"
FT                   /db_xref="GOA:B9DKC3"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKC3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27187.1"
FT                   /translation="MLDFLQHIFDYQFLSRALIISIFVGIVCGTVGSLIVLRGLSLMGD
FT                   AMSHAVLPGVALSFLFKIPMFVGALVTGMLASLFIGFISDKSKTKQDAAIGISFTAFLA
FT                   VGVIIISLINSTTDLYHILFGNLLAITHTAYWSTIIISIIVLLLIIIFYRPLMISTFDP
FT                   TFSRMSGLNTTFIHYFVMLLLSLVTVASIQTVGIILVVALLITPASAAFLITKKLWSMM
FT                   IAASVISVISAIVGMYFSYIYNIPSGATIVLCAFAIYIGTFIYSKISQQIRKGVPS"
FT   CDS_pept        complement(281003..281659)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0275"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /function="ABC-type Mn/Zn transport systems ATPase
FT                   component"
FT                   /note="(P96117) Zinc transport system ATP-binding protein
FT                   troB,InterPro: ABC transporter"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0275"
FT                   /db_xref="GOA:B9DKB0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKB0"
FT                   /inference="similar to AA sequence:UniProtKB:P96117"
FT                   /protein_id="CAL27188.1"
FT                   /translation="MGPNGAGKSSLIKTLIGEFKSEGIKRLNGKPVASQLKKITYIPQK
FT                   TQLDLDFPISVESVVLSGAFKEIGWFRRPTQRIKKRLDDLLEDMELIPLKKRQISELSG
FT                   GQLQRVLVARALMTESTLYLLDEPFVGIDFTSEQLIMNKLQRLKAQGKLILIVHHDLSK
FT                   AAEYFDRIILLNRTLRYFGPSQEAMTTERLNETYMNQSTENTMFQHSEKERIKNA"
FT   CDS_pept        281886..282542
FT                   /transl_table=11
FT                   /locus_tag="SCA_0276"
FT                   /product="putative metal dependent transcriptional
FT                   regulator"
FT                   /function="Mn-dependent transcriptional regulator"
FT                   /note="(Q92AD1) Transcriptional regulator mntR (Manganese
FT                   transport regulator),InterPro: Iron dependent repressor"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0276"
FT                   /db_xref="GOA:B9DKB1"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKB1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27189.1"
FT                   /translation="MLTEEKEDYLKAILNNGGATSFVTNKKLSQYLNIKPPSVSEMVNR
FT                   LEKAGYVITKPYKGVKLSEEGFNHTLEIIKRHRLLELFLIEILKYNWEEVHQEAEVLEH
FT                   RVSDLFVERLDSLLNYPTTCPHGGVIPRNGKFEEIYNDSLKDFKEGDHVTIRRVRDRTK
FT                   LLIYLSSKSISIGDEIVVESQDDTNQVIAIRKENDPLIILSYENAAHIFGEKSED"
FT   CDS_pept        282696..283400
FT                   /transl_table=11
FT                   /locus_tag="SCA_0277"
FT                   /product="putative PA-phosphatase related membrane protein"
FT                   /function="Membrane-associated phospholipid phosphatase"
FT                   /note="(P35575) Glucose-6-phosphatase (EC 3.1.3.9) (G6Pase)
FT                   (G-6-Pase),InterPro: PA-phosphatase related
FT                   phosphoesterase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0277"
FT                   /db_xref="GOA:B9DKB2"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKB2"
FT                   /inference="similar to AA sequence:UniProtKB:P35575"
FT                   /protein_id="CAL27190.1"
FT                   /translation="MNKDTNKSIEKTAMLICGAIFLVTMIGAFWHLSLFHMMDKGTFNW
FT                   FDHMFEEPKMNFNGGLFNDFMTLVSTYGDVVTFVIMTVVVAVALLIKRYYLMGLWLLAT
FT                   VGLGGILGIIFKDLIHRARPYDHLLADTGFSFPSGHSLSSTLIVIILFTVFIPNIRNKA
FT                   VKVIVTLLIFVLWISILFSRMYFHAHFLTDVVGGVSLGITWVMASILIFRACTPMLSKL
FT                   PLLRKGKIFNVK"
FT   CDS_pept        complement(283444..283935)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0278"
FT                   /product="putative N-acetyltransferase"
FT                   /function="Sortase and related acyltransferases"
FT                   /note="(P76112) Hypothetical acetyltransferase yncA (EC
FT                   2.3.1.-),InterPro: GCN5-related N-acetyltransferase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0278"
FT                   /db_xref="GOA:B9DKB3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKB3"
FT                   /inference="similar to AA sequence:UniProtKB:P76112"
FT                   /protein_id="CAL27191.1"
FT                   /translation="MVKLKIAEKADLPVFTKVYNQAIRMRNVTADVDEVSDEEMAPIFN
FT                   SHDTSRPLYTIWDDQGQAIGYASLNHFYGRPAYDETAELSIYLDEQTRGQGYGTKVMQL
FT                   LEQEAASLNIHYLTGYVFAQNVPCNKLFEKQGYALWGNLPQIAHIDKNRLDLCIWGKHI
FT                   "
FT   CDS_pept        complement(283953..284699)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0279"
FT                   /product="putative membrane protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0279"
FT                   /db_xref="GOA:B9DKB4"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKB4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27192.1"
FT                   /translation="MQLFKEIISTPMTLHLYLVVIIAIIYMTVHHYRNRPGLAVTDIIL
FT                   NYIPVLTHEFGHIVFNKISGGRTEDLVIVTSPRERIATSQQGFAITRASRRSTMIITTL
FT                   GGYVMPPLMLALGIFSAYFHYPSLFVLSYLLIFIYFVCITSRKGIPILIAILLGLMIYL
FT                   LIQNNQPEMIVLILSIVYHFILGVLFGELLQSIWTMLRLTFTQYPIEWDGTALRNLTHL
FT                   PVVVFTTLWVAFNFYVVYAIVKYLLF"
FT   CDS_pept        complement(284780..285337)
FT                   /transl_table=11
FT                   /gene="maa"
FT                   /locus_tag="SCA_0280"
FT                   /product="putative maltose O-acetyltransferase"
FT                   /function="Acetyltransferase (isoleucine patch
FT                   superfamily)"
FT                   /EC_number="2.3.1.79"
FT                   /note="(P37515) Probable maltose O-acetyltransferase (EC
FT                   2.3.1.79) (Maltose transacetylase),InterPro: Bacterial
FT                   transferase hexapeptide repeat"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0280"
FT                   /db_xref="GOA:B9DKB5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKB5"
FT                   /inference="similar to AA sequence:UniProtKB:P37515"
FT                   /protein_id="CAL27193.1"
FT                   /translation="MTTEKEKMLSGQLYNSRDPQLVKERHKARHATKAINNAFSIKERH
FT                   FLLRQSIGHCGDNVFIEPDIHFDYGYNISLGNHFYANFNPVMLDVAPITIGNHVLLGPN
FT                   VQLITATHPLNPAERASGLELAFPIMIGDHVWIGAGAIVLPGVTIGDNVVVGAGSVVTK
FT                   DIPDNQVVAGNPARFIREVPLD"
FT   CDS_pept        285455..286231
FT                   /transl_table=11
FT                   /gene="tagA"
FT                   /locus_tag="SCA_0281"
FT                   /product="putative teichoic acid biosynthesis protein"
FT                   /function="Teichoic acid biosynthesis proteins"
FT                   /note="(Q7MYM6) Probable UDP-N-acetyl-D-mannosaminuronic
FT                   acid transferase (EC 2.4.1.-) (UDP-ManNAcA
FT                   transferase),InterPro: Glycosyl transferase WecB/TagA/CpsF
FT                   family"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0281"
FT                   /db_xref="GOA:B9DKB6"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="InterPro:IPR034714"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKB6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27194.1"
FT                   /translation="MRKLGDFIMENQRTAKREKIDILSVQFDNVTMDEMKHHVTNFVEA
FT                   DTTDNMFVVTANPEIVDYALEDKNYYDLIGEADFIIPDGTGIIQAGRILGTPLKERVPG
FT                   IEFMAACLAIAERHRQKVFLLGASKHVVAEAVKQLQKKYPHIEFASHHGYIDTGDESVA
FT                   RQVCNFNPDYIFVGMGYPKQEEWIKRHRHRFQHTLLMGVGGSIEVYSGTKKRAPLIFRK
FT                   LNLEWFYRLITDWKRMARMQRLPRFVSKVFRTRLKK"
FT   CDS_pept        286873..288780
FT                   /transl_table=11
FT                   /gene="thrS"
FT                   /locus_tag="SCA_0282"
FT                   /product="threonyl-tRNA synthetase"
FT                   /function="Threonyl-tRNA synthetase"
FT                   /EC_number="6.1.1.3"
FT                   /note="(P18256) Threonyl-tRNA synthetase 2 (EC 6.1.1.3)
FT                   (Threonine--tRNA ligase) (ThrRS),InterPro: Threonyl-tRNA
FT                   synthetase class IIa"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0282"
FT                   /db_xref="GOA:B9DKB7"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKB7"
FT                   /inference="similar to AA sequence:UniProtKB:P18256"
FT                   /protein_id="CAL27195.1"
FT                   /translation="MGNQVIVTLPDQRKLEVEQSTTLYQVAQQIGSSFAKKAAVASIDG
FT                   ELHDLNHQIEKDCQVEFFTYEDEEGLAAIRYTLSYLVGEAAVKYGVEVADFGVNKEQFY
FT                   CDFKAENTLKAADLKEVTKTINKAISANHPIEVHEYSKLDALDLFKDNPFMQHHIEQGE
FT                   EPVKVAVHGDYKAVIHQPLVTNLSKVKNYKLQSISATNWLRDVNNESLQRIAGFAFADA
FT                   KALEEHQAFIEKYEQVNHRRLGKELDIFSFSEYAPGMPFYAHNGQVIRLELQNMLRQLQ
FT                   FEADYEEVYTPFIMDETLWKNSGHWDHYQDNMYFTEVDEQTYALKPMNCPGHMLIYKNH
FT                   LHSYRDLPIRMAEFGQVHRHELSGSLNGLFRVRTFNQDDAHIFVRRDQIESEILDVLGL
FT                   IHKVYSVFGFDYSIELSTRPDDFMGEIELWDFAEQSLENMLNQHGFKYTVNEKDGAFYG
FT                   PKIDIHIKDALGRSHQCGTVQLDFQMPEKFDLTFINQAGEKERPVVIHRAIYGSSDRFI
FT                   GILLEHFGGNLPLWLAPVQMEVILVNADLHLDAVKDLKRRLKKEGFRVELDLSDEKMGY
FT                   KIRQAHLKKVPYTLVVGDNEVENGTVAVRKRGESEEHSINVEDFVKQLKEEVDVLDKVK
FT                   "
FT   CDS_pept        289006..290343
FT                   /transl_table=11
FT                   /locus_tag="SCA_0283"
FT                   /product="putative aminotransferase"
FT                   /function="4-aminobutyrate aminotransferase and related
FT                   aminotransferases"
FT                   /note="(P94427) Probable 4-aminobutyrate aminotransferase
FT                   (EC 2.6.1.19) ((S)-3-amino-2-methylpropionate transaminase)
FT                   (EC 2.6.1.22) (Gamma-amino-N-butyrate transaminase) (GABA
FT                   transaminase) (Glutamate:succinic semialdehyde
FT                   transaminase) (GABA aminotr,InterPro: Aminotransferase
FT                   class-III"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0283"
FT                   /db_xref="GOA:B9DKB8"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKB8"
FT                   /inference="similar to AA sequence:UniProtKB:P94427"
FT                   /protein_id="CAL27196.1"
FT                   /translation="MTRAQEIFERDEKYFAKAGRIPYYPLIIDHAHGAVLTDVDGKEYI
FT                   DLLSSASSQNIGHTPERVVKAIQAQTEKMIHYTPAYMYHEPLAELAEKICSLSPGDFKK
FT                   RVIFGLTGSDACDGIIKFARAYTGRPNVTSFTNAYHGSTYGSISLSAISLNMRRKIGPL
FT                   LPGIHHIPFPDSYRGMFNSTEPNTVDEYLAPLKEMFEKYLPPEEVACIMLETIQGDGGL
FT                   LEPVPGYFEALEKLCREHGILLAVDDIQQGMGRTGKWSSIEHFNFEPDLVAYGKSLAGG
FT                   MPMSAIVGREDIMGSLDAPAHLFTMGANPVSCAAAVATLEMMEEDNLVEEAARKGEYAK
FT                   TRMKAWENQHEFIGNVRGLGLSIGVDIVTDKQSKARDNDAALKICNRCYERGVVIIAVA
FT                   GNVLRFQPPLVITDEELDQALTILEETFEELEQGKLEAYQVAGQGW"
FT   CDS_pept        290357..291448
FT                   /transl_table=11
FT                   /locus_tag="SCA_0284"
FT                   /product="putative membrane protein"
FT                   /function="uncharacterized membrane protein"
FT                   /note="(P37520) Hypothetical protein yyaD"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0284"
FT                   /db_xref="GOA:B9DKB9"
FT                   /db_xref="InterPro:IPR038728"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKB9"
FT                   /inference="similar to AA sequence:UniProtKB:P37520"
FT                   /protein_id="CAL27197.1"
FT                   /translation="MGQQIDWKNVLKLSGAYMAYLIGSGFATGQEVMQFFASYGKAGIA
FT                   GILLSAILFCSLGVTLMTRGYELQLEHPGDIFRVYCGKIIGRLIEYFTLLFLFCIVVIM
FT                   ISGTGAIAHEHFGIPAIVGLLGMGIITMITVIFGLNKLVDIIGAVGPVIVVLTIAICLV
FT                   VFFKNIGSLPSLDTLPQAAKDLQPAGHWWQSSILFFCYNILAGTIFFTQLGQQSGSKKE
FT                   AAAAGILGGAGLMLAVLAMVVAMFAHYNHVLKLEVPVLYLGDTISPWVAIVFSICILLG
FT                   IYSTTAPMYWLIKNEFMRMIPAKFGVIVTIVLGIVFMLGGSLPFGKLVAMIYPFVGYVG
FT                   LAVVIIIFVRTIWAKMNPQKSKV"
FT   CDS_pept        complement(292392..292796)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0285"
FT                   /product="conserved hypothetical protein"
FT                   /note="(O05398) Hypothetical protein yrhF"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0285"
FT                   /db_xref="InterPro:IPR018745"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKC0"
FT                   /inference="similar to AA sequence:UniProtKB:O05398"
FT                   /protein_id="CAL27198.1"
FT                   /translation="MSYHFSSKQVIDIANKNTKNKTQEFANLVRAYRKAHIGKGPEQIK
FT                   VFFKDNWAIAHMTGSLSKVENFYLRNTESKEFERMLKFGRTEEIKQLYNQHPPTEMEEL
FT                   VGAKFVKLFTDVNLEDDEVISIFVFDRSIE"
FT   CDS_pept        complement(293141..293938)
FT                   /transl_table=11
FT                   /gene="tagH"
FT                   /locus_tag="SCA_0286"
FT                   /product="teichoic acid translocation ATP-binding protein"
FT                   /function="ABC-type polysaccharide/polyol phosphate
FT                   transport system ATPase component"
FT                   /EC_number="3.6.3.40"
FT                   /note="(P42954) Teichoic acid export ATP-binding protein
FT                   tagH (EC 3.6.3.40) (Teichoic acid-transporting
FT                   ATPase),InterPro: ABC transporter"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0286"
FT                   /db_xref="GOA:B9DKC1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015860"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKC1"
FT                   /inference="similar to AA sequence:UniProtKB:P42954"
FT                   /protein_id="CAL27199.1"
FT                   /translation="MKDISVKMENITKEYRIYRNNKERVKDALIPNHKNKTFYALNDVS
FT                   MTAYKGDIIGLVGINGSGKSTLSNIIGGSLSNTSGEIEKHGEVSVIAINAGLNAQLTGL
FT                   ENIEFKMLCMGFKPKEIKELTPKIIEFSELGEFIYQPVKKYSSGMRAKLGFSINVTIDP
FT                   DILVIDEALSVGDQTFTQKSLDKIHEFKEADKTIFFVSHNIGQVREFCTKIAWIEGGRL
FT                   KEFGELDDVLPKYEQFLKDFRKKSKAQQKEFKQELDKSRFVMK"
FT   CDS_pept        294249..295052
FT                   /transl_table=11
FT                   /gene="tagG"
FT                   /locus_tag="SCA_0287"
FT                   /product="teichoic acid translocation permease protein"
FT                   /function="ABC-type polysaccharide/polyol phosphate export
FT                   systems permease component"
FT                   /note="(P42953) Teichoic acid translocation permease
FT                   protein tagG,InterPro: ABC transporter family 2"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0287"
FT                   /db_xref="GOA:B9DKC2"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKC2"
FT                   /inference="similar to AA sequence:UniProtKB:P42953"
FT                   /protein_id="CAL27200.1"
FT                   /translation="MGALITVLKEHIKGFYLINRLAQFELKIANHNNYLGMAWELINPL
FT                   IQILVYWFVFGFGIRTNAPVDGIPFIYWMLVGISMWFFINQGILDGTRSIVSKYNQVAK
FT                   MNFPLSIIPTYTVTAKLYGHLVLLLIIFIFCVASGIYPTIHIIQLLLYVPFAYIFTCAV
FT                   AFVTSTLGVLIRDTQMLMQALMRVLFYASPILWVAKPGSIVQKILMLNPIYFIAEAYRA
FT                   ALLYHKWYFIEHWELALYNVFIVLFLFFVGSILHMRYRDQFADFM"
FT   CDS_pept        295134..296228
FT                   /transl_table=11
FT                   /gene="tagB"
FT                   /locus_tag="SCA_0288"
FT                   /product="teichoic acid biosynthesis protein B"
FT                   /function="putative glycosyl/glycerophosphate transferases
FT                   involved in teichoic acid biosynthesis TagF/TagB/EpsJ/RodC"
FT                   /note="(Q8RKI8) Putative CDP-glycerol:glycerophosphate
FT                   glycerophosphotransferase tarB (EC 2.7.8.-),InterPro:
FT                   CDP-glycerol:poly(glycerophosphate)
FT                   glycerophosphotransferase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0288"
FT                   /db_xref="GOA:B9DKA9"
FT                   /db_xref="InterPro:IPR007554"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKA9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27201.1"
FT                   /translation="MRQIIKKVYLLIISILNGLYKKRKIKSNHIVVFMTFKEDVMPIIK
FT                   RLSDDGYEVTVIGKPADKLSVKHLKNVDFIDNSNKKVFAQIHALSTAKVIFVDNYYLLM
FT                   GGFRKKKGQTVIQTWHAAGALKYFGLKDHAVDLTNKKMVEQYMKVYNATDRYLVGGKPM
FT                   EICFTNAFGAKPYQMLQFGLPRMLQYFSKDLEAQKIALKKQYGIEGKLAVYVPTYRENY
FT                   QANREINKEKFEAALPEYTLINKLHPAALKLGETSKIDTQRLFLMADVIITDYSSLAIE
FT                   ASLLNKPVLFYVYDQAEYETERGLNHFYWEIPETYKAYNEEDLLQKLQEGPEYYPPLFK
FT                   EWHTFSTPDTLNKISNYIRELVKK"
FT   CDS_pept        296228..297286
FT                   /transl_table=11
FT                   /gene="tagX"
FT                   /locus_tag="SCA_0289"
FT                   /product="teichoic acid biosynthesis protein X"
FT                   /function="Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /note="(Q48214) Putative glycosyl transferase HI1696 (EC
FT                   2.-.-.-),InterPro: Glycosyl transferase family 2"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0289"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK97"
FT                   /inference="similar to AA sequence:UniProtKB:Q48214"
FT                   /protein_id="CAL27202.1"
FT                   /translation="MKISIIIPVYNSEEVVKRAVRSIDTKYDHETICINDGSTDHTLQT
FT                   LEELQRENKHIKIINQENKGAAASRNVGLSQMTGDVYMFLDADDEFLPSRIDLMARRYE
FT                   ANDDVEIVVGQTGRDYHGEWRTFPTHEEIKKDEVVNLTQCPAILQSIGPRDKMFSSRFK
FT                   NLRFDEDIVFCEEHTYMAHAFNQARDIQLLPDIIAGYNMRENSITAQSVERFFSYMRDA
FT                   YKVRQRVMDYLRMPNVQEYYSYRMDELIVSYMLQAYVTAKPKVTQDLLDVVIQYIEGMQ
FT                   KTHYDGNALFRIVKVMEGGAIGWTPAFYRQWREALNKVGIGRPNYIAFHLQLVPKIGVF
FT                   RGRNALKKALKR"
FT   CDS_pept        297401..297799
FT                   /transl_table=11
FT                   /gene="tagD"
FT                   /locus_tag="SCA_0290"
FT                   /product="teichoic acid biosynthesis protein D"
FT                   /function="Cytidylyltransferase"
FT                   /EC_number="2.7.7.39"
FT                   /note="(P27623) Glycerol-3-phosphate cytidylyltransferase
FT                   (EC 2.7.7.39) (GCT) (Gro-PCT) (CDP-glycerol
FT                   pyrophosphorylase) (Teichoic acid biosynthesis protein
FT                   D),InterPro: Cytidylyltransferase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0290"
FT                   /db_xref="GOA:B9DK98"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR006409"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK98"
FT                   /inference="similar to AA sequence:UniProtKB:P27623"
FT                   /protein_id="CAL27203.1"
FT                   /translation="MKRVITYGTYDLLHYGHIELLRRAREMGDYLIVALSSDEFNRIKN
FT                   KKSYYNYEQRKMMLESIRYVDLVIPEENWGQKERDVERYDVDTFVMGHDWEGEFDFLKD
FT                   KCEVIYLKRTEGISTTQIKKELYGKDAK"
FT   CDS_pept        complement(297894..299183)
FT                   /transl_table=11
FT                   /gene="pbp4"
FT                   /locus_tag="SCA_0291"
FT                   /product="penicillin binding protein 4"
FT                   /function="D-alanyl-D-alanine carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="(Q05523) D-alanyl-D-alanine carboxypeptidase
FT                   precursor (EC 3.4.16.4) (DD-peptidase)
FT                   (DD-carboxypeptidase) (CPase) (PBP5),InterPro: Peptidase
FT                   S11 D-alanyl-D-alanine carboxypeptidase 1"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0291"
FT                   /db_xref="GOA:B9DK99"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015294"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037091"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK99"
FT                   /inference="similar to AA sequence:UniProtKB:Q05523"
FT                   /protein_id="CAL27204.1"
FT                   /translation="MKKIILLTLLIFFASTIITPFSEADTNTPSPAQVANEYGYNISDD
FT                   FNPEGAVNISQTGQVLYDYHMDKKWYPASMTKLMTMYLTLEAVKAHKLSLNDKVKITED
FT                   DYRMSTLPKLSNTKLYPGETYTIKELLQITVSASSNAAALILAKKVSGNTSDFTDKMNK
FT                   KAKELGMTKTHYVNPTGAENNLLQDFAPKKYKNEMSSRASAKDYAILSQRVIQDTPKIL
FT                   YFTKQLAPTQHGVTYYTFNWSLEGAELGLKGTDGLKTGSSDIADYNHTITTKRDGFRID
FT                   QAIMGAGDFKHLGGEKERNKMGNSIMNRSFDQYKYVKILSKGEQKINGKKYYVKKDLYD
FT                   VLPKNYTKKDYKFVVEDGKVHIDYPRQFISKKYGPPSVEVNRPLAHEATSFAKTSFSEH
FT                   PVLTIIGFGFVVAALAIIIFLIIDFIRRKK"
FT   CDS_pept        299414..301144
FT                   /transl_table=11
FT                   /locus_tag="SCA_0292"
FT                   /product="ATP-binding cassette transporter A"
FT                   /function="ABC-type multidrug transport system ATPase and
FT                   permease components"
FT                   /note="(P97046) Multidrug resistance ABC transporter
FT                   ATP-binding and permease protein,InterPro: ABC transporter
FT                   transmembrane region"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0292"
FT                   /db_xref="GOA:B9DKA0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKA0"
FT                   /inference="similar to AA sequence:UniProtKB:P97046"
FT                   /protein_id="CAL27205.1"
FT                   /translation="MEQTKTKNNPLLFLLKKLKWPIGLIIVAVSISSLGSISGLLVPLF
FT                   TGRMVDKFTGSQFNMQFILIFVAVFALNAVLSGIGLYLLSKIGEKVIYAIRSVVWAHII
FT                   RLRMRFFDINESGQLMSRLTDDTKVINEFVSQKLPNVLPSIITLIGSLIMLFIMDWQMT
FT                   LLTFITIPLFVAIMIPLGRVMQRISTRTQAEIANFSGLLGRVLTEMRLVKVANTEQVEL
FT                   DKAHLNLKEIYNLGLKQAKISAVIQPISGLIMLLTIGIILGFGGIRISSGAITAGTLVA
FT                   MIFYVIQLSMPLVNLSTLMTDYKKAVGASSRIYEIMQEPLEEVKAPTGHELANGNLDFD
FT                   HVDFGYDTKEVLHDLNFEIPKGKVTAFVGPSGSGKSTIFNLIERMYDVTQGDILYAGVS
FT                   IYQLPLSDWRNKIGYVMQSNAMMSGTIRDNILYGINREVTDAELENYTKLANCHDFIME
FT                   FDEGYDTLVGERGLKLSGGQRQRIDIARSFVKNPDILLLDEATANLDSESEKKIQEALE
FT                   TLMEDRTTVVIAHRLSTIMKADQIIFLDNGYVTGMGKHKELMETHTKYKEFVMTQKLTD
FT                   "
FT   CDS_pept        301442..302671
FT                   /transl_table=11
FT                   /locus_tag="SCA_0293"
FT                   /product="putative sodium dependent nucleoside transporter"
FT                   /function="Nucleoside permease"
FT                   /note="(O00337) Sodium/nucleoside cotransporter 1
FT                   (Na(+)/nucleoside cotransporter 1) (Sodium-coupled
FT                   nucleoside transporter 1) (Concentrative nucleoside
FT                   transporter 1) (CNT 1) (hCNT1),InterPro: Na+ dependent
FT                   nucleoside transporter"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0293"
FT                   /db_xref="GOA:B9DKA1"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKA1"
FT                   /inference="similar to AA sequence:UniProtKB:O00337"
FT                   /protein_id="CAL27206.1"
FT                   /translation="MYLLINIIGLAVFLGIAVLFSRNRKEIHWKSVVILVVVNLFLAWF
FT                   FVFFPWGNWFVSKMADGISWVIESANAGTGFAFASFVNQKQMDMAISALFPILLVVPLF
FT                   DILMYLNILPKFIGAVGWLLAKVTRQPKFESFFGIEMMFLGNTEALAVSSEQLKRMNEV
FT                   RVLTIAMMSMSSVSGAIVGAYVTMIPGELVLTAIPLNIINAIIVTSILNPVSVEEREDI
FT                   IYNLKEEGAQRQPFFSFLGDSVINAGKLVLIIIAFVISFVALADLLDRFINLITGIIGG
FT                   WIHVKGSFGLNQILGVFMYPFALLLGLPWDTAWIVAQQMAKKIVTNEFVVMGQISDVVK
FT                   SYDPHRRAVISTFLVSFANFSTIGMIVGTLKGIVNQKTSDFVSKYVPMMLLSGILVSLL
FT                   TAAFVGLFAW"
FT   CDS_pept        303156..303992
FT                   /transl_table=11
FT                   /locus_tag="SCA_0294"
FT                   /product="putative membrane protein"
FT                   /function="uncharacterized conserved protein"
FT                   /note="(P39803) Hypothetical protein yitT,InterPro: Protein
FT                   of unknown function DUF161"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0294"
FT                   /db_xref="GOA:B9DKA2"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKA2"
FT                   /inference="similar to AA sequence:UniProtKB:P39803"
FT                   /protein_id="CAL27207.1"
FT                   /translation="MNKKTMRDLALVVFGSFVFSAGVNTFIISGKLGEGGVTGLAIVLY
FT                   YAFHLSPGITNFVLNAILIVIGYKFLSKRSMFLTIIATVLISVFLGLTESWHIETGNVV
FT                   VNAVFGGSCVGLGIGVIVLAGGTTAGTTILARLAHKYLDVSTSYALLFFDLIVVAISIT
FT                   VIPMDKILVTIISLYIGTKVMEFVIEGLNTKKAMTIISSRPDEVAKVIDEKVGRGVTII
FT                   DGRGYYSKEDKEILYVVISKTQVSKAKRLIRSLDENAFLVIHDVRDVYGNGFLADE"
FT   CDS_pept        304305..305108
FT                   /transl_table=11
FT                   /gene="fhuC"
FT                   /locus_tag="SCA_0295"
FT                   /product="ferrichrome transport ATP-binding protein"
FT                   /function="ABC-type cobalamin/Fe3+-siderophores transport
FT                   systems ATPase components"
FT                   /note="(P49938) Ferrichrome transport ATP-binding protein
FT                   fhuC,InterPro: ABC transporter"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0295"
FT                   /db_xref="GOA:B9DKA3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKA3"
FT                   /inference="similar to AA sequence:UniProtKB:P49938"
FT                   /protein_id="CAL27208.1"
FT                   /translation="MNRLNGQQVTIGYGEHVIVSDLDVEIPDGKVTSIIGPNGCGKSTL
FT                   LKALSRLLSVKNGEILLDGKNIHTQSTKEIAKKIAILPQSPDVADGLTAGELVSYGRFP
FT                   HQKGFGRLSAEDKEEIDWALKVTGTYDFKHRAINDLSGGQRQRVWIAMALAQKTDIIFL
FT                   DEPTTYLDISHQLEILELVQELNREHGTTIVMVLHDINQAIRFSDHLIAMKGGDIVSSG
FT                   ETHEVLTKEILEQVFNIDAELSTDPRTGKPMLVTYDLLCKHYSKV"
FT   CDS_pept        305119..306126
FT                   /transl_table=11
FT                   /gene="fhuB"
FT                   /locus_tag="SCA_0296"
FT                   /product="ferrichrome transport permease"
FT                   /function="ABC-type Fe3+-siderophore transport system
FT                   permease component"
FT                   /note="(P49936) Ferrichrome transport system permease
FT                   protein fhuB,InterPro: FecCD transport family"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0296"
FT                   /db_xref="GOA:B9DKA4"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKA4"
FT                   /inference="similar to AA sequence:UniProtKB:P49936"
FT                   /protein_id="CAL27209.1"
FT                   /translation="MTQKQKKQKQINFTSAFILSCLLLFVMLLISILYGDARIHLSTIY
FT                   QAIFHYNPSIEQHNIISEIRIPRDLGAVLVGMALAVSGAVVQGVTKNGLADPSLIGLNA
FT                   GASFMLAVTYAFYPSANFSILMLAGFAGAVIGGTIVLLMGRTRQDGFNPIRIILTGAAV
FT                   SAFLTALSQGIALFFKLNQDINFWSMGGVSGTTWIQLKWSAPIIIVTVILIILLSKQLT
FT                   ILNLGESLATGLGQNVTWIRTISLVLTMLLAGIAVAMVGQIAFVGLIVPHIVRFLIGTD
FT                   YAKVIPLTAVLGGFLVLLADTIARMLGDAPVGAIVSFIGVPYFIYLIRKGGRTI"
FT   CDS_pept        306123..307139
FT                   /transl_table=11
FT                   /gene="fhuG"
FT                   /locus_tag="SCA_0297"
FT                   /product="ferrichrome transport permease"
FT                   /function="ABC-type Fe3+-siderophore transport system
FT                   permease component"
FT                   /note="(P49937) Ferrichrome transport system permease
FT                   protein fhuG,InterPro: FecCD transport family"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0297"
FT                   /db_xref="GOA:B9DKA5"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKA5"
FT                   /inference="similar to AA sequence:UniProtKB:P49937"
FT                   /protein_id="CAL27210.1"
FT                   /translation="MIDNKLRIKQLIALAISIILLFMACAWSVTSGEYHMSISTFFKTL
FT                   FGQGEYTDSLILLDFRLPRMLITILAGAALSMSGAMMQSVTNNPLAEPGILGINAGSGF
FT                   LIALFLVVGHVSADNFIYILPILSIIGGMLTAVIIFYFSYTKEKGITPASMVLVGVGLS
FT                   AALAGGSLTLMSKFDRDQSEFMATWLAGNIWGDDWSFVIALLPWLIVIIPFLFTKANTL
FT                   NILNTNEQIAQGLGINVRRERMIILFAAVALSSAAVAVSGAISFIGLMGPHIAKTIVGP
FT                   RHQLFMPLAIFIGAFLLVFSDTVGQVILQPSGIPAGIVVALIGAPYFLYLMYRSKSF"
FT   CDS_pept        307258..307758
FT                   /transl_table=11
FT                   /locus_tag="SCA_0298"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0298"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKA6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27211.1"
FT                   /translation="MQDLIKRHVLNGEFESVKQLMSESDFMEFEEAYISSAHDVESVMF
FT                   YTCILDMMKEGETAELHDLAFLLLVYPLSEVEGALDSAYYHAESSIKLTEGKEVKSLLQ
FT                   MLLLHAIPEPVISDKKAFDISKQILKLDPNNNVARNILKQTAKRMDNVVVSIDELNQNR
FT                   GAK"
FT   CDS_pept        308113..309180
FT                   /transl_table=11
FT                   /locus_tag="SCA_0299"
FT                   /product="putative membrane protein"
FT                   /function="uncharacterized membrane protein"
FT                   /note="(P37520) Hypothetical protein yyaD"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0299"
FT                   /db_xref="GOA:B9DKA7"
FT                   /db_xref="InterPro:IPR038728"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKA7"
FT                   /inference="similar to AA sequence:UniProtKB:P37520"
FT                   /protein_id="CAL27212.1"
FT                   /translation="MTFNKETVKIGFAYVGVVVGAGFSTGQEVMQFFTDYGLYAYIGVL
FT                   IAGLILGFIGRQVAKIGTAFDAENHESTLSYLFGKQFGRIIDYILVFFLFGISVTMIAG
FT                   AGSAFHESYGIPTWLGSLIMVIAIYITLLMDFNKIVRALGVVTPFLIVLVIVIAGVYLV
FT                   KGQVPISQINSVVPDANPIQGIWRGTIYGGLAFAVGFSTIVAIGGDASRRKVSGAGALF
FT                   GGVVYTILLALITFALQTEYPAIKDAAIPTLTLAHGIHPIVTILLSIVMLAVMYNTILG
FT                   LLYSFAARFTTPYTKKYHILIVIMMLVAYGLSFVGFSSLINFLYPAMGYVGLLIVIAVL
FT                   IKYFKRKKENKEHIA"
FT   CDS_pept        309405..310427
FT                   /transl_table=11
FT                   /locus_tag="SCA_0300"
FT                   /product="putative esterase"
FT                   /function="Esterase/lipase"
FT                   /note="(P23872) Acetyl esterase (EC 3.1.1.-),InterPro:
FT                   Esterase/lipase/thioesterase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0300"
FT                   /db_xref="GOA:B9DKA8"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9DKA8"
FT                   /inference="similar to AA sequence:UniProtKB:P23872"
FT                   /protein_id="CAL27213.1"
FT                   /translation="MSKRKKRWLVWSTIIVIVLCIAAGISIKKYFDYRHTQDMKEKVQL
FT                   NNRNVKVFNNITYGKTYPKSQLDIITPAELDKDVKLPVIFWMHGGGFIAGDKQYKNPLL
FT                   SKIAEQGYIVVNINYALAPEYKYPTPLVQMDQAVSFIKKNQHELPIDFKQVVFGGDSAG
FT                   AQLSSQYTAIQTDKSLRDSMDFKQQFKPKDIRAAIFFGGFYNMNTVKKTEFPRIQLFMR
FT                   SYTGTSHWESEFKNLSEMSTVEHVTHQYPPTFLSVGDADPFASQNAEFADVLKQHDVPT
FT                   DTFFFDGSHHLHHQYQFHLDKPESKENLAEVQHFLSRNTSSTNIKKQNEQFEPIQLNPF
FT                   "
FT   CDS_pept        complement(310560..311066)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0301"
FT                   /product="putative N-acetyltransferase"
FT                   /function="Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /note="InterPro: GCN5-related N-acetyltransferase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0301"
FT                   /db_xref="GOA:B9DK96"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK96"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27214.1"
FT                   /translation="MEHSIREISINDADDYIKLLKDIYDESDFMLYSPGEYVPSLSSAL
FT                   KNLEHFITSPSNTIYIAEIDGMLIGFAIVSSREYERTQHETRVRIGIREHYRSKGVGQS
FT                   LLNAVDAWALNHNIRRLEAVVVPQNEHAVELFKSAGYQIEGEMRDKLKIDNQYYNEYVM
FT                   AKLLR"
FT   CDS_pept        311275..311955
FT                   /transl_table=11
FT                   /locus_tag="SCA_0302"
FT                   /product="putative response regulator protein"
FT                   /function="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /note="(O34951) Sensory transduction protein bceR,InterPro:
FT                   Response regulator receiver"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0302"
FT                   /db_xref="GOA:B9DK83"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK83"
FT                   /inference="similar to AA sequence:UniProtKB:O34951"
FT                   /protein_id="CAL27215.1"
FT                   /translation="MKILLVEDDKTLFEQLKKELEHWDLHVEGIENFDDVLTEAKTKNP
FT                   EIIIMDVELPKYDGFYWCRQIRHESNVPILFLSARDNPMDQVMSMELGADDFIQKPFYT
FT                   NVLIAKLKAVYRRVYQFNLEEKRTMTWGNIQVDLAKGVLEREEEVIYLSKTEMMILEIL
FT                   LKHRNEIVSRDEIITALWDDEAFISDNTLTVNINRLRKKLADFGLDTAIETRVGKGYIA
FT                   NDNI"
FT   CDS_pept        311942..312985
FT                   /transl_table=11
FT                   /locus_tag="SCA_0303"
FT                   /product="putative two-component sensor histidine kinase"
FT                   /function="Signal transduction histidine kinase"
FT                   /note="(Q9K620) Sensor protein bceS (EC 2.7.3.-),InterPro:
FT                   Histidine kinase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0303"
FT                   /db_xref="GOA:B9DK84"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK84"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27216.1"
FT                   /translation="MTIFKRISNFLLTRIYWILLLLGLQVVILVVGYLDRDLSMESAFY
FT                   LVLVNLMIIILFLFFAYMRETAFLKKLSEMHEVEELKHKEAANSPMEREVLDYLYTQIV
FT                   RQKKIVSDQAIVLKEQEQSLTHFVHEMKTPLTAMKLLIEKEKDKENKNALLFEWSRLNE
FT                   MLDNQLYLVRLDSKNRDTYFESVNLKRMIIEEIQITRHVSQLKGIGFEMDFEADYQVFT
FT                   DMKWCKMLLRQLISNAIKYSPEGQDITIHAFMHHDYVNLTISDKGRGIPPKDLPRIYER
FT                   GFTSTGYRNETTSSGIGLYLVDQIKNTLGLNVKIDSAVNHGTKVTIIFPKQNEITAREA
FT                   EVTTLSL"
FT   CDS_pept        313078..313839
FT                   /transl_table=11
FT                   /locus_tag="SCA_0304"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /function="ABC-type antimicrobial peptide transport system
FT                   ATPase component"
FT                   /note="(Q9K619) Bacitracin export ATP-binding protein
FT                   bceA,InterPro: ABC transporter"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0304"
FT                   /db_xref="GOA:B9DK85"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK85"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27217.1"
FT                   /translation="MAILTVSNLTKVFGNKHVAQEVLKGLSFKVEKGEFISIMGPSGSG
FT                   KTTLLNLLSSIDYVTQGSVELNGHQMQNLTNKQLSEVRKREIGFIFQDYNLLSTLTVKE
FT                   NIMLPLSIQNLPKQEAEKYFNEVTEALGISELADKYPSEISGGQKQRASAARAFITRPA
FT                   IIFADEPTGALDSKSAQDLLRRLKAMNERFDSTILMVTHDPAAASYSNRIIMLKDGQIY
FT                   SELYQGDQDKQSFYKEVIQAQSVLGGVQYDF"
FT   CDS_pept        313829..315733
FT                   /transl_table=11
FT                   /locus_tag="SCA_0305"
FT                   /product="putative ABC transporter permease"
FT                   /function="ABC-type antimicrobial peptide transport system
FT                   permease component"
FT                   /note="(O34741) Bacitracin export permease protein
FT                   bceB,InterPro: Protein of unknown function DUF214"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0305"
FT                   /db_xref="GOA:B9DK86"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR027022"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK86"
FT                   /inference="similar to AA sequence:UniProtKB:O34741"
FT                   /protein_id="CAL27218.1"
FT                   /translation="MTFKHIVLKNLKKNLRHYGLYLFSLIFSIALYFSFVTLKYTKNIN
FT                   NEASAKIIREGANVGSVFLFIIIVIFLMYVNQLFIKQRVKELGLYQLIGLTRTNIIRML
FT                   MLEQFVIFIMTGIVGIVGGLLGSRFLLLILVKLMNIKESIHLSFSFKAFIATILMLFLA
FT                   YVLIVIQNAVFIKRRSILKLMKTRQATDVKDNKITKLERIFGVVGIIMIAIGYVLALDI
FT                   KLYAIIIVPLLVLFLTIVGAYFFFRSTVSLLFKTLKKRKGGNVNINDVIFTSSIMHRMK
FT                   KNALSLTIIAVISAITVTVLCFSAITLKSENTQINLTAPFDATIQKQQKAEQYRTLLDQ
FT                   HNIQYHENYKQLLDLPRIKNNLYKGKYVSLMGIQITSEKYVEGAHITRGKGELVQPYGT
FT                   SDTLTLNKINEHSYAQFDDKNKKPLVRIKVKPSDLDIKFALITLRGGPLLILNQEDYQL
FT                   IKEKAAYDKDNLVNQYGFTFKEKNQEAEATQLLHQVNPDYETQKEISEQYRSFSSVFLF
FT                   VSSFLGIAFLIAAGYIIYIKQMDETEDEMENFKILRKLGFTQEDMRKGLILKVLFNFGL
FT                   PLIVGLLHAYFASWAFLKLMGSNDHSPVILVMVLYTIIYACFAVIAYTHMKRTIRQSI"
FT   CDS_pept        316127..316744
FT                   /transl_table=11
FT                   /locus_tag="SCA_0306"
FT                   /product="conserved hypothetical protein"
FT                   /function="Phosphate transport regulator (distant homolog
FT                   of PhoU)"
FT                   /note="(O34454) Hypothetical UPF0111 protein ykaA,InterPro:
FT                   Protein of unknown function DUF47"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0306"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK87"
FT                   /inference="similar to AA sequence:UniProtKB:O34454"
FT                   /protein_id="CAL27219.1"
FT                   /translation="MFNKKKDKFMVKLEEMVFNLDRAAIEFGKMDFNTHLDLKAYSDNI
FT                   KTYESHGDELMHQVISDLNQTFITPIEREDILSLCNAIDDVLDAMEETSAMFEMYSIEY
FT                   SDEYMAEFVDNIQKAVAEMKLAIGLLVEKKLSHMRIHSINIKEFETNCDGILRQSIKHI
FT                   FNSETDPITLIKIKDIYESLEDVADKCQAVANNFETIIMKNS"
FT   CDS_pept        316758..317765
FT                   /transl_table=11
FT                   /locus_tag="SCA_0307"
FT                   /product="putative phosphate transporter protein"
FT                   /function="Phosphate/sulphate permeases"
FT                   /note="(O34436) Probable low-affinity inorganic phosphate
FT                   transporter,InterPro: Phosphate transporter"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0307"
FT                   /db_xref="GOA:B9DK88"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK88"
FT                   /inference="similar to AA sequence:UniProtKB:O34436"
FT                   /protein_id="CAL27220.1"
FT                   /translation="MDYVLIITVAIVIFSLIFDFINGFHDTANAVATAVSTRALTPRRA
FT                   ILLAAVMNFIGALTFTGVAGTITKDIVDPFKLQNGLVVVLAAIFAAIFWNLLTWYFGIP
FT                   SSSSHALIGAIAGAAVASQGSFTVLHFQGFTKIIIVLIVSPLIAFCVGFIMYSIIKIFF
FT                   KNANLTKTNRNFRIFQIFTAALQSFSHGTNDAQKSMGIITLALIVANLQDGNNVEPALW
FT                   VKVACATAMGLGTAIGGWKIIKTVGGNIMKIRPANGAAADLSSALTIFVASSLHFPLST
FT                   THVVSSSILGVGAANRAKGVKWNTAQRMIVTWVITLPISAIVAAIVYWIMHIFI"
FT   CDS_pept        complement(317832..318665)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0308"
FT                   /product="Aldo/keto reductase family protein"
FT                   /function="Aldo/keto reductases related to diketogulonate
FT                   reductase"
FT                   /note="(Q46857) 25-diketo-D-gluconic acid reductase A (EC
FT                   1.1.1.274) (25-DKG reductase A) (25-DKGR A) (25DKGR-A)
FT                   (AKR5C),InterPro: Aldo/keto reductase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0308"
FT                   /db_xref="GOA:B9DK89"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK89"
FT                   /inference="similar to AA sequence:UniProtKB:Q46857"
FT                   /protein_id="CAL27221.1"
FT                   /translation="MKYKTFNNDNTMPQLGLGVFRVENDDTAKNAVKHAIESGYRSIDA
FT                   ALVYGNEEMVGRGIQEGIEAAGITREDLFITSKLWLDDFGRDNVAKGYETSLKNLGLDY
FT                   LDLYLIHWPGTDNDLMIDTWKGMEDLYNAGKVKNIGVSNFNVEHLETLKAHSEIQPVIN
FT                   QVEFHPYFTQEPLRNYLKEEGIQMESWSPLMNAEILSDQTVNDIANEIDKSPAQVVIRW
FT                   NIDNGVITIPKSVTPSRIEENLDVFDFSLTPEQMDKISSLNQNKRIGPNPAEFNG"
FT   CDS_pept        complement(318814..319992)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0309"
FT                   /product="major facilitator family protein"
FT                   /function="Arabinose efflux permease"
FT                   /note="(P77389) Hypothetical transport protein
FT                   ydhP,InterPro: General substrate transporter"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0309"
FT                   /db_xref="GOA:B9DK90"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK90"
FT                   /inference="similar to AA sequence:UniProtKB:P77389"
FT                   /protein_id="CAL27222.1"
FT                   /translation="MNKNKFAILALAVSAFAIGMTEFISVGLLPLIKDAFNVTLPLAGL
FT                   TVSMYAIGVTVGAPVLTPLTNKMKRKHLLIGIMLIFIIANALAAFSFSFSMLLAMRILS
FT                   ALMHGVFMSVATAIASDLVTPDKRSSAIAMMFTGLTVATITGAPFGTWIGQQFGWEMSF
FT                   VAISIIGLLSLIANIIFVPNDLTEYDQAPMSEQLKVFNNKPLLAVYLITALGYGGTFVV
FT                   YTYLTTLLTKSLGYSDHAVVIILILYGVMVAIGNTLGGKFTNLNPTKALVWIFLIQAII
FT                   LLLVGATVHYHILGLISILLMGLFAFMNVPGLQLIVVLFAEKENTSTVNFASSLNISAF
FT                   NIGITLGSVIGGFVLEHFSIISTPYFGFLMVILASGMMYLLHKKESTALVEC"
FT   CDS_pept        320137..320475
FT                   /transl_table=11
FT                   /locus_tag="SCA_0310"
FT                   /product="putative transcriptional regulator"
FT                   /function="predicted transcriptional regulators"
FT                   /note="(O34533) Hypothetical UPF0087 protein ytcD,InterPro:
FT                   Protein of unknown function DUF24"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0310"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK91"
FT                   /inference="similar to AA sequence:UniProtKB:O34533"
FT                   /protein_id="CAL27223.1"
FT                   /translation="MKDYNIGVEATIDVIGGKWKPVILCHLKDEGTMRTSELKRAIPKI
FT                   TQKMLTQQLRELEQDQIINRIVYQQVPPKVEYELSEYGSSLNTILTSLCGWGEKHIEVM
FT                   KENEELNV"
FT   CDS_pept        complement(320530..321345)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0311"
FT                   /product="putative peptidoglycan hydrolase"
FT                   /function="Surface antigen"
FT                   /note="(P39046) Muramidase-2 precursor (EC 3.2.1.17)
FT                   (14-beta-N-acetylmuramoylhydrolase) (Peptidoglycan
FT                   hydrolase) (Pg-hydrolase-2) (Lysozyme),InterPro: CHAP"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0311"
FT                   /db_xref="GOA:B9DK92"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK92"
FT                   /inference="similar to AA sequence:UniProtKB:P39046"
FT                   /protein_id="CAL27224.1"
FT                   /translation="MKKLAITFSVATGAALALTHQDADASTQHTVQSGESLWSIADQYG
FT                   VSVDSIKQDNNLSNNMVFPGQVITVNGSSQQNSGSNTTSNTGGQGGATHTVQAGESLGI
FT                   IAAQYGTSAEAIMQANGLNGNLIYPGQSLTIPGASGGQGGGQGGTPTATENGTTPTFND
FT                   QNLYDWGQCTWHVFNRRAETGQPISTYWWNAENWADNARADGYTVNNQPSAGSILQTYE
FT                   GPVGHVAYVEQVNGDGSILVSEMNYNTAPGEVGYRTIPASMVSSYNYIH"
FT   CDS_pept        321693..322322
FT                   /transl_table=11
FT                   /locus_tag="SCA_0312"
FT                   /product="putative integral membrane protein that interacts
FT                   with FtsH"
FT                   /function="Integral membrane protein interacts with FtsH"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0312"
FT                   /db_xref="GOA:B9DK93"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK93"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27225.1"
FT                   /translation="MTQHSQTMSRSHAYAKVWLYFMYFWIIFGIGTYFGQYLPLEWRRP
FT                   LSIGLTVLILISLFINRSRRFGFIISNIYAIAIGLLAYASFATYMQNLGPEIFYKNVAL
FT                   AVGAFIAFGVIGYFFIQDASSIGKYLFVVLIALIVASLIGFFIQNPIFYTIINVVAVGL
FT                   FLLYTLYDFNRLKRGQFEPSEMGFNLFVNLLNIIINILSLANRFRD"
FT   CDS_pept        322807..323685
FT                   /transl_table=11
FT                   /locus_tag="SCA_0313"
FT                   /product="truncated AraC/XylS family transcriptional
FT                   regulator (fragment 1)"
FT                   /function="AraC-type DNA-binding domain-containing
FT                   proteins"
FT                   /note="InterPro: Helix-turn-helix AraC type,This fragment
FT                   is N-terminally truncated by about 60 aa which are encoded
FT                   in preceding ORF (not annotated)"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0313"
FT                   /db_xref="GOA:B9DK94"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK94"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27226.1"
FT                   /translation="MILYIASDWFIENGLSFYNYMFNTQLVHSIRDIKKSIAILMMHQL
FT                   EETLTEEIMTEQITKICSVLIEEAAVDRNHITSQLTPSVNNQYRDILEYIHTYIDSKLT
FT                   LDSISKTFFTSKTALSARFQEIFNVGFKKYVETLRIGLSLEYLNATDDTISYISERVGF
FT                   SHSSLYTKKFKQYLEMTPNVYRKLTKFQKNMKYLLKDYNIPLPEKKKASYIRSLAEELR
FT                   DWQDEKENIVYIDDLQPRFSPTRPFIMVIHIHNMSELRAMLIERKYKDIFEFDKEVMLL
FT                   IDINLEKSTVS"
FT   CDS_pept        323697..324011
FT                   /transl_table=11
FT                   /locus_tag="SCA_0314"
FT                   /product="truncated AraC/XylS family transcriptional
FT                   regulator (fragment 2)"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0314"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK95"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27227.1"
FT                   /translation="MIQLLNTIYHYQVSTSFTIENKSDIDCLKNGLLQSERFLNHPIYK
FT                   TMKSPNPNISFTFSLRHESLKDIYIQMLRVQELDFKIDFNLDITNLFNNPEEFKTMETR
FT                   "
FT   CDS_pept        324053..324784
FT                   /transl_table=11
FT                   /locus_tag="SCA_0315"
FT                   /product="truncated AraC/XylS family transcriptional
FT                   regulator (fragment 3)"
FT                   /function="AraC-type DNA-binding domain-containing
FT                   proteins"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0315"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK82"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27228.1"
FT                   /translation="MDYPYLEKEYDNLPIKQVAELSEIKAVMKEMDLDERRYILVNLPN
FT                   RNLINDDLSLLDCTPLMMYMFMQFYGTLYGMGVDLIQQPNSKTIYLYDKNGLKTTLYFL
FT                   YQQLSDFKTFYFYEEKSYVITEDDERFAIMLYDWRVIENELYLTNQGSQLFSIGFKNNQ
FT                   LRKHYLVTREITDYRYGNINKIISPKLLERYNWSEYLKRKIKSVNNPKFEVGEHNFQKG
FT                   AMRINIKFNSLQLISIYKKNR"
FT   CDS_pept        324944..325303
FT                   /transl_table=11
FT                   /locus_tag="SCA_0316"
FT                   /product="putative transcriptional regulator, MarR type"
FT                   /function="Transcriptional regulators"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0316"
FT                   /db_xref="GOA:B9DK70"
FT                   /db_xref="InterPro:IPR010166"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK70"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27229.1"
FT                   /translation="MKKSKLESLLNEYKKYMDLMNYIETSYKINMNDFMVLNCIHDNCT
FT                   KEKMLMQPFLKVATDSFELSRTKVLASIRKLVNQDRVSKVRSDTDERKVYLFMDESNVE
FT                   KLNAILDDIEKYLEK"
FT   CDS_pept        325511..326230
FT                   /transl_table=11
FT                   /locus_tag="SCA_0317"
FT                   /product="conserved hypothetical protein"
FT                   /function="uncharacterized conserved protein"
FT                   /note="(Q8CTK9) Hypothetical UPF0082 protein
FT                   SE0437,InterPro: Protein of unknown function DUF28"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0317"
FT                   /db_xref="GOA:B9DK71"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026562"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DK71"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27230.1"
FT                   /translation="MGRKWNNIKEKKAQKDKNTSRIYAKFGKEIYVAAKSGEPDPESNQ
FT                   NLRLVLERAKTYNVPRNIIDRAIDKAKGSDDENYDNLRYEGFGPNGSMLIVDALTNNVN
FT                   RTASDVRAAFGKNGGNMGVSGSVSYMFDHTATFAFEGKSADEILEVLMEQDLDVRDVVD
FT                   DGNLTIVYAEPDQFAQVQDALRQDGVEDFQVAEFEMLPQNDIQLSDEDKATLEGLIDAL
FT                   EDLEDVQNVYHNVDLDS"
FT   CDS_pept        326232..326714
FT                   /transl_table=11
FT                   /locus_tag="SCA_0318"
FT                   /product="conserved hypothetical protein"
FT                   /function="uncharacterized conserved protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0318"
FT                   /db_xref="InterPro:IPR009327"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR039935"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK72"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27231.1"
FT                   /translation="MRSADEWVQLLNLTPHPEGGFFKEVIREPKETHQSRSDYTSIYFL
FT                   LTDDNISHFHRIDADEIWYYHAGQTLTVHMIHPNGQYEAVHIGPNIAEGDVLQHVVPAG
FT                   TIFASSIKDEEGYALVGCMCHPGFMFETFELFEQSTLKRQFPELTHIIEKYALAEI"
FT   CDS_pept        326944..327516
FT                   /transl_table=11
FT                   /locus_tag="SCA_0319"
FT                   /product="conserved hypothetical protein"
FT                   /function="uncharacterized conserved protein"
FT                   /note="InterPro: Protein of unknown function DUF402"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0319"
FT                   /db_xref="InterPro:IPR007295"
FT                   /db_xref="InterPro:IPR035930"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK73"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27232.1"
FT                   /translation="MKVKYIDKRHWRRLIERDYTEVKVNNNKFKGIIGLITMKKVKEPL
FT                   KVNVVGQTIVVADDNYQWLQIVPDKKRYSITVMLDEQGSPLEYYFDINIKNITQKGKAR
FT                   TVDLCLDVIVLPNGKYELVDEDDLLRALESKQISKKQYHEAYIIAHQLMMKIDNDFPGM
FT                   QDNIMYCYNKIKRKYLSDKHTTHHHRS"
FT   CDS_pept        327648..328514
FT                   /transl_table=11
FT                   /locus_tag="SCA_0320"
FT                   /product="LysR family regulatory protein"
FT                   /function="Transcriptional regulator"
FT                   /note="(O34827) Putative HTH-type transcriptional regulator
FT                   ykuM,InterPro: LysR substrate binding domain"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0320"
FT                   /db_xref="GOA:B9DK74"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK74"
FT                   /inference="similar to AA sequence:UniProtKB:O34827"
FT                   /protein_id="CAL27233.1"
FT                   /translation="MKIEDYRLLITLDETRTLRKAAEILYISQPAVTQRLKAIENTFGV
FT                   DIFIRTKKQLITTTEGAMVIEHAREMLKRERLFFDKMQAHIGEVNGTISIGCSSLIGQT
FT                   LLPEVLSHYNDKYPNVEIQVRVGSSDHIKAHHRDYHIMIIRGSKITNLNNEHLFNDKHY
FT                   FIYPKGKRDTVADMPFIEFQADPIYMNQIKEWYGRNLGRDYHAMISVDQVATCKEMLVG
FT                   GVGVTVLPEIMVKGLDKNRFEFEQVDIEGNPLGRSTYLSYDSSMLQLPQVESFVELVNH
FT                   DLKKEDE"
FT   CDS_pept        328689..329885
FT                   /transl_table=11
FT                   /locus_tag="SCA_0321"
FT                   /product="putative sugar efflux transporter"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /note="(P31436) Sugar efflux transporter C,InterPro: Major
FT                   facilitator superfamily"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0321"
FT                   /db_xref="GOA:B9DK75"
FT                   /db_xref="InterPro:IPR004750"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK75"
FT                   /inference="similar to AA sequence:UniProtKB:P31436"
FT                   /protein_id="CAL27234.1"
FT                   /translation="MFRALLQIKNYRLFAVNMMLLGMAIAITIPFLVLFATNELGMTTT
FT                   QFGILLALAAISQFSVNAIVARFSDNGKVNRKLLVIIALFMGAMSFSIYFYVHNIWLFI
FT                   VLYAVLQGLFAPAMPQLYASAREAINQSSSRNRAKFANTVLRSMFSFGFLFGPLIGSLL
FT                   NRTMGYAGLFGGTVAVILITLILQIFFFKDVKVEHPIEEGPHVETKAPSMLREKSLIIP
FT                   FLAFILLHIGQWMYTLNMPLFVTSYLHESEDYVGYLASLCAGLEVPFMIILGVLSSKLE
FT                   TRTLLILGAISGALFFFSIGVFDDVRMMLVGQIFLAMFLAILLGIGISYFQDILPAFPG
FT                   YASTLFANAMVIGQLLGNLLGGVMSQFVGLGNVFYVSAASLVLGMILIFFTKEQKFIE"
FT   CDS_pept        329901..330386
FT                   /transl_table=11
FT                   /locus_tag="SCA_0322"
FT                   /product="putative membrane protein"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /note="(P54486) Hypothetical protein yqgC,InterPro: Protein
FT                   of unknown function DUF456"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0322"
FT                   /db_xref="GOA:B9DK76"
FT                   /db_xref="InterPro:IPR007403"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK76"
FT                   /inference="similar to AA sequence:UniProtKB:P54486"
FT                   /protein_id="CAL27235.1"
FT                   /translation="MVATILWICIIACFVVAFVGLIKPIIPSMPMMWIGFLIYQIGFHN
FT                   GRLSWIFFVSMIILTILVFAADLMMSQYFTRRFGGSKAGELTALIGVIAGCFIFPPFGI
FT                   IIVPLVAVFIVELIMRKDPTIALKASFGSVVGFLASTAAQAIVMVIMVLWFFLDILF"
FT   CDS_pept        complement(330514..331200)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0323"
FT                   /product="putative membrane protein"
FT                   /note="(P40350) Dolichyl-phosphate beta-glucosyltransferase
FT                   (EC 2.4.1.117) (DolP-glucosyltransferase)"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0323"
FT                   /db_xref="GOA:B9DK77"
FT                   /db_xref="InterPro:IPR009214"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK77"
FT                   /inference="similar to AA sequence:UniProtKB:P40350"
FT                   /protein_id="CAL27236.1"
FT                   /translation="MAKSTEQLMRENNVKSLQLNNTDREIFENYMTYIRADLRVNPHDS
FT                   ELMLNRILKHLLKAENKGMLAMDFFDHNPKAHAIRTIKELKNEMVQNIFKYIWHHILFL
FT                   LGIFCFFKGFIGFFIGEKPLYLYTFPIILLAGLFIIFLFVWWAFKTVQIQAFNHSNWVW
FT                   LLTYAIIFAIIALLFYVVYIPQSFLAFGPHIKIANWTFIIVSFIITPIAFYVDHHYVKK
FT                   DSSTYL"
FT   CDS_pept        331388..331831
FT                   /transl_table=11
FT                   /locus_tag="SCA_0324"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0324"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK78"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27237.1"
FT                   /translation="MKKIVMLLLASTLILGACGKNDEKAALQKDIDKLQKENKSLKATK
FT                   DKLKKQKKDTQERVDKLQNEVNEKVASESVKQKSDAKSKEEDKKKSTSEDTKNKPENAS
FT                   GQNQTAKDKQTKDKQTKDKPAASTTTKDKTSGTAADKKNGNTP"
FT   CDS_pept        331906..332217
FT                   /transl_table=11
FT                   /locus_tag="SCA_0325"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0325"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK79"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27238.1"
FT                   /translation="MYEAEFHELEGKKMTLKQVSEAIEKISGYQLEQPTGQIKRIVAQK
FT                   PNFESDTDTFQATYKLNHLGDFVDVTFAALKSERERLNDVQVTIQLITYITRSELPQA"
FT   CDS_pept        332445..332990
FT                   /transl_table=11
FT                   /locus_tag="SCA_0326"
FT                   /product="putative N-acetyltransferase"
FT                   /function="Acetyltransferases including N-acetylases of
FT                   ribosomal proteins"
FT                   /note="InterPro: GCN5-related N-acetyltransferase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0326"
FT                   /db_xref="GOA:B9DK80"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK80"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27239.1"
FT                   /translation="MSVYIETERLKLRDWEEKDLLPFQKMNANRQVRRFFPSILSYRRS
FT                   ELDMQAMKKNLEQDGIGLFAVELKESGEWIGFVGLNYIPANSQYNFPELPFYEIGWRLI
FT                   PEVWDNGIATEGAKAVLGYATEKGLKDVFSIAAESNAASRRVMEKIGMTLMDTFELPAV
FT                   SEIHPLRPQVRYHKRLNE"
FT   CDS_pept        complement(333097..333669)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0327"
FT                   /product="lysine decarboxlyase family protein"
FT                   /function="predicted Rossmann fold nucleotide-binding
FT                   protein"
FT                   /note="(P48636) Hypothetical protein PA4923,InterPro:
FT                   Conserved hypothetical protein 730"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0327"
FT                   /db_xref="GOA:B9DK81"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK81"
FT                   /inference="similar to AA sequence:UniProtKB:P48636"
FT                   /protein_id="CAL27240.1"
FT                   /translation="MSLKRIAVYCGASKGKDPVYMERGYELGKYMAEHGYELVFGAGSV
FT                   GIMGAIQNGVLDHGGSAIGVMPRSLDDKEITSQRLTELVLVDSLHGRKAKMSELADAFI
FT                   LAPGGAGSLEEFFETYSWAQIGIHDKPMAVFNINNFFIPLQTMLDEMIDAGFIDAKYRA
FT                   LAPLYDDLEALFESLENYESVGTRSYD"
FT   CDS_pept        complement(333687..334127)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0328"
FT                   /product="conserved hypothetical protein"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /note="(Q8CTJ9) Hypothetical UPF0178 protein
FT                   SE0451,InterPro: Protein of unknown function DUF188"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0328"
FT                   /db_xref="InterPro:IPR003791"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK69"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27241.1"
FT                   /translation="MIDGDACPVTDSVIRLTEGTGIFVVLVRSYSHFSMQDYPSHVTVK
FT                   YVDDGPDMVDYKIVQLTGPSDIVITQDYGLASLLIGKARMVMHHNGMVYTENNMGRLLE
FT                   QRYQHAQARQQGKHHKGPRRFTEEARTKFEQKFQYVIDEITS"
FT   CDS_pept        complement(334140..334841)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0329"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0329"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK58"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27242.1"
FT                   /translation="MEKKRLIRTLITVLPVILVPLIVERKRIKDHPDVQKVNDKTADLR
FT                   HNVSDKTSQLASGISNKSSQAASAVSNKSSEFAQYVGDKKEELEEKRQAKKEAKENDPE
FT                   RIKTKGEKLEKKNRKEAEKMAKKLDKNLEKRRKEEEKDDEKTRKRLVKEMKDAQKYQEK
FT                   VGLVPGDASDKQVANKGEELEQENKDEAYDMNRILEDRIEQRLKKEEEARRANQEERIK
FT                   EIQKYEKKPNL"
FT   CDS_pept        complement(335021..335911)
FT                   /transl_table=11
FT                   /gene="bacA"
FT                   /locus_tag="SCA_0330"
FT                   /product="putative undecaprenol kinase"
FT                   /function="uncharacterized bacitracin resistance protein"
FT                   /EC_number="2.7.1.66"
FT                   /note="(Q8NXQ4) Putative undecaprenol kinase (EC 2.7.1.66)
FT                   (Bacitracin resistance protein),InterPro: Bacitracin
FT                   resistance protein BacA"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0330"
FT                   /db_xref="GOA:B9DK59"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DK59"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27243.1"
FT                   /translation="MLLLELLKALILGIVEGLTEFAPVSSTGHMILVDDMWLKSPEFLG
FT                   SQSAFTFKIVIQLGSVFAAAWVFRKRYFEMLYIGKYQPAATETESADGKIGKRVKPKRL
FT                   TLWHVLVGMIPAGILGLLFDDVIEKYLFSVPTVMIGLLLGAFYMIFAQKFSERYAHREN
FT                   IDQITFFQAFVIGLSQAVAMWPGFSRSGSTISTGVLMKMNYKAASDFTFIMAVPIMLAA
FT                   SLLSLVKHIGYIHLSHIPFYIIGFLAAFIFGLLSIRLFLNLINRIKLIPFAIYRIILVI
FT                   FIAILYFGFGIGKGI"
FT   CDS_pept        336359..337999
FT                   /transl_table=11
FT                   /gene="cydD"
FT                   /locus_tag="SCA_0331"
FT                   /product="putative ABC transporter required for expression
FT                   of cytochrome bd, CydD"
FT                   /function="ABC-type transport system involved in cytochrome
FT                   bd biosynthesis ATPase and permease components"
FT                   /note="(P29018) Transport ATP-binding protein
FT                   cydD,InterPro: ABC transporter transmembrane region"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0331"
FT                   /db_xref="GOA:B9DK60"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK60"
FT                   /inference="similar to AA sequence:UniProtKB:P29018"
FT                   /protein_id="CAL27244.1"
FT                   /translation="MKNLTRYIQKYISYPILMAIVCAMLAIVVVVQNVTIAKVLDIMLT
FT                   KAHSSISLTAILGILLAILILRAVLNMSNQLLGTQLAYKVKTNLRKRAVTQNADQPIGE
FT                   QMSVITESIDGIAPFYQDYLPQVFKAVMIPLFIIIAMCFIHLNTALIMMVTAPFIPVFY
FT                   ILFGLKTRDESKDQMTYLTQFSQRFLNLAQGLITLKLFNRSKQAEATIYQESTKFRDKT
FT                   MKILRSAFLSGLMLEFISLLGIGLVALEAGLGLVLFHNINFQTAAIAIILAPEFYNSIK
FT                   DLGQAFHTGKQSEGAADVVFDMLDVDSNHDETTRYSVDTSQAAQIHLDQVSYHYPNTER
FT                   LAVDGVTLDIDKGDHIALVGPSGAGKTTLSQLILQIRQPSKGIVTFNKEDLKLGVLSQQ
FT                   PYIFNASIRENVTMFKEVPDAEVMKVIEAVGLTDKIKSLPDGLDTAIGEGGEMLSGGQM
FT                   RRIELSRVLLDRPEVVVFDEPATGLDVWTERIIQTALKEYFDTRTVIMIAHRQSTIRAA
FT                   DRRIYMKQGRIETDDQDISIGMRKGREKA"
FT   CDS_pept        337996..339681
FT                   /transl_table=11
FT                   /gene="cydC"
FT                   /locus_tag="SCA_0332"
FT                   /product="putative ABC transporter required for expression
FT                   of cytochrome bd, CydC"
FT                   /function="ABC-type transport system involved in cytochrome
FT                   bd biosynthesis fused ATPase and permease components"
FT                   /note="(P23886) Transport ATP-binding protein
FT                   cydC,InterPro: ABC transporter transmembrane region"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0332"
FT                   /db_xref="GOA:B9DK61"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK61"
FT                   /inference="similar to AA sequence:UniProtKB:P23886"
FT                   /protein_id="CAL27245.1"
FT                   /translation="MKKRPIQFKLDKDLIFAIIVGVIGALVAIGMFFLSGLMISQAAQN
FT                   APLVALIILVVLVKMFGFIRALARYFERLFSHRTTFTMLRDIRVQFFSGLTQVVPDIYR
FT                   KFKSSDLISRMVSSVEALQNIYLRVYYPPVVIGITALITVVALWEFSFAHTLLLFLSMT
FT                   ISLGILPWLSAKRARVLSERVAEDESQFLSQYFDYKEGYGELQRFHQVESYRKDLMQRL
FT                   FGYSKRQRSEQRFLTLYDFALDAVSMISLFLCVWLGIIQVQNGNMDVIYLTSIVLMLLT
FT                   LFEQAVPMSNVAYFKADTDQAIINISEVLNDVPDPSRYPQSGQNNNFNSEHELIDVENV
FT                   DFKYWNQIGNVLKQINLHVKKGERLAIIGPSGSGKSTLMQVIAGLYQTETGAALLNGRT
FT                   IFELTEAEKAESFNVMLQHQQLFDGTVRENLLSDADDNKMRQVLDELGLEHVALDYEIT
FT                   LTGVGLSGGELQRLCLARLFLKEAPIWLLDEPTRSLDWDNSEGMMQRIFEQSETLIVAT
FT                   HDLELLPKFDRIAVMIEGELVEIDNYQQLMQQKGYLYDMVTLNE"
FT   CDS_pept        complement(339826..340266)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0333"
FT                   /product="MarR family regulatory protein"
FT                   /function="Transcriptional regulators"
FT                   /note="(O34777) Organic hydroperoxide resistance
FT                   transcriptional regulator,InterPro: Bacterial regulatory
FT                   protein MarR family"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0333"
FT                   /db_xref="GOA:B9DK62"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK62"
FT                   /inference="similar to AA sequence:UniProtKB:O34777"
FT                   /protein_id="CAL27246.1"
FT                   /translation="MSEQLNLGGRLCFSLYNAQRQVNRYYSNKVFKKYKLTYPQFLVLT
FT                   ILWEDSPVNVKKVVTELALDTGTVSPLLKRMEQVDLIKRERSEVDQREVFIHLTEKSEA
FT                   IKPELGQACNQLADISGLSENEEKELNRLLDKLIDSLAKEDA"
FT   CDS_pept        340516..341445
FT                   /transl_table=11
FT                   /locus_tag="SCA_0334"
FT                   /product="putative cobalamin synthesis protein"
FT                   /function="putative GTPases (G3E family)"
FT                   /note="(P31521) 47 kDa protein (P47K),InterPro: Cobalamin
FT                   synthesis protein/P47K"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0334"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK63"
FT                   /inference="similar to AA sequence:UniProtKB:P31521"
FT                   /protein_id="CAL27247.1"
FT                   /translation="MERNNNSKLSIYIVTGFLGSGKTSFLKHYTEELLKRDEKIAVIMN
FT                   EFGDFDVDSQILKPVIQTISLQNGCVCCDLSQALVAQLSVIINQNQAQHVIIEATGIAH
FT                   PLQLIEACFDPVLANHVNPPQVIGLVDAPRFLQRHEYSDSTQQLMEEQIEVSHDIIVNK
FT                   IDLINDEEQNEVKLQLKALNPHGILLPATYGQVDFTDLKQKDSSDKPHSHSHLHHHGIS
FT                   SLAYTFTAPIDRQMFYQFILRLPENIYRLKGYVRFRDTPETTYLFQFAYGMPDYEPIQG
FT                   NNTNTVVLIGENLDKERLRNQLDALQFT"
FT   CDS_pept        341634..342542
FT                   /transl_table=11
FT                   /locus_tag="SCA_0335"
FT                   /product="alpha/keto reductase family protein"
FT                   /function="predicted oxidoreductase"
FT                   /note="(P42972) Hypothetical oxidoreductase ycsN (EC
FT                   1.-.-.-),InterPro: Aldo/keto reductase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0335"
FT                   /db_xref="GOA:B9DK64"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK64"
FT                   /inference="similar to AA sequence:UniProtKB:P42972"
FT                   /protein_id="CAL27248.1"
FT                   /translation="MERVQINHNVDYSRVIQGFWRTKDWQKSTQELNRFIHELVELGVT
FT                   TMDHADIYGDYSCEALFGKALALSPELRDKIQLISKCGIILPTDRLELFDGHRYDLSKS
FT                   HIVGAVDRSLKSLGTDYLDTLLLHRPSPLMNPDEVRAALDTLVEQGKIKSFGVSNFSNT
FT                   QYDLLNSDIKSHKLHIAVNQLQVSPYHAEPMYDGTIDHMYQEGVKIMGWSPLAGGKLLN
FT                   LNDDKAKSVMSIISPIAFKNNVAPTSVITAWLAKHPATIMPIMGTGQIEHMQDAVKGLE
FT                   VELSDQEWFDIYVAVLGQDIP"
FT   CDS_pept        342573..342863
FT                   /transl_table=11
FT                   /locus_tag="SCA_0336"
FT                   /product="putative membrane protein"
FT                   /note="(P45403) Cytochrome c-type biogenesis protein cycK"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0336"
FT                   /db_xref="GOA:B9DK65"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK65"
FT                   /inference="similar to AA sequence:UniProtKB:P45403"
FT                   /protein_id="CAL27249.1"
FT                   /translation="MNPDEKARQRIKFERNFVVLPYIIFAIIVFIFTTIFAQPTVVLTL
FT                   FGIFLIYNAVLLFVAFIKHYHRTMILLLILTIFVGLIFGISATAHFSARYN"
FT   CDS_pept        342937..343560
FT                   /transl_table=11
FT                   /locus_tag="SCA_0337"
FT                   /product="DedA family protein"
FT                   /function="uncharacterized membrane-associated protein"
FT                   /note="(Q9CHL6) Alkaline phosphatase like protein,InterPro:
FT                   DedA family"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0337"
FT                   /db_xref="GOA:B9DK66"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK66"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27250.1"
FT                   /translation="MKFLNQWLTHVMEQFGYLGVALLIFLENLFPPIPSEIVLTFGGFL
FT                   AGEHKLSFIGVVLSATAGSVVGAILLYGLGDWIGKKRIYRLTEKYGKYVYIKEADIDRT
FT                   VHWFDKYGHWTVFFCRFIPVLRCLISLPAGMTHMPFWTFVSYSAAGALIWNGVMIYLGK
FT                   AVGSHWHSVLQYIDFYSKFFIIILIIAVIFLIWKWWRRKKSDSK"
FT   CDS_pept        343732..344667
FT                   /transl_table=11
FT                   /gene="mdh"
FT                   /locus_tag="SCA_0338"
FT                   /product="putative malate dehydrogenase"
FT                   /function="Malate/lactate dehydrogenases"
FT                   /EC_number="1.1.1.37"
FT                   /note="(P19858) L-lactate dehydrogenase A chain (EC
FT                   1.1.1.27) (LDH-A) (LDH muscle subunit) (LDH-M),(Q9X4K8)
FT                   Malate dehydrogenase (EC 1.1.1.37),InterPro: Lactate/malate
FT                   dehydrogenase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0338"
FT                   /db_xref="GOA:B9DK67"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011275"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DK67"
FT                   /inference="similar to AA sequence:UniProtKB:P19858"
FT                   /protein_id="CAL27251.1"
FT                   /translation="MAKNKIAIIGAGHTGSTLAFIIAERALADVVLLEIPKNEKPARGK
FT                   ALDIKESGPILGFNGNVLGTSDYQDIAGADIVVITAGAARKPGMSRDDLIQINENVMAQ
FT                   VTEGIKKYAPESKIIVLTNPVDAMTYAVYKLSGFPKERVLGQSGILDTARYRTFVSEAL
FT                   NVAQTDVTGLVLGGHGDTMVPLLSTTMVGGVPLRELLAQDKIDAIVERTRKGGAEIVGL
FT                   LGNGSAYYAPAAAIYEMAAAILNDERRLVPAITYLDGEYGFKDICLGVPTILGANGVEK
FT                   VVEIELSDDEQQLRDSADAVEDVKSALKNK"
FT   CDS_pept        344956..346494
FT                   /transl_table=11
FT                   /locus_tag="SCA_0339"
FT                   /product="sodium/sulphate symporter family protein"
FT                   /function="Di- and tricarboxylate transporters"
FT                   /note="(Q07252) Membrane protein,InterPro: Sodium/sulphate
FT                   symporter"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0339"
FT                   /db_xref="GOA:B9DK68"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR030676"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK68"
FT                   /inference="similar to AA sequence:UniProtKB:Q07252"
FT                   /protein_id="CAL27252.1"
FT                   /translation="MASKEDTSQKEKKNKKVKPLWIVISFVVLIAIMLIPTGSSVPVMA
FT                   KVSLAILAFAVIMWVTEAVSYPVSSTMIAALMILLLGFSPVQNLAEKLGNPKANGAVLH
FT                   GSDMFGTSNALKLAFSGFATPAVVLVAAALFLAAAMQVTNLHKRLALLVLSIVGNKTNR
FT                   IVIGAILVSIVLAFFVPSATARAGAVVPILLGMIAAFKASKESKLAGLLIITAVQAVSI
FT                   WNVGIKTAAAQNIVAINFINQSFGQDISWGQWFLYAAPWSVLMSIALYFIMMKVMPPEH
FT                   KEIEGGKQLIRQELDKLGPISAREWRLIAISVLLLFFWSTEKILHPIDSSSITLVAMAV
FT                   MLMPKIGVMNWKEVEDKIPWGTIIVFGIGISLGNVLLNTGGAQWLSDKTFGLMGLQHMP
FT                   LVATIALITLFNILIHLGFASATSLSSALIPVFISLTTTLHLGDQSIGFVLIQQFVISF
FT                   GFLLPVSAPQNMLAYGTGTFTVKDFLKSGVPLTIVGYILIIIFSMTYWKWLGLI"
FT   CDS_pept        complement(346852..347469)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0340"
FT                   /product="putative membrane protein"
FT                   /function="predicted membrane protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0340"
FT                   /db_xref="GOA:B9DK57"
FT                   /db_xref="InterPro:IPR009793"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK57"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27253.1"
FT                   /translation="MQSRYIARILFVLLLLLTLPLNHFYNFMALNLFLAYIPFELVLLL
FT                   PLFVPKRKFEWPLFIVFAVIFILILPNTFYMVTDLIHLNQFGFDIYHGARPTEWMYFTF
FT                   LVSGVLFALYLYALINMKLLHLTDKPVFNYLIVIILVFTNSLGIFMGRFLRLHTVYLVN
FT                   QPFSIFRDVMTLLDSRGVFFIFLMTVLQFLFLILIKGVRMVK"
FT   CDS_pept        347779..348945
FT                   /transl_table=11
FT                   /gene="norA"
FT                   /locus_tag="SCA_0341"
FT                   /product="quinolone resistance protein NorA"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /note="(P21191) Quinolone resistance protein norA,InterPro:
FT                   General substrate transporter"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0341"
FT                   /db_xref="GOA:B9DK46"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR004734"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK46"
FT                   /inference="similar to AA sequence:UniProtKB:P21191"
FT                   /protein_id="CAL27254.1"
FT                   /translation="MSKQLITLYFNIFLVFLGIGLVVPVLPVYLKDLGLNGSDLGILVA
FT                   AFALAQMVISPFGGNLADKLGKKLIICIGLVLFSVSEFIFAMSSSYTLLIISRIIGGFS
FT                   AGMVMPGVTGMIADISPAKDKAKNFGYMSAIINSGFILGPGLGGFMAEFSHRLPFYFAG
FT                   TLGIAAFICSIFFIHGAKRQTTDGFTQIEPQELAKINIKAFITPVIITFVLAFGLSAFE
FT                   TLFPLYTADKAHYTPKDISISITGGGILGAVFQIFLFDKFMKYFKELTFIQFALFYSAL
FT                   VLFFLIIAHSYWSIMLISFIVFIGFDMIRPAVTNYFSNIAGDRQGLAGGLNSTFTSMGN
FT                   FIGPLVAGVLYDFDFEFPLYMSIAVMLLGIFIIFVEKTIRSKKQTQEG"
FT   CDS_pept        349280..350098
FT                   /transl_table=11
FT                   /locus_tag="SCA_0342"
FT                   /product="putative lipoprotein"
FT                   /function="ABC-type metal ion transport system periplasmic
FT                   component/surface antigen"
FT                   /note="(Q8Z992) D-methionine-binding lipoprotein metQ
FT                   precursor,InterPro: NLPA lipoprotein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0342"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK47"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27255.1"
FT                   /translation="MKKLISVLTLVVIAFALAACGQSKSAENKKITVAASPAPHGEVLE
FT                   HAKEEMKKKGYDLEIKVVNDYKVPNKLLDKGDVDANLFQHVPYLNAEKKSHGYKIEEVG
FT                   KVFTTPMGVYSKKYKNIKDIPEGSTIYVSNNPAEEGRFLSFFVNEGLVKIKKGVKIEDA
FT                   KFDDIVENKKHLKFNNQQGAEFLPKTYKSGEGAAVIMNSNYAMDNGLKPSKDAIVMEDK
FT                   SSPFANILAVKEGHKNDKKFQELIKVLQSKDMKHFIEKKYGKDVVPYEAK"
FT   CDS_pept        350120..351073
FT                   /transl_table=11
FT                   /gene="ldh"
FT                   /locus_tag="SCA_0343"
FT                   /product="putative L-lactate dehydrogenase"
FT                   /function="Malate/lactate dehydrogenases"
FT                   /EC_number="1.1.1.27"
FT                   /note="(P14561) L-lactate dehydrogenase P (EC 1.1.1.27)
FT                   (L-LDH P),InterPro: Lactate/malate dehydrogenase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0343"
FT                   /db_xref="GOA:B9DK48"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK48"
FT                   /inference="similar to AA sequence:UniProtKB:P14561"
FT                   /protein_id="CAL27256.1"
FT                   /translation="MTKLGIIGTGRVGSQVLTDAQYLGIFSEIVLIDTNEDLAKGEALD
FT                   HRHLQGLGHTHHVNIYSGTYQDLSDADIVIVSASAPSTPEMADRTLLTRANSLIVHSVF
FT                   QKLSEVTQEAVAILISNPVDAMTLIAQEAGYPAHKVIGTGTNLESSRFRTLIADHYQVD
FT                   PKNVEAFVLGEHGSHAVPIWSRVRIAGIELPEFETLTGSTPIDKKAVSKRIDEVAFEVF
FT                   KKKGWTNSAISRSAVQLAQAILLDEHPIEPVSASVNGEYELTGGALSLLSLIDRNGIVK
FT                   RLPISLNSDELQQLKDAHIFITEAVAQAHKEIENIS"
FT   CDS_pept        351371..351730
FT                   /transl_table=11
FT                   /locus_tag="SCA_0344"
FT                   /product="putative membrane protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0344"
FT                   /db_xref="GOA:B9DK49"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK49"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27257.1"
FT                   /translation="MKTVILWIYVGILTCCLVFLLVLVSNESELAKFQNSVSTFMQGEQ
FT                   VSSNDTKDNGAPPTYSAVAGNDISHQTQSESKQHTEKQNADKTFVISLTSVNLKMSHYL
FT                   LEDLTSQGAQDTRLR"
FT   CDS_pept        351848..352336
FT                   /transl_table=11
FT                   /locus_tag="SCA_0345"
FT                   /product="YbaK family protein"
FT                   /function="uncharacterized conserved protein"
FT                   /note="(P37174) Protein ybaK,InterPro: YbaK/prolyl-tRNA
FT                   synthetase associated region"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0345"
FT                   /db_xref="GOA:B9DK50"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK50"
FT                   /inference="similar to AA sequence:UniProtKB:P37174"
FT                   /protein_id="CAL27258.1"
FT                   /translation="MKQKKTNAMRILENEGIKYDVRTFKMGKEHIEGQEVAELIGASPE
FT                   QVFKTLLFINNNHDPYVFVIPVEGNLNMKHAAQAVGEKKLHLLPLQELTKVTGYIRGGC
FT                   SPVGMKHLYPTVIDASAEQQETIFVSAGHRGVQMEVNVEELAKVTNAKIADVANHHTN"
FT   CDS_pept        352463..353227
FT                   /transl_table=11
FT                   /locus_tag="SCA_0346"
FT                   /product="putative transcriptional regulators of sugar
FT                   metabolism"
FT                   /function="Transcriptional regulators of sugar metabolism"
FT                   /note="(P16644) Lactose phosphotransferase system
FT                   repressor,InterPro: Bacterial regulatory protein DeoR
FT                   family"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0346"
FT                   /db_xref="GOA:B9DK51"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK51"
FT                   /inference="similar to AA sequence:UniProtKB:P16644"
FT                   /protein_id="CAL27259.1"
FT                   /translation="MITEKRFEVIINLLKEKEFLTLQELIKMTGCSASTIRRDLSKLQQ
FT                   QGILQRVHGGATLKTTSLNEPKLSEKQGRNTQEKREIAKIAAAKVEDNDCIYIDAGSST
FT                   YEMVEYITADNIVVVTNGLTHVEPLLKKGFKTIIVGGDVKANTLASVGSKAIETIKRYH
FT                   FDKVFIGMNGVDLEKGLTTPDEQEAYVKETAMKSGAQIYVLIDSSKFAHTYFADVQIPQ
FT                   NKHALLLTSEKALQRQDIKAYRNRFVIEGGQS"
FT   CDS_pept        353224..354144
FT                   /transl_table=11
FT                   /gene="fruB"
FT                   /locus_tag="SCA_0347"
FT                   /product="putative fructose 1-phosphate kinase"
FT                   /function="Fructose-1-phosphate kinase and related
FT                   fructose-6-phosphate kinase (PfkB)"
FT                   /EC_number="2.7.1.56"
FT                   /note="(O31714) 1-phosphofructokinase (EC 2.7.1.56)
FT                   (Fructose 1-phosphate kinase),InterPro: Carbohydrate kinase
FT                   PfkB"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0347"
FT                   /db_xref="GOA:B9DK52"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR022463"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK52"
FT                   /inference="similar to AA sequence:UniProtKB:O31714"
FT                   /protein_id="CAL27260.1"
FT                   /translation="MIYTVTFNPSIDYVMKVDGFTTGGLNRAAATYKFAGGKGINVSRV
FT                   LQTHETTSTALGFIGGFPGKFIKDALEKAEIPTGFIEVDEDTRINVKLKSGNETEINAN
FT                   GPAISEDAFQALLSQIKVTTPEDTVVVAGSVPKSIPDDAYEQIAQITKETGAKLVVDAE
FT                   KHLVEAVLPYHPFFIKPNKDELEVMFDTEIKSDADVVRFGKEILAKGAHAVIVSLGGDG
FT                   AIYIDETHQLKAEVPKGEVVNTVGSGDSTVAGMIAGLEKGMSVKEAFRNAVASGTATAF
FT                   SDDLAEKEMIEAVREKIVLADLEKE"
FT   CDS_pept        354151..356109
FT                   /transl_table=11
FT                   /gene="fruA"
FT                   /locus_tag="SCA_0348"
FT                   /product="putative fructose specific permease"
FT                   /function="Phosphotransferase system fructose-specific IIC
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /note="(P20966) PTS system fructose-specific IIBC component
FT                   (EIIBC-Fru) (Fructose-permease IIBC component)
FT                   (Phosphotransferase enzyme II BC component) (EC 2.7.1.69)
FT                   (EII-Fru),InterPro: PTS fructose IIC component"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0348"
FT                   /db_xref="GOA:B9DK53"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK53"
FT                   /inference="similar to AA sequence:UniProtKB:P20966"
FT                   /protein_id="CAL27261.1"
FT                   /translation="MRITELLTRDTIAMDIDATTKDGVIDTLVDQLDQAGILSDKAAFK
FT                   DAIFAREGQSTTGIGEGIAIPHAKVAAVKKPAIAFGKSKEGVDYQSLDGQPAHLFFMIA
FT                   APEGGAQTHLDALAKLSGILMDDNVREALLHAETPDEVLAIIDKADDEAPNEDEEATVD
FT                   PGVDDKEASENEPYVLGVTACPTGIAHTYMAKDALLKQAKKMGVKMKVETNGSGGIKNR
FT                   LTSEDIEKADGIIVAADVHVETDRFDGKNVVQVPVADGIKRPGELIDLALATDRTPFRA
FT                   KDGHGKGAQGAAGGKTEKQSVGKTIYKHLMNGVSNMLPLVIAGGILMAIAFMFGTNSFD
FT                   PKSSDYNAFAEQLWNIGKNSAFALIIPILAAFIARSIADKPGMAAGLVGGMLAISGDSG
FT                   FIGGIIAGFLAGYLTEGIKVLTRRMPQSLEGLKPTLIYPVLSVTITGLLMIYVFNPPAS
FT                   WINHLLLNGLNSLSGANIMLLGLVIGAMMAIDMGGPFNKAAYVFATAALTEGNAAPITA
FT                   AMVGGMVPPIAIALAMIIFKRKFTKAQRGSIVPNFVMGASFITEGAIPFAAADPLRVIP
FT                   SMMIGSGVAGAIALALGSSIHAPHGGIFVIFGTDWSHSLQTLLAIIVGSVIGALIYGLL
FT                   KRKPTADEIEASESMDD"
FT   CDS_pept        356529..357938
FT                   /transl_table=11
FT                   /locus_tag="SCA_0349"
FT                   /product="predicted membrane protein with CBS domains"
FT                   /function="Hemolysins and related proteins containing CBS
FT                   domains"
FT                   /note="(O07585) Hypothetical UPF0053 protein yhdP,InterPro:
FT                   CBS"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0349"
FT                   /db_xref="GOA:B9DK54"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK54"
FT                   /inference="similar to AA sequence:UniProtKB:O07585"
FT                   /protein_id="CAL27262.1"
FT                   /translation="MDSTTIINLVIFIFLIALTTVFVGSEFALVKVRATKIEEMIAEGN
FT                   GSAKVVKKMITNLDYYLSACQLGITVTSLGLGWLGEPVFEKLLHPLFVLLPLPDALNAT
FT                   ISLIVSFLVVTYLHVVIGELAPKSFAIQHTERVALLYARPLYYFGLIMKPLIWLMNGSA
FT                   RMIIRIFGIDPDENNDAMSEEEIKMIINNSYNSGEINQTELAYMQNIFSFDERQAKDVM
FT                   VPRTQMATLNEPFTVNELLETIREYQFTRYPITEDGDKDHIKGFINVKEFLTEYASGKP
FT                   IKISNYIHELPLISETTRISDALIRMQRERVHISLIIDEYGGTAGILTMEDILEEIVGE
FT                   IRDEFDENEVNDVVKLGENTYQINGRVLLEDLTDEFGIEFEDSDDIDTIGGWLQAHNTN
FT                   LQQNDYVDTFYDRWIISEVDNHQIITVILKYEYNEERKEEIEEDSDDDKNHKDKHHKDK
FT                   KEKKDRKDKED"
FT   CDS_pept        358107..358535
FT                   /transl_table=11
FT                   /locus_tag="SCA_0350"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0350"
FT                   /db_xref="InterPro:IPR019545"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK55"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27263.1"
FT                   /translation="MKPSHLIATASLTAALILGGCGNKEKEEKHEHDNKTEEHQHSNKS
FT                   HKTLTGKFKSGEEHVEGNAKIENGKIMLTDFKSAKGPDLYVYLTKDGNIKEGKQLEMVD
FT                   YNKPEQTFDIQGADLDKYNEVTIYCKKAHVIFGAAKVK"
FT   CDS_pept        358612..359091
FT                   /transl_table=11
FT                   /locus_tag="SCA_0351"
FT                   /product="putative membrane protein"
FT                   /function="predicted membrane protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0351"
FT                   /db_xref="GOA:B9DK56"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK56"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27264.1"
FT                   /translation="MKNYKDIIQYIIIFIIRVGSGGYILVQGWEKLTGGFTINGLIPVV
FT                   IKNEDSLEWFKFFFEHVVAHTAGIFNIVVPLGEIAIGLGLLFGIMSQIASFFGAFVMLN
FT                   YILSDMIFTYLVQLAFFIILLMNPVILKKISLKAMILYIREKGDYKHEPHPTRRR"
FT   CDS_pept        359063..359596
FT                   /transl_table=11
FT                   /gene="saeR'"
FT                   /locus_tag="SCA_0352"
FT                   /product="truncated response regulator saeR (fragment 1)"
FT                   /function="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /note="(P39663) Alkaline phosphatase synthesis
FT                   transcriptional regulatory protein sphR,InterPro: Response
FT                   regulator receiver,Similar to N-terminal part (aa 1-178) of
FT                   saeR protein [Staphylococcus aureus] (CAD89114): 228 aa"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0352"
FT                   /db_xref="GOA:B9DK45"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK45"
FT                   /inference="similar to AA sequence:UniProtKB:P39663"
FT                   /protein_id="CAL27265.1"
FT                   /translation="MNHILLVDDEKDIVDICQTYFEYEGYTVTTASNGEEALQHLDDSI
FT                   DLIVLDIMMPELNGYDVVKEMKLRQLDIPFIYLSAKTQEQDTIYALTLGADDYMTKPFS
FT                   PRELVLRANNLLNRVQKCMNLQSCLKFGALELNDTQKRALIYDEPVNLRIKEFELLWYL
FT                   GKHENEVISKSELI"
FT   CDS_pept        <359597..>359746
FT                   /transl_table=11
FT                   /gene="saeR''"
FT                   /locus_tag="SCA_0352A"
FT                   /product="truncated response regulator saeR (fragment 2)"
FT                   /note="Similar to C-terminal part (aa 179-228) of saeR
FT                   protein [Staphylococcus aureus](CAD89114): 228 aa"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0352a"
FT                   /db_xref="GOA:B9DK33"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK33"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27266.1"
FT                   /translation="EVWQYDYYEDVNTVNVHIHRLREKFEQFNYRDYTIKTVWGLGYTF
FT                   ERNQI"
FT   CDS_pept        359749..360783
FT                   /transl_table=11
FT                   /gene="saeS"
FT                   /locus_tag="SCA_0353"
FT                   /product="histidine protein kinase SaeS"
FT                   /function="Signal transduction histidine kinase"
FT                   /note="(Q93CB7) Sensor histidine kinase mtrB (EC
FT                   2.7.3.-),InterPro: Histidine kinase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0353"
FT                   /db_xref="GOA:B9DK34"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK34"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27267.1"
FT                   /translation="MFSIRTQVIIGVLSSILLASTILGMAYKLMVFNGHTTALLTISAI
FT                   ISSCLALLICSLFLTPLVKRIKVFNRKTKEFANGNYKMEPINFKSPREIKELSHSFNKM
FT                   AKEITEQMAQIKTEQQEKYELIQNLAHDLKTPLSCIISYSEGLKEGIIAAPKDRDAAYE
FT                   SLIKQSKRLSNMFDELTNVAALELPNKDSIEMIQIDQLLITILSGYEQRMKLDLRNLEV
FT                   NFCSQLEPFKQYPRPLERILTNLIDNALKFSPTGSPVNLTLSENGERIEISVQDEGIGI
FT                   QPEHLPRLFERTFRVEHSRNNETGGSGLGLYIANELAKQIGGTINVESTPEVGTKMTVS
FT                   IPRL"
FT   CDS_pept        complement(360836..361528)
FT                   /transl_table=11
FT                   /gene="scdA"
FT                   /locus_tag="SCA_0354"
FT                   /product="cell division and morphogenesis-related protein"
FT                   /function="Regulator of cell morphogenesis and NO
FT                   signaling"
FT                   /note="InterPro: Protein of unknown function HHE"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0354"
FT                   /db_xref="GOA:B9DK35"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR019903"
FT                   /db_xref="InterPro:IPR023551"
FT                   /db_xref="InterPro:IPR038062"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DK35"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27268.1"
FT                   /translation="MISKSDIVANVVTDYPKTADVFKRSGIDFCCGGQVSIEEAAEEKK
FT                   KISLDDLLNELETVRKQDNSADGLNPKYLSIPSLIQYIQDAYHKPMKEEFKNLTPYVTK
FT                   LAKVHGPNHPYLLELKELYTTFKNNMLEHTEKEDNEDFPQLIAFAEGKDIKNINAIIQD
FT                   LKSDHDNTGVILRKMAELTNNFQPPAEACGTWRLVYTRIVALENATLQHVHLENHVLFE
FT                   KCLEKENS"
FT   CDS_pept        complement(361849..362685)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0355"
FT                   /product="Aldo/keto reductase family protein"
FT                   /function="Aldo/keto reductases related to diketogulonate
FT                   reductase"
FT                   /note="(Q8XBT6) 25-diketo-D-gluconic acid reductase A (EC
FT                   1.1.1.274) (25-DKG reductase A) (25-DKGR A) (25DKGR-A)
FT                   (AKR5C),InterPro: Aldo/keto reductase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0355"
FT                   /db_xref="GOA:B9DK36"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK36"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27269.1"
FT                   /translation="MKKTMKLNNDLKIPRIGFGVYKIDENHMDPAVKVAEKAGYRSFDT
FT                   AYIYKNEHELGEALKKGDIPREKLFITTKIWNDFQGYESTKEQFKASLERLGTDYLDLY
FT                   LIHWPCEADGLFIETYKAMEELYKEGLIKAIGVCNFEQHHLEKLMAETEIVPAVNQIEC
FT                   HPYLSQQPLQDFCDQHDIKVTAWMPLMRGRGLFEDPVIEKLAEKYEKTPAQIILNWHLC
FT                   HGRIVIPKSQTPSRIYENFDAIKFELRDKDVKKIDALNKNLRQGKHPDDVKIGTLK"
FT   CDS_pept        complement(362914..363168)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0356"
FT                   /product="putative membrane protein"
FT                   /function="predicted membrane protein"
FT                   /note="InterPro: Transglycosylase-associated protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0356"
FT                   /db_xref="GOA:B9DK37"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK37"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27270.1"
FT                   /translation="MGFIVMLIVGGLIGWLAGAILGKDIPGGIIGNIIAGIVGAWLGSA
FT                   IFGHWGPSFGGISIFPALIGTIILVAIVSFIFGAMRKRK"
FT   CDS_pept        complement(363272..363853)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0357"
FT                   /product="putative membrane protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0357"
FT                   /db_xref="GOA:B9DK38"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK38"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27271.1"
FT                   /translation="MLIYIIINILIIISAIVIDMWLHTFRQLRLSTLLIALTINSVINI
FT                   WVIGKYDFISFSIIAFILIWTVLALLTDWKLHPIVFETQKFAAFIIFTLMSVSFFIIFN
FT                   TSEDSYYMSIPYLSPVFFLMGASLLFLSIFQNSDAEKNNSSKKLRNKLTIGTILIVLSF
FT                   MVTTLLTLFWYIFVVIYLILIAFILWMKIF"
FT   CDS_pept        complement(364011..364724)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0358"
FT                   /product="putative organic radical activating enzyme"
FT                   /function="Organic radical activating enzymes"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0358"
FT                   /db_xref="GOA:B9DK39"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017742"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK39"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27272.1"
FT                   /translation="MAKIPVLEIFGPTIQGEGRVIGRKTMFVRTAGCDYHCSWCDSKFT
FT                   WDGSAKDQIEMMTAEEIYHQLKEVGGDYFNHVTISGGNPALIKGIQELVDLFEDKNIET
FT                   ALETQGSRYQPWMRQINDLTISPKPPSSGMKPNLEILDDVIAQCVLESLNLKVVIFEDK
FT                   DFEFAKEIHHRYPSIPFYLQVGNPYLEDEVENHTERLLKRYENLVETVMVSSEMNDVYV
FT                   LPQLHTLLWSNKKGV"
FT   CDS_pept        complement(364717..365142)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0359"
FT                   /product="putative 6-pyruvoyltetrahydropterin synthase"
FT                   /function="6-pyruvoyl-tetrahydropterin synthase"
FT                   /EC_number="4.2.3.12"
FT                   /note="(Q46903) Putative 6-pyruvoyl tetrahydrobiopterin
FT                   synthase (EC 4.2.3.12) (PTPS) (PTP synthase),InterPro:
FT                   6-pyruvoyl tetrahydropterin synthase and hypothetical
FT                   protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0359"
FT                   /db_xref="GOA:B9DK40"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK40"
FT                   /inference="similar to AA sequence:UniProtKB:Q46903"
FT                   /protein_id="CAL27273.1"
FT                   /translation="MLQQIYPSVSHPYAFELNKDFHFAAAHYIPCEDAGKCVRTHGHTY
FT                   FVNLTIVGNELDHSGFLINFAYLKKQIHEQFDHYLLNDLPQFKDKMPSTEIVAQTIYKM
FT                   TEEILEKQPNHPKCAQVYLRETPSSYVVYKGKEFRYG"
FT   CDS_pept        complement(365144..365815)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0360"
FT                   /product="putative ExsB family protein"
FT                   /function="predicted PP-loop superfamily ATPase"
FT                   /note="(P77756) Hypothetical protein ybaX,InterPro: ExsB"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0360"
FT                   /db_xref="GOA:B9DK41"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK41"
FT                   /inference="similar to AA sequence:UniProtKB:P77756"
FT                   /protein_id="CAL27274.1"
FT                   /translation="MASHTLDDNKALVVFSGGQDSTTCLFYAKEKFEEVELVTFQYGQR
FT                   HDTEIEVAKKIADEQGLKHHILDMSLLSQLTPNALTQHNLEIEQTDDGVPNTFVPARNL
FT                   LFLSFAGALAYQIKARHIITGVCETDFSGYPDCRDDFVKSMNVTLNLSMDKNFVIHTPL
FT                   MWLDKKETWALSDQLGVLDYVRNQTLTCYNGIIADGCGECPACKLRARGLNAYLEEKGV
FT                   K"
FT   CDS_pept        366157..366744
FT                   /transl_table=11
FT                   /locus_tag="SCA_0361"
FT                   /product="glutamine amidotransferase class-I protein"
FT                   /function="Anthranilate/para-aminobenzoate synthases
FT                   component II"
FT                   /EC_number="4.1.3.27"
FT                   /note="(P06193) Para-aminobenzoate synthase glutamine
FT                   amidotransferase component II (EC 6.3.5.8) (ADC
FT                   synthase),InterPro: Glutamine amidotransferase of
FT                   anthranilate synthase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0361"
FT                   /db_xref="GOA:B9DK42"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK42"
FT                   /inference="similar to AA sequence:UniProtKB:P06193"
FT                   /protein_id="CAL27275.1"
FT                   /translation="MIIMIDNKDSFTYNIVDYLTVESESEIKVLDSKELTLSQLKAMQP
FT                   SALVISPGPGRPSDYPVLRQILEEYEKKIPILGVCLGFQFLIEHYGGNIVPNFRPVHGH
FT                   TTCITNTGEGIFEGLPTSFEVMRYHSLMADAESVPNVLKVTATNDENIVMGIQHKQYPI
FT                   YGVQYHPESILSEYGHEQIRLFLQKAGEIVAS"
FT   CDS_pept        366734..367879
FT                   /transl_table=11
FT                   /locus_tag="SCA_0362"
FT                   /product="putative chorismate binding protein"
FT                   /function="Anthranilate/para-aminobenzoate synthases
FT                   component I"
FT                   /EC_number="2.6.1.85"
FT                   /note="(P32483) Para-aminobenzoate synthase (EC 6.3.5.8)
FT                   (P-aminobenzoic acid synthase) (PABA synthase),InterPro:
FT                   Anthranilate synthase component I and chorismate binding
FT                   protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0362"
FT                   /db_xref="GOA:B9DK43"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK43"
FT                   /inference="similar to AA sequence:UniProtKB:P32483"
FT                   /protein_id="CAL27276.1"
FT                   /translation="MLAKFNFRYYEDEAEYKDYQFDFTAIKTQCVAYSLEDVKKVLDFA
FT                   EQYQEKGNYVALYLPYEAAPAFNSDMEVNFSKESSNIYAAAYVFDSPSKSNELHNKQSD
FT                   SQTKLDFKFRLPDDMLQAHIQAVQQAIVEGNTYQVNYTTRLYDEIRLPITDLYVHLTRH
FT                   AHGNYTVLLDTAELQVASISPELFFQKGRFKEQENVVLSKPMKGTMPRGHNEADDHMLY
FT                   EKLMYSSKDRAENVMIVDLLRNDIARIAKPGSVKVYQPFHIEVYETVYQMTSMVVGTMK
FT                   ENTSLVSLFEALFPCGSITGAPKINTMRYIKQLEEIPRHVYCGTIGLLLPNGKAIFNVA
FT                   IRTVQYINGRAMYGVGAGITIDSNPEAEVAEFKSKTKILEQ"
FT   CDS_pept        367882..368490
FT                   /transl_table=11
FT                   /locus_tag="SCA_0363"
FT                   /product="putative 4-amino-4-deoxychorismate lyase"
FT                   /function="Branched-chain amino acid
FT                   aminotransferase/4-amino-4-deoxychorismate lyase"
FT                   /EC_number="4.1.3.38"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0363"
FT                   /db_xref="GOA:B9DK44"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK44"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27277.1"
FT                   /translation="MYLFETMRVEAGDIPRNIYHTKRIANSAEQLNFQFNKKEWDNYLD
FT                   NICQQHTEGLWRLKVMLGQDGTLTHQIVKLPDKQQFSARFECIDAQFPDWQYTNKTSER
FT                   EHVTHDHETDTVLYYDTNGKILEFDIGNVVVEESGNWYTPPFENDFLKGCMRQALLDEG
FT                   KLQLRSYQLDELNEKLKRGRAQIFLINSLREVADIQINL"
FT   CDS_pept        368771..369466
FT                   /transl_table=11
FT                   /locus_tag="SCA_0364"
FT                   /product="putative allophanate hydrolase subunit 1"
FT                   /function="Allophanate hydrolase subunit 1"
FT                   /EC_number="3.5.1.54"
FT                   /note="(P60495) Kinase A inhibitor (Sporulation inhibitor
FT                   kipI),InterPro: Protein of unknown function DUF213"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0364"
FT                   /db_xref="GOA:B9DK32"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK32"
FT                   /inference="similar to AA sequence:UniProtKB:P60495"
FT                   /protein_id="CAL27278.1"
FT                   /translation="MKIYSQGDQAIVVSVEKEVTQDTTEDLLALRSYLIEQDYPFITEI
FT                   VPTESDMMIVYDARSMIKHHHIKSPFQYMKELLQSIKIEVKHGESVNMPTEIPMIYGGE
FT                   YGPDLEDLLEFYNLDKEEFIKLHSQKTYFVSMMGYSPGFPYLTGMNERLYINHTVDGKK
FT                   FIPAGSVILEGKKCGIVTTDTYGDWIVIGYTPVKLFDPSKEDFTLLKLGDTVRFKPTDS
FT                   DFEKIGGEA"
FT   CDS_pept        369466..370470
FT                   /transl_table=11
FT                   /locus_tag="SCA_0365"
FT                   /product="putative allophanate hydrolase subunit 2"
FT                   /function="Allophanate hydrolase subunit 2"
FT                   /EC_number="3.5.1.54"
FT                   /note="(P75745) Hypothetical protein ybgK,InterPro: Urea
FT                   amidolyase-related"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0365"
FT                   /db_xref="GOA:B9DK15"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK15"
FT                   /inference="similar to AA sequence:UniProtKB:P75745"
FT                   /protein_id="CAL27279.1"
FT                   /translation="MTIIIEDPGLFSSFQDFGRQGYEHDGVIPGGALDFLAHEVANRLV
FT                   ANDKNEATLEMTMKMARIRFTEPTLIALSGGNFKAWTQNMRILPNKLYLVEKGDVLQFA
FT                   ESNRTSRVYLAIGGGVELEEWLDSTSTDFLSKIGGYEGRKLQAGDAINMKRDYTQRHMK
FT                   LFDNLKHTHKTNWGVDGYALSFNYMSDMFHVVLNKGSEDFDEDTLNRFTRGEYKVTSKA
FT                   NRAGMILEGEPVKAYYEDMPPHQSVKRGTIQVKRDGSPIILLNDHYTLGSYPQIGTIAS
FT                   YHLTKLAQKPQGSRLKFQYIDVYTAEDNLMKYSSWVQQLFHGIEYRMMQEMQK"
FT   CDS_pept        371112..373052
FT                   /transl_table=11
FT                   /locus_tag="SCA_0366"
FT                   /product="putative membrane-bound sulfatase"
FT                   /function="Phosphoglycerol transferase and related proteins
FT                   alkaline phosphatase superfamily"
FT                   /note="(P54496) Hypothetical protein yqgS,InterPro:
FT                   Sulfatase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0366"
FT                   /db_xref="GOA:B9DK16"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012160"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK16"
FT                   /inference="similar to AA sequence:UniProtKB:P54496"
FT                   /protein_id="CAL27280.1"
FT                   /translation="MSLQKKKISIFGFFILTLITLSLKTYFAYYVDFSLGVKGLVQNLI
FT                   LLMNPYSLIALVLSVFLFFKGKKAFWFMFVGGFLLTFLLYANVVYFRFFSDFLTFSTLN
FT                   QTGNVESMGGAVSASFKWYDFVYFIDTIVYLFILVFKSKWLSTRAFSKKFVPVVMAVSV
FT                   ALFFLNLAFAETDRPELLTRTFDHKYLVKYLGPYNFTIYDGVKTIQNNQEKALASEDDL
FT                   TKVLNYTKQKQTQPNPEYYGVAKKKNIIKIHLESFQTFLINKKVNGKEVTPFLNKLSSG
FT                   NDEFRYYPNFFHQTGQGKTSDAEFTMDNSLYGLPQGSAYSLKGSNTYQSLPAILDQKEG
FT                   YNSNVMHGDYKTFWNRDQIYKHFGIDKFYDATYYDMSPNNIENLGLKDMPFFKASADYQ
FT                   SKMKQPFYSHLITLTNHYPFTLSSEDADIEKPNTGDSTVDGYVQTANYLDRSLEQYINE
FT                   LKEKGLYKNSVIIIYGDHYGISENHNKAMEKLLGEDITPAKFMDLNRTGLWMKIPGKPG
FT                   GVDHTYGGQVDVMPTLLHLVGIDSKNYLMMGTDLLSKDHSQLVPFRNGDFITPKYKYVN
FT                   GKAYDNKTNQPLTKEPADLQKNKQQVEKDLEMSDNVLNGDLFRFYKNPDFKKINPSKYQ
FT                   YKTGPKGSEQK"
FT   CDS_pept        373321..375192
FT                   /transl_table=11
FT                   /locus_tag="SCA_0367"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /function="ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /note="(P43672) ABC transporter ATP-binding protein
FT                   uup,InterPro: ABC transporter"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0367"
FT                   /db_xref="GOA:B9DK17"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK17"
FT                   /inference="similar to AA sequence:UniProtKB:P43672"
FT                   /protein_id="CAL27281.1"
FT                   /translation="MESYKIEHLHKSYADKVIFDDLHLSVSEHERIGLVGINGTGKSTL
FT                   LKVIAGLDDDFEAEVNCPNQYRIRYSSQKQDLNEDKTVLDEVLSADTTAVKIIKNYETA
FT                   VQKYSETQSDADFQKMMNAQEAMDQAEAWDYSAEVKTILSKLGINDTAQSVKALSGGQQ
FT                   KRVVLAKTLIEQPDLLLLDEPTNHLDFDSIKWLINYVKQYPHTVLFVTHDRYFLNEVSR
FT                   RIVELDRGKLRTYPGNYEDYIVMRAENEQIEQQQNQKQRALYKQELSWMRAGAKARSTK
FT                   QQARINRFSDLESQVKNQTTKDTGQLNLAHSRLGKQVFELEDLSKSIEGKTLFEHVTQI
FT                   IQNGQQIGIVGPNGAGKTTLLNILAGEDTDYSGVVKIGQTVKTAYFKQTDERLDRDIRV
FT                   IDFLREESEVAKEKDGTTVSVTQLLERFLFPSSTHGKKVYKLSGGEQKRLYLLRLLVHQ
FT                   PNVLLLDEPTNDLDTETLTILEDYISTFGGTIITVSHDRYFLNKVAQEFWYVHDGQIER
FT                   IIGNFEDYEVYKEEQEKAKEAAKQLPKQVKERQRKGLSYKEKREYETVMERIEEAEIRL
FT                   EEIEQEMVDASDDYTKIQTLNSEKETLESQYDQDMTRWSELEELKEQ"
FT   CDS_pept        375205..376983
FT                   /transl_table=11
FT                   /gene="recQ"
FT                   /locus_tag="SCA_0368"
FT                   /product="DNA helicase recQ"
FT                   /function="Superfamily II DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="(P15043) ATP-dependent DNA helicase recQ (EC
FT                   3.6.1.-),InterPro: ATP-requiring DNA helicase RecQ"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0368"
FT                   /db_xref="GOA:B9DK18"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK18"
FT                   /inference="similar to AA sequence:UniProtKB:P15043"
FT                   /protein_id="CAL27282.1"
FT                   /translation="METILSHYFGYQTFRPGQKEIISKILEKQNVLGVLPTGGGKSLCY
FT                   QVPGLMMGGVTVVISPLISLMKDQVDQLKAMGINAAYLNSSLSQKDQKAIEAELRKGEI
FT                   QFLYIAPERFENNQFMKLLYGLDIKLVAFDEAHCISKWGHDFRPSYQQVIDKVMCLPQN
FT                   FAVAALTATATAEVQQDIMERLHIAQGDMVKTSIKRPNLKFKVNSTYQRQKFVLEYVKE
FT                   HKDKAGIIYCSTRKQVEELQQVFEDQKINSAIYHAGLTNKEREAAQNDFVFDKTKVVIA
FT                   TNAFGMGIDKSNVRFVIHYNMPGDLESYYQEAGRAGRDGLESDCILLYSERDIGLHQFF
FT                   IASSKADDDYKEKMGEKLNKMIQYTKTKKCLEATLVHYFEPNEKLEECGRCSNCVNENK
FT                   TYDMTDEAKKIISCIVRMRQQETYGVIIQVLRGETSDYVKYNQYDELSTFGIMKSYTTS
FT                   ECSHLIDELRFKGFLNENDEVLTCDKKVKKVLSEGLKIYTVPFKRKAKEKVNINTIEGV
FT                   DRALFDELVEVRKTLSETLNIAPISIFTDFTLEEFAKRKPESKQEMIAIDGVGSYKLKH
FT                   YCPKFIETIHNYKAQV"
FT   CDS_pept        377083..378039
FT                   /transl_table=11
FT                   /gene="opuBA"
FT                   /locus_tag="SCA_0369"
FT                   /product="putative ATPase component of ABC-type
FT                   proline/glycine betaine transporter"
FT                   /function="ABC-type proline/glycine betaine transport
FT                   systems ATPase components"
FT                   /note="(Q45460) Choline transport ATP-binding protein
FT                   opuBA,InterPro: ABC transporter"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0369"
FT                   /db_xref="GOA:B9DK19"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK19"
FT                   /inference="similar to AA sequence:UniProtKB:Q45460"
FT                   /protein_id="CAL27283.1"
FT                   /translation="MIEFKHVSKKYGNKIAVDDVSFKINEGEFFVLIGPSGCGKTTTLK
FT                   MINRLIPLTEGYIYFKDSPISDYPVYEMRWDIGYVLQQIALFPHMSVKENIAQVPQMKG
FT                   WDKDRIDQRVDELLKMVNLDPDTYRDRKPDELSGGQRQRVGVVRALAADPPVILMDEPF
FT                   SALDPISRTKLQDDLIELQKQIKKTIVFVTHDIDEAMKLGDRICLLNEGHVEQIDTPEY
FT                   FINHPKNDFIKQFISQYDRNVQQQLKLDDVLENTELKSLQSTQDLPVVQHDTPLKKVYE
FT                   DLARYNAVAVERDGKTHMLTREDVFNFLADSERGDAS"
FT   CDS_pept        378036..379550
FT                   /transl_table=11
FT                   /gene="opuAC"
FT                   /locus_tag="SCA_0370"
FT                   /product="putative substrate binding component of ABC-type
FT                   glycine betaine transporter"
FT                   /function="Periplasmic glycine betaine/choline-binding
FT                   (lipo)protein of an ABC-type transport system
FT                   (osmoprotectant binding protein)"
FT                   /note="(Q45462) Choline-binding protein precursor,InterPro:
FT                   Substrate-binding region of ABC-type glycine betaine
FT                   transport system"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0370"
FT                   /db_xref="GOA:B9DK20"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK20"
FT                   /inference="similar to AA sequence:UniProtKB:Q45462"
FT                   /protein_id="CAL27284.1"
FT                   /translation="MNAFLETLSTRKGELLSTLLEHIQISFIALLIACLIGVPLGIFLT
FT                   KTKYISEFVINIAAVLQTIPSLALLGLMIPIFGIGTLPAIIALVVYALLPILRNTYTGI
FT                   KEVDPSLVEAAKGIGMKPGRRLTKVELPIAMPIIMAGIRTAMVLIIGTATLAALIGAGG
FT                   LGDLILLGIDRNNSSLILLGAIPAAILAIVFDLALRYIQKLSYKKILITLGALLIIVVL
FT                   VIVIPLFGGKGDKVTIAGKLGSEPSIITNMYKILIEEETDDTVDVKDGMGKTSFLFNAL
FT                   KSDDIDGYLEFTGTVLGELTKEPLKSKEEHKVYEQAKTSLEKKDKMTLLKPMKYNNTYA
FT                   LAVKRDFAEKHHLKTIGDLEKVEDEIKPGFTLEFNDRPDGFKAVSKAYDLHFNKIRTME
FT                   PKLRYQAVKKGDINLIDAYSTDAELKQYDMVVLKDDKHVFPPYQGAPLFKEKYLKEHPE
FT                   IKKPLNKLAGKITDEEMQEMNYKVTVKNEDPYKVAKDYLKRHHLIK"
FT   CDS_pept        380128..381192
FT                   /transl_table=11
FT                   /gene="hisC"
FT                   /locus_tag="SCA_0371"
FT                   /product="putative histidinol-phosphate aminotransferase"
FT                   /function="Histidinol-phosphate/aromatic aminotransferase
FT                   and cobyric acid decarboxylase"
FT                   /EC_number="2.6.1.9"
FT                   /note="(Q8NXN3) Histidinol-phosphate aminotransferase (EC
FT                   2.6.1.9) (Imidazole acetol-phosphate
FT                   transaminase),InterPro: Histidinol-phosphate
FT                   aminotransferase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0371"
FT                   /db_xref="GOA:B9DK21"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DK21"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27285.1"
FT                   /translation="MKEQIQQLSAYQPGLSPRALKKEFGLDIDLHKLASNENLYGPSPK
FT                   AKEAIKEHVDEVLYYPETGAPTLRKKIADTLNIDENRILFGAGLDEVILMISRAVLTPG
FT                   DKIVTSQATFGQYYHNAIVESAEVVQVPLKENGQFDLDGILNEIDEDTALVWICNPNNP
FT                   TGTYVTHEELEAFLEKVPSNVPVLVDEAYFEFVTADDFPDTLKLQEKFPNAFLMRTFSK
FT                   AYGLAGLRVGYVIATKEAIHNYNIIRPPFNVGRLSEYAAVAAFEDQDYLKEIQKRNAEE
FT                   RAKFFEIPESKHFFDSQTNFIFVNTKRPKELYEALLKVGCITREFPIGVRITIGFPEQN
FT                   DKMIEVLKNFDFEA"
FT   CDS_pept        381349..381648
FT                   /transl_table=11
FT                   /locus_tag="SCA_0372"
FT                   /product="truncated putative 5(3)-deoxyribonucleotidase
FT                   (fragment 1)"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /note="(Q99VP8) Putative 5(3)-deoxyribonucleotidase (EC
FT                   3.1.3.-)"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0372"
FT                   /db_xref="GOA:B9DK22"
FT                   /db_xref="InterPro:IPR010708"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK22"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27286.1"
FT                   /translation="MERESIAIDMDEVLADTIKALIEGVNTRTDLGIKEALLDGNKLRH
FT                   FMPEYEGVLDEVLKEPGFFRNLEVIQDSQEVVEKLSKHYDIYCYSCYGCTNIVS"
FT   CDS_pept        381623..381889
FT                   /transl_table=11
FT                   /locus_tag="SCA_0373"
FT                   /product="truncated putative 5(3)-deoxyribonucleotidase
FT                   (fragment 2)"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /note="(Q99VP8) Putative 5(3)-deoxyribonucleotidase (EC
FT                   3.1.3.-)"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0373"
FT                   /db_xref="GOA:B9DK23"
FT                   /db_xref="InterPro:IPR010708"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK23"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27287.1"
FT                   /translation="MDVPTSFHEKYEWLRMHFPFLDPQNFVFCGRKNIVKADYLIDDNP
FT                   RQLERFTGKSLMYTAAHNIHNEDFDRLNNWKEVEKYFLGNEEI"
FT   CDS_pept        complement(382067..383569)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0374"
FT                   /product="putative proton-dependent oligopeptide
FT                   transporter"
FT                   /function="Dipeptide/tripeptide permease"
FT                   /note="(P94408) Hypothetical transporter yclF,InterPro:
FT                   Amino acid/peptide transporter"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0374"
FT                   /db_xref="GOA:B9DK24"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR005279"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK24"
FT                   /inference="similar to AA sequence:UniProtKB:P94408"
FT                   /protein_id="CAL27288.1"
FT                   /translation="MQNNLHNQHVQEIPQKGFFGHPRGLGVLFFVEFWERFSYYGMRAL
FT                   LIFYMFYAIKDGGLGMDEVTAQSVMSIYGSLIFMTTIIGGWIADRITGTRGATMYGAVL
FT                   IIVGHVVLSLPLADIGLFVSMFFIIIGSGLMKPNISNIVGRLYPENDSRIDSGFVIFYM
FT                   AVNMGALVAPLVLNQFSDNHKFHQGFLIAAIGMAVALVIYLIFNKRNLGDVGLAPTNPL
FT                   SSTEKKRYGIIFGAIAALIAIVLVITISTGTFSFDLISTTVLILGVALPIIYFTIMIRS
FT                   KEVSDDERSRVISFIPLFIIGVIFWSIQEQGSNVLNIFAFKGTDMTINLFGWTSSFGKT
FT                   YFQSINPLFIVLLGPVISYIWKKMGERQPSLATKFVWGAVLAGISYIMIAFVMMGSNGH
FT                   QITVNWVILSYIICVIGELCISPTGNSAAVKLAPKAFNSQMMSLWLLTNATAQAINGTL
FT                   VKLIKPLGYQNYFLFLGCLAVVIGLITLAFVPKIVKGMRGLR"
FT   CDS_pept        complement(383798..385318)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0375"
FT                   /product="putative di-/tripeptide transporter"
FT                   /function="Dipeptide/tripeptide permease"
FT                   /note="(P94408) Hypothetical transporter yclF,InterPro:
FT                   Amino acid/peptide transporter"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0375"
FT                   /db_xref="GOA:B9DK25"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR005279"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK25"
FT                   /inference="similar to AA sequence:UniProtKB:P94408"
FT                   /protein_id="CAL27289.1"
FT                   /translation="MNKKQYTREEVVNSIPRTGFFGHPKGLSTLFFTEFWERFSYYGMK
FT                   AILVYYLYYSVAKGGFGLDESVAMQIVALYGTLIYMSGVIGGWIADRITGTQNAVFFGG
FT                   IFIMFGHIILSLPGSLTAVMIALLLLIIGTGLLKPNISTTVGELYEKNDPRVDSAFTIF
FT                   YMGINAGALLSPLITGYLQTRVGFHAGFATAAIGMFIGLVLYWTKRKKYLNLAGLTVHN
FT                   PMTKSDVKKFSLITIIVVVAFVLYLVILKAFNALTIENFSLLVTILGIALPVYIVTRML
FT                   MSKEATPEEKSRVRSYIPLYITSVAFWMIQEQGSTILANFADKNTQLKMSELTGGAIHF
FT                   DIPAAWFQSLNPIFIVALAPVFATLWVKLGKRNPSTVMKFAIGAIIAGLSYLIMMIPLA
FT                   GGLHRELINPIWLVLSFLLITIGELCISPVGLATTTKLAPYAFTAQMMSLWMLSNATAQ
FT                   GLNAQLVVVYKTMNPSQYFMYSGLLTIIIGVLLIIVSPMVKRAMKGIH"
FT   CDS_pept        complement(385483..385986)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0376"
FT                   /product="putative GTP cyclohydrolase I"
FT                   /function="Enzyme related to GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="(Q46920) Hypothetical protein yqcD,InterPro: GTP
FT                   cyclohydrolase I"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0376"
FT                   /db_xref="GOA:B9DK26"
FT                   /db_xref="InterPro:IPR016856"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK26"
FT                   /inference="similar to AA sequence:UniProtKB:Q46920"
FT                   /protein_id="CAL27290.1"
FT                   /translation="MSNEGRKKEELEDITLLGNQNNTYNFDYRPDVLETFENKHQGRDY
FT                   FVKFNCPEFTSLCPITGQPDFATIYISYIPNIKMVESKSLKLYLFSFRNHGDFHEDCMN
FT                   IIMNDLIDLMDPHYIEVWGKFTPRGGISIDPYTNYGRPDSKYEQMAEYRMMNHDLYPET
FT                   IDNR"
FT   CDS_pept        complement(385989..386879)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0377"
FT                   /product="putative permease"
FT                   /function="Permeases of the drug/metabolite transporter
FT                   (DMT) superfamily"
FT                   /note="(Q07835) Hypothetical transport protein
FT                   yxxF,InterPro: Protein of unknown function DUF6"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0377"
FT                   /db_xref="GOA:B9DK27"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK27"
FT                   /inference="similar to AA sequence:UniProtKB:Q07835"
FT                   /protein_id="CAL27291.1"
FT                   /translation="MDPKIKGIIAILISAIGFSFMSLFFRLSGDLPVFQKSLARNLVAM
FT                   LIPLYFLYKYKQPMFGKLSSQPLLITRSTLGLVGVLLNIYAIDHMLLSDADTLMKLNPF
FT                   WTILLSLVFLHEKVRKYQVTAMVVAIIGMLFVVQPQFSSAMIPAIGGLFSGIFAAAAYT
FT                   CVRALSTREAPYTIVFYFSFFSIVALIPFVIFTYEPMSGMQIIYLIGAGLSAAVGQIGI
FT                   TLAYSYAPARDISIFTYASIIFTAIMGIVIFGESPDLYATLGYVIIISASYYMFEKARR
FT                   QGRKNKPARAHKGGN"
FT   CDS_pept        387760..388152
FT                   /transl_table=11
FT                   /gene="nrdI"
FT                   /locus_tag="SCA_0378"
FT                   /product="NrdI protein"
FT                   /function="Protein involved in ribonucleotide reduction"
FT                   /note="(Q8Z4E6) NrdI protein,InterPro: NrdI"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0378"
FT                   /db_xref="GOA:B9DK28"
FT                   /db_xref="InterPro:IPR004465"
FT                   /db_xref="InterPro:IPR020852"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DK28"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27292.1"
FT                   /translation="MKVVYFSFTGNVRRFIARSGFENTLEITNDNCAEVRIDEPYILVT
FT                   STIGFGEVPDVVQTFLRHNGTMIRGVVGSGNRNWGQNFAKASDTISKDYMVPLLMKFEV
FT                   QGTKKDVEEFKDKVGHFYEDNERKAI"
FT   CDS_pept        388133..390229
FT                   /transl_table=11
FT                   /gene="nrdE"
FT                   /locus_tag="SCA_0379"
FT                   /product="ribonuceloside diphosphate reductase alpha chain"
FT                   /function="Ribonucleotide reductase alpha subunit"
FT                   /EC_number="1.17.4.1"
FT                   /note="(P50620) Ribonucleoside-diphosphate reductase alpha
FT                   chain (EC 1.17.4.1) (Ribonucleotide reductase),InterPro:
FT                   Ribonucleotide reductase large subunit,similarity with
FT                   ORF80 [Staphylococcus phage K] gi|37729162|gb|AAO47529.1|"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0379"
FT                   /db_xref="GOA:B9DK29"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR013554"
FT                   /db_xref="InterPro:IPR026459"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK29"
FT                   /inference="similar to AA sequence:UniProtKB:P50620"
FT                   /protein_id="CAL27293.1"
FT                   /translation="MNEKQYNHIELNNEVTKRKEDGFFSLEKDQEALAVYLEEIKDHTI
FT                   YFDSEIERLHYLVDNDFYVDVFAQYSEEDLKELTDFARSIPFKFASYMSASKFFKDYAL
FT                   KTNDKKQYLEDYSQHVTIVSLYLADGDKEQARQFISSMIEQRYQPATPTFLNAGRARRG
FT                   ELVSCFLLEVDDSLNSINFIDSTAKQLSKIGGGVAINLSKLRARGEAIKGIKGVAKGVL
FT                   PVAKSLEGGFSYADQLGQRPGAGAVYLNIFHYDVEEFLDTKKVNADEDIRLSTISTGLI
FT                   VPAKFFELAKNGEDFYMFAPHTVYNEYGVTLDDIDLDKYYDDMVKNPNILKHKKDAREM
FT                   LNTIAQTQLQSGYPYLMFKDNANKVHANSNIGQIKMSNLCTEIFQLQETSVINDYGIED
FT                   EIKRDISCNLGSLNIVNVMESGKFRDSVHTGMDALTVVSDEANIQNAPGVRKANSELHS
FT                   VGLGVMNLHGYLAKNQIGYESEEAKDFANIFFMTMNYYSIERSMQTAKERGQAYQDFDK
FT                   SDYASGKYFEKYTQADIVPEYEKVKSLFEGLEIPTAEDWKTLEKDVKEYGLYHAYRLAI
FT                   APTQSISYVQNATSSVMPIVDQIERRTYGNSETFYPMPFLSPQTMWYYKSAFNTDQMRL
FT                   IDLVATIQQHVDQGISTILYVNSEISTRELSRLYVYAHHKGLKSLYYTRNKLLSVDECT
FT                   SCAI"
FT   CDS_pept        390368..391342
FT                   /transl_table=11
FT                   /gene="nrdF"
FT                   /locus_tag="SCA_0380"
FT                   /product="ribonucleoside-diphosphate reductase beta chain"
FT                   /function="Ribonucleotide reductase beta subunit"
FT                   /EC_number="1.17.4.1"
FT                   /note="(P50621) Ribonucleoside-diphosphate reductase beta
FT                   chain (EC 1.17.4.1) (Ribonucleotide reductase small
FT                   subunit),InterPro: Ribonucleotide reductase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0380"
FT                   /db_xref="GOA:B9DK30"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR026494"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK30"
FT                   /inference="similar to AA sequence:UniProtKB:P50621"
FT                   /protein_id="CAL27294.1"
FT                   /translation="MIAVNWNTQEDMTNMFWRQNISQMWVETEFKVSKDIASWKTLTPE
FT                   EQDTFKKALAGLTGLDTHQADDGMPLIMLHTKDLRKKAVYSFMAMMEQIHAKSYSHIFT
FT                   TLLPSSETNYLLDTWVLEEPHLKFKSDKIVGNYHKLWAKEASVYDQYIARVSSVFLETF
FT                   LFYSGFYYPLYLAGQGRMTTSGEIIRKILLDESIHGVFTGLDAQHLRNELSENEKQRAD
FT                   QHMYKLLEELYKNEVSYTHKLYDDIGLAEDVLNYVRYNGNKALSNLGFEPYFEEREFNP
FT                   IIENALDTSTKNHDFFSVKGDGYTLALNVEALQDEDFIFDDEK"
FT   CDS_pept        391626..392600
FT                   /transl_table=11
FT                   /gene="sstA"
FT                   /locus_tag="SCA_0381"
FT                   /product="homolog of FecCD transport family protein SstA"
FT                   /function="ABC-type enterochelin transport system permease
FT                   component"
FT                   /note="(P37738) Ferric anguibactin transport system
FT                   permease protein fatD,InterPro: FecCD transport family"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0381"
FT                   /db_xref="GOA:B9DK31"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK31"
FT                   /inference="similar to AA sequence:UniProtKB:P37738"
FT                   /protein_id="CAL27295.1"
FT                   /translation="MIIRQLMRGPVLFFIFIVLSILSLFIGVSQLGLSDIFHLSAEQRN
FT                   ILFSSRIPRTVSIIISGSSLALAGLIMQQMMQNKFVSPTTAGTMEWAKLGILIALVFFP
FT                   HAHILIKLLFAMLLSIAGTFFFMKLIQIIRFKDVIFVPLLGIMIGGIISSLTTFIALRT
FT                   NAVQSIGNWLNGNFAIITSGRYEILYLSIPLLIVTYTFANYFTIAGMGKDFSHNLGVNY
FT                   ERIMMFGLTITATMTALVVVTVGALPFLGLIVPNIVSIYRGDHLKHALPHTVLLGAIFV
FT                   LFSDILGRLIVYPYEINIGLTLGVFGTFIFLAMLLKGSRNYES"
FT   CDS_pept        392590..393552
FT                   /transl_table=11
FT                   /gene="sstB"
FT                   /locus_tag="SCA_0382"
FT                   /product="homolog of FecCD transport family protein SstB"
FT                   /function="ABC-type enterochelin transport system permease
FT                   component"
FT                   /note="(P37737) Ferric anguibactin transport system
FT                   permease protein fatC,InterPro: FecCD transport family"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0382"
FT                   /db_xref="GOA:B9DK14"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK14"
FT                   /inference="similar to AA sequence:UniProtKB:P37737"
FT                   /protein_id="CAL27296.1"
FT                   /translation="MKANHLTTKLTILIAITLLTGGLYLFLGIDWDILEYQLQSRVRKL
FT                   ILMILVGAAIGTSVIIFQAITVNRLLTPSMMGLDAVYMFIKVLLIFVFGVQSLVVTNLY
FT                   LNFTLTLVAMILFALLLFQVIFKHGNFSVYFILLIGVILGTFFRSITGFLELVINPEEF
FT                   LAVQSSMFANFNASNEKLVAVCGVVLLVLIIITIRVLPYLDVLLLGKAQAMNLGVNYTR
FT                   VTRLLMIMVALLTAIATALVGPITFLGLLTINVAHEIMKTYEHKFLLPATIMLSWISLF
FT                   SAEWIVEHLFEATTEVSILINLVGGTYFIYLLISRRNVQ"
FT   CDS_pept        393549..394307
FT                   /transl_table=11
FT                   /gene="sstC"
FT                   /locus_tag="SCA_0383"
FT                   /product="homolog of ABC transporter ATP-binding protein
FT                   SstC"
FT                   /function="ABC-type enterochelin transport system ATPase
FT                   component"
FT                   /note="(P49938) Ferrichrome transport ATP-binding protein
FT                   fhuC,InterPro: ABC transporter"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0383"
FT                   /db_xref="GOA:B9DJN2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJN2"
FT                   /inference="similar to AA sequence:UniProtKB:P49938"
FT                   /protein_id="CAL27297.1"
FT                   /translation="MISVKNLNKSIQDKPILQSIDVTIQKGRLTSLIGPNGAGKSTLLS
FT                   AISRLIDVDSGEINLEDASLDQFKSNEIAKKLSVLKQTNHTELNITVEQLVAFGRFPYS
FT                   KGRLTKFDKHKINEALDLLQLQEIKDRNLKTLSGGQRQRAYIAMTIAQDTEYILLDEPL
FT                   NNLDMKYSVQIMKTLRQLTHEVGKTIIIVLHDINFASCYSDDVIAMKDGQLIKAAHKDE
FT                   VIQPDTLKCLYDMDVQIESVNGQRICLYYD"
FT   CDS_pept        394395..395423
FT                   /transl_table=11
FT                   /gene="sstD"
FT                   /locus_tag="SCA_0384"
FT                   /product="homolog of lipoprotein SstD"
FT                   /function="ABC-type enterochelin transport system
FT                   periplasmic component"
FT                   /note="(P11460) Ferric anguibactin-binding protein
FT                   precursor,InterPro: Periplasmic binding protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0384"
FT                   /db_xref="GOA:B9DJN3"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR033870"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJN3"
FT                   /inference="similar to AA sequence:UniProtKB:P11460"
FT                   /protein_id="CAL27298.1"
FT                   /translation="MKKLGLFLLISIMFLFAACSNDSSSKDESKKGESDQKTVKIENNY
FT                   ELSGKDPKGSDAKQVKNTVDVPVNPKNAIVLDYGALDTLKALGVADKVKGMPKGENNSS
FT                   LPDFLKEFKDDKYINTGSLKEVNFDKVAQAKPEVIFISGRTANQKNIDEFKKAAPKAKV
FT                   VYVGADDKDYVKSMKQNTENLGKIYDKEDKAKDLNKDLDNKIADMKDKTKKFDKTVMYL
FT                   LVNEGELSTYGPKERFGSLVYNTLGFKPADKNVKAGSHGQNVTNEYINEKNPDVILAMD
FT                   RGQAIGEKSTAKQTLGNAVIKNVKAIKDDKVYELDPKLWYFASGSTTTTMKQIDELKKV
FT                   VE"
FT   CDS_pept        complement(395914..396252)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0385"
FT                   /product="putative CHY zinc finger family protein"
FT                   /function="uncharacterized conserved protein"
FT                   /note="(P36078) Hypothetical 13.6 kDa protein in MDH1-VMA5
FT                   intergenic region,InterPro: CHY zinc finger"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0385"
FT                   /db_xref="GOA:B9DJN4"
FT                   /db_xref="InterPro:IPR008913"
FT                   /db_xref="InterPro:IPR016694"
FT                   /db_xref="InterPro:IPR037274"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJN4"
FT                   /inference="similar to AA sequence:UniProtKB:P36078"
FT                   /protein_id="CAL27299.1"
FT                   /translation="MTEYDKNGTPIVHGIDLDHETRCTHYHTPLDVVAMRFKCCDKYYA
FT                   CIHCHNECEDHEPIPWSKDEQDTLAVMCGVCKYEMTIREYVNTDQCPNCSASFNPRCEA
FT                   YYPYYFTL"
FT   CDS_pept        complement(396265..397191)
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="SCA_0386"
FT                   /product="putative UDP-N-acetylenolpyruvoylglucosamine
FT                   reductase"
FT                   /function="UDP-N-acetylmuramate dehydrogenase"
FT                   /EC_number="1.1.1.158"
FT                   /note="(Q8CPZ7) UDP-N-acetylenolpyruvoylglucosamine
FT                   reductase (EC 1.1.1.158) (UDP-N-acetylmuramate
FT                   dehydrogenase),InterPro: FAD linked oxidase N-terminal"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0386"
FT                   /db_xref="GOA:B9DJN5"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DJN5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27300.1"
FT                   /translation="MHKDDILKELKKVLPEEIIKVDEPLKRYTYTQTGGNADFYLSPTT
FT                   NEQVQAINHLARMNNIPVTYLGNGSNIIIREGGIRGIVLSLLSMDYIKVEDNVIIAGSG
FT                   AAIIDVSRKARDYSLTGLEFACGIPGSIGGAVFMNAGAYGGEVRDCIEHAVCVNERGEI
FT                   VTLTRDELELGYRSSIVQKQHLVVLEASFNLAPGNQEEIQSVMDDLTNRRETKQPLEYP
FT                   SCGSVFQRPPGHFAGKLIQDSELQGHRIGGVEVSKKHAGFMVNVDNGTATDYEDLIHHV
FT                   QNVVKEKFDVELHPEVRIIGDHPEEHQ"
FT   CDS_pept        complement(397271..397795)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0387"
FT                   /product="conserved hypothetical protein"
FT                   /note="(Q45133) Glutamate-rich protein grpB,InterPro:
FT                   Protein of unknown function UPF0157"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0387"
FT                   /db_xref="InterPro:IPR007344"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJN6"
FT                   /inference="similar to AA sequence:UniProtKB:Q45133"
FT                   /protein_id="CAL27301.1"
FT                   /translation="MYTKTQPLISDANLLVVYHNLFEDYHNLLFGLLDTPVKAVHHIGG
FT                   TAHFKYPTEPILDILVGVNNLHDITSLDEKRLNYAGFYRIHHQYKKKVMMVKFNNLIDL
FT                   KQEVRLHILQIESEMYDQYLQMQRALKDDHQLAQQFKTEKEQLHASPSSIRDYETQKET
FT                   LFEKLSKQIRD"
FT   CDS_pept        397900..398793
FT                   /transl_table=11
FT                   /locus_tag="SCA_0388"
FT                   /product="putative lipoprotein"
FT                   /note="(P15801) DNA polymerase gamma (EC 2.7.7.7)
FT                   (Mitochondrial DNA polymerase catalytic subunit)"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0388"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJN7"
FT                   /inference="similar to AA sequence:UniProtKB:P15801"
FT                   /protein_id="CAL27302.1"
FT                   /translation="MKPWLLAFLLLCATFSLVACGNRTQSDLNQFEQSMSEVDKKQDHV
FT                   KKTMDDIHLNRLNELSKSDLTDRNKEDFEQMSKDMDKKLMPAFKSYKEAAHSLPADTKA
FT                   VKQLRTEYLKEVDQQEKALKKDRDYIRLCNQSVKTNEDILNYTRLFEKRRAQLEIKVAD
FT                   AKKAGENKSADALVGKLKDNNKKLQEVAKKYLDAEDPKQTKVVIKDKIEPLISKQIEDL
FT                   NQSTVTDNETTKARQSAIEMYYSLQNYYETRQQTIDISTKLEQYDMNKLPLTGKDLSEY
FT                   HQKYNKALKHLKQDVK"
FT   CDS_pept        398932..399252
FT                   /transl_table=11
FT                   /locus_tag="SCA_0389"
FT                   /product="conserved hypothetical protein"
FT                   /note="(P39914) Hypothetical protein ytxJ (ORF2) (ORF3)"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0389"
FT                   /db_xref="InterPro:IPR022551"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJN8"
FT                   /inference="similar to AA sequence:UniProtKB:P39914"
FT                   /protein_id="CAL27303.1"
FT                   /translation="MATKLTSIDQFEQVINDNKDVFILKHSNTCPISANAYDQFNKFLY
FT                   ERDIAGYYLVVQEQRNLSNYIAEETGVKHESPQAFYFVDGKVKWHASHDDINVSSLAQA
FT                   EE"
FT   CDS_pept        399487..400617
FT                   /transl_table=11
FT                   /locus_tag="SCA_0390"
FT                   /product="putative glycerate kinase"
FT                   /function="Glycerate kinase"
FT                   /EC_number="2.7.1.31"
FT                   /note="(P44507) Glycerate kinase (EC 2.7.1.31),InterPro:
FT                   Conserved hypothetical protein 45"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0390"
FT                   /db_xref="GOA:B9DJN9"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJN9"
FT                   /inference="similar to AA sequence:UniProtKB:P44507"
FT                   /protein_id="CAL27304.1"
FT                   /translation="MRVLVAMDEFNGIVSSYEANRYVEEAVASQIENADIVQVPLFNGR
FT                   HELMDSVFLWQSGTKYREMVHNADMNQVEAVYGKTENGMTVIEADLFLQGEKPIGKRSS
FT                   YGLGELISKALDNDAEHLVISLGNIASFDGGAGMLQALGARYYDDEGQPIDTRKGAEVL
FT                   KYIRHVDLSNLHLRLAQVRIQLVSDFASKMYGKQSEIMQVYPLLDITREEAATIDNLVW
FT                   YFSEILKNEAHLVTSTVERGGAGGGVAAIFAALYDAEILTSHNLVDQITHLEDLIEQAD
FT                   LVMFGEGINEADHLLETTTLRIAELATKYHKPCIAINATNDKFDRYEALGVTGMFNLFM
FT                   EMPEHYTSFKAGIQIRFYAVQALKLLKAQFDVDKKS"
FT   CDS_pept        complement(400684..401916)
FT                   /transl_table=11
FT                   /gene="pepT"
FT                   /locus_tag="SCA_0391"
FT                   /product="peptidase T"
FT                   /function="Di- and tripeptidases"
FT                   /EC_number="3.4.11.14"
FT                   /note="(Q99VN1) Peptidase T (EC 3.4.11.4) (Tripeptide
FT                   aminopeptidase) (Aminotripeptidase)
FT                   (Tripeptidase),InterPro: Peptidase M20/M25/M40"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0391"
FT                   /db_xref="GOA:B9DK09"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010161"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DK09"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27305.1"
FT                   /translation="MKEELIDRLKRYAEIDTQSDPDSESTPSTEKQRDLLNLLKQELEE
FT                   LGLQTDIDDNGYLFATLESNIANEVPTVGFLAHVDTSHDFNASNVKPQIIENYDGKPIQ
FT                   LGDTDRELNQEVFPAMKSVEGHTLMITDGTSLLGADDKAGVAEIMTALTYLVEHPEVKH
FT                   GRIRVAFTPDEEIGRGPHKFDVKRFDADFAYTMDGSQYGELQFESFNAAEATITCHGVN
FT                   VHPGSAKDVMVNAIKLGERFDSMLPEDEVPEKTEGYEGFFHLMNFNGTTEKAQLKYIIR
FT                   DHDRERFEARKACLLEIRDQINTVYNNDPVEVDMYDQYHNMAEKINEVPEVIEVPKRVF
FT                   KKLGIEPNTEPIRGGTDGSQLSFMGLPTPNIFTGCDNFHGPFEYASIDVMERAVEVILG
FT                   IAEEIAQPTDK"
FT   CDS_pept        complement(401930..402427)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0392"
FT                   /product="putative membrane protein"
FT                   /function="uncharacterized conserved protein"
FT                   /note="(P44520) Hypothetical protein HI0108"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0392"
FT                   /db_xref="GOA:B9DK10"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK10"
FT                   /inference="similar to AA sequence:UniProtKB:P44520"
FT                   /protein_id="CAL27306.1"
FT                   /translation="MFSQYIFQFLISFCSTLLFSILFNAPRKLLPACGFVGAMGWIIYV
FT                   IAMDMNTGKVAASFLGSFILAIMSHTMSKRYFQPVIIFIVPGIIPLVPGGAAYEATRFL
FT                   VTNQYTHAVNTFLEVTLISGAIAFGILCAEIAYHTYNRIRANYGKMKGKSYHKQFNMNN
FT                   RS"
FT   CDS_pept        complement(402446..403210)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0393"
FT                   /product="putative membrane protein"
FT                   /function="uncharacterized conserved protein"
FT                   /note="(P39402) Hypothetical protein yjjP"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0393"
FT                   /db_xref="GOA:B9DK11"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK11"
FT                   /inference="similar to AA sequence:UniProtKB:P39402"
FT                   /protein_id="CAL27307.1"
FT                   /translation="MPEEAITIIDENKVIDVVMTAGKILLESGAETYRVEDTMSRIAYS
FT                   YGLDNTNSFVSNTAIIFSLNDRTNTRLIRVRDRTTDLEKIALANNISRKIAKKQLSIDE
FT                   AKSELIHLEHASLQYSYLTKFIAVSIACGFFLFMFGGVAQDFIYAIIAGAGAYLTFDYV
FT                   QRFIQIKFFSEFISAIVVIGVAAVTHKLGLSVNQDIITIAGVMPLVPGILITNAIRDLM
FT                   AGELLAGMSRGMEAALTAFAIGAGVAIILLFF"
FT   CDS_pept        complement(403415..404482)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0394"
FT                   /product="putative membrane protein"
FT                   /function="FOG: GGDEF domain"
FT                   /note="(P54595) Hypothetical protein yhcK,InterPro: GGDEF"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0394"
FT                   /db_xref="GOA:B9DK12"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR011620"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK12"
FT                   /inference="similar to AA sequence:UniProtKB:P54595"
FT                   /protein_id="CAL27308.1"
FT                   /translation="MIEAIIYNISVTVAGIYLFHRLQYSETKQMKFSQTYVTILMTVVA
FT                   LLLAAYPIPVHDYLLFLTFVPLLFLGRYTNVFFTMVSAAIIFIVDVFVYGDPLAYNIAL
FT                   LIIALAVSVIGPFIKQNDIVSLQILNAISLIILSIISIITKLYTLQEIIYLIPISFVVT
FT                   IASSITFVDIWRFFTLVQRYESEDRYDYLTGLGNVKEFDRYLNKMTDEADEKSTSLGLL
FT                   LIDIDGFKDVNDAFTHRSGDAVLKQISQLLINYVPPNVRIFRNGGEEFSVVVLGYSLDQ
FT                   SVKLAESIRAGVEQSTFHLPDKEVIKLSVSIGIGYLTADDYKSQRKVFKDADDMLHMAK
FT                   NEGRNQVMFNPIVKS"
FT   CDS_pept        404763..405818
FT                   /transl_table=11
FT                   /gene="llm"
FT                   /locus_tag="SCA_0395"
FT                   /product="putative
FT                   phospho-N-acetylmuramyl-pentapeptide-transferase"
FT                   /function="UDP-N-acetylmuramyl pentapeptide
FT                   phosphotransferase/UDP-N- acetylglucosamine-1-phosphate
FT                   transferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="(O34753) Probable undecaprenyl-phosphate
FT                   N-acetylglucosaminyl 1-phosphate transferase (EC 2.7.8.-)
FT                   (UDP-GlcNAc:undecaprenyl-P GlcNAc 1-P
FT                   transferase),InterPro: Glycosyl transferase family 4"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0395"
FT                   /db_xref="GOA:B9DK13"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:B9DK13"
FT                   /inference="similar to AA sequence:UniProtKB:O34753"
FT                   /protein_id="CAL27309.1"
FT                   /translation="MITLLLVVFSMIVSLILTPIVIKISVELDIMDKPNFRKVHTKPVS
FT                   VLGGTVILFSFMLGIWIGHPIEREVIPLILGTIIMYLVGLIDDVYNLKPILKLLGQCIA
FT                   ALVVVYYGVTIDFIQLPFGTIHFGILSVPFTVFWIIAITNAINLIDGLDGLAAGVSTIA
FT                   FMTIGFIAILQADIFIIMICSVMIGSLIGFLFYNFHPAKIFLGDSGSLQLGFIISFLSL
FT                   LGFKNITFFSLFFLIVILAVPFIDTLFAMIRRARKGQKIMQADKSHLHHKLLKLGYTHR
FT                   QTVILIYSIAILFSIYSIILYLSQPWGVVMMLILILITIELIVEFTGLIDDNYRPLLRL
FT                   LEKRHQNHEEE"
FT   CDS_pept        complement(405859..406500)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0396"
FT                   /product="conserved hypothetical protein"
FT                   /function="uncharacterized conserved protein"
FT                   /note="(P32437) Hypothetical UPF0029 protein yvyE,InterPro:
FT                   Protein of unknown function UPF0029"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0396"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJN1"
FT                   /inference="similar to AA sequence:UniProtKB:P32437"
FT                   /protein_id="CAL27310.1"
FT                   /translation="MENHIITIKQEYIIENTINKSRFIAHIKPVKTEEEAKAFIDEVKK
FT                   EHREATHNCSAYTIGDNMLIQKANDDGEPSGTAGVPMLEILKKLETHDTAAVVTRYFGG
FT                   IKLGTGGLIRAYSGAVRDAIKEGGRVELRNAFPTTVTISYDLTGKLEYELQSTDFILRD
FT                   TVYTDKVSYKIDVLEDDFDDFINFLNRITAGKYELEKGEATRLPFDIETK"
FT   CDS_pept        406641..407525
FT                   /transl_table=11
FT                   /locus_tag="SCA_0397"
FT                   /product="conserved hypothetical protein"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /note="(Q927X9) Hypothetical UPF0230 protein
FT                   lin2658,InterPro: DegV"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0397"
FT                   /db_xref="GOA:B9DJL8"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJL8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27311.1"
FT                   /translation="MKIAVMTDSTTSLPQRLLDKYNISVVSLSITFANGDNYIEGKELN
FT                   ASELYRRMKSEKTLPTTSQPAIGNVIEEYERLRDAGYTDVIGLFLSDGISGTYQAATQA
FT                   GEMVEGINVHTFDSKLSGMILGGYVIYAAERVEAGLTADEVMNELLEMREYTGALVVVD
FT                   DLKNLQKSGRITGAQAFIVSLLKMKPVLEFVDGKILPLDKVRTKKRAIKTIEQGVLDRV
FT                   KDYDNVTLFVVNGDAKEDGIKLYNHLKENYPNYVINYSEFTPVIATHLGVGSVALGFTN
FT                   KHIATLANSPEEE"
FT   CDS_pept        407553..408908
FT                   /transl_table=11
FT                   /locus_tag="SCA_0398"
FT                   /product="putative ATP-dependent helicase"
FT                   /function="Superfamily II DNA/RNA helicase required for DNA
FT                   uptake (late competence protein)"
FT                   /note="(P39145) ComF operon protein,InterPro: DEAD/DEAH box
FT                   helicase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0398"
FT                   /db_xref="GOA:B9DJL9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJL9"
FT                   /inference="similar to AA sequence:UniProtKB:P39145"
FT                   /protein_id="CAL27312.1"
FT                   /translation="MSYECFDLLFCIQNSHKGMIEIKYYGRLIRNKEDLSDEEIKTIQK
FT                   GVIKNEKGRWHCIQCESTVSEDYYTYYSEPLQKEITYCRQCLQLGRMDTHSDVCITKTK
FT                   HVSSQATYQLDFELSAQQTYASENIIRAIKAKENLLLYAVTGAGKTEMMFAGIQYARQQ
FT                   GYNVAIVSPRVDVVVEISIRIAEAFASEDIDVLYQGQSQKYNGHFVVATIHQLYRFKQH
FT                   FDVIFIDEVDAFPLSMDPLLQHTLECASSITSSHIYMTATPSRKLRSQFKNENIITLPA
FT                   RYHRQPLPVPHYKYLKFKPDKLQISLLQILKKQISSNRYTLVFFNHIEAMKQAFEVYRK
FT                   HIPDLIYVHSEDALRFDKVTALREGCHPIVFTTTILERGFTMSHLDVIVLNSQDFKTAA
FT                   LVQIAGRTGRKIQDTKGLVLYLHNGVSLSMMHAKYQFKQMNRIGIEKGWLDA"
FT   CDS_pept        408901..409602
FT                   /transl_table=11
FT                   /locus_tag="SCA_0399"
FT                   /product="putative amidophosphoribosyltransferase"
FT                   /function="predicted amidophosphoribosyltransferases"
FT                   /note="(P39147) ComF operon protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0399"
FT                   /db_xref="GOA:B9DJM0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJM0"
FT                   /inference="similar to AA sequence:UniProtKB:P39147"
FT                   /protein_id="CAL27313.1"
FT                   /translation="MPRCLQCRQKFADPLTAVNFYRAPEILCEKCREGWKQCLLFKSKK
FT                   HKNMDEEGYCKQCLKPLATHDTRCSECVKLSRRFTLIDHLYCEYQNKDIVKETMNRYRN
FT                   SGDTALCEVIASQIHLPKKQYDFIVPIPSLIKEDMKRTFNPVTQVLNAKKVSYTNLLVK
FT                   NRTTGSTAFQGKHNMKNLFDLTQAAHSFNLENKTILLVNDIYTTGVTEHQAAEILFVRK
FT                   IGKVDVFTFVR"
FT   CDS_pept        409674..410240
FT                   /transl_table=11
FT                   /locus_tag="SCA_0400"
FT                   /product="putative ribosome-associated protein"
FT                   /function="Ribosome-associated protein Y (PSrp-1)"
FT                   /note="(P47995) Hypothetical protein in secA 5region (ORF1)
FT                   (Fragment),InterPro: Sigma 54 modulation protein/ribosomal
FT                   protein S30EA,In comparison to published sequence P47995
FT                   Hypothetical protein in SECA 5'region (ORF1) of S.
FT                   carnosus, the gene starts further upstream."
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0400"
FT                   /db_xref="GOA:P47995"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/Swiss-Prot:P47995"
FT                   /inference="similar to AA sequence:UniProtKB:P47995"
FT                   /protein_id="CAL27314.1"
FT                   /translation="MIRFEIHGDNLTITDAIRNYIEDKVGKLERYFTNVPNVNAHVKVK
FT                   TYANSSTKIEVTIPLNDVTLRAEERNDDLYAGIDLITNKLERQVRKYKTRVNRKKRKES
FT                   EHEPFPATPETPPETAVDHDKDDEIEIIRSKQFSLKPMDSEEAVLQMDLLGHDFFIFND
FT                   RETDGTSIVYRRKDGKYGLIETVEN"
FT   CDS_pept        410632..413160
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="SCA_0401"
FT                   /product="preprotein translocase secA subunit"
FT                   /note="Sca_0401"
FT                   /db_xref="GOA:P47994"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:P47994"
FT                   /protein_id="CAL27315.1"
FT                   /translation="MGFLTKIVDGNKREIKRLSKQADKVISLEEEMSILTDEEIRNKTK
FT                   AFQERLQAEEDVSKQDKILEEILPEAFALVREGAKRVFNMTPYPVQIMGGIAIHNGDIS
FT                   EMRTGEGKTLTATMPTYLNALAGRGVHVITVNEYLASSQSEEMAELYNFLGLSVGLNLN
FT                   SLSTEQKREAYNADITYSTNNELGFDYLRDNMVNYSEERVMRPLHFAIIDEVDSILIDE
FT                   ARTPLIISGEAEKSTSLYTQANVFAKMLKAEDDYNYDEKTKSVQLTDQGADKAERMFKL
FT                   DNLYDLKNVDIITHINTALRANYTLQRDVDYMVVDGEVLIVDQFTGRTMPGRRFSEGLH
FT                   QAIEAKEGVQIQNESKTMASITFQNYFRMYNKLAGMTGTAKTEEEEFRNIYNMTVTQIP
FT                   TNRPVQREDRPDLIFISQKGKFDAVVEDVVEKHKKGQPILLGTVAVETSEYISQLLKKR
FT                   GVRHDVLNAKNHEREAEIVSTAGQKGAVTIATNMAGRGTDIKLGEGVEELGGLAVIGTE
FT                   RHESRRIDDQLRGRSGRQGDRGESRFYLSLQDELMVRFGSERLQKMMGRLGMDDSTPIE
FT                   SKMVSRAVESAQKRVEGNNFDARKRILEYDEVLRKQREIIYGERNNIIDSESSSELVIT
FT                   MIRSTLDRAISYYVNEELEEIDYAPFINFVEDVFLHEGEVKEDEIKGKDREDIFDTVWA
FT                   KIEKAYEAQKANIPDQFNEFERMILLRSIDGRWTDHIDTMDQLRQGIHLRSYGQQNPLR
FT                   DYQNEGHQLFDTMMVNIEEDVSKYILKSIITVDDDIERDKAKEYQGQHVSAEDGKEKVK
FT                   PQPVVKDNHIGRNDPCPCGSGKKYKNCCGK"
FT   CDS_pept        413332..>413403
FT                   /transl_table=11
FT                   /gene="prfB'"
FT                   /locus_tag="SCA_0401A"
FT                   /product="N-terminal part of peptide chain release factor
FT                   2"
FT                   /note="probably fused to Sca_0402 by programmed
FT                   translational frameshift"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0401a"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJM3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27316.1"
FT                   /translation="MELSEIKRNLANYEEKLNQLRGSL"
FT   CDS_pept        413447..414448
FT                   /transl_table=11
FT                   /gene="prfB''"
FT                   /locus_tag="SCA_0402"
FT                   /product="peptide chain release factor RF-2, major part"
FT                   /function="Protein chain release factor B"
FT                   /note="(P28367) Peptide chain release factor 2
FT                   (RF-2),InterPro: Peptide chain release factor 2,Probably
FT                   fused to preceding ORF (prfB') by translational frameshift.
FT                   According to sequence similarity, the fusion will start
FT                   with codon at position 413405..413407."
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0402"
FT                   /db_xref="GOA:B9DJM4"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJM4"
FT                   /inference="similar to AA sequence:UniProtKB:P28367"
FT                   /protein_id="CAL27317.1"
FT                   /translation="MMTDPNFWDDQNKAQEIIDKNNALKHVVNGYRDLEAELEDMSATH
FT                   ELLAEEFDEDLKADLEEEANAFKDKLDQFELQLLLNGPYDANNAILELHPGAGGTESQD
FT                   WASMLLRMYQRYAEQQGFKVEFADYLPGDEAGVKSVTLVIKGHNAYGYLKAEKGVHRLV
FT                   RISPFDSSGRRHTSFVSCDVIPEFSNNEIEIEVNPDDITVDTFRASGAGGQHINKTESA
FT                   IRITHHPTGIVVNNQNERSQIKNREAAMKMLKSKLYQLKLEEQEREMAEIRGEQKEIGW
FT                   GSQIRSYVFHPYSMVKDHRTNEETGNVNAVMDGEIGPFIEAYLRTQMDNREA"
FT   CDS_pept        414759..415745
FT                   /transl_table=11
FT                   /locus_tag="SCA_0404"
FT                   /product="putative LysM family protein"
FT                   /function="Surface antigen"
FT                   /note="(Q37896) Lysozyme (EC 3.2.1.17) (Lysis protein)
FT                   (Muramidase) (Endolysin) (Morphogenesis protein
FT                   2),InterPro: CHAP; LysM"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0404"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJM5"
FT                   /inference="similar to AA sequence:UniProtKB:Q37896"
FT                   /protein_id="CAL27318.1"
FT                   /translation="MKKALLLSAASVTVFTGLNGVASAEQTHVVKENAKLSDVAALFAT
FT                   TTNEIKNLNNLNKDEVKKDTQLVLPDTDIVEVKAGDSLNSIAKKHHISVDKLHELNPGL
FT                   TNLILPGDILAVSDKGAAHLQVLFTGKIAPETEKQAYNEEGQSSKQPTSSNYHNVEQVT
FT                   TAPQAYYSNENNVEYKAPTRSYTTSYKVPSYTAPTSYSGNYSSTSYSAPAAQSSYSNYS
FT                   GANYYTSGQCTSYVFERAGGKAGSLWGNANNWANAAAAAGRTVNNTPTAGAIMQSTAGA
FT                   YGHVAYVEGVNGDGSVRVSEMNYGYGPGVVTSRTLSAGQAASYNFIH"
FT   CDS_pept        415939..416580
FT                   /transl_table=11
FT                   /locus_tag="SCA_0405"
FT                   /product="predicted metal-dependent phosphohydrolase of HD
FT                   superfamily"
FT                   /function="predicted hydrolases of HD superfamily"
FT                   /note="InterPro: Metal-dependent phosphohydrolase HD
FT                   subdomain"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0405"
FT                   /db_xref="GOA:B9DJM6"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJM6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27319.1"
FT                   /translation="MGVHQYFKRLSDLEKLIRLPGKFKYFEHNVAAHSFKVTKIAQYLG
FT                   TVEEAHGNEINWKNLYEKALNHDFAEVFTGDIKTPVKYASRDLKKLFSQVEEEMVDNFI
FT                   REEFPPEYQDVYRERLQEGKDDSLEGQILAVADKIDLLYETFGEIQKRNPDDLFFEIYE
FT                   MSLETIMQFDHLVSVQDFIENVIPEMLTENFIPRSELRELTMSILNKRDG"
FT   CDS_pept        416587..416832
FT                   /transl_table=11
FT                   /locus_tag="SCA_0406"
FT                   /product="putative membrane protein"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /note="(P37953) CsbA protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0406"
FT                   /db_xref="GOA:B9DJM7"
FT                   /db_xref="InterPro:IPR019242"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJM7"
FT                   /inference="similar to AA sequence:UniProtKB:P37953"
FT                   /protein_id="CAL27320.1"
FT                   /translation="MVLVWYLCASFFPCILVVLFSVVTKNKWVGAIVTLTLIGGSIYKG
FT                   FFHSEWIIFIDVVSLLAGFVIVDQLNLHKQHEDEDR"
FT   CDS_pept        417181..419163
FT                   /transl_table=11
FT                   /gene="uvrB"
FT                   /locus_tag="SCA_0407"
FT                   /product="excinuclease ABC subunit B"
FT                   /function="Helicase subunit of the DNA excision repair
FT                   complex"
FT                   /note="(Q99VL7) UvrABC system protein B (UvrB protein)
FT                   (Excinuclease ABC subunit B),InterPro: Excinuclease ABC B
FT                   subunit"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0407"
FT                   /db_xref="GOA:B9DJM8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJM8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27321.1"
FT                   /translation="MEHHPFKIVSDYEPQGDQPAAIKELTEGIKAGKRHQTLLGATGTG
FT                   KTFTMSNVIKEVGKPTLVIAHNKTLAGQLYNEFKELFPENRVEYFVSFYDYYQPEAYVP
FT                   STDTFIEKDATINDEIDQLRHSATSSLFERDDVIIVASVSSIFGLGNPEEYSDLVVNIR
FT                   EGMEMDRSQFLRDLVDIQYTRNDIDFKRGTFRVRGDVVEVFPASREEICIRVEFFGDEI
FT                   DRISEVNYLTGEVLRQREHFSIFPASHYVTRDEKLKLAIERIEKELEERLKELRSENKL
FT                   LEAQRLEQRTNYDLEMMREMGFCSGIENYSVHLTLRPIGSTPYTLLDYFGDDWLVMVDE
FT                   SHVTLPQIRGMYNGDRARKQVLIDHGFRLPSAIDNRPLTFEEFEEKAKQLVYVSATPGP
FT                   YELEHTDEMTEQIIRPTGLLDPKIDVRPTKNQIDDLLSEIQDRVDKNERVLITTLTKKM
FT                   SEDLTTYLKEAGIKVNYLHSEIKTLERIEIIRDLRMGTYDAVVGINLLREGIDIPEVSL
FT                   VVILDADKEGFLRSERSLVQTIGRAARNEHGEVIMYADKITDSMKFAIDETERRRKIQN
FT                   EYNEEHGITPQTIHKKIHDVISATVETKEENEKDQKVVPKKLTKKEREKTIANIEKEMK
FT                   KAAKDLDFERATELRDMLFELKAEG"
FT   CDS_pept        419171..422014
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="SCA_0408"
FT                   /product="excinuclease ABC subunit A"
FT                   /function="Excinuclease ATPase subunit"
FT                   /note="(Q8NXL9) UvrABC system protein A (UvrA protein)
FT                   (Excinuclease ABC subunit A),InterPro: Excinuclease ABC A
FT                   subunit"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0408"
FT                   /db_xref="GOA:B9DJM9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJM9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27322.1"
FT                   /translation="MKEPSIVVKGARAHNLKNVDVELPKNKLIVMTGLSGSGKSSLAFD
FT                   TIYAEGQRRYVESLSAYARQFLGQMDKPDVDTIEGLSPAISIDQKTTSKNPRSTVATVT
FT                   EIYDYIRLLYTRVGKAYCPEHGIQIESQTVQQMVDRTLELEERTKIQLMAPVVNHRKGS
FT                   HEKLLEDISKKGYVRVRVDGEILDINDVPDLDKNKNHTIEVVVDRLVVKDGIEGRLADS
FT                   METALELAEGNLTVDVIGGDEMKFSENHACPICGFSIGELEPRMFSFNSPFGACPDCDG
FT                   LGQKLTADIDLIVPDQDKTLEEGAIVPWEPKSSDFYPTLLKRVCEVYKIKMDKPFKKLT
FT                   DRQKDIILYGSKDKEIKFTFESRNGQKRTRTMPFEGVIPNIERRFHESPSEYVREVMRK
FT                   YMTELPCETCHGKRLSKEALSVYVSGLNIGEVVEYSIKEALDFFENIDLSEQDRKIADL
FT                   ILKEIISRLYFLNNVGLDYLTLNRSSGTLSGGEAQRIRLATQIGSRLSGVLYVLDEPSI
FT                   GLHQRDNDRLIETLKEMRDLGNTLIVVEHDDDTMREADYLVDVGPGAGEHGGEIVASGT
FT                   PKQVMRNKKSLTGQYLSGKKRIEVPEYRRPATDRRLKVRGAKSNNLKDVDVDFPLSTMT
FT                   VVTGVSGSGKSSLVNEVLYKTLAQKINHSKVRPGKVDEIEGIDQLDKVIDIDQSPIGRT
FT                   PRSNPATYTGVFDDIRDVFAQTNEAKIRGYQKGRFSFNVKGGRCEACKGDGIIKIEMHF
FT                   LPDVYVPCEVCGGKRYNRETLEVTYKGKNIADVLDMTAEEATHFFENIPKIKRKLQTLV
FT                   DVGLGYVKLGQPATTLSGGEAQRVKLASELHKRSTGRSIYILDEPTTGLHVDDISRLLK
FT                   VLDRIVENGDTVVIIEHNLDVIKTADYIIDLGPEGGDGGGTIVATGTPEEIAEAPDSYT
FT                   GKYLKKVLERDKAVETK"
FT   CDS_pept        422226..423167
FT                   /transl_table=11
FT                   /gene="hprK"
FT                   /locus_tag="SCA_0409"
FT                   /product="HPr kinase/phosphatase"
FT                   /function="Serine kinase of the HPr protein regulates
FT                   carbohydrate metabolism"
FT                   /EC_number="2.7.1.-"
FT                   /note="(Q8CTE7) HPr kinase/phosphorylase (EC 2.7.1.-) (EC
FT                   2.7.4.-) (HPrK/P) (HPr(Ser) kinase/phosphorylase),InterPro:
FT                   HPr(Ser) kinase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0409"
FT                   /db_xref="GOA:B9DJN0"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DJN0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27323.1"
FT                   /translation="MLTARALVNKFNLQLVAGEEGLDRPIHNTDISRPGLEMAGYFSHY
FT                   ASDRIQLLGTTELSFYNLLPDEERHGRLRKLCRPDTPAIIVTRDIEPPEELVVAAKELG
FT                   TPLLTSKDATTSLMSRLTTYLEHELAKTTSLHGVLVDVYGVGVLITGDSGIGKSETALE
FT                   LVKRGHRLVADDNVEIREITKDELIGKPPKLIEHLLEIRGLGIINVMTLFGAGSILTEK
FT                   KIGLNINLENWDKNKLYDRVGLNEETLRILDTEITKKTIPVRPGRNVAVIIEVAAMNYR
FT                   LNIMGINTAEEFNERLNAEILRKNEHKEENES"
FT   CDS_pept        423164..423991
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="SCA_0410"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /function="Prolipoprotein diacylglyceryltransferase"
FT                   /EC_number="2.4.99.-"
FT                   /note="(Q9S1H4) Prolipoprotein diacylglyceryl transferase
FT                   (EC 2.4.99.-),InterPro: Prolipoprotein diacylglyceryl
FT                   transferase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0410"
FT                   /db_xref="GOA:B9DJL7"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DJL7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27324.1"
FT                   /translation="MISNLAYIDPVAFQLGPIEVHWYGIIIAAGILLGYFIAQEGAKRA
FT                   GLHKDALVDIIFWSAIFGFITARIYFVIFQWPYYAANPAEIPMIWHGGIAIHGGLIGGF
FT                   ITGVIICRRNNHNPLQVGDIIAPSIILAQGIGRWGNFMNHEAHGGPVAKSVLENMHIPE
FT                   FIINNMYIDGRYYQPTFLYESIWDVLGFALLLFLRKHLRIGETFFTYLIWYSIGRFFVE
FT                   GLRTDSLMLTSNIRVAQLVSILLILIGIAMIIYRRFKYQPPKYKDVKALPWPK"
FT   CDS_pept        424006..424488
FT                   /transl_table=11
FT                   /locus_tag="SCA_0411"
FT                   /product="putative acetyltransferase"
FT                   /function="Acetyltransferase (isoleucine patch
FT                   superfamily)"
FT                   /note="(P77558) Putative colanic acid biosynthesis
FT                   acetyltransferase wcaB (EC 2.3.1.-),InterPro: Bacterial
FT                   transferase hexapeptide repeat"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0411"
FT                   /db_xref="GOA:B9DJK6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJK6"
FT                   /inference="similar to AA sequence:UniProtKB:P77558"
FT                   /protein_id="CAL27325.1"
FT                   /translation="MRQYKKVVNHFPHTNPLWHMYKIIRFPKVLKQTILIEIARFIPSL
FT                   PLKRWIYRACLGMEIGQKTSFAYKVMPDVLYPELIHIGDNCVIGYNTTILTHEFLVTEY
FT                   RIGEVFIGSNTLIGANTTILPGVTIGKNVRVGAGTVVSKDIPDNALAFGNPIQIRK"
FT   CDS_pept        424509..425948
FT                   /transl_table=11
FT                   /locus_tag="SCA_0412"
FT                   /product="conserved hypothetical protein with TPR repeats"
FT                   /function="FOG: TPR repeat"
FT                   /note="InterPro: TPR repeat"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0412"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJK7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27326.1"
FT                   /translation="MAQNEHKNVIPMQRDAAFFKRVAESKAKQKDYHKAAEYYHKAFEL
FT                   SPSDFELLIDYTEALKEIGRGGNVADYYYDYIAKGEHLADAYYQLSQLYISLNDPNKAF
FT                   CFGMNYVLESDDEAYRSELEGMFEVVYDDLDKLEKESQAFAVQMIFQHLFSQGRLEDAR
FT                   DYILRQEMKVRAHHSIRNLLAMSYLYLGDYDQARSMLKQLLKENQTDVHALCHYILLLY
FT                   NTKDKAYPNYLQSLSKVVPMNDDETFKLGIVLSYLKKYEASQKLLFPLYKKGKFISLQL
FT                   FHALSYNYYFLGNKEESMQFWNKLREMANGNPGYPPWVISENDNFFRSNIMPLLTSEDN
FT                   HARIYGIFLLNQVNGKELMITEEVWSVLETMDEYEKLYLTYLIKELKLVKLDFIHRGML
FT                   ALYENETLRHYHNLFIAWIDRAEGIIAGGYDLEHVEGYVAAFVYLFFQQSQQKVTKKQA
FT                   AEWFDISTYRLNKSIDILLEV"
FT   CDS_pept        426058..427011
FT                   /transl_table=11
FT                   /gene="trxB"
FT                   /locus_tag="SCA_0413"
FT                   /product="putative thioredoxine reductase"
FT                   /function="Thioredoxin reductase"
FT                   /EC_number="1.8.1.9"
FT                   /note="(Q99VL2) Thioredoxin reductase (EC 1.8.1.9)
FT                   (TRXR),InterPro: Thioredoxin reductase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0413"
FT                   /db_xref="GOA:B9DJK8"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJK8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27327.1"
FT                   /translation="MAIQQPDYDVVIIGAGPAGMTAAVYASRADLKTLMIERGVPGGQM
FT                   ANTEDVENFPGFESISGPDLSTKMFDHAQKFGAVYQYGDIKSIEDEGDVKKIVYGDKSV
FT                   TAYAVIITTGAEYKKIGVPGEEELGGRGVSYCAVCDGAFFKGKKLFVIGGGDSAVEEGA
FT                   FLTKFADSVTVVHRRDKLRAQKILQDRAFKNEKMDFIWNHTLAAINEENGKVGSVTLQS
FT                   TIDGKEETLPADGVFVYIGMKPLTAPFIDLGITNDAGYIVTNDEMETKLPGIYAAGDVR
FT                   EKGLRQIVTATGDGSIAAQNAQAYIEEVKDKLATEA"
FT   CDS_pept        427150..428103
FT                   /transl_table=11
FT                   /locus_tag="SCA_0414"
FT                   /product="putative P-loop-containing kinase"
FT                   /function="predicted P-loop-containing kinase"
FT                   /note="(Q8CTE3) Hypothetical UPF0042 protein
FT                   SE0548,InterPro: Uncharacterised P-loop ATPase protein
FT                   family UPF0042"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0414"
FT                   /db_xref="GOA:B9DJK9"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DJK9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27328.1"
FT                   /translation="MSEFKQDGGKMQHEENEIVSKSELLVVTGMSGAGKSLVLQNLEDL
FT                   GYFCVDNLPPILLPKFVELMEQGNPSLRKVAIAIDLRGQEFFKSLVKEVDLLRSQNRVI
FT                   VDVMFVEASEAKLISRYKETRRAHPLNDNGQRSLIDAIEEERNSLTEIRSIANYVIDTT
FT                   VLKPKELRAQINHLFNRNDIETFSISVTSFGFKHGIQQDADLVFDVRFLPNPFYVEALR
FT                   PLTGVDDEVYQYVMKWQETAIFYDKLLDLLKFMIPGYKKEGKTQLVIAIGCTGGQHRSV
FT                   ALAKRLAEDLNESYDYNVYVHHRDAHIESGVENEKS"
FT   CDS_pept        428090..429088
FT                   /transl_table=11
FT                   /locus_tag="SCA_0415"
FT                   /product="conserved hypothetical protein"
FT                   /function="uncharacterized conserved protein"
FT                   /note="(Q9K706) Hypothetical UPF0052 protein
FT                   BH3568,InterPro: Protein of unknown function UPF0052"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0415"
FT                   /db_xref="GOA:B9DJL0"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="InterPro:IPR038136"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJL0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27329.1"
FT                   /translation="MKKVKIVLIGGGTGLSVLARGLKDYPIDITAIVTVADDGGSTGKI
FT                   RNEMDIPAPGDIRNVIAALSDTEPTLKELFQYRFQDNQVEGHSLGNLLIAAMTNITDDF
FT                   GHAVKELSKILNIKGRVIPSTNSSIRLNAEMEDGEIVYGESSIPKRQKKIKRVFIEPAD
FT                   VQPMEEAVDALEHADLIVLGPGSLYTSVLSNLCVPGIGKAIQQSHAPKVYVSNVMTQHG
FT                   ETDDFDVMDHVHALNRHMGTDFIDYVICCGNEDYSEQILENYRKEHAEPVKYHKEELEA
FT                   EGITPLTDENLVHISEKNRVRHNTTILAKMIYDLALDLTSTIPFKPKKRKK"
FT   CDS_pept        429107..430051
FT                   /transl_table=11
FT                   /locus_tag="SCA_0416"
FT                   /product="conserved hypothetical protein"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /note="InterPro: Protein of unknown function DUF199"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0416"
FT                   /db_xref="GOA:B9DJL1"
FT                   /db_xref="InterPro:IPR003802"
FT                   /db_xref="InterPro:IPR018478"
FT                   /db_xref="InterPro:IPR023054"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039518"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DJL1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27330.1"
FT                   /translation="MSFASDMKNELTRIDVDEKNARAELSALIRMNGALSLSNQQFVIN
FT                   VQTENATTARRIYSLIKKVFNIEVEILVRKKMKLKKNNIYICRTKVKSREILDELGILK
FT                   DGVFTHAIDPDMIQDDEMKRSYLRGAFLAGGSVNNPETSSYHLEIFSLYENHSEGLAEL
FT                   MNEYELNAKHLERKKGSIVYLKEAEKISDFLSLIGGYQAMLKFEDVRIVRDMRNSVNRL
FT                   VNCETANLNKTVSAAMRQVESIQLIDQEIGIENLPERLKEIAKLRVENQDVSLKELGEM
FT                   VSTGTISKSGVNHRLRKLNELADKIRSGEHIDM"
FT   CDS_pept        complement(430101..431276)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0417"
FT                   /product="putative permease of the major facilitator
FT                   superfamily"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /note="(P43531) Hypothetical transport protein
FT                   ynfM,InterPro: Major facilitator superfamily"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0417"
FT                   /db_xref="GOA:B9DJL2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJL2"
FT                   /inference="similar to AA sequence:UniProtKB:P43531"
FT                   /protein_id="CAL27331.1"
FT                   /translation="MDQKFNYNLITTVFFITGIAVMCSLYSAIPLMPVIGKELHLSESA
FT                   TTLIGVVFSISYSVSCMFYGIISDKFGKKKVILVGLYMLTLTTFAIGFIHNFILLLIVR
FT                   VIQGMAAASFSSVSLTYVTEVFPINKRVTAISFISTSFMLSGVIGQNLSDIIAAHMSWR
FT                   IVYFILTVVYILLAFWILRAIPKSPYHIPDTKFSVFFKNMRHIFDNKGIVLCFFVSLTI
FT                   LTSFVSMYTILNEFLTSKAIHADLTMISTVKLFGLIGMLLALAAGRVSDFIGVKKVLLI
FT                   ALLTSGISIILMGISHNVIIITTFSVIFIAGIAFAIPSVISQIGLLTDKDKGFYLSINT
FT                   FMLFIGTAIAPVLSLRLLELPSYSLMFAVLSIVNFIGFAIAFFIPKAQITE"
FT   CDS_pept        complement(431668..432993)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0418"
FT                   /product="putative branched-chain amino acid transport
FT                   system II carrier protein"
FT                   /function="Branched-chain amino acid permeases"
FT                   /note="(P19072) Branched chain amino acid transport system
FT                   II carrier protein (LIV-II),InterPro: Branched-chain amino
FT                   acid transport system II carrier protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0418"
FT                   /db_xref="GOA:B9DJL3"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJL3"
FT                   /inference="similar to AA sequence:UniProtKB:P19072"
FT                   /protein_id="CAL27332.1"
FT                   /translation="MKKVILVSGLMLFSLFFGAGNLIFPPMLGYTAQGNMWVGMTGFAI
FT                   TGILMPYITVIVIAYYDGGVEFIGNRVHPKFGFIFAVCIYLSIGALYGIPRAANVAYEI
FT                   GAKSILPFHNTWTLVGFSLVFFIVVGLIALYPNRMVDNLGKVLTPALLLVIGALCIAAI
FT                   IHPEGKVGEPHGKYAEAPLVSGILEGYYTMDLVAALAFSVVIVQSFKLAGISDSKKIVK
FT                   NVILAGLISAVLLTIIYFSLAYLGITTSKPGFENGASILTYNSVRLFGAFGNILFGVIV
FT                   ILACLTTCIGLVNASSAFGMKKFPKISYKTYVLVFSLVGFLISTLGLNMILQIAVPLLT
FT                   FIYPISIVLVLISLVAIVIPTHLKIAYILPTISTLIISVLEILNTFKLIKPLNHLYQAL
FT                   PLSEQGLAWLYPFLVLTIIGIIIDFMRNKNTVRSNQVDEQKA"
FT   tRNA            complement(433261..433332)
FT                   /gene="tRNA-Arg (CCG)"
FT                   /locus_tag="SCA_t0010"
FT                   /product="transfer RNA-Arg (CCG)"
FT                   /anticodon="(pos:433297..433299,aa:Arg)"
FT                   /note="tRNA-Sca_0010"
FT                   /inference="nucleotide motif:tRNAscan"
FT   CDS_pept        433481..434065
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="SCA_0419"
FT                   /product="putative ATP-dependent Clp protease proteolytic
FT                   subunit"
FT                   /function="Protease subunit of ATP-dependent Clp proteases"
FT                   /EC_number="3.4.21.92"
FT                   /note="(Q8CTE0) ATP-dependent Clp protease proteolytic
FT                   subunit (EC 3.4.21.92) (Endopeptidase Clp),InterPro: Clp
FT                   protease"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0419"
FT                   /db_xref="GOA:B9DJL4"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DJL4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27333.1"
FT                   /translation="MNLIPTVIETTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIV
FT                   SQLLFLQAQDAEKDIYLYINSPGGSVTAGFAIYDTIQHIKPDVQTICIGMAASMGSFLL
FT                   AAGAKGKRFALPNAEVMIHQPLGGAQGQATEIEIAATHILKTRAKLNKILAERTGQSIE
FT                   QIEKDTDRDNFLTADEAKEYGLIDEVMQPEK"
FT   CDS_pept        complement(434389..435291)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0420"
FT                   /product="putative nucleoside-diphosphate sugar epimerase"
FT                   /function="predicted nucleoside-diphosphate sugar
FT                   epimerase"
FT                   /note="(O31574) Hypothetical UPF0105 protein yfhF"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0420"
FT                   /db_xref="GOA:B9DJL5"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJL5"
FT                   /inference="similar to AA sequence:UniProtKB:O31574"
FT                   /protein_id="CAL27334.1"
FT                   /translation="MKEFLITGGTGLVGSHLVDAIHDTDSHITILTRQDRHNLDDKITY
FT                   VNWEKEGWEEKVPNHIDIVINLAGASLNNRWTDDYKRELMLSRIRSTQALFELFEHKGT
FT                   HPSVLFNASAVGYYRPDFHRTYTELSKCDPHDFLSDITYQWERLARQFEKLGTRVIIGR
FT                   FGMILSDEGGALPTMKLPYRFYFGGKLGTGFQWYSWIHIADLTRAILFLINDSQAEGVF
FT                   NLTAPVSERQNLFGYTLAREMHKPHETWAPSLILRLVLGQRATIILDTQKAIPNRLQAR
FT                   GFNFAFPNLKAALDNLARE"
FT   CDS_pept        435881..436771
FT                   /transl_table=11
FT                   /locus_tag="SCA_0421"
FT                   /product="hypothetical protein"
FT                   /function="AAA ATPase containing von Willebrand factor type
FT                   A (vWA) domain"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0421"
FT                   /db_xref="GOA:B9DJL6"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJL6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27335.1"
FT                   /translation="MSNKGRNDFDRSSKNKMSNLAKIVSAIIVVILLFTLAFATFSFVD
FT                   HSKKGSERLSQEQKKEKQEKKEKKEKKEREEKKKKDEEKKRKEKQRQEEEWANQQAAEQ
FT                   ERQNNLNAQREQAARQEQQNQNVQKQQPKNNKAQQEQSKKQQEQARKDQEAAQKQAEEQ
FT                   QKKNEEVAKERQQQAKEQADKAMEQQKQQEQQKAQDDKQKQQQQQQQQEQQKSNQNQQQ
FT                   KQQQNSQNQQSNNKPRPGQEQQQQQPTVKNTPSSNQSNTQSSSGSNQAQSKQTPSNSSN
FT                   NSAQKPSSNNQSSQH"
FT   CDS_pept        complement(436847..437077)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0422"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0422"
FT                   /db_xref="GOA:B9DJK5"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJK5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27336.1"
FT                   /translation="MAEKDEQPEVIDPEDPRYKDDTYFQPTHSNQQKSNFENQRRIKYY
FT                   SFGGCFPIGCGCLPILIILSFLITWLLNLMN"
FT   CDS_pept        437391..438407
FT                   /transl_table=11
FT                   /locus_tag="SCA_0423"
FT                   /product="putative transcriptional regulator with sugar
FT                   binding domain"
FT                   /function="Transcriptional regulator contains sigma
FT                   factor-related N-terminal domain"
FT                   /note="(P35168) Central glycolytic genes
FT                   regulator,InterPro: Putative sugar-binding domain"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0423"
FT                   /db_xref="GOA:B9DJJ4"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJJ4"
FT                   /inference="similar to AA sequence:UniProtKB:P35168"
FT                   /protein_id="CAL27337.1"
FT                   /translation="MEDLLKVQQKLIPELVDRMYRRFTILTTIKMHQPVGRRSLSEYMN
FT                   LTERVLRSETNTLKKQELIKVKPTGMEITDEGERLIDELETYFNMYSDGYHLAQLIKER
FT                   YQINNVYVVPGDTDIDSAVKKEMGNQAGQLLEKTFYKDAIVSITGGSTMASVSDSMHVL
FT                   PFKTFFVPARGGLGENMVYQANTIAASMAEQTGGDYTTLYVPDNVSESTYELLLQEPSV
FT                   INTLDKIKQSNITVHGIGDALKMANRRHSPKDVIEMLQHHNAVGEAFGYYFDTNGNIVH
FT                   KVKTIGLQMEDLESKQYIFAVAGGASKGEAIKAYLSIAPKNTILITDEGAAKTIVQS"
FT   CDS_pept        438473..439480
FT                   /transl_table=11
FT                   /gene="gapA"
FT                   /locus_tag="SCA_0424"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase"
FT                   /function="Glyceraldehyde-3-phosphate
FT                   dehydrogenase/erythrose-4-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0424"
FT                   /db_xref="GOA:B9DJJ5"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJJ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27338.1"
FT                   /translation="MAVKVAINGFGRIGRLAFRRIQDVEGIDVVAVNDLTDDEMLAHLL
FT                   KYDTMQGRFTEEVEVVDGGFRVNGKEVKSFEEPDASKLPWKDLDIDVVLECTGFYTSEE
FT                   KAKAHIDAGAKKVLISAPATGDVKTIVYNVNQDTLDSSDVIVSGASCTTNSLAPVAQVL
FT                   NDSFGLVEGFMTTIHAYTGDQNTQDGPHRKGDKRRARAAAENIVPNSTGAAKAIGKVIP
FT                   EIDGKLDGGAQRVPVATGSLTELTVVLDKDVTVDEVNEAMKQASNESFGYNEDEIVSSD
FT                   VVGMTFGSLFDATQTRVMTVSGRQLVKVAAWYDNEMSYTAQLVRTLEYLIKDVK"
FT   CDS_pept        439744..440934
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="SCA_0425"
FT                   /product="phosphoglycerate kinase"
FT                   /function="3-phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="(Q928I0) Phosphoglycerate kinase (EC
FT                   2.7.2.3),InterPro: Phosphoglycerate kinase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0425"
FT                   /db_xref="GOA:B9DJJ6"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DJJ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27339.1"
FT                   /translation="MAKKHVSDLDLKGKVVLERADFNVPLKDGKITNDNRIVQALPTIE
FT                   YILDQGGRLVLFSHLGKVKEESDKEKLTLRPVAERLSEKLGKDVNFIPHTRGEVLEKAI
FT                   AELKDGEVLLVENTRFEDLDGKKESKNDPELGKYWASLGDVFVNDAFGTAHRSHASNVG
FT                   IASNLESAAGDLMEKEIKFIGGVVNNPDKPVVAILGGAKVSDKIGVIENLLNVADKVLI
FT                   GGGMAYTFLKAQGYEIGKSLLEADKVDFAKDLLERAGDKIVLPVDAKVAREFSNEAQFT
FT                   VVTIDQIPADQEALDIGPKTVELFEKELKGAHTVVWNGPMGVFEFENFAQGTVGVCEAI
FT                   AEMKDATTIIGGGDSAAAAMMLGFEDDFSHISTGGGASLEYLEGKELPGIQSISDK"
FT   CDS_pept        440977..441738
FT                   /transl_table=11
FT                   /gene="tpiA"
FT                   /locus_tag="SCA_0426"
FT                   /product="triosephosphate isomerase"
FT                   /function="Triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /note="(Q9Z5C3) Triosephosphate isomerase (EC 5.3.1.1)
FT                   (TIM),InterPro: Triosephosphate isomerase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0426"
FT                   /db_xref="GOA:B9DJJ7"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJJ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27340.1"
FT                   /translation="MRKPIIAGNWKMNKTVQEAKDFVNELPQLPDTNEVEAVICAPTIQ
FT                   LDALITLVKEGKAEGLEIGAENTYYEESGAFTGETSPVALADLGVKYVIIGHSERRELF
FT                   HETDEDVNKKVHAVFKHGMTPIICVGETNEQRESGKAEEVVSDQVKKALAGLSDEQLKQ
FT                   VVIAYEPIWAIGTGKSSTAKDANEMSAFIRKTVAELSNQEVADAVRIQYGGSVKPNNIA
FT                   EYMAESDIDGALVGGASLKVEDYVKLLEGAK"
FT   CDS_pept        441740..443257
FT                   /transl_table=11
FT                   /gene="gpmI"
FT                   /locus_tag="SCA_0427"
FT                   /product="2,3-bisphosphoglycerate-independent
FT                   phosphoglycerate mutase"
FT                   /function="Phosphoglyceromutase"
FT                   /EC_number="5.4.2.1"
FT                   /note="(Q8CPY4) 23-bisphosphoglycerate-independent
FT                   phosphoglycerate mutase (EC 5.4.2.1) (Phosphoglyceromutase)
FT                   (BPG-independent PGAM) (iPGM),InterPro: Phosphoglycerate
FT                   mutase 23-bisphosphoglycerate-independent"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0427"
FT                   /db_xref="GOA:B9DJJ8"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJJ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27341.1"
FT                   /translation="MAKQPTALIILDGFANRESEHGNAVKQAFKPNFDRYYEKYPTTQI
FT                   EASGLAVGLPEGQMGNSEVGHMNIGAGRIVYQSLTRINKAIEDGDFFENEVLNEAIDHV
FT                   KSHDSALHVFGLLSDGGVHSHYKHLFAILELAKKQGLDKVYVHGFLDGRDVDQKSALKY
FT                   VKETEEKFKEIGIGQFASISGRYYAMDRDKRWEREEKAYNAIRDIDAPEYASAEEGIEA
FT                   NYENGVTDEFVVPFSIKEQNEGVQDGDSVVFFNFRPDRAGQLSEIFTNKDFKGFDVEQP
FT                   NDLFFATFTKYNDQVDASIVFEKVDLKQTIGEVAEANNLKQLRIAETEKYPHVTYFMSG
FT                   GRNEEFEGERRRLIDSPKVATYDLKPEMSAYEVKDALLEELDKGDLDLILLNFANPDMV
FT                   GHSGMLEPTVKAIEAVDECLGEVVDKIIDMGGHAIITADHGNSDQVLTDDDEPMTTHTT
FT                   NPVPVIVTKEGVTLRETGKLGDLAPTLLDLLNVSQPEEMTGVSLIEH"
FT   CDS_pept        443353..444657
FT                   /transl_table=11
FT                   /gene="eno"
FT                   /locus_tag="SCA_0428"
FT                   /product="2-phospho-D-glycerate hydrolase (enolase)"
FT                   /function="Enolase"
FT                   /EC_number="4.2.1.11"
FT                   /note="(Q8CPY3) Enolase (EC 4.2.1.11) (2-phosphoglycerate
FT                   dehydratase) (2-phospho-D-glycerate hydro-lyase),InterPro:
FT                   Enolase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0428"
FT                   /db_xref="GOA:B9DJJ9"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DJJ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27342.1"
FT                   /translation="MPIITDVYAREVLDSRGNPTVEVEVLTESGAFGRALVPSGASTGE
FT                   YEAVELRDGDKDRYLGKGVTKAVENVNEKIAPEIVEGEFSVLDQVSIDKMMIQLDGTEN
FT                   KGKLGANAILGVSIAVARAAADLLGQPLYKYLGGFNGKQLPVPMMNIVNGGSHSDAPIA
FT                   FQEFMILPVGADSFKESLRWGAEIFHNLAKILKKRGLETAVGDEGGFAPKFHGTEDAVD
FT                   TILEAIKAVGLEPGKDVYLGFDIASSEFYENGVYDYTKFEGPEGAKRTSAEQVDYLEEL
FT                   VNKYPIITIEDGMDENDWDGWKQLTDRLGKKVQLVGDDLFVTNTKKLSEGIEKGIGNSI
FT                   LIKVNQIGTLTETFDAIQMAQKAGYTAVISHRSGETEDTTIADIAVATNAGQIKTGSLS
FT                   RTDRIAKYNQLLRIEDELYETAEFDGIHSFYNLDK"
FT   CDS_pept        444845..445315
FT                   /transl_table=11
FT                   /locus_tag="SCA_0429"
FT                   /product="putative membrane protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0429"
FT                   /db_xref="GOA:B9DJK0"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJK0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27343.1"
FT                   /translation="MQTTEQEKELRAKKSGRFIAYASVILAVIYAIYLFVSLDNSVVAD
FT                   ILTSHHINATKNAVGNFINSYRLTGIMYLIAYMCGLIAIWNQHTYLWWFLFAVYISQAF
FT                   YTAVNAGVIIQSINHVKSGFMTLPLWITIIGSLALAVYMLVISIKRKSTFNR"
FT   CDS_pept        445406..445642
FT                   /transl_table=11
FT                   /gene="secG"
FT                   /locus_tag="SCA_0430"
FT                   /product="putative preprotein translocase subunit SecG"
FT                   /function="Preprotein translocase subunit SecG"
FT                   /note="(O32233) Probable protein-export membrane protein
FT                   secG,InterPro: Preprotein translocase SecG subunit"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0430"
FT                   /db_xref="GOA:B9DJK1"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJK1"
FT                   /inference="similar to AA sequence:UniProtKB:O32233"
FT                   /protein_id="CAL27344.1"
FT                   /translation="MHTLLTVLLVIDCIALITVVLLQESKSNGLSGAISGGAEQLFGGK
FT                   QKQRGVDLFLNRVTIGLSIAFFVLMLAITYFNM"
FT   CDS_pept        445733..446473
FT                   /transl_table=11
FT                   /gene="est"
FT                   /locus_tag="SCA_0431"
FT                   /product="carboxylesterase precursor"
FT                   /function="Esterase/lipase"
FT                   /EC_number="3.1.1.1"
FT                   /note="(Q06174) Carboxylesterase precursor (EC
FT                   3.1.1.1),InterPro: Esterase/lipase/thioesterase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0431"
FT                   /db_xref="GOA:B9DJK2"
FT                   /db_xref="InterPro:IPR012354"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJK2"
FT                   /inference="similar to AA sequence:UniProtKB:Q06174"
FT                   /protein_id="CAL27345.1"
FT                   /translation="MQIKLPKPFFFEEGKRAVLLLHGFTGNSSDVRQLGRFLQKKGYTS
FT                   YAPQYEGHAAPPEEILQSSPHVWFKDALDGYDFLVEHGYDEIVVAGLSLGGDFALKLSL
FT                   NRDVEGIVTMCAPMFIKTEGSMYEGVLEYARNFKKYQGKDEATINREMEAFHPTHTLKE
FT                   LQQTIQGVRDHVDEVMDPLLVIQAEQDKMINPESANVIYDEASSEDKNIKWYADSGHVI
FT                   TIDKEKEKVFEDIYEFLESLDWPE"
FT   CDS_pept        446512..448869
FT                   /transl_table=11
FT                   /gene="rnr"
FT                   /locus_tag="SCA_0432"
FT                   /product="putative ribonuclease R"
FT                   /function="Exoribonuclease R"
FT                   /EC_number="3.1.-.-"
FT                   /note="(O32231) Ribonuclease R (EC 3.1.-.-) (RNase R) (VacB
FT                   protein homolog),InterPro: VacB and RNase II family 3-5
FT                   exoribonuclease"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0432"
FT                   /db_xref="GOA:B9DJK3"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJK3"
FT                   /inference="similar to AA sequence:UniProtKB:O32231"
FT                   /protein_id="CAL27346.1"
FT                   /translation="MNLKQSVAEIIKQPDYEPMSVSDFQDCLGLNNADSFRDLIKVLVE
FT                   LEQSGLVERTKTDRYQRKGSQTMKNNLVKGTLSQNKKGFAFLRPEDEEMEDIFIPPTKI
FT                   NRAMDGDTVIVEVQPSKGEFKGKVEGEVKTIEKHSVTQVVGTYTEGRHFGFVIPDDKRI
FT                   MQDIFIPKGQSLGVVEGHKVLVQISKYAQGNDNPEGHISAILGHKNDPGVDILSIIYQH
FT                   GIEIEFPDEVLKEAEAIPETIEPSEIEGRRDLRDEMTITIDGADAKDLDDAISLKKLPN
FT                   GNTQLTVSIADVSHYVKEGSALDKEAYDRGTSVYLVDRVIPMIPHRLSNGICSLNPNVD
FT                   RLTLSCRMEIDQDGNVKNHEIFDSVIESDHRMTYDEVNKIITDKDPELREKYKDVTPML
FT                   DLAQDLSNRLKEMRKRRGEIDFDIDEAKVLVNEEGIPVDVQMRDRGEGERLIESFMLAA
FT                   NETVAEHFSKMEVPFIYRVHEQPKSDRLTQFFDFITNFGIMVRGTGEDISPSTLQEIHE
FT                   KVKGLPEQTVVSTMMLRSMQQARYEDANLGHFGLSADYYTHFTSPIRRYPDLVVHRLIR
FT                   KYLIDETMDRKELKKWEDKLPEIAEHTSNRERRAIEAERDTDELKKAEFMLQHIGEEYE
FT                   GIISSVANFGMFVELPNTVEGMVHVSNMTDDYYQFAEGQMAMIGERSGNVFRIGDSVKI
FT                   KVVNVDVEQRMIDFQIVGMPEPKRRKSEDRPARGTTIQAKSRGKSLSGDKKKGKKKQRK
FT                   GKNQRSRDKQNNTQHKPYYKSKKVKQKARKKK"
FT   CDS_pept        448945..449415
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /locus_tag="SCA_0433"
FT                   /product="putative tmRNA-binding protein SmpB"
FT                   /function="tmRNA-binding protein"
FT                   /note="(Q7VM64) SsrA-binding protein,InterPro: SmpB
FT                   protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0433"
FT                   /db_xref="GOA:B9DJK4"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DJK4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27347.1"
FT                   /translation="MSKKKKKSPGTLAENRKARHDYNIEDTIEAGIVLRGTEIKSIRRG
FT                   SANLKDSFAQVKNGEIYVHNMHIAPYEEGNRFNHDPLRPRKLLLHKREIEKLGTRTREI
FT                   GYSIIPLKLYLKHGVCKVLIGVARGKKKYDKRQDLKDKAVKRDMQRAMKDRY"
FT   misc_RNA        449570..449798
FT                   /gene="NEW_REGION_507"
FT                   /note="NEW_REGION_507"
FT   CDS_pept        450785..451387
FT                   /transl_table=11
FT                   /locus_tag="SCA_0434"
FT                   /product="putative flavoprotein oxygenase, DIM6/NTAB family
FT                   protein"
FT                   /function="conserved protein/domain typically associated
FT                   with flavoprotein oxygenases DIM6/NTAB family"
FT                   /note="(O05220) Hypothetical protein ywrF"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0434"
FT                   /db_xref="GOA:B9DJJ3"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJJ3"
FT                   /inference="similar to AA sequence:UniProtKB:O05220"
FT                   /protein_id="CAL27348.1"
FT                   /translation="MFINPSETEMGNMYKLLIGTVTPRPIAFVTSQDENGNLNAAPFAF
FT                   FNVVCPEPPMLMISVGKQDGALKDTNSNIIKNKEFVVHIVDESIVKEVVKTGDNYPHDI
FT                   NELEKTNLTTTPSKTVSVPSVKEAKVRYECELVEHLSLGDEKNGTDMLIGQVKAVYIDD
FT                   EIYDVEHGYVDVEKLNPISRVIGNQYVKIGESIEDLL"
FT   CDS_pept        451535..452599
FT                   /transl_table=11
FT                   /locus_tag="SCA_0435"
FT                   /product="BNR repeat domain protein"
FT                   /note="InterPro: Glycosyl hydrolase BNR repeat"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0435"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJI1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27349.1"
FT                   /translation="MKKIFLGMVDELVIINEKNNGGFDIETRLEGTHPVDLVQHPDSPE
FT                   IMYCATYGNGLWKSNDEGNHWKAIGQMNAYHEPTKGLGIKSAYITAVAINPNNPDILYV
FT                   GTEPSAIYYSEDGGQTFTEFEEVQNLPSQPFWEFPARPYTHHVQDLMPSSKEENTLNAA
FT                   IEFGAFINSNDGGESWNDRPFFSPRDVHQMATHNAVPGKLFAVCGDGLAIKGHSFAESD
FT                   NDGMSWSYSSEGLEKYPYLYTIAVNPNSERDIFVGAAENAFAAHHRDEDKGYPRSTVFR
FT                   RNDEGSWEDSSEGLPNEDMYISQLEADPKALDTFYALNNRGLYKFANSEWNRVDIPWKE
FT                   KYLDQHPTFLKIIK"
FT   CDS_pept        complement(452697..453425)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0436"
FT                   /product="similar to exotoxin"
FT                   /note="(P06886) Toxic shock syndrome toxin-1 precursor
FT                   (TSST-1),InterPro: Staphylococcal/Streptococcal toxin
FT                   beta-grasp"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0436"
FT                   /db_xref="GOA:B9DJI2"
FT                   /db_xref="InterPro:IPR006123"
FT                   /db_xref="InterPro:IPR006126"
FT                   /db_xref="InterPro:IPR008375"
FT                   /db_xref="InterPro:IPR008992"
FT                   /db_xref="InterPro:IPR013307"
FT                   /db_xref="InterPro:IPR016091"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJI2"
FT                   /inference="similar to AA sequence:UniProtKB:P06886"
FT                   /protein_id="CAL27350.1"
FT                   /translation="MKKQIIKKVILSTSITLMGLGAVSTFNSDPSLSSQVHAAQFQGQN
FT                   QADELKKYYSQTPEIFSNKKLTQVEEGSDKGKIYVKIQSSWGAFINVIGNQSWGNVNKL
FT                   RGKQVDVFGIKDKPTSQYWWAYTEYFTGGVTPAANPSAPVYPIKVTVKKNAHVKSSFDI
FT                   KAFETRKDKITLKELDFQIRKALINNNNLYSNGQNTGTVQITTKDNQLFTFDLNKRLEN
FT                   ERANVYVDGKNIATIIADIK"
FT   CDS_pept        453810..454013
FT                   /transl_table=11
FT                   /gene="csp"
FT                   /locus_tag="SCA_0437"
FT                   /product="putative cold-shock protein"
FT                   /function="Cold shock proteins"
FT                   /note="(Q54974) Major cold-shock protein,InterPro:
FT                   Cold-shock DNA-binding domain"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0437"
FT                   /db_xref="GOA:B9DJI3"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJI3"
FT                   /inference="similar to AA sequence:UniProtKB:Q54974"
FT                   /protein_id="CAL27351.1"
FT                   /translation="MNNGTVKWFNAEKGFGFIERENGDDVFVHFSAIQGDGYKTLEEGQ
FT                   SVDFDIVEGDRGEQAANVVKMS"
FT   CDS_pept        454120..454605
FT                   /transl_table=11
FT                   /locus_tag="SCA_0438"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0438"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJI4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27352.1"
FT                   /translation="MQIFRVSPDPKVSAEFLDNRRLSKQVLELYQIIRVCLGELDVIKT
FT                   GPGYRHHPVVEAVYNNGKPYLWGAWILLAAMNEEHMRRGGKRSEVFKKELEGLYDVVKK
FT                   TDQTLSLSHEDLPPFYIEGEKRIYGGEAYQMYVKLLFDKWQHDKIPPRCDINLNNKA"
FT   CDS_pept        complement(454648..455067)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0439"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0439"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJI5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27353.1"
FT                   /translation="MGLFDNINLETEYLRSLSVKKRKAYKEKPVSVKKELLNQFKYETE
FT                   TFNNKASHDIIKRFLESKGIYEPTEKMISAIGNRELDNFIYQSPSPNTSETPSSTHEKE
FT                   DKINWQNEKIIKQNEEIIHQNKKIIKLLTKIHEKS"
FT   CDS_pept        complement(455256..455966)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0440"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0440"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJI6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27354.1"
FT                   /translation="MKKVLFLILASFLALAACSDDDKTSHKKDKQTSKSEKKDKNKASK
FT                   KEKSKHDTRGSNEKIAEKNQDDSSVDTKNQSSTQHQNPQVNLGDIRDRSTLESIIYGDY
FT                   SEMEKIQAYNSAVANGVIPQGNVMEGPASAAYQSSLRVESGAEKSVYDQSQSSEQDEPT
FT                   EDVNTEINNAQTEDEYVDALRKKYNGGLSSGEMQTKTAIEQGYYDGDDGPEVYQKIKER
FT                   EADIEAGKYDQYKQ"
FT   CDS_pept        complement(456076..457380)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0441"
FT                   /product="putative cation transport protein of TrkH family"
FT                   /function="Trk-type K+ transport systems membrane
FT                   components"
FT                   /note="(P43440) V-type sodium ATP synthase subunit J (EC
FT                   3.6.3.14) (Na(+)-translocating ATPase subunit J),InterPro:
FT                   Cation transporter"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0441"
FT                   /db_xref="GOA:B9DJI7"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJI7"
FT                   /inference="similar to AA sequence:UniProtKB:P43440"
FT                   /protein_id="CAL27355.1"
FT                   /translation="MDFLKKPLSVYLLLFLTTTLIGAFLLYLPITGKQPTPFIDAFFVA
FT                   SSAFTVTGLSTVDITTQFNWLGDLIIMLLIQIGGLGIVTITTLTLIIANRRISLHDRRL
FT                   IMVTWNVEEPGGMVRFIRQLVIYSFTSELIGMLLLSLSFIPRYGFGKGVYISLFTSVSA
FT                   FNNAGFALFSKNMIGFNNDPVVNIVIPLLIILGGLGPLIMLDLLKTRRLSKLKLHTKVV
FT                   MSTTLVLIIGGAILYYILEFNNTLKHFNIWGQVGTAFFQSVTTRTAGFQSVDLGLIHTP
FT                   TAILMMILMFIGGAPFSAAGGIKVTTFMVLIMFVYSTLKNENSTVIFHRTIQPKTISKA
FT                   VAITAVSGIFVLFITFIVSLLNETTPFIKVIFEVVSAFGTVGLSMDFTTEYHAATKAII
FT                   ILVMICGKIGVATVLALFIPNKKRLYQYAKGNIYL"
FT   CDS_pept        457433..458176
FT                   /transl_table=11
FT                   /locus_tag="SCA_0442"
FT                   /product="putative lemA family protein"
FT                   /function="uncharacterized conserved protein"
FT                   /note="(P43054) Hypothetical 25.5 kDa protein in gyrB
FT                   5region (ORF219),InterPro: LemA family"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0442"
FT                   /db_xref="GOA:B9DJI8"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJI8"
FT                   /inference="similar to AA sequence:UniProtKB:P43054"
FT                   /protein_id="CAL27356.1"
FT                   /translation="MLLYIFFAYMHYFNEKYFCNNFSVIKLCMVSIIVILVDFMYNIVK
FT                   NLLEKGVKKLKKTLTPIIIIGIVIVIIGAMMIGPYNKLIGLDEDTDKALSNIDNQLQRR
FT                   VDLIPNLVNTVKGYTKHEEDVFKQVSDARSKLAGANSPKEKAEANDEVNSSLSRLLAIS
FT                   EKYPDLKADKQFTGLRDELAGTENRIAVSRKDYNDSVNEYNQAIRHFPTTIVAKIFGFD
FT                   KKEYFKADKGAEKAPKVDFGTDSSQ"
FT   CDS_pept        458224..459027
FT                   /transl_table=11
FT                   /locus_tag="SCA_0443"
FT                   /product="putative membrane protein"
FT                   /function="Beta-propeller domains of methanol dehydrogenase
FT                   type"
FT                   /note="(P55140) Hypothetical protein ygcG,InterPro: Protein
FT                   of unknown function DUF477"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0443"
FT                   /db_xref="GOA:B9DJI9"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJI9"
FT                   /inference="similar to AA sequence:UniProtKB:P55140"
FT                   /protein_id="CAL27357.1"
FT                   /translation="MAGQSVFASEKFPPLEKPVFVQDHADIVSQKDKDDIVKKGQKLQD
FT                   GTDADILVMTMKSIGNTPREDYAYEAGRHYKVGDQKHNRGIVILVNLDNGNENNNRGVQ
FT                   VAVGDGLEGVLNDAKVGRLIDEKFSPYAKKAIEADSKAESKQYYSQGITNLYNAIWDEI
FT                   AKAYGYDGKHFKEKAPKETDHSGSGGFLESFGAIFVIVIIILIIITKNGGGPPRGGGRR
FT                   RDDSGMWWIGPGSGGFGNGSSGGGYSGGSFGGGGGFSGGGAGRGF"
FT   CDS_pept        459247..459528
FT                   /transl_table=11
FT                   /locus_tag="SCA_0444"
FT                   /product="hypothetical protein"
FT                   /function="uncharacterized conserved protein contains
FT                   double-stranded beta-helix domain"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0444"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJJ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27358.1"
FT                   /translation="MKKITGTGKTGPIYQSDNQTIVNIVFKAGESLPIHSSPNCVVVVP
FT                   VRGTIQFKGEDFDERIAPGSLVRIEPDEKHSLEALTDAELMVIKSELA"
FT   CDS_pept        459714..459917
FT                   /transl_table=11
FT                   /locus_tag="SCA_0445"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0445"
FT                   /db_xref="InterPro:IPR023089"
FT                   /db_xref="InterPro:IPR036806"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJJ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27359.1"
FT                   /translation="MSFYKFILTFMEDDTPFGQLADYITKDHNFPKEETNVQNIYDYVH
FT                   EHYMEHHLLESANRAMSIYENN"
FT   CDS_pept        complement(460154..460549)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0446"
FT                   /product="hypothetical protein"
FT                   /note="(Q10845) Hypothetical protein Rv2012/MT2067/Mb2035"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0446"
FT                   /db_xref="InterPro:IPR009833"
FT                   /db_xref="InterPro:IPR036696"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJJ2"
FT                   /inference="similar to AA sequence:UniProtKB:Q10845"
FT                   /protein_id="CAL27360.1"
FT                   /translation="MKFTKFNLKQALNSEVSTADFPETLKKIRECSVAKYVYDVKKGIY
FT                   TFTNQDGDEIHIEGNSTSIIIPRHVDKTAFNEVLQASRAGEFTFDEFCNRAASFGIASW
FT                   LVDLIHFNTTYFSKSGDVVKIVEIPKN"
FT   CDS_pept        complement(460572..461090)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0447"
FT                   /product="putative acetyltransferase, similar to
FT                   lactococcal prophage ps3 protein 05"
FT                   /function="Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0447"
FT                   /db_xref="GOA:B9DJI0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJI0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27361.1"
FT                   /translation="MKEIRLLTQDDLEDVYRLFKEASQDRKNIYTWAIYDESNISEEYF
FT                   THLLDENNTIQYLFGVFHNGVLVGALTLFHPIIVGTKHKSIIENMYVKDIDHLDEQLLN
FT                   SVVEFCQEMNIEKILAPVASNNIGAMVFYSEYGFSKAGFETNSRKYGDHYIDEHWLIYP
FT                   IESVTSSHT"
FT   CDS_pept        461522..462247
FT                   /transl_table=11
FT                   /gene="aroD"
FT                   /locus_tag="SCA_0448"
FT                   /product="putative 3-dehydroquinate dehydratase"
FT                   /function="3-dehydroquinate dehydratase"
FT                   /EC_number="4.2.1.10"
FT                   /note="(Q8CPX1) 3-dehydroquinate dehydratase (EC 4.2.1.10)
FT                   (3-dehydroquinase) (Type I DHQase),InterPro: Dehydroquinase
FT                   class I"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0448"
FT                   /db_xref="GOA:B9DJG9"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DJG9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27362.1"
FT                   /translation="MSKVDVAVTIAPKEEITDQLKKDLIREQKSIDIIELRIDQRESFE
FT                   IADLERLFKTLKDLQLDVQVLVTYRTSVQGGKGQKNGNTYYEFLQDLIQIQGYDMVDIE
FT                   WDEAQTEILLQLIVQAQSAGLKVVLSQHDFDKTPNLEVLKFLYFKMNKLGADIVKLAVM
FT                   PNEKQDVLNLLEALATASESIEAKPVGISMSHLGLISRTAQGVFGGIISYGCLGTPQAP
FT                   GQIHVGQLKELLNIYEINK"
FT   CDS_pept        462320..462862
FT                   /transl_table=11
FT                   /locus_tag="SCA_0449"
FT                   /product="putative nitroreductase"
FT                   /function="Nitroreductase"
FT                   /note="InterPro: Nitroreductase family"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0449"
FT                   /db_xref="GOA:B9DJH0"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJH0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27363.1"
FT                   /translation="MELKDAITSRRSVKIFDHDMHIDDEALYEALKLSTDAPNHGMREP
FT                   WRIVHVSKDRLGDMSRSVSRFAFRNEPEKQQSHFDAVTKLGGLLVMIVKRDPRQKENLE
FT                   NHLAFGTYAQNLMLLLYEAGIGTCWKSPEYIFSPKVRKVLGVQADEDLVGFLYLTDLEG
FT                   KIPPKKPRHTESFISEY"
FT   CDS_pept        complement(462919..463242)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0450"
FT                   /product="putative thioredoxin"
FT                   /function="Thiol-disulfide isomerase and thioredoxins"
FT                   /note="(P22217) Thioredoxin II (TR-II),InterPro:
FT                   Thioredoxin type domain"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0450"
FT                   /db_xref="GOA:B9DJH1"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJH1"
FT                   /inference="similar to AA sequence:UniProtKB:P22217"
FT                   /protein_id="CAL27364.1"
FT                   /translation="MEAIKTREDFDKIIQSAEPVIIKFEAGWCPDCRAMDMWIDPIIKK
FT                   YDEYKWYSVNRDELEEVTQENEVMGIPSLLVFQYGDKLAHLHSANAKSPEQVESFLSET
FT                   FNK"
FT   CDS_pept        463387..463743
FT                   /transl_table=11
FT                   /locus_tag="SCA_0451"
FT                   /product="putative ArsC family protein"
FT                   /function="Arsenate reductase and related proteins
FT                   glutaredoxin family"
FT                   /note="(O32175) Hypothetical protein yusI,InterPro:
FT                   Conserved hypothetical protein ArsC related"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0451"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJH2"
FT                   /inference="similar to AA sequence:UniProtKB:O32175"
FT                   /protein_id="CAL27365.1"
FT                   /translation="MIRFYQYQNCTTCKKAAKFLDEYGVSYEPIDIVELNPNKRELQDI
FT                   IDKTGVEIDKLFNKRGGKYRELGLKDRLDDLSDDEKLDLLASDGMLVKRPLAVSGDKIT
FT                   LGFNEKEYKETWVN"
FT   CDS_pept        463900..464280
FT                   /transl_table=11
FT                   /gene="gcdH"
FT                   /locus_tag="SCA_0452"
FT                   /product="glycine cleavage system protein H"
FT                   /function="Glycine cleavage system H protein
FT                   (lipoate-binding)"
FT                   /note="(P46485) Glycine cleavage system H protein
FT                   mitochondrial precursor,InterPro: Glycine cleavage
FT                   H-protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0452"
FT                   /db_xref="GOA:B9DJH3"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DJH3"
FT                   /inference="similar to AA sequence:UniProtKB:P46485"
FT                   /protein_id="CAL27366.1"
FT                   /translation="MAVPEELKYSKEHEWVKVEGDTVTIGITEYAQGELGDIVFVELPE
FT                   TEDDIEESESFGSVESVKTVSELYAPVSGSVVEINEELEDSPEFVNESPYEKAWMVKVK
FT                   LNDESQLDDLLSADQYKEMIGE"
FT   CDS_pept        464560..464922
FT                   /transl_table=11
FT                   /locus_tag="SCA_0453"
FT                   /product="TOPRIM domain containing protein"
FT                   /function="Small primase-like proteins (Toprim domain)"
FT                   /note="InterPro: TOPRIM"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0453"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJH4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27367.1"
FT                   /translation="MALLDKVIVVEGKTDKKRVQEVINEPVQIMCTHGTMGIDKLDGMI
FT                   ESLYERPVFILVDADKEGNRIRQWFKQYLSESGHIFVDKTYCEVARCPRPYLARVLRKY
FT                   GFEVKEEAPVKGLVYR"
FT   CDS_pept        464919..465218
FT                   /transl_table=11
FT                   /locus_tag="SCA_0454"
FT                   /product="conserved hypothetical protein"
FT                   /function="Thiol-disulfide isomerase and thioredoxins"
FT                   /note="(P46843) Bifunctional thioredoxin
FT                   reductase/thioredoxin [Includes: Thioredoxin reductase (EC
FT                   1.8.1.9) (TRXR); Thioredoxin],InterPro: Thioredoxin domain
FT                   2"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0454"
FT                   /db_xref="GOA:B9DJH5"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJH5"
FT                   /inference="similar to AA sequence:UniProtKB:P46843"
FT                   /protein_id="CAL27368.1"
FT                   /translation="MSTSKEERTDITQNFDKDKHLIFGYTPMCGTCKISERMLDIANEI
FT                   LQLPVTKVDLNFHADFSEQYQIQSVPVLLIMSKDEEMKRIYAFQSVPYLLENLK"
FT   CDS_pept        465478..466503
FT                   /transl_table=11
FT                   /locus_tag="SCA_0455"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /function="ABC-type metal ion transport system ATPase
FT                   component"
FT                   /note="(P30750) D-methionine transport ATP-binding protein
FT                   metN,InterPro: ABC transporter"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0455"
FT                   /db_xref="GOA:B9DJH6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJH6"
FT                   /inference="similar to AA sequence:UniProtKB:P30750"
FT                   /protein_id="CAL27369.1"
FT                   /translation="MIQLKQIVKRYKTKHQDVLAVDHVDLDVAEGTIYGVIGFSGAGKS
FT                   TLVRILNYLEEPTSGEVIIDGEELGKLSKAQLRKKRQKVSMIFQHFNLLWSRTVLDNIT
FT                   FPLEIAGYNRRDAVKRAKELVQLVGLSGREKAYPSELSGGQKQRVGIARALANDPKVLL
FT                   CDEATSALDPQTTDEILELLLKIRKEQDLTIVIITHEMNVIRQICDEVAVMENGRVIER
FT                   GNVKEVFENPQHQVTKRFVKEGLNDEFDESIEELIPESQDGYILRFNFAGEETTEPIVS
FT                   FITQKYNLDVNILEANIRHSKNGPIGFLIVHIAGLKTEYFEEFKNELESHNVNVEVVRH
FT                   G"
FT   CDS_pept        466496..467191
FT                   /transl_table=11
FT                   /locus_tag="SCA_0456"
FT                   /product="putative ABC transporter permease protein"
FT                   /function="ABC-type metal ion transport system permease
FT                   component"
FT                   /note="(P46492) Probable D-methionine transport system
FT                   permease protein metI,InterPro: Binding-protein-dependent
FT                   transport systems inner membrane component"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0456"
FT                   /db_xref="GOA:B9DJH7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJH7"
FT                   /inference="similar to AA sequence:UniProtKB:P46492"
FT                   /protein_id="CAL27370.1"
FT                   /translation="MDKSFSDILQEMITMPNVQWDQVWQASLETLYMTAISTVFAFVIG
FT                   LILGVLLFLTAKSTSPAAKVFYQIVSFIVNLFRAIPFIILILLLIPFTSLILGTISGPT
FT                   GALPALVIGAAPFYARLVEIAFKEINKGVIEAARSMGANTWTIIRKVLIPEARPALISG
FT                   ITVTAIALVGSTAVAGVIGAGGLGNLAYLTGFTRNQNDVILVSTILILVFVFIIQFVGD
FT                   WATNKIDKR"
FT   CDS_pept        467225..468049
FT                   /transl_table=11
FT                   /locus_tag="SCA_0457"
FT                   /product="putative lipoprotein"
FT                   /function="ABC-type metal ion transport system periplasmic
FT                   component/surface antigen"
FT                   /note="(Q8ZH40) D-methionine-binding lipoprotein metQ
FT                   precursor,InterPro: NLPA lipoprotein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0457"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJH8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27371.1"
FT                   /translation="MKKIISILAVLVLTAALAACGNKDKTSSENSKTITVGASPAPHAE
FT                   ILEKAKPILKKEGYDLKIKTINDYTTPNKLVDNGELDANFFQHTPYLNTEKKSKGYKLV
FT                   SVGNVELEPMGVYSKKYKSLKDLPKGATVYVSNNPAEEGRFLKFFVDDGLIKLKKGVKI
FT                   QDAKFSDIVENKKDIKFNNKQSAEYLPKIYQNQDVDAAIINSNFAIEQHLSPKKDSIAL
FT                   EKPKDNPYANLVAVKDGDQNKKKIKALIKVLQSKEIKDYINKKYDGAVIPAK"
FT   CDS_pept        468422..469180
FT                   /transl_table=11
FT                   /locus_tag="SCA_0458"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /function="ABC-type transport system involved in Fe-S
FT                   cluster assembly ATPase component"
FT                   /note="(P80866) Vegetative protein 296 (VEG296),InterPro:
FT                   ABC transporter"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0458"
FT                   /db_xref="GOA:B9DJH9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJH9"
FT                   /inference="similar to AA sequence:UniProtKB:P80866"
FT                   /protein_id="CAL27372.1"
FT                   /translation="MPSTLEIKDLHVSIEDKEILKGVNLTINTGEIHAVMGPNGTGKST
FT                   LSAAIMGHPAYTVTQGEVLLDGVNVLELEVDERAKAGLFLAMQYPSEITGVTNADFMRS
FT                   AINAKREEGKEINLMQFIKKLDKEMEFLDMDPNMAQRYLNEGFSGGEKKRNEILQLMML
FT                   QPKFAILDEIDSGLDIDALKVVSKGINEMRGDDFGSLIITHYQRLLNYITPDFVHVMYN
FT                   GKIVKTGGEELAQRLENEGYEWVKEEFSEA"
FT   CDS_pept        469246..470553
FT                   /transl_table=11
FT                   /locus_tag="SCA_0459"
FT                   /product="conserved hypothetical protein"
FT                   /function="ABC-type transport system involved in Fe-S
FT                   cluster assembly permease component"
FT                   /note="(O50093) Hypothetical UPF0051 protein
FT                   PH1385,InterPro: Protein of unknown function UPF0051"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0459"
FT                   /db_xref="GOA:B9DJG8"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJG8"
FT                   /inference="similar to AA sequence:UniProtKB:O50093"
FT                   /protein_id="CAL27373.1"
FT                   /translation="MTTETLNISEAELVEYSQAHNEPSWMTDLRKEALKLTETLEMPKP
FT                   DKTKIDKWDFDSFKQLETTSDKYKDINDVPDSIEKVIDVEKSENLIIQHNNTLAFSRVS
FT                   ESAQKDGVIIEGLAEALVNHGDLVQKYLMQDAVTVDEHRLTALHTALINGGIFVYVPKN
FT                   VVVENPIQYVVLHDDENASFFNHVIIATEQSAEVTYVENYLSDVSGEGSQVNIVSEVIA
FT                   GANSKITYGAVDYLDKGFTGHIIRRGVTEADASINWALGLMNEGNQIIDNTTNLIGDRS
FT                   TSELKSVAVGTGSQKSNVTSKIVQYGVETDGYILKHGVVEDSATIIFNGIGYIKHGGSK
FT                   SVANQESRVLMLSEKARGDANPILLIDEDDVEAGHAASVGRVDDEQLYYLMSRGISQQE
FT                   AERLVIHGFLDPVVRELPIEDVKRQLREVIELKVAK"
FT   CDS_pept        470756..471988
FT                   /transl_table=11
FT                   /gene="csdB"
FT                   /locus_tag="SCA_0460"
FT                   /product="putative selenocysteine lyase"
FT                   /function="Selenocysteine lyase"
FT                   /EC_number="4.4.1.16"
FT                   /note="(Q99VG1) Probable cysteine desulfurase (EC
FT                   2.8.1.7),InterPro: Aminotransferase class V"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0460"
FT                   /db_xref="GOA:B9DJF6"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJF6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27374.1"
FT                   /translation="MADTLNVNEIIEDFPILKQQVNGKRLAYLDTTATSQKPLQVIEAI
FT                   DDYYKRYNSNVHRGVHTLGSLATDGYEGARETVRRFINAHYFEEIIFTRGTTASINLVA
FT                   RSYANISEGDEIVVTEMEHHANIVPWQELAHRKNASLKFIPMTETGELNIEDVKATIND
FT                   KTKIVAVAHVSNVLGTINDVKEIAKVAHEHGAIISVDGAQAAPHMKLDMQDLDVDFYSF
FT                   SGHKMLGPTGIGVLYGKRDLLKNMEPIEYGGDMIDFVGKYDATWTDLPVKFEAGTPLIA
FT                   QAIGLAEAIKYLENIGFDAIHAHEKELTEYAYEQMSQVEDLEIYGPPKDRRAGVITFNI
FT                   KDIHPHDVATALDTEGVAVRAGHHCAQPLMKWLGQSSTARASFYIYNTKEDIDQLVYAL
FT                   KQTKEFFSYEF"
FT   CDS_pept        471978..472448
FT                   /transl_table=11
FT                   /locus_tag="SCA_0461"
FT                   /product="NifU-like protein"
FT                   /function="NifU homolog involved in Fe-S cluster formation"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0461"
FT                   /db_xref="GOA:B9DJF7"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJF7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27375.1"
FT                   /translation="MNFNNLDQLYRSVIMDHYKNPRNKGKLDNGSLTVDMNNPTCGDRI
FT                   HLTFDIEDGIIQDAKFDGEGCSISMSSASMMTEAVKGHSLKEALEMSQEFSKMMLGEDY
FT                   ELTEDMGDIEALQGVSQFPARIKCATLAWKALEKGTVEREGKADANSEQDAN"
FT   CDS_pept        472679..474076
FT                   /transl_table=11
FT                   /gene="sufB"
FT                   /locus_tag="SCA_0462"
FT                   /product="putative FeS assembly protein SufB"
FT                   /function="ABC-type transport system involved in Fe-S
FT                   cluster assembly permease component"
FT                   /note="(Q55790) Hypothetical UPF0051 protein
FT                   slr0074,InterPro: Protein of unknown function UPF0051"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0462"
FT                   /db_xref="GOA:B9DJF8"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJF8"
FT                   /inference="similar to AA sequence:UniProtKB:Q55790"
FT                   /protein_id="CAL27376.1"
FT                   /translation="MAKQAPDVGDYKYGFHDEDVSIFRSERGLTENIVTEISKMKEEPQ
FT                   WMLDFRLKALKLFYKMPMPQWGGDLSELNFDDITYYVKPSEHAERSWDEVPEEIKRTFD
FT                   RLGIPEAEQKYLAGVSAQYESEVVYQNMEEELEEKGVIFKDTDSALREHEELFKEYFAS
FT                   VVPAGDNKFAALNSAVWSGGSFIYVPKNIKLDTPLQAYFRINSENMGQFERTLIIADEG
FT                   ASVNYVEGCTAPVYTTNSLHSAVVEIFVHKDAHVRYTTIQNWANNVYNLVTKRTMVHEN
FT                   GNMEWVDGNLGSKLTMKYPNCVLAGEGAKGSTLSIALAGKGQVQDAGAKMIHLAPNTSS
FT                   TIVSKSISKDGGKVVYRGIVKFGRKAKGARANIECDTLILDNKSTSDTIPYNEIMNDDI
FT                   SLEHEAKVSKVSEEQLFYLMSRGISEEEATEMIVMGFIEPFTKELPMEYAVEMNRLIKF
FT                   EMEGSIG"
FT   CDS_pept        complement(474144..475193)
FT                   /transl_table=11
FT                   /gene="int"
FT                   /locus_tag="SCA_0463"
FT                   /product="phage integrase"
FT                   /function="Integrase"
FT                   /note="(Q9CI63) Prophage ps2 probable integrase
FT                   (Int-TnX),InterPro: Phage integrase,Sca-Prophage"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0463"
FT                   /db_xref="GOA:B9DJF9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR028259"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJF9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27377.1"
FT                   /translation="MPVYKDSSTNKWYFSVRYKDVYGNNKRKMKRGYNTKREAKYAEAA
FT                   FLNDINEGYSDSNTFDYVFNHYLEHSDLRPKTKKRKINEYNRHFKDKFGHINMNKITQN
FT                   QCQEFRKYLMDNIPSTNTARTIWSGFKVVINYAKKYFGLRTDPTISIKPIPRIKTKPKY
FT                   MLREEFDERVKEVEEQDYQELFKLMFYTGLRIGEAMALVWTDYNKYKKEISIDKTMDIS
FT                   NRTIYPRPKTDSSEDIVPLPNFINEMLAERYQREKAANKYFDERSYFIFGGIAPKHYSH
FT                   VHKKFQKAFPQYNIHTLRHSYASYLANNGVDIFVLQSLMRHAQITETMGTYSHLYTQKK
FT                   HDAIAIFDE"
FT   CDS_pept        complement(475670..475852)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0464"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0464"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJG0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27378.1"
FT                   /translation="MKIKNYTLTYDNYRNLITIYAETESGKPFSYVFSEDQTVREIREK
FT                   LIEIANKLEQNEQVE"
FT   CDS_pept        complement(476194..476658)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0465"
FT                   /product="conserved hypothetical phage protein"
FT                   /note="Sca-Prophage,reporting helix-turn-helix motif"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0465"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJG1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27379.1"
FT                   /translation="MSKYEKMLITHENIAIKDTFELPGKFKGFYTDGVILIDKYLSPKE
FT                   KVEVLAEEIAHCKFTYGNIIDESEMFNRKLELKAKRMGAEMIITLSGIINAFEHGIYNL
FT                   YELAEYFEVSQHYVLNAIKHYKMKLGLSTCHDGYLIRFEPLQVFKYIDKE"
FT   CDS_pept        complement(476674..476997)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0466"
FT                   /product="putative repressor, phage associated"
FT                   /function="predicted transcriptional regulators"
FT                   /note="(O85264) Cryptic phage CTXphi transcriptional
FT                   repressor rstR,InterPro: Helix-turn-helix
FT                   motif,Sca-Prophage"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0466"
FT                   /db_xref="GOA:B9DJG2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJG2"
FT                   /inference="similar to AA sequence:UniProtKB:O85264"
FT                   /protein_id="CAL27380.1"
FT                   /translation="MFSRNLKYLRQKNGLEQIDLAHKLGRKSASSISEWEKGKYTPKMS
FT                   TLNKLAEIFNVSIDELMNEDLENGTSSEPKTLAAHLEGQDYTQEELDKILEFAEMVRKS
FT                   RDK"
FT   CDS_pept        477436..478203
FT                   /transl_table=11
FT                   /locus_tag="SCA_0467"
FT                   /product="putative antirepressor, phage associated"
FT                   /function="Prophage antirepressor"
FT                   /note="InterPro: BRO family N-terminal,Sca-prophage"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0467"
FT                   /db_xref="GOA:B9DJG3"
FT                   /db_xref="InterPro:IPR003497"
FT                   /db_xref="InterPro:IPR005039"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJG3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27381.1"
FT                   /translation="MSELQVFNFEELPVRTLIMDDEPYFVGKDVAEVLGYSNTRDALNK
FT                   HVDEDDKKILTSRNTTLENLPNRGLTAVNESGLYSLIFSSKLESAKRFKRWVTSKVLPA
FT                   IRKHGIYATDSVIEQTIQNPDYIINILTEFKKEREGRLVAEQQVHELKPKATYYDLVLQ
FT                   NKSLLSVSKIAKDYGMSARALNKLLHELGVQYKHGDIWLLYAKHQDKGYTHTSTYALDE
FT                   EHSKVTTKWTQKGRLFIYDLLKDNNILPTIERG"
FT   CDS_pept        478209..478364
FT                   /transl_table=11
FT                   /locus_tag="SCA_0468"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Sca-prophage"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0468"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJG4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27382.1"
FT                   /translation="MNGMQENSLKTNPNTMYETINILLKEIQKNPNPQLIEATANLVLA
FT                   YKEVTR"
FT   CDS_pept        complement(478357..478581)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0469"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Sca-prophage"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0469"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJG5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27383.1"
FT                   /translation="MNIDNIRTFLNRYEDMFLRLHLDNGDNVEVEVLENTPSIAGILQV
FT                   KKPEKIIVNLDRVVWIEYLNTSSEPPKFI"
FT   CDS_pept        complement(479252..479524)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0470"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Sca-prophage"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0470"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJG6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27384.1"
FT                   /translation="MNKYLVSYDLHTPRKEYNSLWYLLKSFKDSLHIQDSVWLVKSTKT
FT                   QQDISELLQEVLDSDDSWIVLKFDSNISGALDDEVAKKVIELYQA"
FT   CDS_pept        479588..479824
FT                   /transl_table=11
FT                   /locus_tag="SCA_0471"
FT                   /product="conserved hypothetical phage protein"
FT                   /note="Reporting helix-turn-helix motif,Sca-prophage"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0471"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJG7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27385.1"
FT                   /translation="MIINYLTIKDIQMLAGVSKSKASSIVRELNSELEEEGFIAIRGKV
FT                   PIQLVREKFPYCDLSDEAIRELKEFNVKKEVKQ"
FT   CDS_pept        480130..480375
FT                   /transl_table=11
FT                   /locus_tag="SCA_0472"
FT                   /product="conserved hypothetical phage protein"
FT                   /note="Sca-prophage"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0472"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJF5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27386.1"
FT                   /translation="MGLKKYAHKFIDMLDESEIEGYIEYSKDPRQTLIFAHYDVKYNSG
FT                   IRFFIVSSQDTDDEQLRTLKLIEKLLSDRKKVSSNA"
FT   CDS_pept        480368..480628
FT                   /transl_table=11
FT                   /locus_tag="SCA_0473"
FT                   /product="conserved hypothetical phage protein"
FT                   /note="Sca-prophage"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0473"
FT                   /db_xref="InterPro:IPR018918"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJE3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27387.1"
FT                   /translation="MPKQTVTYLIKITDTNLYVTNRPTEQNTTIKYSTSLSDAREFNGM
FT                   EDAAVDMTFHTAIKKTVTETTEYEEVAYDTGNEPIPENSRC"
FT   CDS_pept        480585..481256
FT                   /transl_table=11
FT                   /locus_tag="SCA_0474"
FT                   /product="conserved hypothetical phage protein"
FT                   /note="Sca-prophage,InterPro: ERF,putatively involved in
FT                   single-strand annealing"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0474"
FT                   /db_xref="InterPro:IPR007499"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJE4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27388.1"
FT                   /translation="MTQEMNLFQKIADVKANIDGFTKDTKGYNYSYVSGSQVLHRIRNK
FT                   MIENNLLLVPKTSEENYKQIDVTRFNKKAGREITTSEFIVEMKLTYVWINADKPEEQFE
FT                   VTFYAVGQQDDVSKAHGTALTYAERYFLMKFFNIPTDEDDADAKEKREQYTKPDAKAIG
FT                   TLKEEMLKFSELMQSVGKQVSVDDVQQKLGINDVQNLSNSQITVCIKKLDNWSKQAKEN
FT                   E"
FT   CDS_pept        481256..481687
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="SCA_0475"
FT                   /product="putative single strand DNA binding protein,phage
FT                   associated"
FT                   /function="Single-stranded DNA-binding protein"
FT                   /note="(Q932A8) Single-strand binding protein 1 (SSB 1)
FT                   (Helix-destabilizing protein 1),InterPro: Single-strand
FT                   binding protein,Sca-prophage"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0475"
FT                   /db_xref="GOA:B9DJE5"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJE5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27389.1"
FT                   /translation="MINRVVLVGRLTKDPEFRTTPSGVDVATFTLAVNRNFKSKNGEQQ
FT                   ADFINCVVFRKQAENVNNYLNKGSLAGVDGRLQSRSYENKEGQRVFVTEVVADSVQFLE
FT                   PKNNNQQNNQPQQQQGQAPAGNNPFGNASDDISESELPF"
FT   CDS_pept        481699..482250
FT                   /transl_table=11
FT                   /locus_tag="SCA_0476"
FT                   /product="putative HNH-family endonuclease, phage
FT                   associated"
FT                   /note="InterPro: HNH endonuclease,Sca-prophage"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0476"
FT                   /db_xref="GOA:B9DJE6"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR010902"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJE6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27390.1"
FT                   /translation="MAEIWKDVVGYEGIYEVSNKGRVRTHKDKVSWSKRFKKWKHWKQR
FT                   YLKDKTPNGRDARVALWKDGKPKYFLVHRLVAFAFIPRIEGKDCINHIDGNPKNNNVSN
FT                   LEWCNYKENINHAFENGLSTTNMAVRLTNHLGIEYEFISMSRASKFLGRNHGYVSGRLK
FT                   NNCSKLTDTDGNKYKVEKLI"
FT   CDS_pept        482251..482925
FT                   /transl_table=11
FT                   /locus_tag="SCA_0477"
FT                   /product="conserved hypothetical phage protein"
FT                   /note="Sca-prophage"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0477"
FT                   /db_xref="InterPro:IPR041242"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJE7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27391.1"
FT                   /translation="MAKIKNYITQDDGTTTVVIEGVDIDNKTSLLLDNGLDVEVECKPI
FT                   DPYKITDKQRKKIFALCNDIESHTGQPRDYMRYLFMDYVEVLYGYEKRLSLSDCTRTQA
FT                   NQIIEVTLDWIFHNNIPLAYKTSDLLKNDKVFLYWSTVNRNCVICGKTHAQLAHYHAVG
FT                   RGRNRRKISHLNNKVLALCSEHHKEQHAIGMDSFNEKYHLENSWVSVDDRLNKMLRGGK
FT                   NE"
FT   CDS_pept        482922..483683
FT                   /transl_table=11
FT                   /locus_tag="SCA_0478"
FT                   /product="conserved hypothetical protein, phage associated"
FT                   /note="Sca-prophage"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0478"
FT                   /db_xref="InterPro:IPR011741"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJE8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27392.1"
FT                   /translation="MSKLLIDDYPIQVLPKLAEKVGLNEAIILQQIHYWLNSSKHNYDG
FT                   KRWIYNSYPNWAKQFPFWSERTIKRAFGSLEKQDLLYVGNYNRAGFDRTKWYSINYENL
FT                   NNLVARPSGQNGTTSMTNCHDARGQNVTTNTRDYTEITTETTNNNILSPSSTAYPYRDV
FT                   INYLNQQTDKHYKSTTKKNQTVIRARTDEGFTLDDFIKVIDNKVSEWKDTDMEKYLRPE
FT                   TLFGTKFEGYLNQQQSNAVDEDWKKQYEDVF"
FT   CDS_pept        483684..484469
FT                   /transl_table=11
FT                   /locus_tag="SCA_0479"
FT                   /product="putative IstB-like ATP-binding protein, phage
FT                   associated"
FT                   /function="DNA replication protein"
FT                   /note="(Q89B30) DNA replication protein dnaC,InterPro:
FT                   IstB-like ATP-binding protein,Sca-prophage"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0479"
FT                   /db_xref="GOA:B9DJE9"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJE9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27393.1"
FT                   /translation="MDAFSKIAKQAKFRNKVVKQEMGLHCEKCGRDYDYYEFDNGQVIK
FT                   DGCDCKMIALAKESTENFKKKQQRIKTNAIFKKSIINDDLADADFNNYDPTSQQLAKAK
FT                   ALLERYANNFTLNNKQSILLFGTYGTGKSHLSMATIKRVREKGYSVLYMNVPQLITTYK
FT                   DTYNKQSQLTERDLDKAIADVDLLVLDDYGTSLSNFGVQKMFEVMESRTGKHNIITTNN
FT                   SSKELIQNKDLAKIFSRMMKNTTTINMNGEDFRMRGLNF"
FT   CDS_pept        484635..485042
FT                   /transl_table=11
FT                   /locus_tag="SCA_0480"
FT                   /product="putative holliday junction resolvase, phage
FT                   associated"
FT                   /function="Holliday junction resolvase"
FT                   /note="(P45911) Hypothetical protein yqaN,InterPro:
FT                   Endodeoxyribonuclease RusA,Sca-prophage"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0480"
FT                   /db_xref="GOA:B9DJF0"
FT                   /db_xref="InterPro:IPR008822"
FT                   /db_xref="InterPro:IPR036614"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJF0"
FT                   /inference="similar to AA sequence:UniProtKB:P45911"
FT                   /protein_id="CAL27394.1"
FT                   /translation="MELEINFNETHKAPIGSPRPRFSMRGKYVQTYMPKTYTDHKQFIQ
FT                   KQMPKLMMEGNLIVTLQFLFIPPLSWSNKKRLAMVGQYKRTKPDIDNLIKTVLDAANNH
FT                   LWQDDNQIVEVKSFKKYGETPKIIMKVEMVE"
FT   CDS_pept        485039..485215
FT                   /transl_table=11
FT                   /locus_tag="SCA_0481"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Sca-prophage"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0481"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJF1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27395.1"
FT                   /translation="MIVRMQYTLTFEKDIEVDTQDIYLAEEQAIDEIHKNKEDHIDGEV
FT                   IEADDFEMKWIME"
FT   CDS_pept        485221..485751
FT                   /transl_table=11
FT                   /locus_tag="SCA_0482"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Sca-prophage"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0482"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJF2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27396.1"
FT                   /translation="MYAKSKTPIVIDGREIVLTNKQRAEMRVKQLSLALVQQRINEGWT
FT                   LKQALKYNSTYVTKNNEICWMIPMIEMSFYIPVREKERINVVGARITERVKKGEWIDEI
FT                   LGDIDYYVEYNGRTHYDLATDDIERKLEAEKLEEERKKRLKPWLYDGTPQAVKPSEWFK
FT                   YLCENDLMKKAVR"
FT   CDS_pept        485752..486228
FT                   /transl_table=11
FT                   /locus_tag="SCA_0483"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Sca-prophage"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0483"
FT                   /db_xref="InterPro:IPR021739"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJF3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27397.1"
FT                   /translation="MKEIKDLNVNDRIIIWRYNDMNIDEGHNATVIRRVVRHAEPQAVV
FT                   VQLDGVSNEATITDKDYFDTLPLSNQKSEDYENEEPFFVNDADKGIPSHYQGKDGIDVI
FT                   EFLRQQMTSQEFKGFMTGNIIKYATRLGRKDEKVKELEKIEVYAKRLKEVLTNE"
FT   CDS_pept        486221..486706
FT                   /transl_table=11
FT                   /locus_tag="SCA_0484"
FT                   /product="hypothetical protein, phage associated"
FT                   /function="Nucleoside 2-deoxyribosyltransferase"
FT                   /note="(Q9PR82) Hypothetical protein UU063"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0484"
FT                   /db_xref="InterPro:IPR007710"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJF4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27398.1"
FT                   /translation="MNKQIYLGGGMLDLGDQMRRAWERDDLKRLGFDVYVPQDDKSVND
FT                   KNNAVQEGLAERIVRNDTNGISESDILIFDYLTHNQGTIAEMGYIQGLMHSGHECKVYV
FT                   QCTDIRQGTGHVNREQDRAEFSINQYVYGVILDITDGRGVQTWNEITEELIKKPCVS"
FT   CDS_pept        486753..486950
FT                   /transl_table=11
FT                   /locus_tag="SCA_0485"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Sca-prophage"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0485"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJE2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27399.1"
FT                   /translation="MTDKELAYKYKANRDELIDDVNKLRNEWLELEEYINEKMEWNPSN
FT                   YQYKSVKHEMDRIKGGQVND"
FT   CDS_pept        487147..487656
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="SCA_0486"
FT                   /product="putative dUTP pyrophosphatase, phage associated"
FT                   /function="dUTPase"
FT                   /EC_number="3.6.1.23"
FT                   /note="(P33316) Deoxyuridine 5-triphosphate
FT                   nucleotidohydrolase mitochondrial precursor (EC 3.6.1.23)
FT                   (dUTPase) (dUTP pyrophosphatase),InterPro: DeoxyUTP
FT                   pyrophosphatase subfamily 1"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0486"
FT                   /db_xref="GOA:B9DJC8"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJC8"
FT                   /inference="similar to AA sequence:UniProtKB:P33316"
FT                   /protein_id="CAL27400.1"
FT                   /translation="MTNLQIKLLSDNATMPTRANATDAGYDIYAAETVILEPQEKALIA
FT                   TDIAVNIPKGYVGLLTSRSGVSSKTHLVVETGKIDAGYQGHMKINIKNDSQEFDTEEDA
FT                   YFNIQNKFEHGYVSKFVNTNYTIHKGDRLAQLVIVPIWKPELEPVKEFSNETARGEKGF
FT                   GSSGTR"
FT   CDS_pept        487706..487912
FT                   /transl_table=11
FT                   /locus_tag="SCA_0487"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Sca-Prophage"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0487"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJC9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27401.1"
FT                   /translation="MVVDKDTHYVVEVNKGIYLFKYRIGGFGFTDDIKRATLFEYNNYD
FT                   EANNVAIKCGGKLTKYVITHEVL"
FT   CDS_pept        487913..488155
FT                   /transl_table=11
FT                   /locus_tag="SCA_0488"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Sca-Prophage"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0488"
FT                   /db_xref="InterPro:IPR009812"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJD0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27402.1"
FT                   /translation="MQFLIRHITDSTGHPFTHVTKARENETYTVIEAESKEEAERMVKE
FT                   PRMLANRGLGTTIKHERFTEEEKETLFGKDYKKGQ"
FT   CDS_pept        488427..488711
FT                   /transl_table=11
FT                   /locus_tag="SCA_0489"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Sca-Prophage"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0489"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJD1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27403.1"
FT                   /translation="MIKKAIKRPDVVEYIEFKGKENFKEVCEFIGRSEPLLTRTDGKEY
FT                   LLLNHYVSDKEDAPIYPGTIFYRWYDFEQDCKPWGVMNKGAFFKRYMED"
FT   CDS_pept        489235..489414
FT                   /transl_table=11
FT                   /locus_tag="SCA_0490"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Sca-Prophage"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0490"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJD2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27404.1"
FT                   /translation="MDKFYQSQIHNIEVDIDIAKNTIDKYQRQIKEWQEDIKHKEAYIK
FT                   QLKQFKSDIENKLM"
FT   CDS_pept        489427..489840
FT                   /transl_table=11
FT                   /locus_tag="SCA_0491"
FT                   /product="hypothetical phage protein"
FT                   /note="Sca-Prophage,Probably truncated"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0491"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJD3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27405.1"
FT                   /translation="MYTEKEVREMLDNYKFYQNMVEADIYDSDSTSVAQYGIEATLPKA
FT                   KGTTGDKVLVKVINRNKQWRRKIKMIEKMQFIDEHEEYVTDEVNYHILQMMKRGMKHKT
FT                   IMDIACINSRSNFYGRVNEIVNVYMDVQQGNYS"
FT   CDS_pept        490644..490991
FT                   /transl_table=11
FT                   /locus_tag="SCA_0492"
FT                   /product="conserved hypothetical phage protein"
FT                   /note="Sca-Prophage"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0492"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJD4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27406.1"
FT                   /translation="MRVRDDDEKVVQERERLLDIYKDVPQDKLNVVQGLIIQAARLRVM
FT                   LDYMWEDIQENGEYMLFTQSEKTEPYERERPVARLYNTRDQSYQRIIKQLSDLLPKKDD
FT                   EPEKPVRRDLV"
FT   CDS_pept        490988..492628
FT                   /transl_table=11
FT                   /locus_tag="SCA_0493"
FT                   /product="putative phage terminase, large subunit"
FT                   /function="Phage terminase-like protein large subunit"
FT                   /note="(P59217) Putative terminase large subunit,InterPro:
FT                   Phage Terminase,Sca-Prophage"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0493"
FT                   /db_xref="InterPro:IPR005021"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJD5"
FT                   /inference="similar to AA sequence:UniProtKB:P59217"
FT                   /protein_id="CAL27407.1"
FT                   /translation="MIKNKYIDDYIRLWKTGKILLNKERIMLIAYLERDVLSRGDLYFD
FT                   EEQIENFIKFTEKWYFPLQPFQKFIVPFIFLFEKEGNFLYFEQFFITLGRGGGKNGFIT
FT                   ALSNYFISYLHGIPNYDISVVANSEDQAKTSFEEAYNMIERNELEDMFYLTKLVITDTE
FT                   TKSRFRFRTSNAGTKDGGREGCVIYDEVHRYEDSETVDVFSSGLGKVRNPREFFIGTDG
FT                   YVREGFLDKLKERSLSLLKGETPDDRIFPFICKLDDPKEVDDPTMWEKANPMFSEPMCE
FT                   YAQGLFRKVKNQYNEMTFAPSKREEFMTKRMNLPEVDLEKVVAPWEEILATNRPFPELE
FT                   QRQCLGGLDYASIKDFAAVGLLFREGDDYIWKSHSFVRKGFLDKVKLKAPIHEWEKEGL
FT                   LTIVDEPSINPLHIVLWFDKMRETYGLEKVIADNFRMDLLRPLFEEYGIEIEVIRNPRA
FT                   IQSLLAPRIETMFANHNVIFDDNPMMRWYTNNVAVKIKPDGNKEYIKKDEIRRKTDGFQ
FT                   AFIHALYRADDLLEADVSSSLDFLNAIDF"
FT   CDS_pept        492643..493815
FT                   /transl_table=11
FT                   /locus_tag="SCA_0494"
FT                   /product="putative phage portal protein"
FT                   /note="InterPro: Phage portal protein,Sca-Prophage"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0494"
FT                   /db_xref="InterPro:IPR006427"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJD6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27408.1"
FT                   /translation="MAGLFDKIFGRHEEASWMYDLELFQDTSEKAYLKQAALNTCIEFL
FT                   ARTLSQSEFRFLDADNKSLKDQSWYKLNVRPNTDLSSTDFWQKVIYKLIYDNEVLIVVT
FT                   DTKDLVVADNYNRKKYALYPDIFEDVTVSDYEFERSFNMDEVIYLTYNNDKLNKFTEGL
FT                   FADYGEIFGRMISAQMRNYQIRGIMNVDSSAVNGEKNTEKMQNYVDKVVNSFSNNGVAV
FT                   APLTKGFDYQDVSSASKSNNAPFDELGKLFRSLIDIVAKAIGIPPSLIHGEMADLDNAM
FT                   KSYIKFCIKPLIKKIEDELNAKLLKQNEVIKGKRIKVIGIDKKDPLEMAESIDKLVSSS
FT                   TFTPNQVLVMLGEEPSDDPQMDQYFVTKNYTTTREETADSTPEGGETDED"
FT   CDS_pept        493805..494521
FT                   /transl_table=11
FT                   /locus_tag="SCA_0495"
FT                   /product="putative Clp protease, phage associated"
FT                   /function="Protease subunit of ATP-dependent Clp proteases"
FT                   /note="(P56317) ATP-dependent Clp protease proteolytic
FT                   subunit (EC 3.4.21.92) (Endopeptidase Clp),InterPro: Clp
FT                   protease,Sca-Prophage"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0495"
FT                   /db_xref="GOA:B9DJD7"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJD7"
FT                   /inference="similar to AA sequence:UniProtKB:P56317"
FT                   /protein_id="CAL27409.1"
FT                   /translation="MKINVKGAIVPNNEKWIYDLLDMDATSPNDIINALPSTNEDVEVI
FT                   INSGGGEVMSGSEIYTALKSYAGNVNVKVVGVAASAASVIAMAGDTIEMSPTAQMMIHN
FT                   ASTLAYGDDRAMASASKMLNSVNRGIANAYMNKTGKSEQEILDLMNEESWMSAQDAVDL
FT                   GFADSKMFDESATRLVANTGHMIPKNAIDKVSAMMNKTPEIKIDVEQIANKVIEKLEEK
FT                   EELSKPQNKVKHKFFF"
FT   CDS_pept        494546..495664
FT                   /transl_table=11
FT                   /locus_tag="SCA_0496"
FT                   /product="conserved hypothetical protein, phage associated"
FT                   /note="Sca-Prophage"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0496"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJD8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27410.1"
FT                   /translation="MTIKLSDEFKTAREEFLNALSQGETEEKQAELYGQMINELFEESK
FT                   KHAKQEAEAIASLPNADKQLTAQQRKFFNEINTEVGYKEEKLLPEETIDRIFEDLTTEH
FT                   PLLADLGIKNAGLRLKFLKSETSGVAVWGKIFGDIKGQLDAAFSEETAIQNKLTAFVVL
FT                   PKDLQDFGPAWIEQFVRLQIEEAFAVALEAAFLNGTGKDQPIGLNRQVQEGVSVTGGVY
FT                   PEKESEGTLTFKDSETTVKELTKVFKFHSTNEKGHSVVVKGNVTMVVNPSDAFDIQAQY
FT                   THLNANGVYVTALPYNLNVIESIAQTPGKVLTYVKGRYDGYLGGGINIQKFEQTLAIED
FT                   MNLFTAKQFAYGKAKDNKVAAVYDLAIDSTTP"
FT   CDS_pept        495737..496033
FT                   /transl_table=11
FT                   /locus_tag="SCA_0497"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Sca-Prophage"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0497"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJD9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27411.1"
FT                   /translation="MDELLNEFKSRMHIFHSSEDESLKEILNKSFVAIKSTCGVFDLDE
FT                   NMIGRELVLERSRYVYNEQLQFFHENFSTLITDFGLQNQVYEGDAFGTDEIQE"
FT   CDS_pept        496008..496373
FT                   /transl_table=11
FT                   /locus_tag="SCA_0498"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Sca-Prophage"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0498"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJE0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27412.1"
FT                   /translation="MAQMRFKNRKVQSGDMRTPVIFYQYVNEGPYPDDFEEKTLYQCFA
FT                   HTYAPSMKDQEILGVYEASLGLTIVIRDPWQDYTPKTNHIVRVEDFRLEQQTFNVYEVR
FT                   LDAPETGFITIVLGDKK"
FT   CDS_pept        496370..496777
FT                   /transl_table=11
FT                   /locus_tag="SCA_0499"
FT                   /product="conserved hypothetical protein, phage associated"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0499"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJE1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27413.1"
FT                   /translation="MSVELKGVKELERQLERRFGETAMRRKADDALEKASEYLLKELKK
FT                   NFEVFKDTGASIDEMHKTKPFTAASDKLRTVVIDWVGPMDRFRLIHLNEHGYTRNGIKY
FT                   TPRGMGVIAKTLESSESRYRQIIKEELRRSL"
FT   CDS_pept        496774..497169
FT                   /transl_table=11
FT                   /locus_tag="SCA_0500"
FT                   /product="conserved hypothetical protein, phage associated"
FT                   /note="Sca-Prophage"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0500"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJC7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27414.1"
FT                   /translation="MNILNYVYDVIKNDELIKQNIGNRIYFYTTSENADTSKPFVVLSP
FT                   INDVPSTYNSDKYLSETYLIQVDVETYKDQLTIDLTKRIRYLLMQHDLYQASTQLDEYF
FT                   KETKRYVKSRRYQGIPKNQYYKGLHIE"
FT   CDS_pept        497211..497852
FT                   /transl_table=11
FT                   /locus_tag="SCA_0501"
FT                   /product="major tail protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0501"
FT                   /db_xref="InterPro:IPR006490"
FT                   /db_xref="InterPro:IPR006724"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJ00"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27415.1"
FT                   /translation="MANGQGSYKVGFKKVLVGVYGKDGQTVEKQFEWKDENGGTVNLNI
FT                   TGLAPELVDMFASNKRVWMKKQGTNEVKSDMDIFNIPSDDLNAVLGREKDQNGTAWVGE
FT                   NTRAPYVAMIGVSEDGLTGEPVYVALLKGTFSLDSIEFKTKGEKAEAPEPTKLTGDWMN
FT                   RTIEVDGENQGIVYGYHEGKDGEDEFFKKVFVGYTDSLKNSDEEGTGTPS"
FT   CDS_pept        497929..498390
FT                   /transl_table=11
FT                   /locus_tag="SCA_0502"
FT                   /product="similar to minor tail protein of phage phiSLT"
FT                   /note="InterPro: Bacterial Ig-like group 2,Sca-Prophage"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0502"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJ01"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27416.1"
FT                   /translation="MVKTLKVYKDDEVVGTQDGEGRLTVSVSGLNADTEYPKGTYQVAF
FT                   EEDGAESDKVDVPTFKTNPILVTGISFSPNTKEIKTGADDSVKAVVAPTTATNKSVTYT
FT                   SDSTDIVTVDAKTGAIHGAAEGKAVITAKADDGSGKTGTINITVTTDAV"
FT   CDS_pept        498438..498782
FT                   /transl_table=11
FT                   /locus_tag="SCA_0503"
FT                   /product="conserved hypothetical protein, phage associated"
FT                   /function="Integrase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0503"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJ02"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27417.1"
FT                   /translation="MTIKFDIKDNKTGKTSTYSKDIITMGEAEKFYEFLDKTQKESAKD
FT                   EPDAKKVRELERQYLVSLFADQGLTEEEVLNNMGTRQYTKALGDVFREIQGDDDEDTKN
FT                   ETDEVGKTEN"
FT   CDS_pept        498833..498988
FT                   /transl_table=11
FT                   /locus_tag="SCA_0504"
FT                   /product="conserved hypothetical phage protein"
FT                   /note=">sas:SAS0943,Length = 52,Score = 42.4 bits
FT                   (98),Expect = 0.001,Identities = 22/52 (42%), Positives =
FT                   27/52 (51%), Gaps = 1/52 (1%),But no detectable SD
FT                   sequence!"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0504"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJ03"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27418.1"
FT                   /translation="MEKYGWTITQAKEQPYFELLDLLNDDNEEEQPQQEEEKVYTGTDL
FT                   RMLFGS"
FT   CDS_pept        499002..501107
FT                   /transl_table=11
FT                   /locus_tag="SCA_0505"
FT                   /product="truncated phiSLT orf2067-like protein (fragment
FT                   1)"
FT                   /function="Phage-related tail protein"
FT                   /note="Sca-Prophage,Similar to aminoterminal part of phiSLT
FT                   ORF2067"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0505"
FT                   /db_xref="GOA:B9DJ04"
FT                   /db_xref="InterPro:IPR010090"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJ04"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27419.1"
FT                   /translation="MNEKLQGLTLEMKLDSLGVQEGMKGLKRQLGVVNSEMKANLSAFD
FT                   KAERSMDQYKAKIDGLNNKMKVQKQMFNQAESELKELNANYAKATSRVKGVEQAYKSLT
FT                   AANQKNKQALEKSNASLKESNRELKKAETQSNRTNNQREKAAQRLEKLKKAEKELKNSN
FT                   KATTTQLKRASEAVEKQSQKHKELDERYKKEETQVEKLRGENKKLSDSNEKVKSTYDKT
FT                   NKELKQTEKEYNDVNKTIKDHNKNLAAAENQVNNEKASLNNLQRAIDKTTSEMKEFNKE
FT                   QTIANSQYTKTADHMDNMAGKFGTIGSKMTDVGRNMTMGVTTPIVAGLGAAVKISADFE
FT                   AQMSRVGAIAQASGGEMKAMSNQAMELGAKTSQSASEVAKGMEELAALGFNANQVMSAM
FT                   PGVISAAEASGADMATTATVMASSINSFNLKASDSSHVADLLATAANDSAADISYMGEA
FT                   LKYAGTPAKALGVSIEDTSAAIEIMSNAGLDGSTAGTVLRASFIRLANPTGKAAKEIEK
FT                   MGIHLTDNEGKFVGMGNLVGQFREEMKGMTKEQKLANVSTVVGTEAASGFLALIEAGPD
FT                   KVNQYSDSLKNSDGASKKAADQMKNNLKGALEQLKGAFETLGIQVGKDLTPAIQGAAKG
FT                   IQGFVEGFSSLPGWVRKGAIGMGLFAAALGPVVLGLGLVLRAVGSAAKGYGFIKQTNGN
FT                   QYCRSSR"
FT   CDS_pept        501142..505263
FT                   /transl_table=11
FT                   /locus_tag="SCA_0506"
FT                   /product="truncated phiSLT orf2067-like protein (fragment
FT                   2)"
FT                   /function="Phage-related tail protein"
FT                   /note="Sca-Prophage,Similar to carboxyterminal part of
FT                   phiSLT ORF2067,InterPro: SLT domain"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0506"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJ05"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27420.1"
FT                   /translation="MTTGKSVKGSTGLFGSFTNTIMKTTGKFGGLGNTLKTGTKIIGKV
FT                   GVPLTILTTIFGVAYEKMDWFRKGFDNMGKLVKQVGDSMDFSWIDKAKDKMGKFWDDFK
FT                   NDMAKGLQEGLLFKGIKKSFDGLDKMVSKASDTTDVFAKGVSKGTEKALKSYNKLSKQS
FT                   TLKLEEIKLHHGKISNEQYQQITNIYKKMGDEISKQLDSRHDKEISGLNKIFRDTNGLT
FT                   KKQEAKIIAQAQQQNEKESASIQKTQEKIQAIYKKAHDEHRALKKSEIKQIEELQTQLD
FT                   SKVVKSMSKGEVEQKAILERMKQNKSKLSIQAASNVIKESAKERDKTISDAKKKYKDTV
FT                   AEAIKQRDQNGTLSKEQADKVIKNAKKQYDESKDKAKKQHKDVVNEAKKQNKGVGANID
FT                   SQTGKVKTGWQKMIDTTVVKGAKIWITTKKTWDNISNKIGSATKNGLNNAKKWFGQLPG
FT                   RVSGWFESTKKHTDDKWNKISSKISSSSRNALNNTKKWFGQLPGKTSSWFKSTKKHTDD
FT                   NWNKISNKISSSTKSAFNNSRKWLGQLPGKTSSWFKSAKKNTDDNWNKISSKIGSSTRN
FT                   AYNSAKKWFGNTTANAKSNFKNTWNTTKDRFGDIANKVEKKTHSVFNSGKKWFGKTYGN
FT                   AKENFKNMWNNTKSRYGDIANKAEEKSKSVFNSGKKWFGKTYSNSKENFQNMKNKATDR
FT                   FKEIAAQAEEKAKKTFGSWKSWLDKTLGWIKNIKKDFGSAASSLGKEVANKAIGGLNSM
FT                   IGGINNIAKAITDKTLIKPIPTLSTGTFDGSSLATDSNGGVMAPTMALVNDRGPGNGSG
FT                   SNGHQELIQRADGSLHAPQGRDVIVKLNKGDGVINGTATQRMQNMGMIPKLSKGSIPRF
FT                   AKGSFKKKLDDYLEHPLQSLVKDATKGSQVAKKVVKDKSKNVIEKAKEVGNDAVESAED
FT                   MASGIWGGIKGVTKDVGEFLENPGKLVEKVMDKMGINFGGGDNATVKMAKGAYSILKKK
FT                   LVDKVQSWFDESGGDGAGGWIDLSRGINTPYSPNGPPPGYAFNWPHPGIDLPYIYEPVY
FT                   STISGTAHTKEMPGGFGHYIQVHGGDLDVIYGHLSKWLVHEGQRVHPGTKLGISGNTGA
FT                   STGPYLHYEMHQNGRPINPIKWLKAHPGKKGGKSSAPREVSAWRPEVMQALRLAGLPAN
FT                   SAYANAWLRQINTESSGNPSATGPGSSEGTPRGLVQVKPGTFNAYKLPGHGNVLNGLDN
FT                   LIAGMRYAKARYGGRMLSTIGVGGPYANGGMVTKHQIAEIGEGNKPEMVVPLTRRNRAI
FT                   QLIEQAMSYVGMNKGKTEVTVNNDNSTIERLLQQNISLNAQNNNLTQTLINVVQNLPVG
FT                   IDGDSLNKHFNKKNGNSISLEAYSKGGSIV"
FT   CDS_pept        505260..506093
FT                   /transl_table=11
FT                   /locus_tag="SCA_0507"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Sca-Prophage"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0507"
FT                   /db_xref="InterPro:IPR008841"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJ06"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27421.1"
FT                   /translation="MINDKWLKLLTDTGTIDVNEALPGFIFLDTKQDYPNYNDNKLVIN
FT                   GLDGEIPGAISFAPFNLVLRFGLDSQDVEDVYLAEQKLRRLFFRRKHYSVVTSDIPNKK
FT                   FAVATPNIATNVKDFASMEFEVTFQVYKGYSESLYKTDQFSLMSDKWQFESGVMPDNEI
FT                   AYTHNRQKFSIFNGSDDTIDPRLRHELQIWIRLNTTTGFRLVNKTTGDIFEYKGKLETN
FT                   QSFLLDGAYPYIETKRCGRLTNHGIITLAPGYNDFEIWGSVSGVNIQFIFPFIYR"
FT   CDS_pept        506104..507669
FT                   /transl_table=11
FT                   /locus_tag="SCA_0508"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Sca-Prophage"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0508"
FT                   /db_xref="InterPro:IPR010572"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJC3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27422.1"
FT                   /translation="MSTDIIVTDINETMSELLLDFAYDTFKYEYERNNTRQITFIAYKT
FT                   RYNEDVYNLLQNEAYIEYKGQKYVIKTASPSFDGFIHTKEIIATHIMFEFQNHYVSKDT
FT                   DSETINDDSDSNKAQKVTLNEFLEYGFKGNKLGYSYEIKGSFNNKVSFEGLGEKNGMEY
FT                   LVEGAELFGFIYYADNKKIYIHDNNSFYVPTEKTIRYKYNNSEVKASIDTKELKTVIKG
FT                   YGKKLTSKDTKNYSPVKPKDLTYSGKFIKDGTWRTEEVGASFSYELECKYGNETIVFSL
FT                   KKMSKGGMLDLYFNGEKVGEYSCYSKSATTQNITLSKNTKKGKYTVKAVFKGKKSGVDY
FT                   KKSAPCMYVGTEKATVINTTAVLKGDDLYSSTYVYKSSKSYDVFGHREAPDHFDESITD
FT                   KDELKSKLEKELKDEPDIELDINYIGDEKIEERDAIWFIHEIMGYNTELKVVSLIQVHP
FT                   LNPAPDEIGFSNNKRDIVQISNVLNRKMKSVSAALNKSKLNNIYSPSTGYTGGSIVGSV
FT                   LVDE"
FT   CDS_pept        507662..507880
FT                   /transl_table=11
FT                   /locus_tag="SCA_0509"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Sca-Prophage"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0509"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJC4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27423.1"
FT                   /translation="MSKEIPIIRMSYEGEDAFPQTHTEGVIGLEDLIESIVTQYIRSDL
FT                   IVQAPTGQKFKIVVDDKGVLTTERMEG"
FT   CDS_pept        507885..509840
FT                   /transl_table=11
FT                   /locus_tag="SCA_0510"
FT                   /product="conserved hypothetical protein, phage associated"
FT                   /note="(P28296) Oryzin precursor (EC 3.4.21.63) (Alkaline
FT                   proteinase) (ALP) (Elastase) (Elastinolytic serine
FT                   proteinase),InterPro: Parallel beta-helix repeat"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0510"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR024535"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJC5"
FT                   /inference="similar to AA sequence:UniProtKB:P28296"
FT                   /protein_id="CAL27424.1"
FT                   /translation="MLTMQTNMSNQLDQRWRNETISNFKNVLSFTNGIEDKMIYHQYEQ
FT                   LKAHDSKQITHANTTLDKMIVYLLNEVKNLVVGVDGDGVKEVTDARVGQDGTQHGILSQ
FT                   RLFTDFSDVYTDINRVEEKISSINIDEYHPDKTGKTDVSDYIQDALNRIHNNGSGTLYI
FT                   PAGKYLIGKRLIIYENTTVKMDNNAILLRGWGGGFFMNGPSEDAFYGYEGRGNIHFEGG
FT                   TLDSNYEQIDKFKTTAIDMVILKHAENITFNNVRFRNLISYHCVDANGVRSLTFDNCTF
FT                   EGYINLTGDNFKEAIQIGEYTAEGIGGAGYNDGTPCKEVSIKNCTFRKSDILEGFNVAI
FT                   GNHYSVHNIYQEDIKIVGNTFEDIKQAAVRPYKWVNTKITENSFRRCYEGVRISSVGGE
FT                   DKSANDVKGIPSGTPQAGRLYAINNNSFEEYKKTGVSVFGQQYNGISAPVQNIKITNNF
FT                   FVSDNNDIGEAIVMNLCDDMHIKDNTISYAYRGVRYKGCINVFIEKNYLNNIKTEAVYN
FT                   EVSPYTGYYAQNKYINILNNLVNTTGKNGIYVQHASYSFVRSNTVSNPNTDNIDGNERG
FT                   GIYLNNFDTGEVAHNHAYGSDKSFAIRGVNMKNTTIFNNGGSGGIFIDGDANTKIGYWN
FT                   VSDYNNIIKTSTKGVY"
FT   CDS_pept        509843..511267
FT                   /transl_table=11
FT                   /locus_tag="SCA_0511"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Sca-Prophage"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0511"
FT                   /db_xref="InterPro:IPR018913"
FT                   /db_xref="UniProtKB/TrEMBL:B9DJC6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27425.1"
FT                   /translation="MTMDKQTNIPLETTAKYQPLSNLDVNFYTRDIQTSILNFIVTRNH
FT                   KPLLLGESNVVTNISLEFEDGSIVRDDLTIKDGINGILSYTLSDEMLRHTGKVTGQVDI
FT                   AIKGKEDTVVERLFSFNIAKTLIDSIDAETKLIHIKHFADLEKNITERYERMEETFANG
FT                   ENLAQAVLDASTKGLDELTSAKTKSLNEIKTSKDSTLKEITNTGSDYTNQLNTVYNTMD
FT                   EKINKFNSDVQAGGYVKSSITDNWQKYKLTNNDGSSKELTKADLLNNEYLNGLEPGSYF
FT                   ASESVSTPSGTDGFVNVQKRNVIKIVYFQPQNSDKLYINRFNNVWSNWHDPLNDKESIS
FT                   GSQAKADKALSDAKVYVDKNISDTGWQELPLMSGVEADTDLGPSVYRVKNGVCNIIFNV
FT                   RMTSAKAETSFLTLPSNVLPKYAFSFLARTDGNSGKNPVKCSYDVTNKVFKIWQNNDNT
FT                   INTGDFVYGQLTYIVG"
FT   CDS_pept        511272..511628
FT                   /transl_table=11
FT                   /locus_tag="SCA_0512"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Sca-Prophage"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0512"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIZ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27426.1"
FT                   /translation="MYKQVFDYNGNPYLVLTNEDGSLSEKDLKEQGVYQYTEIMPPSNL
FT                   YPPRKFDGEKWYGATANDTEQNNNGITQKPDPLELIVAQSQMQIAKGNVQLRETQKELA
FT                   KAMLEISKLKGSVE"
FT   CDS_pept        511628..511801
FT                   /transl_table=11
FT                   /locus_tag="SCA_0513"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Sca-Prophage"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0513"
FT                   /db_xref="InterPro:IPR010022"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIY8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27427.1"
FT                   /translation="MWPTFESIKYFYDIKCYTNDDIKTYVELGCLTKEDYARITKEEYQ
FT                   DDKEDGIPEGHY"
FT   CDS_pept        511840..512262
FT                   /transl_table=11
FT                   /locus_tag="SCA_0514"
FT                   /product="putative membrane protein, phage associated"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0514"
FT                   /db_xref="GOA:B9DIY9"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIY9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27428.1"
FT                   /translation="MNEQFTIRDKLATLSLFGLGVFVDVRGLYWFISPERVIKESAFYQ
FT                   ALNDVMSIWIWGLLLLIFGTCLILSSLFFGKRSVNNTSDYFMLIGGLGSAIIHFLMSSA
FT                   AVYNALNWLTPAQMIIMTAWLGFVGFLGGLGIYGRR"
FT   CDS_pept        512249..512647
FT                   /transl_table=11
FT                   /locus_tag="SCA_0515"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Sca-Prophage"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0515"
FT                   /db_xref="GOA:B9DIZ0"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIZ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27429.1"
FT                   /translation="MDEDKYVLKHEWEKSRGKIHERINEVDKKHTENFNSLLNKLDRQT
FT                   LLQEKSFESQARSEKHLEKMSESLATVGTRVTDLEYETKSHEKEIKNLQGTVEAEAKGN
FT                   REVIGYWLGFAGIVLVPLISLVANIFFK"
FT   CDS_pept        512694..514799
FT                   /transl_table=11
FT                   /locus_tag="SCA_0516"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Sca-Prophage"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0516"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR018913"
FT                   /db_xref="InterPro:IPR024535"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIZ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27430.1"
FT                   /translation="MTIFKNKDVQANINNKSVDLGNIGANFYTEDDNTSSIRIYINWNG
FT                   QPVNLNTIDMKPRLDLFLQDKSIFLNEPVDVVLPESGLIQYIIPTKIIKHIGKVDAKLF
FT                   LESKERSVHVANFNFNILDSGIEGAVEKEISVNLVEDTVRRIIEENPDDFKGQDADPND
FT                   VKDLLIPYTENRVSEEFEKLSSAKQVDSEVINARDNFNSLNERLNNSDVKLNNTQRVIN
FT                   IVARGAIGDGTTDNYQIIQDAIKEAEIDGSTIFIPSGTFYISKNLETKHMTSYNYRFGI
FT                   KIYGNGKDSILTRKSGKIPADYTSKEKLPHQAALSLYGSNNIIEDISINDCQVGIYIGQ
FT                   DPSTTEPSSASMNRIKNIWMEYVGTGLQFTHGAGNHYNIFDNFHIIHAQICVDLGVGYF
FT                   MNKFNNNRNTFNNFRVARTWIGFLLRETDGNFFNNIYAETLQGDGAIGNAPSFLPSELN
FT                   GKKTFIVALDGQYNTFNNYGAEAVEWYIYSVGFRNSFVNGMTKDDSVATSKVMFPNPSR
FT                   QPLNYIANSTMIAGLVYQPQAGIFYEGSNGIGIQAPYRLFDINYHRQNKSLAQLSSNIT
FT                   GLTSLSSSKAHRVGRKVDWSVYARFIAKFDENTNQLVKEPIKINLPFTETPETLYTNAL
FT                   TTNLTKPFLIFVGNSNGATEVAQARISTAAEAKDFGTYHLVVNAPATGWRTDANVNYLS
FT                   FDISWNV"
FT   CDS_pept        514858..515121
FT                   /transl_table=11
FT                   /locus_tag="SCA_0517"
FT                   /product="putative holin"
FT                   /note="(Q99165) Hypothetical 9.5 kDa protein in ORF3
FT                   5region,InterPro: Holin SPP1,Sca-Prophage"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0517"
FT                   /db_xref="InterPro:IPR006479"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIZ2"
FT                   /inference="similar to AA sequence:UniProtKB:Q99165"
FT                   /protein_id="CAL27431.1"
FT                   /translation="MDTGTIVRTILLILAWVNQALALNHISPIPVDEVTISTLITGVVS
FT                   LWTWWKNNNFTHHAQKGQKVIKQSKAGTYSTGGAPQMNGDEF"
FT   CDS_pept        515121..516524
FT                   /transl_table=11
FT                   /locus_tag="SCA_0518"
FT                   /product="putative amidase, phage associated"
FT                   /EC_number="3.5.1.28"
FT                   /note="(P54525) Hypothetical protein yqiI,InterPro:
FT                   CHAP,Sca-Prophage"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0518"
FT                   /db_xref="GOA:B9DIZ3"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIZ3"
FT                   /inference="similar to AA sequence:UniProtKB:P54525"
FT                   /protein_id="CAL27432.1"
FT                   /translation="MTSIRTYKQAISYLKSMEGHAYNPDNAYGVQCFDLANQYWLYLFN
FT                   HGLKGVGAADIPTWNNFTNEATVYENTQSFQALPGDVVIFNRNYGEGYGHVGIVLKATL
FT                   NSITILEQNWLGGAYWTPPEVATRRTHGYDFPMWFIRPFYAKSTKLNAVKSKSKPARKA
FT                   KANKGKKIMLVAGHGKGAYSNDPGAVANGYNERDFNRKNIIPRVKKYLESVGHTVVLYG
FT                   GKTMNQDLYQDTRYGQQVGNYSDYGLYWVKKNVKPDIIVEFHLDAASPQASGGHVIISD
FT                   RYPADDIDKALSSALGKTVGKIRGVTPRNDLLNANVTGRLNLNYRLIELGFITSKHDMN
FT                   YITNNLDSFTKRIAEAINGRQIGAKASKPKEKQTVWNWKGKFTADRTIKVRKSPGLNGT
FT                   EVEPRSWLKNGNYVPFDQVIKKDGHWWVRFKYVQPGSSDKDFYCAVCKITDKEQKIKNE
FT                   KYWGEIVWK"
FT   CDS_pept        517218..517898
FT                   /transl_table=11
FT                   /locus_tag="SCA_0519"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Sca-Prophage"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0519"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIZ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27433.1"
FT                   /translation="MKRLKELTLYDQSIQKLEFYLYHIELLKQKQAINLNDQIMINLLL
FT                   NVLKSSMEYSIKYLRNYNKINKKINSYIPNKNDFKNDENFYNVLEQRFGVRDEKGRTIF
FT                   GNLFSTNLYNEFNKMQNNEKHSSINIHRKNIIENSGTGVYGNNILINNVTIIRDEDSDS
FT                   KGIVIDDKEIDITKNEGYTYEEELYFEYNNREVFSFLDEVYHMVNNFVLDIKEYIENRS
FT                   DKHG"
FT   CDS_pept        517891..518031
FT                   /transl_table=11
FT                   /locus_tag="SCA_0520"
FT                   /product="hypothetical protein, phage associated"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0520"
FT                   /db_xref="GOA:B9DIZ5"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIZ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27434.1"
FT                   /translation="MDNLVWILPTLSAAFFGLAFYGQSVKVDRLEKDIEKLKSINYSRP
FT                   N"
FT   CDS_pept        518111..518911
FT                   /transl_table=11
FT                   /gene="glpQ"
FT                   /locus_tag="SCA_0521"
FT                   /product="putative glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /function="Glycerophosphoryl diester phosphodiesterase"
FT                   /EC_number="3.1.4.46"
FT                   /note="(P37965) Glycerophosphoryl diester phosphodiesterase
FT                   (EC 3.1.4.46) (Glycerophosphodiester
FT                   phosphodiesterase),InterPro: Glycerophosphoryl diester
FT                   phosphodiesterase,Sca-Prophage"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0521"
FT                   /db_xref="GOA:B9DIZ6"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIZ6"
FT                   /inference="similar to AA sequence:UniProtKB:P37965"
FT                   /protein_id="CAL27435.1"
FT                   /translation="MKRLLAFGLLSSYLLAGCSNNNILEKDYLNIAHRGASGKAPEHTY
FT                   AAYDKAIKQEADYLELDLQMTKDKELIVMHDNDVTRTTNSSGLVKNKTNNEIKKLDAGS
FT                   WFDGKYSNEKVPLLSDVLKKYYNKTNFYIETKTPEAYPGMDRKLIDELNKKTLLTPHNL
FT                   KNGRIIIQSFSEKSLSNIHKMNKNIPLILLVEDNDISKLTDTELKRLSKFSYGIGINYK
FT                   KTEKELVERAHENGLKVHVFTLNNKKEVEKMKEIKVDGGFNNNP"
FT   CDS_pept        519699..519914
FT                   /transl_table=11
FT                   /locus_tag="SCA_0522"
FT                   /product="putative membrane protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0522"
FT                   /db_xref="GOA:B9DIZ7"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIZ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27436.1"
FT                   /translation="MKNTATTLKIFIIIFIILTLVSPLFAIGSIICSVKLKKYDEVNGN
FT                   RFLTASIIAAVIFMILHFMYYLTYFF"
FT   CDS_pept        520221..521174
FT                   /transl_table=11
FT                   /locus_tag="SCA_0523"
FT                   /product="conserved hypothetical protein, truncated"
FT                   /function="putative Mg2+ and Co2+ transporter CorB"
FT                   /note="(P74409) Hypothetical UPF0053 protein
FT                   sll0260,InterPro: CBS,Truncation of 20 amino acids at
FT                   N-terminus"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0523"
FT                   /db_xref="GOA:B9DIZ8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIZ8"
FT                   /inference="similar to AA sequence:UniProtKB:P74409"
FT                   /protein_id="CAL27437.1"
FT                   /translation="MKLKTESRKGDPRAKKLVKLLDKPREFITTILIANNSANIVLPTL
FT                   VTIYAVDHGWNVGIASAIITVVVIIISEVIPKSVAATYPDAISRIVYPVIHLFVVILSP
FT                   ITKVLNALTGLINKMLINDRFQAQKMSKEEVRTMVAIAGTQGAFNEYERNRLQSVMEFD
FT                   QLKVNDVDTTPRVNVTAFSIDTPYDEVYKIIMSHPYTRYPVYDEDIDDIVGVFHSKYLL
FT                   IWSRQHNKTLRDFISEPLFVNEHNKAEWVMRKMIASRKHIAIVLDEYGGTDAIITMEDL
FT                   IEQLLGLDIEDEMDQREQNMVEQRLKNKNKQIKGKK"
FT   CDS_pept        521216..522292
FT                   /transl_table=11
FT                   /locus_tag="SCA_0524"
FT                   /product="putative FMN-dependent dioxygenase"
FT                   /function="Dioxygenases related to 2-nitropropane
FT                   dioxygenase"
FT                   /note="(Q12723) 2-nitropropane dioxygenase (EC 1.13.11.32)
FT                   (Nitroalkane oxidase) (2-NPD),InterPro: 2-nitropropane
FT                   dioxygenase NPD"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0524"
FT                   /db_xref="GOA:B9DIY7"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIY7"
FT                   /inference="similar to AA sequence:UniProtKB:Q12723"
FT                   /protein_id="CAL27438.1"
FT                   /translation="MWSDTKVSKQLGIKYPIIQAGMAGNTMPELVAHVSESGGLGTIGA
FT                   GYFGLERLEEEIDAVKQLTSQPFAVNLFVPNKQRLLPAQVDLMNAWLSPYRRALNLENP
FT                   VINLSQDQLLEAQIDILIKKEVPIASFTFGIPDKYLIRRMHEHDIVVMGTATSVAEAAA
FT                   NETAGVDIIVTQGSEAGGHRGSFMKENGEYPMVGNISLIPQVADAVSIPIVAAGGIMDG
FT                   RGVLASMILGASGVQMGTAFLTSQESGADIAYKEAILNSTDTSTVLTNAFSGKMARGIR
FT                   NDFINYLSEFNGEIPDYPIQNQLTSGIRKASTEQHNDKLMSLWSGQTPRLATNRKASKI
FT                   INTIVDEIEEMNKNGIRR"
FT   CDS_pept        522417..523265
FT                   /transl_table=11
FT                   /locus_tag="SCA_0525"
FT                   /product="conserved hypothetical protein"
FT                   /function="uncharacterized conserved protein"
FT                   /note="InterPro: Protein of unknown function DUF72"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0525"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIX5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27439.1"
FT                   /translation="MIDIGLTGWGDHDSLYTDLSRKTDKLKTYASHFPVVELDASYYAI
FT                   QPERNIRKWIKETPERFKFVVKIHQALTLHADYKDYAETRDELFEQFRLMISPLVEADK
FT                   LAMVLVQFPPWFDCKTQNINYIRYVREQLKDVPVCIEFRNQTWFEGDMKENTLQFLTEQ
FT                   HLIHAIVDEPQVGEGSAPMVNRITTDTAFVRYHGRNRHGWTKQDMTDEAWRDVRYLYDY
FT                   STAELESLADQIRIIQHKAKKIYVVFNNNSGGHAAGNAKELQEILGIDYEGLAPQQLKL
FT                   F"
FT   CDS_pept        523277..524101
FT                   /transl_table=11
FT                   /locus_tag="SCA_0526"
FT                   /product="putative membrane protein"
FT                   /function="predicted permeases"
FT                   /note="(P54437) Hypothetical protein yrkJ,InterPro: Protein
FT                   of unknown function DUF81"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0526"
FT                   /db_xref="GOA:B9DIX6"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIX6"
FT                   /inference="similar to AA sequence:UniProtKB:P54437"
FT                   /protein_id="CAL27440.1"
FT                   /translation="MLSILLLILIGALSAILGSIVGIGGGIIIVPTMVYFGVEHHLLTG
FT                   ITPQIAIGTSSIILIVTGLTSTLGYMKSKQVDIKNGYIFLIGLLPGSLVGSLLSRYLTL
FT                   DSFNLYFGIFLIFVSIILMVRYYIKPISLFEKKKYERTYIANDGTTYHYHVPPVFAFFA
FT                   TFGIGILTGLFGIGGGALMTPLMLIVFRFPPHVAVGTSMMMIFFSSVMSSIGHIFQGHV
FT                   AWHYAIVLVISSYFGAKLGVKINQSIQSNTVVVLLRTVMLLMGIYLIIKSIL"
FT   CDS_pept        524118..525437
FT                   /transl_table=11
FT                   /locus_tag="SCA_0527"
FT                   /product="putative 5-nucleotidase"
FT                   /function="5-nucleotidase/23-cyclic phosphodiesterase and
FT                   related esterases"
FT                   /note="(P54602) Hypothetical protein yhcR
FT                   precursor,InterPro: Metallo-phosphoesterase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0527"
FT                   /db_xref="GOA:B9DIX7"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR011240"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIX7"
FT                   /inference="similar to AA sequence:UniProtKB:P54602"
FT                   /protein_id="CAL27441.1"
FT                   /translation="MELTIYHTNDIHSHLHDYERIAAYMAQHRPELNHPSLYIDIGDHV
FT                   DLSAPVTEATHGQKNVQLLNAAHCDIATIGNNEGMTISHDDLNALYEDADFTVTCSNVF
FT                   DEEGNLPHHMTSSFIETIEDTHILFVAATAPFTPFYRALDWVVTDPMAAIKDEIEKQKG
FT                   QYDVLIVMSHCGIFFDRKLCEELPEIDVIFGSHTHHYFEHGEVKNGVLMAAAGKYGHYL
FT                   GEVDLKIENKKVVHKEAKLLPVDTLPEVDTHFAEEGKCLMSDPIIDHPVDLPRRTDVIT
FT                   KTSYLLAQSVYEFTHADCTIINAGLIVKGINGPKVTEFDVHQMLPHPINAVRIKISGKD
FT                   LKSVILTAEEQNYMHEHAQGLGFRGDIFGGYILYKMGYIESEARFFVQGKEIEDDHIYT
FT                   LGTIDMYTFGRYFPIFKDLPTEYLMPEFLRDIFKKKLLEL"
FT   CDS_pept        525521..526453
FT                   /transl_table=11
FT                   /gene="lipA"
FT                   /locus_tag="SCA_0528"
FT                   /product="putative lipoic acid synthetase"
FT                   /function="Lipoate synthase"
FT                   /EC_number="2.8.1.-"
FT                   /note="(Q8CPW4) Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
FT                   synthase) (Lipoate synthase) (Lipoyl-acyl-carrier protein
FT                   synthase) (Sulfur insertion protein lipA)
FT                   (Lip-syn),InterPro: Lipoate synthase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0528"
FT                   /db_xref="GOA:B9DIX8"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DIX8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27442.1"
FT                   /translation="MATKNEEILRKPDWLKIKLNTNENYTGLKKMMREKNLHTVCEEAK
FT                   CPNIHECWGERRTATFMILGAVCTRACRFCAVKTGLPNELDLGEPERVAESVELMNLKH
FT                   VVITAVARDDLRDAGSNVYAETVRKVRERNPYTTIEILPSDMGGDYDALETLMASKPDI
FT                   LNHNIETVRRLTPRVRARATYDRTLEFLRRSKELQPDIPTKSSIMVGLGETIEELHETM
FT                   DDLRAADVDILTIGQYLQPSRKHLKVQKYYSPLEFGKLRKVAMEKGFKHCQAGPLVRSS
FT                   YHADEQVNEAAKERQRIGDEKLEAAKNEA"
FT   CDS_pept        526637..527029
FT                   /transl_table=11
FT                   /locus_tag="SCA_0529"
FT                   /product="conserved hypothetical protein"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0529"
FT                   /db_xref="InterPro:IPR009370"
FT                   /db_xref="InterPro:IPR038141"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIX9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27443.1"
FT                   /translation="MIKAGDKYFELIEEYRDCFDEEQFVNRYSEILDKYDYVVGDFGYE
FT                   QLRLKGFYKDSNKKAEISKRFSTIQDYLLEYCNFGCAYFVLRRIPERELKNIRESEDSE
FT                   LIDNPSDKLHDVKIEPSIPKEQEPEQ"
FT   CDS_pept        complement(527079..527372)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0530"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0530"
FT                   /db_xref="InterPro:IPR021415"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIY0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27444.1"
FT                   /translation="MIDMFLYDDNEEADVQYVGMVGEESRYDLMMFQTNRHYGKVLVLN
FT                   MQTNKFGILGPDDLAEDGYVAYVLGVSDAEGEELTEYLKDVIPSGTFDSGEY"
FT   CDS_pept        527472..527903
FT                   /transl_table=11
FT                   /locus_tag="SCA_0531"
FT                   /product="conserved hypothetical protein"
FT                   /function="uncharacterized conserved protein"
FT                   /note="InterPro: Protein of unknown function DUF86"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0531"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="InterPro:IPR037038"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIY1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27445.1"
FT                   /translation="MYFVDKEKLELKLNYLKQLTEDYPEQKGNHYAFERIAQMLIESSV
FT                   DIGNMIIDGFVLRDPGNYKDVIDILELEKVISPKTKEGINKTVDVRKRFVHEYDQLDTE
FT                   DLIPLFDSSLEDYRNFIDEVIHFLNNENVPVTAFGKGEH"
FT   CDS_pept        527908..528687
FT                   /transl_table=11
FT                   /locus_tag="SCA_0532"
FT                   /product="putative hydrolase of the HAD superfamily"
FT                   /function="predicted sugar phosphatases of the HAD
FT                   superfamily"
FT                   /note="(P15302) NagD protein,InterPro: HAD-superfamily
FT                   subfamily IIA hydrolase hypothetical 1"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0532"
FT                   /db_xref="GOA:B9DIY2"
FT                   /db_xref="InterPro:IPR006354"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIY2"
FT                   /inference="similar to AA sequence:UniProtKB:P15302"
FT                   /protein_id="CAL27446.1"
FT                   /translation="MKHYKGYLIDLDGTMYKGSDEIDGAKQFIDYLNEKDIPHLFVTNN
FT                   STKVPSDVVKKLAGFGIEAKPEEVITSALATAGYIKKENPNASIYVIGEGGIRTALLDA
FT                   GLTLIDDTHVDYVVVGLDTNVNYEKFAQATLGVRNGAKFISTNQDISIPNERGFLPGNG
FT                   AITSVITVSTQVQPTFIGKPQPIIMDMAMDILKLPKDEVAMVGDLYETDIMSGINAGID
FT                   TIHVQTGVTSKEELAQKETQPTYTFKDLNEVLNELEG"
FT   CDS_pept        528696..529667
FT                   /transl_table=11
FT                   /locus_tag="SCA_0533"
FT                   /product="putative D-isomer specific 2-hydroxyacid
FT                   dehydrogenase"
FT                   /function="Lactate dehydrogenase and related
FT                   dehydrogenases"
FT                   /note="(Q8U3Y2) Glyoxylate reductase (EC 1.1.1.26)
FT                   (Glycolate reductase),InterPro: D-isomer specific
FT                   2-hydroxyacid dehydrogenase NAD binding domain"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0533"
FT                   /db_xref="GOA:B9DIY3"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIY3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27447.1"
FT                   /translation="MTKVLVTRKIPERFVDQLKAFAEVEMWDEEYVPMPREKFLEELKD
FT                   ADACFITLSEKVNEETLDAAPKLKIIANLAVGYDNIDIPLAEERGVTVTNTPEVLTETT
FT                   AELGFALMLATARRIVEAEQYIRDGKWKSWGPYLLAGKDVHGSKVGIFGMGDIGKAFAR
FT                   RLKGFEANVMYHNRSRHRIAEKELGVLYVSFDELLENSDFVICTAPLTPETKDKFNRAA
FT                   FKKMRNDAIFINIGRGATVVEEDLIQALKDGEIAGAGLDVFREEPISTDHPLLKLSNAV
FT                   VLPHIGSASVVTRDRMIQLSISNVKAVLEGHPPITPVTDNKK"
FT   CDS_pept        530259..531713
FT                   /transl_table=11
FT                   /gene="dltA"
FT                   /locus_tag="SCA_0534"
FT                   /product="D-alanine-D-alanyl carrier protein ligase"
FT                   /function="Non-ribosomal peptide synthetase modules and
FT                   related proteins"
FT                   /EC_number="6.1.1.13"
FT                   /note="(Q8CT93) D-alanine--poly(phosphoribitol)ligase
FT                   subunit 1 (EC 6.1.1.13) (D-alanine-activating enzyme) (DAE)
FT                   (D-alanine-D-alanyl carrier protein ligase) (DCL),InterPro:
FT                   AMP-dependent synthetase and ligase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0534"
FT                   /db_xref="GOA:B9DIY4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR010072"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIY4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27448.1"
FT                   /translation="MKDIINVLNSIVKDSPDSIAVRHIDDTLSYKELDELSDQLASLIQ
FT                   DSKKPVILYGHMSPFMVVGMIAGIKAGCGYVPIDTSVPNERTAMIIDKTEPEFIFDTSD
FT                   ETFEFKQGKVLTIEGVQNTSTPEVFESHMKPEDVVYTIFTSGSTGEPKGVQIQYTSLIE
FT                   FAEWMKDLNQLGKGQEWLNQAPFSFDLSVMAIYPCLFTGGTLNLVDKDMIKKPKLLNDM
FT                   LQKTPINVWVSTPSFIEMCLLLPTLDEKQYPSLKEFFFCGEILPHRTAKALVERFPSAT
FT                   IYNTYGPTEATVAVTSIQITPEILEKYSTLPVGQARPGTTLSTTDEGELIITGNSVSVG
FT                   YLKNKEKTQEVFSTSEDTRSYRSGDRAKFEDDQWFIQGRIDFQIKMNGYRMELEEIETI
FT                   LRQSSWVREAVVVPIYKNGRVTQLIGAVVPTENVEDSAKLSHEIKSDLKSSLPEYMIPR
FT                   KFVWMDQLPLTSNGKIDRKKIAEELN"
FT   CDS_pept        531713..532927
FT                   /transl_table=11
FT                   /gene="dltB"
FT                   /locus_tag="SCA_0535"
FT                   /product="DltB membrane protein"
FT                   /function="predicted membrane protein involved in D-alanine
FT                   export"
FT                   /note="(P35855) Protein dltB (Basic membrane protein)
FT                   (BMP),InterPro: Membrane bound O-acyl transferase MBOAT"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0535"
FT                   /db_xref="GOA:B9DIY5"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR024024"
FT                   /db_xref="InterPro:IPR024194"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIY5"
FT                   /inference="similar to AA sequence:UniProtKB:P35855"
FT                   /protein_id="CAL27449.1"
FT                   /translation="MTPYGTFTFFLIAFILLIPVIILGFLGKRSYIYNGISTAIMIVII
FT                   FASDKLNFFGIKYLSVQLVSFIIYMLWQAALIMWYYHSRPKNNTFAKFFIVMTLSILPL
FT                   ALVKIFSSSWLGGQQIQFHEHKLIEFIGFLGISYVTFKSVQLIMEIRAGSIKEIKLGKL
FT                   FQFISFFPTISSGPIDRYKRFVKDDKKVPTGDEYRGLVLKAIHMIMLGFLYKYIIAYFV
FT                   NQYGVMPLQMHLHGFVRYWLYMYAYSMYLFFDFAGYSLFAIAVSFLYGIKTPPNFNQPF
FT                   KSRNIKDFWNRWHMTLSFWFRDCIYMRSLFFMSKKKLMKSQFAMSNVAFFLNFFIMGVW
FT                   HGLEVYYIGYGLYHAALFIGYGYYERWRKKHPPRWDNRFTTALSIIITFHFVTFGFLIF
FT                   SGKLI"
FT   CDS_pept        532950..533186
FT                   /transl_table=11
FT                   /gene="dltC"
FT                   /locus_tag="SCA_0536"
FT                   /product="D-alanyl carrier protein"
FT                   /function="Acyl carrier protein"
FT                   /EC_number="6.1.1.13"
FT                   /note="(Q53663) D-alanine--poly(phosphoribitol)ligase
FT                   subunit 2 (EC 6.1.1.13) (D-alanyl carrier protein)
FT                   (DCP),InterPro: D-alanyl carrier protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0536"
FT                   /db_xref="GOA:B9DIY6"
FT                   /db_xref="InterPro:IPR003230"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DIY6"
FT                   /inference="similar to AA sequence:UniProtKB:Q53663"
FT                   /protein_id="CAL27450.1"
FT                   /translation="MEFREQVLDLLAEVAENDVVKENPDVEIFEEGIIDSFQTVGLLLE
FT                   IQNKLGIEVSIMDFDRDEWATPNKIVEALEELK"
FT   CDS_pept        533183..534337
FT                   /transl_table=11
FT                   /gene="dltD"
FT                   /locus_tag="SCA_0537"
FT                   /product="poly D-alanine transfer protein"
FT                   /function="Protein involved in D-alanine esterification of
FT                   lipoteichoic acid and wall teichoic acid (D-alanine
FT                   transfer protein)"
FT                   /note="(P39578) Protein dltD precursor,InterPro: DltD
FT                   central region"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0537"
FT                   /db_xref="GOA:B9DIX4"
FT                   /db_xref="InterPro:IPR006998"
FT                   /db_xref="InterPro:IPR023896"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIX4"
FT                   /inference="similar to AA sequence:UniProtKB:P39578"
FT                   /protein_id="CAL27451.1"
FT                   /translation="MSKKLKPFLPIFISGAIFIIFVLLPSSWFTGLVNKKTLAENRMSL
FT                   TDQVMKGPLIQDKLFHHNKQYYPIYGSSELEKDDPFNPAIALNKHNSPRQAFLIGTGGN
FT                   TDLVNGVELASQYDDLKGKKIAFIISPQWFTNHGLTNVNFDARMSQNQINQMFNQKNMS
FT                   DELKQRYAKRLLQFKNVHNKEFLRETAKNQGKTDGNYISGFKENQLTKIEAIKSLMNFK
FT                   KVPLEHVKPVTSEDASWSEMRDVATQYGEAHSKSNQYHIRDKYWKLIKAHKRRMNRDYE
FT                   FNINSPEFADLKLLADTMHEAGADVEYISIPVNGKWYDNIGIDKDKRQPVYDKIHRTVV
FT                   DSGGKIYDMTDKDYEPYVITDAVHIGWKGWVYIDEHIVYHMKEK"
FT   CDS_pept        534521..536569
FT                   /transl_table=11
FT                   /locus_tag="SCA_0538"
FT                   /product="putative cation exporting ATPase"
FT                   /function="Cation transport ATPase"
FT                   /note="(P05425) Probable copper exporting ATPase B (EC
FT                   3.6.3.4),InterPro: Copper-translocating P-type ATPase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0538"
FT                   /db_xref="GOA:B9DIW3"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIW3"
FT                   /inference="similar to AA sequence:UniProtKB:P05425"
FT                   /protein_id="CAL27452.1"
FT                   /translation="MTQNQNSSHTHESSHVHNHHGMHHQNHMGHHHHGNFKKKFFISLI
FT                   FALPIIILSPMMGLHLPFQFTFKGSDWIVLILATILFVYGGQPFLSGAKDELKEKKPGM
FT                   MTLIALGITVAYVYSLYAFYLNHFSNTSSHAMDFFWELATLIIIMLLGHWIEMNAVGNA
FT                   GNALEKMAALLPNKAIKVNKDGNHETIQTSDIKDGDIIEVKSGDSIPADGIIIKGNTDV
FT                   DESLVTGESKKVPKHIDDKVIGGAINGSGTIQVKVSAAGGKGYLSQVMDMVSQAQDDKS
FT                   KAELLSDKVAGYLFYFTVSAGLIAFIVWVLITHNIDFALERLVTVLVIACPHALGLAIP
FT                   LVTARSTSIGAHNGLIIKNREAVEIAQPLNYVMMDKTGTLTKGVFTVNHYESLDSQLSD
FT                   DEVLQLFASLESASNHPLARGIIEYAKSKDTKVENSEDVQTISGVGLEGKVNGHSFKIV
FT                   NESYLKKHQFKYDVSLFTHWAQKGNSISYLIEGDSVVGFIAQGDQIKESSKQMVSDLIE
FT                   RKITPVMLTGDNKEVAENVAKELGIKYVHSELLPEDKETIIQNYQKDGSKVMMVGDGIN
FT                   DAPSLVRADIGAAIGAGTDVAIDSADIIIVKSNPIDIIHFLTLSKNTMRKMVQNLWWGA
FT                   GYNIIAVPLAAGVLAFAGLILSPAVGAILMSLSTIIVAINAFTLKLD"
FT   CDS_pept        536746..537516
FT                   /transl_table=11
FT                   /locus_tag="SCA_0539"
FT                   /product="putative MerR family transcriptional regulator,"
FT                   /function="predicted transcriptional regulators"
FT                   /note="(P32184) HTH-type transcriptional activator
FT                   tipA,InterPro: Bacterial regulatory protein MerR family"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0539"
FT                   /db_xref="GOA:B9DIW4"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012925"
FT                   /db_xref="InterPro:IPR036244"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIW4"
FT                   /inference="similar to AA sequence:UniProtKB:P32184"
FT                   /protein_id="CAL27453.1"
FT                   /translation="MKYLMSEVSEMTGLSTRTLRYYDEIKLLKAHRSAENGYRIYFSED
FT                   LDVLQVIMFLRKMEVPLPEIRRLIQSDETDLMHILMQQKQKLVEKQSELARLIQLIDTT
FT                   LENEQEGKQMSDREKFEAFKLEKINENNEKYGQEVIEKYGHDTLEKTEQHWSHLSQLEY
FT                   HQAGEYELIIKRGLQNLMERGHENKNSDTDNEVFDAHAKWLKLMSGQYSETYHNAMAEL
FT                   YVEDERFTAYYDNLVGKKGAAEMLSNIIKKYTHK"
FT   CDS_pept        complement(537581..537823)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0540"
FT                   /product="hypothetical protein with NifU domain"
FT                   /function="Thioredoxin-like proteins and domains"
FT                   /note="(Q43909) Nitrogen fixation protein nifU,InterPro:
FT                   Nitrogen-fixing NifU C-terminal"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0540"
FT                   /db_xref="GOA:B9DIW5"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIW5"
FT                   /inference="similar to AA sequence:UniProtKB:Q43909"
FT                   /protein_id="CAL27454.1"
FT                   /translation="MPTENTTIFDQVAVVIERLRPFLLRDGGDCTLIDVEDGIVKLQLH
FT                   GACNTCPSSTITLKAGIERALLEEVPGVVEVEQVF"
FT   CDS_pept        537917..538237
FT                   /transl_table=11
FT                   /locus_tag="SCA_0541"
FT                   /product="conserved hypothetical protein"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0541"
FT                   /db_xref="InterPro:IPR009190"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR038218"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIW6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27455.1"
FT                   /translation="MTKVSVVVYGADVVCASCVNAPTSKDTFDWLQALLKRKYPDINFE
FT                   YTYIDFQKDAENLSDHDQQYIEQLENDELFYPLVTMDDMLVADGFIQSKQITRFVDEHF
FT                   EN"
FT   CDS_pept        538342..538773
FT                   /transl_table=11
FT                   /locus_tag="SCA_0542"
FT                   /product="putative acetyltransferase"
FT                   /function="Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /EC_number="2.3.1.-"
FT                   /note="(P09163) Hypothetical acetyltransferase yjaB (EC
FT                   2.3.1.-),InterPro: GCN5-related N-acetyltransferase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0542"
FT                   /db_xref="GOA:B9DIW7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIW7"
FT                   /inference="similar to AA sequence:UniProtKB:P09163"
FT                   /protein_id="CAL27456.1"
FT                   /translation="MTLSKRKLQEKDYPEALDIWEQSVTATHDFLKEKDRLELKIEIPN
FT                   YFKMVEAYLWFDGQEVVGFSGTNDQNLEMLFIKPEFFNNGYGTEIIRYLIQENKIQYVD
FT                   VNKDNRTALNFYIKNGFKIYSESQKDDQGRDYPILHLKL"
FT   CDS_pept        complement(538826..539890)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0543"
FT                   /product="putative pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /function="NADH dehydrogenase FAD-containing subunit"
FT                   /note="(P80861) NADH dehydrogenase-like protein yjlD (EC
FT                   1.6.99.-) (Glucose starvation-inducible protein 5)
FT                   (GSI5),InterPro: FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0543"
FT                   /db_xref="GOA:B9DIW8"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIW8"
FT                   /inference="similar to AA sequence:UniProtKB:P80861"
FT                   /protein_id="CAL27457.1"
FT                   /translation="MKNLVLLGGGYGNMRILSHILPDKLPEDYTITLIDRMPYHGLKPE
FT                   YYALAAGTKSDKDVRLKFPESEKLNIVYGDISAIDLDEQIVSVGDTKVDYDELVIGLGC
FT                   EDKYHNVPGAEEYTYSIQTLAKSRKTYHTISDLPTGSKVAIVGAGLSGIELASELRESR
FT                   SDLDIRLYDRGERILARFPEKLSHYIEKWFKKNNVTVIPNSNINKVEPGVIYNHDEPEE
FT                   VDIVVWTAGIHPVSVVRNLPVDVSKNGQVIVNQYHQIPTYQNVYVVGDCANLPHAPSAQ
FT                   LAEIQGDQIADVMTKQWKNEPLPDKMPELKIQGFFGSLGDKKGFAYVLDRPLTGRIASI
FT                   MKSGILWLYKYHNG"
FT   CDS_pept        540132..540368
FT                   /transl_table=11
FT                   /locus_tag="SCA_0544"
FT                   /product="conserved hypothetical protein"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0544"
FT                   /db_xref="InterPro:IPR009910"
FT                   /db_xref="InterPro:IPR022916"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DIW9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27458.1"
FT                   /translation="MNPIVEFCISNMAKGGDYVYNKLDQDPGVDVLEYGCLQNCGVCSS
FT                   GLYALVNGDIVEGDSPDDLLQNIYKHIEETWIF"
FT   CDS_pept        540412..540771
FT                   /transl_table=11
FT                   /locus_tag="SCA_0545"
FT                   /product="conserved hypothetical protein with HesB-like
FT                   domain"
FT                   /function="uncharacterized conserved protein"
FT                   /note="(O32113) Hypothetical protein yutM,InterPro: Protein
FT                   of unknown function HesB/YadR/YfhF"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0545"
FT                   /db_xref="GOA:B9DIX0"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIX0"
FT                   /inference="similar to AA sequence:UniProtKB:O32113"
FT                   /protein_id="CAL27459.1"
FT                   /translation="MPTVILTEAAAYEVKSMLESNDMPDGYLKIKVNGGGCTGLTYGMT
FT                   AEEEPGENDEVIEYYGLKVLVDNYDKPVLEGTTIDFKQSLMGGGFQIDNPNAIASCGCG
FT                   SSFRTAKVAGNPEDC"
FT   CDS_pept        541075..542280
FT                   /transl_table=11
FT                   /locus_tag="SCA_0546"
FT                   /product="putative NADH dehydrogenase"
FT                   /function="NADH dehydrogenase FAD-containing subunit"
FT                   /EC_number="1.6.99.3"
FT                   /note="(P80861) NADH dehydrogenase-like protein yjlD (EC
FT                   1.6.99.-) (Glucose starvation-inducible protein 5)
FT                   (GSI5),InterPro: FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0546"
FT                   /db_xref="GOA:B9DIX1"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIX1"
FT                   /inference="similar to AA sequence:UniProtKB:P80861"
FT                   /protein_id="CAL27460.1"
FT                   /translation="MAEIKKVIVLGAGYAGLQTVTKLQKILPADEAEITLIDKDDYHYE
FT                   SVLLHEASAGTVNYEDIIYPIESVINQERVKFLKGEVVKVDPHAKVVETNNGRFNYDIL
FT                   VVGLGFVSETFGIKGMLDHAFQIENIQTARKLSRHIEDKFANYASSKEKDPKDLAFLVG
FT                   GAGFTGIEFLGELTARVDELSNKYGVDRDKVKITCVEAAPTMLPMFDDELVNYAVNYLE
FT                   ERGVEFKIGTPIVGANEKGFLVKVGDEEQQLEANTSVWTAGVRGSKIMDNSFEGVKRGR
FT                   LVVNQDLTAPGFNETFVIGDVSAYIPEGEERPLPTTAQIAMQQGESVAKNVKNILNGQP
FT                   KEPFNYVNRGTVCSLGAHDGVGIVYGRNIVGKKAAFMKKVIDTRSIFKIGGIGLAFKKG
FT                   KF"
FT   CDS_pept        542400..543887
FT                   /transl_table=11
FT                   /locus_tag="SCA_0547"
FT                   /product="cytosol aminopeptidase family protein"
FT                   /function="Leucyl aminopeptidase"
FT                   /EC_number="3.4.11.1"
FT                   /note="(O32106) Probable cytosol aminopeptidase (EC
FT                   3.4.11.1) (Leucine aminopeptidase) (LAP) (Leucyl
FT                   aminopeptidase),InterPro: Peptidase M17 cytosol
FT                   aminopeptidase C-terminal"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0547"
FT                   /db_xref="GOA:B9DIX2"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DIX2"
FT                   /inference="similar to AA sequence:UniProtKB:O32106"
FT                   /protein_id="CAL27461.1"
FT                   /translation="MPIQITFDEQDELASDVLVVALPDHLNQLSTLTFQGHNLTELLDT
FT                   YKQHHIISSEVGKVSSTRFNENGLDVRLITVGLGNLKELNRARTMEVFEKLLQTLKGNH
FT                   ITSADVLLQSFASKAIEKIEIAELFSLQAKKALYHFNNYKADKRVPYHLNLKIHGAEAD
FT                   EVTAIKDGEIIGEGIKLARDFSNIPPNILTPEYFADMISAHFEETSVEVEVKDAETLQA
FT                   EGFGLIHAVGKGSEFGPRLITLTYQGADDDSAPIALVGKGITYDSGGYSIKSKLGMQEM
FT                   KFDMCGSANVLGMIEAAHRLALPINIVGVIASAENMINGEAMKPDDVFTALNGETVEVL
FT                   NTDAEGRLVLGDAVFHASQYQPSVILDFATLTGAAVAALGEDKAAVFKNNSDAPLEEIT
FT                   KIAGENGEWTFELPVTETEKHLIKKSEVADLVNHTNGMGKALFAAAFVMHFSGNIPQLH
FT                   FDIAGPATTNRNNFNGPKGPTGYLIQSIVDWLRQEIK"
FT   CDS_pept        544051..545367
FT                   /transl_table=11
FT                   /locus_tag="SCA_0548"
FT                   /product="putative permease"
FT                   /function="predicted permease"
FT                   /note="(P46231) Hypothetical protein VP2115
FT                   (ORF3),InterPro: Na+/H+ antiporter NhaC"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0548"
FT                   /db_xref="GOA:B9DIX3"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="InterPro:IPR032813"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIX3"
FT                   /inference="similar to AA sequence:UniProtKB:P46231"
FT                   /protein_id="CAL27462.1"
FT                   /translation="MLNAVVIAVLLMIILCLCRLNVVLSLFVSGLVGGVVAGMSVEKVI
FT                   KVFTDNIVDGAEVALSYALLGGFAALISYSGITDYLVSKVINMIHAENNRVSRSTIKVI
FT                   LIVSLLLLSMSSQNLIPVHIAFIPIVIPPLLSLFNELNIDRRQIALVIGFGLCFPYFLM
FT                   PFGFGQIFHQIIQTGFAKAHHPIEFDMIWKALLIPSIGYIVGLALGLFVYRKPRHYRND
FT                   EEQINKAPKELKPYVLAVTIVAILLTFIVQLLTESMIFGALAGVMVFFISRAYKWFVLD
FT                   KEFTEGIKIMAYIGVVILTANGFAGVMNATGDVKSLVTGIASITGDHKLIAIILMYLIG
FT                   LIVTLGIGSSFATIPIIAALFIPLGEQLGMSTMALIALIGTAAALGDSGSPASDSTLGP
FT                   TAGLDVDGQHDHIRDTCVPNFLFYNIPLMIFGTIAAMIL"
FT   CDS_pept        545398..545772
FT                   /transl_table=11
FT                   /locus_tag="SCA_0549"
FT                   /product="conserved hypothetical protein"
FT                   /function="uncharacterized protein possibly involved in
FT                   aromatic compounds catabolism"
FT                   /note="(P14205) ComA operon protein,InterPro: Phenylacetic
FT                   acid degradation-related protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0549"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIW2"
FT                   /inference="similar to AA sequence:UniProtKB:P14205"
FT                   /protein_id="CAL27463.1"
FT                   /translation="MTNLLEELEMEILEVKEGYTKIKMPVSDKVKQPFGYLHGGATMAL
FT                   GETACSVGAAHMVDTNKIIPVGLEMNTNHIRSATEGNVFAIAELIHGGRTTQVWNINII
FT                   DDNDKLISVMRGTMLLKQRH"
FT   CDS_pept        complement(545909..547057)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0550"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0550"
FT                   /db_xref="GOA:B9DIV0"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIV0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27464.1"
FT                   /translation="MSWTIIGGGIHAVTIAIKLRAAGLPADELTIIDPHESLCEQFDDF
FT                   SCRIGMPFLRSPHVHHVHPDPFHLKKFAKTNQYTGATYGKYQRPQRDMFMDHTHKMLHE
FT                   FDLNERHIKDFAVNVDKEDGRWKVEMQNHDPVFSDKLVLAIGSNNIPHIPETYQAHEDI
FT                   HHIFEDVEIPYETSSHVVGSGITAAHLTLKLIEASQSSKVHLWMNKSIEVYDFDADPGW
FT                   LGPKNMTRYREIDSSKERLKVIVQERHKGSMPKELYLRLKKHMQEGELEIHVNEIQTIQ
FT                   NHKIITEQDEYQYDHILLATGFKNNIMQMPVIKNFVENINAPLTETKHPSLTENLEWVP
FT                   GVYVSGALADIELGPFARSFAGGRESANRIAKAFNGEEEKVS"
FT   CDS_pept        complement(547194..547568)
FT                   /transl_table=11
FT                   /gene="mnhG"
FT                   /locus_tag="SCA_0551"
FT                   /product="putative Na+/H+ antiporter subunit"
FT                   /function="Multisubunit Na+/H+ antiporter MnhG subunit"
FT                   /note="(P60696) Na(+)/H(+) antiporter subunit G (Mnh
FT                   complex subunit G),InterPro: Na+/H+ antiporter subunit"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0551"
FT                   /db_xref="GOA:B9DIV1"
FT                   /db_xref="InterPro:IPR005133"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIV1"
FT                   /inference="similar to AA sequence:UniProtKB:P60696"
FT                   /protein_id="CAL27465.1"
FT                   /translation="MNMIDTIMISLSLFFVIVGALISALSALGILRLRDVYGRAHAAGK
FT                   ASTLGSMSLLLGVFLYFIGKDHYANPQLIIGILFILLTGPLSSHLIIRAAYKIKTPYTK
FT                   KTKLDEINEPKEEKPKAASK"
FT   CDS_pept        complement(547540..547836)
FT                   /transl_table=11
FT                   /gene="mnhF"
FT                   /locus_tag="SCA_0552"
FT                   /product="putative Na+/H+ antiporter subunit"
FT                   /function="Multisubunit Na+/H+ antiporter MnhF subunit"
FT                   /note="(O05228) Na(+)/H(+) antiporter subunit F (Multiple
FT                   resistance and pH homeostasis protein F) (Mrp complex
FT                   subunit F) (Sodium-cholate efflux protein mrpF),InterPro:
FT                   Multiple resistance and pH regulation protein F"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0552"
FT                   /db_xref="GOA:B9DIV2"
FT                   /db_xref="InterPro:IPR007208"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIV2"
FT                   /inference="similar to AA sequence:UniProtKB:O05228"
FT                   /protein_id="CAL27466.1"
FT                   /translation="MSAFNIVIIIALIIVALSILGMLVRVILGPSLADRVVALDAIGIQ
FT                   LMAIVALFSIFLDTKYMIVTILLIGIIAFLGTAVFAKYMQEGQVIEHDRHDND"
FT   CDS_pept        complement(547836..548315)
FT                   /transl_table=11
FT                   /gene="mnhE"
FT                   /locus_tag="SCA_0553"
FT                   /product="putative Na+/H+ antiporter subunit"
FT                   /function="Multisubunit Na+/H+ antiporter MnhE subunit"
FT                   /note="(Q7WY60) Na(+)/H(+) antiporter subunit E (Multiple
FT                   resistance and pH homeostasis protein E) (Mrp complex
FT                   subunit E),InterPro: Protein of unknown function DUF68"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0553"
FT                   /db_xref="GOA:B9DIV3"
FT                   /db_xref="InterPro:IPR002758"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIV3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27467.1"
FT                   /translation="MAVQILVNILIAIFWLFVNDSYTLNNFVLGFLFGLLLVFLMRKIL
FT                   PGRFYIVTLYYVVKLGCTFLIELIKANIDVIRIVTKPHMDNEPAFFVYDTDLKRPWEIV
FT                   LLCTMITLTPGTIVLGVSDDNRKIYIHCLDFSTKEEEIEGIKSSLEKAVREVGEY"
FT   CDS_pept        complement(548317..549813)
FT                   /transl_table=11
FT                   /gene="mnhD"
FT                   /locus_tag="SCA_0554"
FT                   /product="putative Na+/H+-antiporter subunit"
FT                   /function="Formate hydrogenlyase subunit 3/Multisubunit
FT                   Na+/H+ antiporter MnhD subunit"
FT                   /note="(P60684) Na(+)/H(+) antiporter subunit D (Mnh
FT                   complex subunit D),InterPro: NADH/Ubiquinone/plastoquinone
FT                   (complex I)"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0554"
FT                   /db_xref="GOA:B9DIV4"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIV4"
FT                   /inference="similar to AA sequence:UniProtKB:P60684"
FT                   /protein_id="CAL27468.1"
FT                   /translation="MIENNLLAAMLLAPMFTAIILVFIGKRPFIKRFVALGGSLVALAL
FT                   AIVNFINVWHHGPLKLELGSWKAPYSIVFVLDLFSATLVITSIIVTILIILFSYQSIGL
FT                   HRETYYYYFAVMFMETGIIGAFITGDIFNLFVFFEVFLISSYALLVIGGTKIQLQESIK
FT                   YVLVNVASSAFFVMAVGILYSVVGTLNMADISRKLAHLSDKDSGLVSIVFILFLFVFAT
FT                   KAGAFPMYVWLPGAYYAPPFAIIAFFGALLTKVGVYAIARTLSLFFVNTLSFSHYTVLV
FT                   LALLTIIFGSIGAISYNDTKKIIIYNIMIAVGIILVGVAMMNEDGIIGALYYTVNDMLI
FT                   KAALFFLIGVMLKITKTTDIREFSGLIKGYPVLGWTFFIACLNLAGIPPFSGFYGKMLI
FT                   VRATFEKGFYISGIIVLLSSLLILYSVMRIFIKGFFGEAKGYKLNHKLHYRGLLSVAIF
FT                   AVVLCVVFSFTADWLYPFFKQAAVTFYDPKAYIDSVLGVK"
FT   CDS_pept        complement(549806..550150)
FT                   /transl_table=11
FT                   /gene="mnhC"
FT                   /locus_tag="SCA_0555"
FT                   /product="putative Na+/H+ antiporter subunit"
FT                   /function="Multisubunit Na+/H+ antiporter MnhC subunit"
FT                   /note="(P60680) Na(+)/H(+) antiporter subunit C (Mnh
FT                   complex subunit C),InterPro: NADH-ubiquinone oxidoreductase
FT                   chain 4L"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0555"
FT                   /db_xref="GOA:B9DIV5"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIV5"
FT                   /inference="similar to AA sequence:UniProtKB:P60680"
FT                   /protein_id="CAL27469.1"
FT                   /translation="MEIIMIIVCGILTSISVYLILSKSLIRIIIGTAVQTHAANLFLIT
FT                   MGGLNEGAVPIFQPGTKSYVDPIPQALILTAIVISFAVTAFFLVLTFRSYKELGTDNVE
FT                   RMKGVPEDDD"
FT   CDS_pept        complement(550150..550515)
FT                   /transl_table=11
FT                   /gene="mnhB"
FT                   /locus_tag="SCA_0556"
FT                   /product="putative Na+/H+ antiporter subunit"
FT                   /function="Multisubunit Na+/H+ antiporter MnhB subunit"
FT                   /note="(Q52978) Probable K(+)/H(+) antiporter subunit A/B
FT                   (pH adaptation potassium efflux system protein A/B) (Pha
FT                   system subunit A/B),InterPro: Na+/H+ antiporter MnhB
FT                   subunit-related protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0556"
FT                   /db_xref="GOA:B9DIV6"
FT                   /db_xref="InterPro:IPR005281"
FT                   /db_xref="InterPro:IPR007182"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIV6"
FT                   /inference="similar to AA sequence:UniProtKB:Q52978"
FT                   /protein_id="CAL27470.1"
FT                   /translation="MIFAFSLFLNGHYQPGGGFIGGLLVSSSLVLVSVAFDVKTMRKIF
FT                   PWDFKKLIAIGLSFCALTPCASWLYGKNFFTHRVFEIPLPLLKPMQVHTALFFDLGVLL
FT                   AVVGTVMTIILAIGENE"
FT   CDS_pept        complement(550559..552976)
FT                   /transl_table=11
FT                   /gene="mnhA"
FT                   /locus_tag="SCA_0557"
FT                   /product="putative Na+/H+ antiporter subunit"
FT                   /function="NADH:ubiquinone oxidoreductase subunit 5 (chain
FT                   L)/Multisubunit Na+/H+ antiporter MnhA subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="(Q8NXF6) Na(+)/H(+) antiporter subunit A (Mnh
FT                   complex subunit A),InterPro: Monovalent cation/proton
FT                   antiporter"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0557"
FT                   /db_xref="GOA:B9DIV7"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR005663"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="InterPro:IPR025383"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIV7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27471.1"
FT                   /translation="MSWLHTAVLLPFIFALIIPIVYRFIKRIHIGWFVLPVPVVLFIYF
FT                   LSYISTTMSGDHRFAELKWMPQIGMNFNLYVDGLSLLFSLLITGIGALVTFYSISYLSK
FT                   NEQLGNFYCYLLLFMGAMLGVVLSDNVFMLYLFWEMTSFSSFLLISFWRTRQASLYGAQ
FT                   KSLLITVFGGLSLLGGLILMTLSGHSTSIRHLIAHASEIQSSPTFILAMILILFGAMTK
FT                   SAQFPFYIWLPDAMEAPTPVSAYLHSATMVKAGIYLVARFTPIFALSEGWIWTVTAIGL
FT                   ITLFWGSLNATKQLDLKGILAFSTVSQLGMVMAMLGIGAVSYHYQGAQSQFYAAAFIAA
FT                   TFHLINHATFKCALFMVAGIIDHETGTRDVRKLGGLMTVMPISFTITVITALSMAGVPP
FT                   FNGFLSKESFIEAMINVTHSHLFSLNTLGVLIPIVAIVGSVFTFVYSVRFIGQIFWGSY
FT                   KPEKLPHKPHEPSFMMWIAPAFLAVLVIVFGLFPAILTKPIIDPASRAISNAHIPHAEF
FT                   HLFHGFTPAFFATLFIYAAGIALIFTYHKWVKVIESIPERLELNYLYDRSGRYMPFYSK
FT                   KVTRTYMSGFIRNKLMVILGSLIALTLITLLCMPFSLNFDHVSRLRTTEIIIVIMILAS
FT                   AFMIVFARSRLFSIIMLSAVGYSMAIFFIFFNAPDLALTQFVVETISTALFLLCFYHLP
FT                   NLNRYNESKSFKVGNALIAAGVGIVVTVLGLIAYGNKHFESIASYYKENVHSLAHGNNM
FT                   VNVILVDFRGTDTLFESSVLGIAGLGVYTLIKLRSKHKNGYERVEENEQTEK"
FT   CDS_pept        complement(553112..553495)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0558"
FT                   /product="conserved hypothetical protein"
FT                   /note="(Q08429) Kinase-associated lipoprotein B precursor"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0558"
FT                   /db_xref="InterPro:IPR014916"
FT                   /db_xref="InterPro:IPR038080"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIV8"
FT                   /inference="similar to AA sequence:UniProtKB:Q08429"
FT                   /protein_id="CAL27472.1"
FT                   /translation="MLYRFSHKTGSYGVSIVEENENGEVLVKVEQVIKHPKQGDLHDPN
FT                   AVDGVFFHERRALSHYEKRFTPKSKLREFNVEEMPYEASLQKAITDLEEKLKEADTPHA
FT                   KRSLENLAELKKDYSIQYKQNFK"
FT   CDS_pept        553567..554160
FT                   /transl_table=11
FT                   /locus_tag="SCA_0559"
FT                   /product="putative peptidyl-prolyl cis-trans isomerase"
FT                   /function="Peptidyl-prolyl cis-trans isomerase (rotamase)
FT                   -cyclophilin family"
FT                   /EC_number="5.2.1.8"
FT                   /note="(P52017) Peptidyl-prolyl cis-trans isomerase 10 (EC
FT                   5.2.1.8) (PPIase) (Rotamase) (Cyclophilin-10),InterPro:
FT                   Peptidyl-prolyl cis-trans isomerase cyclophilin type"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0559"
FT                   /db_xref="GOA:B9DIV9"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIV9"
FT                   /inference="similar to AA sequence:UniProtKB:P52017"
FT                   /protein_id="CAL27473.1"
FT                   /translation="MANYPQLNKEVQDNEIKAVMHTNKGDMTFKLLPDLAPKTVENFVK
FT                   HAKDGYYNGITFHRVINDFMVQGGDPTATGMGGESIYGGPFEDEFSMEAFNLYGALSMA
FT                   NAGPNTNGSQFFIVQMKEVPENMLNQLADGGWPEQIVEAYGEKGGTPWLDQKHTVFGQI
FT                   IEGEDTLEDIANTKVGPQDKPLHDVVIESIDIED"
FT   CDS_pept        554262..554528
FT                   /transl_table=11
FT                   /locus_tag="SCA_0560"
FT                   /product="hypothetical protein"
FT                   /note="(O05234) Hypothetical protein yugE"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0560"
FT                   /db_xref="InterPro:IPR015053"
FT                   /db_xref="InterPro:IPR023162"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIW0"
FT                   /inference="similar to AA sequence:UniProtKB:O05234"
FT                   /protein_id="CAL27474.1"
FT                   /translation="MAEMEKNEVNIALYQLLADWNPMHFEDKTMGDAEVYEMMDAVHQI
FT                   DDVNELARKFQSIFQYSFEEKLAIEDCQKKANEALSLEGTCGL"
FT   CDS_pept        554556..555083
FT                   /transl_table=11
FT                   /locus_tag="SCA_0561"
FT                   /product="hypothetical protein with NUDIX hydrolase
FT                   signature"
FT                   /function="NTP pyrophosphohydrolases including oxidative
FT                   damage repair enzymes"
FT                   /note="(Q8Y9Z9) Putative Nudix hydrolase lmo0368 (EC
FT                   3.6.-.-),InterPro: NUDIX hydrolase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0561"
FT                   /db_xref="GOA:B9DIW1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIW1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27475.1"
FT                   /translation="MAEILDLYNQYRQHLKGQTIERGNKLDEGTFHLVAHVCIFNQQGE
FT                   MLIQQRKYDKKLWPGLWDFSAAGAVMQGETSNIAAQREIKEELDLDFDLTKMRPQLSMT
FT                   FPFGFDDVYLIQAEVQLNDIHIEKDEVEDIRFAGREEILTLIEKEKFINYKPGLIELIF
FT                   DFVESGNDGMYQ"
FT   CDS_pept        555235..555621
FT                   /transl_table=11
FT                   /locus_tag="SCA_0562"
FT                   /product="hypothetical protein with S1 RNA binding domain"
FT                   /function="predicted RNA binding protein (contains
FT                   ribosomal protein S1 domain)"
FT                   /note="(P80870) General stress protein 13 (GSP13),InterPro:
FT                   RNA binding S1"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0562"
FT                   /db_xref="GOA:B9DIU9"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIU9"
FT                   /inference="similar to AA sequence:UniProtKB:P80870"
FT                   /protein_id="CAL27476.1"
FT                   /translation="MNNHYQIGQHVKVKVAGIQPYGAFVETPDNTEGLIHISEIMNDYV
FT                   HNLSRFLSEGQIVRAKILSIDEEGKLNLSLKDNDYFKNYERKKEKKSVLDEIKETEKYG
FT                   FQTLEERLPVWIAQSKKMIKENKL"
FT   CDS_pept        555864..556991
FT                   /transl_table=11
FT                   /locus_tag="SCA_0563"
FT                   /product="putative NADH-dependent flavin oxidoreductase"
FT                   /function="NADH:flavin oxidoreductases Old Yellow Enzyme
FT                   family"
FT                   /note="(P54524) Probable NADH-dependent flavin
FT                   oxidoreductase yqiG (EC 1.-.-.-),InterPro: NADH:flavin
FT                   oxidoreductase/NADH oxidase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0563"
FT                   /db_xref="GOA:B9DIT8"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIT8"
FT                   /inference="similar to AA sequence:UniProtKB:P54524"
FT                   /protein_id="CAL27477.1"
FT                   /translation="MEKKYETLFTEYTLPNGVAIRNRFVLAPLTHISSNDDGTIADVEL
FT                   PYMEKRSKDVGISITAASNVTDLGKAFPGQPSVAHDSDIPGLKKLADVMKKNGAKALVQ
FT                   IHHGGAQSLPNLTPGGDVAAPSPVDLKSFGQKEEHHAREITPDEIRETIKAFGEATRRA
FT                   IEAGFDGVEIHGANHYLIHQFVSPYYNRRDDEWKDPFKFPLEVVESVVAAAEKYADKDF
FT                   IIGYRFSPEEAEEPGIRMELTKELLEHLREQPLDYLHASLFDIHSKTREGQYKDKERIK
FT                   LLHEWIGGKMPLIGIGSIFTPEDALSALETGVEFIALGRELLLDPRFIEKIKDGKTDEI
FT                   ISYFDPTREDKHELPPNLWKQFDQGFYPLPRKDDK"
FT   CDS_pept        557244..558788
FT                   /transl_table=11
FT                   /gene="rocA"
FT                   /locus_tag="SCA_0564"
FT                   /product="1-pyrroline-5-carboxylate dehydrogenase"
FT                   /function="NAD-dependent aldehyde dehydrogenases"
FT                   /EC_number="1.5.1.12"
FT                   /note="(Q9K9B2) 1-pyrroline-5-carboxylate dehydrogenase 1
FT                   (EC 1.5.1.12) (P5C dehydrogenase 1),InterPro:
FT                   delta-1-pyrroline-5-carboxylate dehydrogenase 2"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0564"
FT                   /db_xref="GOA:B9DIT9"
FT                   /db_xref="InterPro:IPR005932"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIT9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27478.1"
FT                   /translation="MIPYQHEPFTDFSKAENREAYEKALKKVEDDLGREYPLIINGERI
FT                   FTDDKVRSFNPSNRDETIGYVSKANKELAAKAVDAAKEAFKTWRNVAPEVRADILFRAA
FT                   AITRRRKHEFSALLTKEGGKPWKEADADTAEAIDFMEYYGRQMLKLKDGKPVNSRPGEY
FT                   NQYDYLPIGVSVVISPWNFAYAIMAGTTVAPVVTGNTVLLKPSSNTPVISYKFMEVLEE
FT                   AGLPKGVVNWIPGDSSDIGDYLVENKDVGLISFTGSKNVGTSIMQKASQIQEGQNHLKR
FT                   VIAEMGGKDTIVVDSEADLDVATDAIVYSAFGFSGQKCSACSRVIAVDDVYDDLIERLK
FT                   TATEKLTVGDSAEYDNFMGPVIDEKALNKIKDYLKVGEKEGRLVVGGKVDDEIGNFVYP
FT                   TIFADLKYDDRVMQEEIFGPVVGITKAKDFDQAIEYANATEYGLTGAVISNNRFKLEQA
FT                   RRDFMVGNLYFNRGCTGAVVGYQPFGGFKMSGTDSKAGGPDYLVLHMQGRTVSEHL"
FT   CDS_pept        558968..560158
FT                   /transl_table=11
FT                   /gene="rocD"
FT                   /locus_tag="SCA_0565"
FT                   /product="ornithine aminotransferase"
FT                   /function="Ornithine/acetylornithine aminotransferase"
FT                   /EC_number="2.6.1.13"
FT                   /note="(P60297) Acetylornithine aminotransferase 2 (EC
FT                   2.6.1.11) (ACOAT 2),InterPro: Aminotransferase class-III"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0565"
FT                   /db_xref="GOA:B9DIU0"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR010164"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR034757"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DIU0"
FT                   /inference="similar to AA sequence:UniProtKB:P60297"
FT                   /protein_id="CAL27479.1"
FT                   /translation="MTKSEDIIKKTEHYGAPNYKPLPIVISEAEGIWITDPEGNKYMDM
FT                   LAAYSAVNQGHRHPKVIEALKEQADKVTLVSRAFNSDNLGDWYEKVSELTGKEKVLPMN
FT                   TGAEAVETAVKAARRWAYEHKDIEPDKAEIIAFNGNFHGRTMAPVSLSSEAEYQRGYGP
FT                   LLEGFLKVDFGDVDQLKDAINENTAAILVEPIQGEAGINVPPEGYLKEIRKLADENNIL
FT                   FIADEIQSGLGRSGKTFATDWDGVKLDVYILGKALGGGVLPISAVAADSEVLDVFTPGS
FT                   HGSTFGGNPLAAAVSIAALDVLEDEKLAERSRELGEYFQDELKKIDNPVIKEVRGRGLF
FT                   IGVELNEDARPYAEALKEEGLLCKETHDTVIRFAPPLIITKEEIDDALERIKKVFS"
FT   CDS_pept        560268..561512
FT                   /transl_table=11
FT                   /gene="gudB"
FT                   /locus_tag="SCA_0566"
FT                   /product="NAD-specific glutamate dehydrogenase"
FT                   /function="Glutamate dehydrogenase/leucine dehydrogenase"
FT                   /EC_number="1.4.1.2"
FT                   /note="(P50735) NAD-specific glutamate dehydrogenase (EC
FT                   1.4.1.2) (NAD-GDH),InterPro: Glu/Leu/Phe/Val dehydrogenase
FT                   C terminal"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0566"
FT                   /db_xref="GOA:B9DIU1"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIU1"
FT                   /inference="similar to AA sequence:UniProtKB:P50735"
FT                   /protein_id="CAL27480.1"
FT                   /translation="MTENNNLVASTQQIIKEALHKLGFDDGMYDLVKEPLRFLEVRIPV
FT                   RMDDGIVKTFTGYRAQHNDAVGPTKGGVRFHPNVNVDEVKALSMWMTMKCGIVDLPYGG
FT                   GKGGIICDPRQMSIHEVERLSRGYVRAISQIVGPSKDIPAPDVMTNSQIMAWMMDEYSA
FT                   LDKFNSPGFITGKPIVLGGSQGRDRSTALGVVIAIEQAAKLRDLDLNGAKIVIQGFGNA
FT                   GSFLAKFLFDKGAKIVGISDAYGALSDPEGLDIDYLLDRRDSFGTVTNLFEETISNKEL
FT                   FELDCDILIPAAIENQITKENAPNIKADILIEAANGPTTLEATRILHERGILLVPDVLA
FT                   SAGGVTVSYFEWVQNNQGYYWTEEEVNEKMRDKLVTAFNDIYELAQNRKIDMRLAAYIV
FT                   GIKRTAEAARYRGWA"
FT   CDS_pept        561745..562707
FT                   /transl_table=11
FT                   /locus_tag="SCA_0567"
FT                   /product="putative amidohydrolase"
FT                   /function="predicted metal-dependent hydrolase of the
FT                   TIM-barrel fold"
FT                   /note="(Q8R5M5) 2-amino-3-carboxymuconate-6-semialdehyde
FT                   decarboxylase (EC 4.1.1.45),InterPro: Amidohydrolase 2"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0567"
FT                   /db_xref="GOA:B9DIU2"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIU2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27481.1"
FT                   /translation="MNKGIIDVHHHIIPDVYKSALVKNGVDKAGGMPIKDWTPEDSIAY
FT                   MDRLGIEVGIGSISDPGLNPLDKETRKQTARKINDFEADMIQKYPNRFGGFATLPLPEV
FT                   DASIEELKYALDELKLDGVGLLSNYNEHFLGDPIFEDVMKELDKRNAVVFIHPSAAQAD
FT                   QNRPYYCQIDFLLEFTFNTTRAAANLVLSGTMDRYPNIKFILGHAGGALPYLRWRIDQS
FT                   YSWMIENLEDAVELNKRPAEYISDFYYETALSTQPPTFEALKETTDESHLLFGSDAHYA
FT                   PESQAVKMIEIIENYHKFSESEIAAIERKNALELFPRFK"
FT   CDS_pept        complement(562777..564150)
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="SCA_0568"
FT                   /product="putative argininosuccinate lyase"
FT                   /function="Argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="(Q8CT81) Argininosuccinate lyase (EC 4.3.2.1)
FT                   (Arginosuccinase) (ASAL),InterPro: Fumarate lyase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0568"
FT                   /db_xref="GOA:B9DIU3"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DIU3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27482.1"
FT                   /translation="MSNKAWGGRFQSEPEAWVDAFNASINFDHLLIDEDIQGSIAHATM
FT                   LAQQGILTEDESNTIIKGLQEIQQDYHDGKIEFTEALEDIHLNIEHELIERIGAVGGKL
FT                   HTGRSRNDQVATDLHLYTKKAVKEIIHLIHTLQETIVKLADDHVDTIMPGYTHLQRAQP
FT                   ISFAHHVMTYFWMLERDKNRFEDALKRIDINPLGAAALSGTTHPIDRAKTQELLDFAAL
FT                   YENSLDAVSDRDFVVETLNDISLVMIHLSRFSEEIIFWSSDEAKFITLSDSFSTGSSIM
FT                   PQKKNPDMAELIRGKTGRTTGHLMSMLMTLKGLPLAYNKDMQEDKEGLFDAVHTVTGSL
FT                   RIFEGMLASLTVNTDRLNETVHQDFSNATELADYLVEKDVPFREAHAIVGQIVYWCIQH
FT                   DCYLLDVPLEKYQEFSSSIDDTIYSYLKPENCLKRRKSYGSTGQESVRHQIKVAKDLL"
FT   CDS_pept        complement(564140..565345)
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="SCA_0569"
FT                   /product="putative argininosuccinate synthase"
FT                   /function="Argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="(Q99VC7) Argininosuccinate synthase (EC 6.3.4.5)
FT                   (Citrulline--aspartate ligase),InterPro: Argininosuccinate
FT                   synthase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0569"
FT                   /db_xref="GOA:B9DIU4"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DIU4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27483.1"
FT                   /translation="MKEKIVLAYSGGLDTSVAVQWLIDKGYDVVACCLDVGEGKDLDEV
FT                   YQKALDMGAIECYIIDATEEFSDEYVSYAIKGNLMYENTYPVVSALSRPLISKKLVEIA
FT                   EKTDAVGIAHGCTGKGNDQVRFEVAIKALNPELKVFAPVRAWGWSREEEIDYAIQHNIP
FT                   VPINHDSPYSIDQNLWGRANECGILEDPYAAPPADAFDLTREIEDTPDTPDEIVIHFEK
FT                   GLPVSIDDKAFPLDELILYLNDLAGKHGIGRIDHVENRLVGIKSREIYETPGAEVILKA
FT                   HKALETITLTKDVAHFKPVIEKQFAEQTYNGLWFSPLTDSLKLFIDSTQEHVTGDVRVK
FT                   LFKGNATVNGRRSPYSLYNEKLATYTKEDAFNQEAAVGFIEIYGLPTEVNSMLHGGYSN
FT                   EQ"
FT   CDS_pept        565693..567024
FT                   /transl_table=11
FT                   /gene="pgiA"
FT                   /locus_tag="SCA_0570"
FT                   /product="glucose-6-phosphate isomerase A"
FT                   /function="Glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="(Q99VC6) Glucose-6-phosphate isomerase (EC 5.3.1.9)
FT                   (GPI) (Phosphoglucose isomerase) (PGI) (Phosphohexose
FT                   isomerase) (PHI),InterPro: Phosphoglucose isomerase (PGI)"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0570"
FT                   /db_xref="GOA:B9DIU5"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIU5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27484.1"
FT                   /translation="MTHIELDYSKALKFVGEHELTQQQEIVKTIHRIIHEGTGAGSDFL
FT                   GWLDLPVDYDKEEFSRILEAAKRIKEHSDVLVVVGIGGSYLGARAAIEMLSSAFRTSDE
FT                   YPEIVFAGNHLSSTYLHDLIQYLDGKDYSVNVISKSGTTTEPAVAFRLFKQLLEDKYGK
FT                   EEAKERIFATTDKEKGALKQLATNEGYETFVVPDDVGGRYSVLTAVGLLPIAAAGIDIQ
FT                   AMMNGAAKAREELASDNLSDNIAYQYATLRNILYAKGYTTEMLINYEPSLQYFNEWWKQ
FT                   LYGESEGKDFKGIYPSSANYTTDLHSLGQYVQEGRRFLFETVVKVEEPKYDITIEKDPD
FT                   DLDGLNYLAGKTIDEVNTKAFQGTLLAHTDGEVPNLVVKIPRIDPETFGYLVYFFELAC
FT                   AMSGYQLGVNPFNQPGVEAYKQNMFALLGKPGYEDKKQELEERL"
FT   CDS_pept        567229..567792
FT                   /transl_table=11
FT                   /gene="orf1"
FT                   /locus_tag="SCA_0571"
FT                   /product="putative membrane protein"
FT                   /function="uncharacterized conserved protein"
FT                   /note="(P76219) Hypothetical UPF0043 protein ydjX,Orf1;
FT                   similar to Bacillus subtilis yhjE,Due to manual inspection
FT                   of SD sequence, start codon at position 39 of published
FT                   sequence ( AAD09009 ) was chosen."
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0571"
FT                   /db_xref="GOA:B9DIU6"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIU6"
FT                   /inference="similar to AA sequence:UniProtKB:P76219"
FT                   /protein_id="CAL27485.1"
FT                   /translation="MSAHQVESWMHSMGDFGYVLGFLLPFIESFIPVLPLFVFVFVNVD
FT                   TFGLFLGIIVSWLGTFLGSFVVFLIVRAFANTNVMDKVKNRKDVRKFLNFVNKQGVTPI
FT                   FIMLCFPFTPSALMNVVAGLSKMKVRTFFLVLAVSNLIAMALTGVLGRDMHSILSSPIR
FT                   VIIMVLILAGLWYLSRRLEKRFMK"
FT   CDS_pept        567805..568329
FT                   /transl_table=11
FT                   /gene="sipA"
FT                   /locus_tag="SCA_0572"
FT                   /product="type-I signal peptidase"
FT                   /EC_number="3.4.21.89"
FT                   /note="Sca_0572"
FT                   /db_xref="GOA:B9DIU7"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIU7"
FT                   /protein_id="CAL27486.1"
FT                   /translation="MRKIINYLLSLIIAIIIVMLIQAFLIIGAVVPNNEMSPTLKQGDR
FT                   ILVSKIQNTFNSVHNGDVVMYKYKGKTYFGRVIGLPGQSVEFKNGQLYRDDRVVKEDYP
FT                   VKAQIKNLALRNIKHSEGDIVAPKQYMILNDNRANQSDTRIFGTIHQKDIIGNVVLRYY
FT                   PWNKFGISFNE"
FT   CDS_pept        568346..568915
FT                   /transl_table=11
FT                   /gene="sipB"
FT                   /locus_tag="SCA_0573"
FT                   /product="type-1 signal peptidase 1B"
FT                   /function="Signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /note="(P72365) Signal peptidase IB (EC 3.4.21.89) (SPase
FT                   IB) (Leader peptidase IB),InterPro: Signal peptidase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0573"
FT                   /db_xref="GOA:B9DIU8"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIU8"
FT                   /inference="similar to AA sequence:UniProtKB:P72365"
FT                   /protein_id="CAL27487.1"
FT                   /translation="MKKEIKEWIIAIAIALVLVLVITNFIAKSYTVRGDSMYPTLKDGE
FT                   KVIVNMIGFKTGGLEKGNVIVFHATKNSDYVKRVIGMPGDSIEYKHDQLYVNGKKVKEP
FT                   YLDYNEKHKSYDEITGSFKVKNLPNANGSNTIPKNKLLVLGDNREVSKDSRSFGLIDED
FT                   QVVGKVSLRYWPFTSFKVNFNPDTKY"
FT   CDS_pept        569078..572545
FT                   /transl_table=11
FT                   /gene="addB"
FT                   /locus_tag="SCA_0574"
FT                   /product="putative ATP-dependent nuclease subunit B"
FT                   /function="ATP-dependent nuclease subunit B"
FT                   /note="(P23477) ATP-dependent nuclease subunit B"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0574"
FT                   /db_xref="GOA:B9DIT7"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014140"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DIT7"
FT                   /inference="similar to AA sequence:UniProtKB:P23477"
FT                   /protein_id="CAL27488.1"
FT                   /translation="MSQLNAYIGRAGTGKSHAMLDEIKTKMKQDPLGDPIIIIAPTQST
FT                   FQLEQDFVKDPELNGSLRTEVLHFERLSHRIFQEIGGLTEEYASKGALEMMIFDILQSH
FT                   RSELNLYQSQTKYYGFSAKLSEQIQDFKKYAVSPEQLEQFISENPLQTRTQDKLHDIAL
FT                   VYRHLEERLADNFVSSEDTLYKFIEKMDESKWLKRAEIYIDGFHNFSTLEYQIIEKLAQ
FT                   CAKSVSILLTTNGDKDPFSLFRKTSSTLTHIEEIAQRQNIDFNLRRFTKQERFENRDLS
FT                   HLEHSFNEVFFDKAAAEGNINILETSNVREEVNAIARDIIRKAREENIRFQDVAVLYRD
FT                   ETYAHLMESVFPEFDIPFNIDTKKSMTHHPVMEMIRSLLEVIESKWSFEPLMRLFKTQV
FT                   LTKKFKDNRYLTDILENYVLERGIYGQRWLDDKYFKIEQFNLMGLKRQPMTEETEADYQ
FT                   RVIDLKNYVIDKILRFEKALAEADTAETYAAAFYEAFEQFNLPSQLMTERDELDLAGEH
FT                   QQAEELDQVWNGFIQTLDDLATVFGNREMTQKRFLELFDVGLEQLEFVMIPQTLDQVSI
FT                   GSMDLAKVDNKKHIYMLGMNDGTMPQAISNSGLISDDEKKYFQEETQLELSPTADVLQM
FT                   DEAFVCYIAMTRASTHVTFSYSLMGLNNDDKEVSPFIQNIRDLYTNLDVLNVQYAAQHN
FT                   PLTVMEHPHQTKIALFEELQSWLNHELTAETWLEAYQAMLHNERLSRGLQYLTSALTFD
FT                   NKTIQLNQSLSKALYGDKINASVSRFEGYQQCPFKHYTSHGLRLNERTKYKLENFDLGD
FT                   IFHSVLKYIADKIHGDFRNLTDASIRKLTQEALENILPEVQYNLLNSSAYYRYMSVRIG
FT                   AIVQSTLTALKYQGTFSKFRPQAFEKSFRKNPKSNEQLAAESLYTSQGISINIRGQIDR
FT                   IDTFNSKDRSFVNIIDYKSSGYSGTLDLTKVYYGLQMQMMTYMDVVLQNKERLNLAETT
FT                   EPGGLLYFHVHEPRVNFANWAEMDEDKRQEELLKSFKLNGLINSDPEVLDAEDTRLEPK
FT                   FKSDIVPIDVGAKGNLNKSSKVADSQTIYKFIEHNKNNFIQIASDIMDGHTQVAPMKYK
FT                   QKLPCEYCNYRSVCHVDGMIDSKKYRTVDESINPIDLLNQESDEDDEE"
FT   CDS_pept        572542..576204
FT                   /transl_table=11
FT                   /gene="addA"
FT                   /locus_tag="SCA_0575"
FT                   /product="putative ATP-dependent nuclease, subunit A"
FT                   /function="ATP-dependent exoDNAse (exonuclease V) beta
FT                   subunit (contains helicase and exonuclease domains)"
FT                   /note="(P23478) ATP-dependent nuclease subunit A,InterPro:
FT                   UvrD/REP helicase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0575"
FT                   /db_xref="GOA:B9DIS2"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014152"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DIS2"
FT                   /inference="similar to AA sequence:UniProtKB:P23478"
FT                   /protein_id="CAL27489.1"
FT                   /translation="MIPEKPNDVIWTDDQWKSIYAKGQDTLVAAAAGSGKTAVLVERII
FT                   QRILRDEIDVDRLLVVTFTNLSAREMKHRVEKRIQKASLEDPSNTHLKNQRVKIHQAQI
FT                   STLHSFCLKLIQQHYDVLDIDPNFRTSSEAENILLLEQTIDEVLEKYYAELNPAFIDLS
FT                   EQLSSDRSDERLRQIIKSVYYFAVANPQPEQWLKSLVSPYKDNQAQDEFLELLMNLAKV
FT                   FMNTALENLNKSFDLYSELAGCDKQLEVIEDERAFIARAMEGGILNTELISKHSFISRF
FT                   PSATKKIKEANDGNLELLESAKAYYDDYKGAVEKVQQDYFSRSAEDLKADMAKLAPRVE
FT                   VLSQITRDVIDTFSKKKRSRNILDFSDYEHFALKILMNEDGTPTDLAKHYRNGFDEILV
FT                   DEYQDTNRVQEQILSCIKRGDETDGNLFMVGDVKQSIYKFRQADPSLFIEKYSRFSHDG
FT                   TTGMRIDLSQNFRSRPEVLSTTNYLFKHMMDESVGEIIYDEAAQLYYGAPFDDKPHPLN
FT                   LNVMVEDKESELTGTEQEAEYIANQVEEIMNHREVYDMGTGSYRKPSYKDIVILERGYN
FT                   RSRELQQAFKNRDIPFHVNSKEGYFEQTEVRLVLSFLRTVDNPLQDIYLVGLMRSVIYQ
FT                   FTEDELARIRVTSPNDDYFYQSIQHYLKTKEADPDLVAKLQDFLKDLKFYQEFSLEHPV
FT                   YQLIDRFYNNRLVIQYFSGMIGGKGRRANLYGLYNKAIEFENSSFRGLFQFIRFIDELI
FT                   DRGKDFGEENVVGPNDDVVRMMTIHASKGLEFPFVIYSGLSKSFNRSDLYKPVILNQKY
FT                   GMGMTYFDVEKDFAFPSLASVTLRAITEKEMISEEMRLMYVALTRAKEQLFLVGRVKAE
FT                   KELDKMLNTAISNNMLPMSYRLEVKNPLQLIYAILAKYQANHLTNDLKFERNIDELDDA
FT                   IHPYAEIHIDEYSDIAQDIHQNEDEEFRTVNDIVNYQSTNTERQQAIETQLDYQYPYQK
FT                   DVVKPTKQSVSELKRQLETEETGTSYERVRQYQLGASTYERPKFMRQHKKRKANEIGTL
FT                   MHTVMQHLPFKEERMTSAELDEYIDGLIEKNIIEDDAKPDIRMDEVMNFIKSDLYLEIA
FT                   QSDQIMREMPFVVNQSKVDHQMNDDEDVSIIQGMIDLIYRKDNQYYFVDYKTDTFNQRR
FT                   GVSDEELGEQLKARYKIQMYYYRSALETILQKEVKGYLYFFKFGTLSLEETEKH"
FT   CDS_pept        576378..577286
FT                   /transl_table=11
FT                   /locus_tag="SCA_0576"
FT                   /product="fumarylacetoacetate (FAA) hydrolase family
FT                   protein"
FT                   /function="2-keto-4-pentenoate
FT                   hydratase/2-oxohepta-3-ene-17-dioic acid hydratase
FT                   (catechol pathway)"
FT                   /note="(O28058) Hypothetical protein AF2225,InterPro:
FT                   Fumarylacetoacetate (FAA) hydrolase,reporting
FT                   helix-turn-helix motif"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0576"
FT                   /db_xref="GOA:B9DIS3"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIS3"
FT                   /inference="similar to AA sequence:UniProtKB:O28058"
FT                   /protein_id="CAL27490.1"
FT                   /translation="MKFLSFKHNDETSYGVKVKREEAAWDLRKVFADFGEGDFHPKTLL
FT                   EGLEQNHTLDFQEQVRKAVVAATDSSNSEDYKVQFSDIEFLPPVTPPNNVIAFGRNYKK
FT                   HADELNHSVERLYVFTKAASSLTGDESTIPNHKDITDTLDYEGELGVVIGKAGEKIPKG
FT                   LALDYVYGYTIINDITDRTAQRQQDQAFLSKSLTGGCPMGPYIVTKDELPTPEDVNIVT
FT                   KVNNDIRQDGNTSQMILKIDELIAEISKYVALHPGDIIATGTPAGVGAGMNPPQYLQPG
FT                   DEVKVTIDNIGTLTNFIAEEK"
FT   CDS_pept        complement(577414..577809)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0577"
FT                   /product="putative membrane protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0577"
FT                   /db_xref="GOA:B9DIS4"
FT                   /db_xref="InterPro:IPR010899"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DIS4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27491.1"
FT                   /translation="MLHLHIFSWVIGIILFIVSYISFTKTGAPKKAYKPLHMTLRLFLV
FT                   LILFSGVWQVVEEFATATGSTHMLLTLKMICGIGVVALMEVTLVRKQRGASHKGLFWGT
FT                   IALIIVTMALGIILPGGPISNMFVITK"
FT   CDS_pept        complement(577930..579252)
FT                   /transl_table=11
FT                   /gene="cdr"
FT                   /locus_tag="SCA_0578"
FT                   /product="coenzyme A disulfide reductase"
FT                   /function="uncharacterized NAD(FAD)-dependent
FT                   dehydrogenases"
FT                   /EC_number="1.6.-.-"
FT                   /note="(Q58065) Putative NADH oxidase (EC 1.6.99.3)
FT                   (NOXase),InterPro: FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0578"
FT                   /db_xref="GOA:B9DIS5"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023536"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIS5"
FT                   /inference="similar to AA sequence:UniProtKB:Q58065"
FT                   /protein_id="CAL27492.1"
FT                   /translation="MTKIIIIGGVAGGATFASQLRRLDPDCDITIFEKDRDVTFANCGL
FT                   PYYLGNIIDDRSELLHFTPEQFKENKGVTAKVFHEVIQVDPNNQTVTVKNLKTDEVFTE
FT                   DYDYLVMSPGCRANQLPLNSDMAFTLRNLEDTDDIESYISNNNVKKAPIIGAGYISLEV
FT                   LENLYNRGIQTTLIHRSEQINKLMDQDMNKVIFDEMDKRQIDYRLNEEVDSVDGHTVHF
FT                   KSGNTEDFDIIIEGIGIKPNTEFLEGAGIEEDDAGYIPVNEYFQTNYRNVYAIGDIVSN
FT                   YYRHVNIPTHVPLAWGAHRGASIVAEHITQTRNVPFKGFLASNAVKFFDYTLTSVGVSP
FT                   SDLKHFDYTMVETEQMNHAGYYPGAEPLHLRVYFENKSRKILRAAAAGKSGADKRIDIL
FT                   SMAMQNDMTVDELTEFESAYAPPFSSPKDIINMIGYKAQNK"
FT   CDS_pept        complement(579364..580209)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0579"
FT                   /product="Predicted hydrolases of the HAD superfamily"
FT                   /function="predicted hydrolases of the HAD superfamily"
FT                   /note="(P43051) Hypothetical 31.6 kDa protein in UPP
FT                   3region,InterPro: Cof protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0579"
FT                   /db_xref="GOA:B9DIS6"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIS6"
FT                   /inference="similar to AA sequence:UniProtKB:P43051"
FT                   /protein_id="CAL27493.1"
FT                   /translation="MEPYLICLDLDGTLLNDKKEISPYTLKVLEKLKEQGHYIMIATGR
FT                   PFRASKPYYEQLKLNTPIVNFNGAFVHNPTDPDSPVIHETLDPDLATSIIESLQKMQVK
FT                   NIIAEVKDHVYIDNFDQHLFDGFSMGNPKIETGDIVNQLKEPPTSILIEADEVMIPRVK
FT                   QMLSRFYAESIEHRRWGAPFPVIEIVKRGISKARGIDSVKDELGVDRNHIIAFGDEDND
FT                   TEMIKYAKHGIAMENGLDELKHIANEVTYSNNDDGIGRYLNDFFSLNIPYNNETKVYSR
FT                   "
FT   CDS_pept        580508..580816
FT                   /transl_table=11
FT                   /locus_tag="SCA_0580"
FT                   /product="conserved hypothetical protein"
FT                   /function="predicted metal-sulfur cluster biosynthetic
FT                   enzyme"
FT                   /note="(P53383) Mrp protein homolog,InterPro: Protein of
FT                   unknown function DUF59"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0580"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIS7"
FT                   /inference="similar to AA sequence:UniProtKB:P53383"
FT                   /protein_id="CAL27494.1"
FT                   /translation="MDEALKDNILGALENVIDPELGIDVVNLGLIYKVDLDDDGLCKVE
FT                   MTLTSMGCPLGPQIIEQIKMVLAEIPEIQETEVNIVWNPPWNKDMMSRYAKIALGVS"
FT   CDS_pept        581131..582966
FT                   /transl_table=11
FT                   /locus_tag="SCA_0581"
FT                   /product="putative membrane protein with acyltransferase 3
FT                   family domain"
FT                   /function="predicted acyltransferases"
FT                   /note="(P43993) Hypothetical protein HI0392,InterPro:
FT                   Acyltransferase 3 family"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0581"
FT                   /db_xref="GOA:B9DIS8"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIS8"
FT                   /inference="similar to AA sequence:UniProtKB:P43993"
FT                   /protein_id="CAL27495.1"
FT                   /translation="MNNLKRSSSNNSPKKMNYMPGLDGLRAIAVLGIIIYHLNKQWLAG
FT                   GFLGVDTFFVISGYLITSLLLIEYKKNGKIDLKKFWTRRIKRLIPAMVFVVSIVTIVTL
FT                   LLQREEIIRVKQDAFAALFYVSNWWYIAKDVNYFDQFSFEPLKHLWSLAIEEQFYLFFP
FT                   VVLILLLNKVKKPKQITLIFWVISLISLLAMVLLTHPGMNFSRVYFGTDTRLQTLLLGV
FT                   ILAFLWPPNRLKKEPPLAVRSVVDIVGVIALAILVCLFIYVDDQSYWIYNGGFYLISGI
FT                   TLFLIASIVHPSGLLARFMGNPVFVYLGKRSYSLYLWHFPVIIFTHRYFVAGQIPIYVY
FT                   FIDLVLTVIMAEFSYRYVETPFRKKGFKALSIGNWTKSNIIRWILILLILIPFVLILAG
FT                   LFDKYGKDTVGDKATQFDTNSIDKYVVRPIPYGKMDFLGNGGGTESEENTDVYDDVQPL
FT                   LIGDSVMVDIGEHFKESVPRSVIDGKVGRNMYQAKPLIDSQYSHYNKKGDKVIIELGTN
FT                   GDFDKNQLDTVINSFGKADVYLVNTRVPRDYEKHVNDLMKEAAAKHKNVKLVDWYSRSA
FT                   GHTEYFAPDGIHLEYSGVKALSDEIIKTMRLKKDK"
FT   CDS_pept        583163..585772
FT                   /transl_table=11
FT                   /gene="clpB"
FT                   /locus_tag="SCA_0582"
FT                   /product="ClpB chaperone"
FT                   /function="ATPases with chaperone activity ATP-binding
FT                   subunit"
FT                   /note="(P74361) ClpB protein,InterPro: AAA ATPase central
FT                   region"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0582"
FT                   /db_xref="GOA:B9DIS9"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIS9"
FT                   /inference="similar to AA sequence:UniProtKB:P74361"
FT                   /protein_id="CAL27496.1"
FT                   /translation="MDANKMTYAVQESLQGAIEIAKQHEQQNVEAEAVLIAALNSDNSL
FT                   FKSVLERANIDIAALSEAYEEKLNHYATVKGDNIQYGQYIGNNTNTLFNRAEKIMETYE
FT                   DEFVSMEHLLLVAIETNEITQQFVGNKDEVIKEIIKRVRGGNHVTSQNPEANYEALEKY
FT                   GRDLVEEVRQGNMDPVIGRDEEIRNTIRILSRKTKNNPVLIGEPGVGKTAIVEGLAQRI
FT                   VKKDVPESLLDKTIFELDLSALVAGAKYRGEFEERLKAVLKEIKDSDGRIILFIDELHM
FT                   LVGAGKTDGAMDAGNMLKPMLARGELHCIGATTLNEYREYIEKDSALERRFQKVGVSEP
FT                   DVEDTISILRGLKERYEVYHGVRIQDRALVAAAELSDRYITDRFLPDKAIDLVDQACAT
FT                   IRTEIGSNPTELDQVNRRVMQLEIEENALKHESDNVSQQRLKELQEELSNEKEKQSALQ
FT                   SRVEQEKEKISKLQEKRAELDESRKALEDAENNYDLEKAAELQHGKIPKLEKELRDLED
FT                   AFQDEQSEDNDRIIREIVTDEEIGDIVSQWTGIPVTKLVESERDKLLHLNDILHERVVG
FT                   QDRAVDLVADAVIRARAGIKDPNRPIGSFLFLGPTGVGKTELAKALASSLFDSEKHMIR
FT                   IDMSEYMEKHSVSRLIGAPPGYVGHDEGGQLTEAVRRNPYSVILLDEVEKAHSDVFNVL
FT                   LQILDEGHLTDSKGRNVDFKNTIIIMTSNIGSQILLEQVKETGVISETTESAVMTSLNQ
FT                   YFKPEILNRMDDIVLFRPLSVNDMSMIVEKILTELNIRLLDQRISIEVSDAAKKWLGEE
FT                   AYEPQFGARPLKRFVQRQIETPLARMMIKESLPEGTTVKVDLGDNELNFKVEEAQLN"
FT   CDS_pept        complement(585874..586077)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0583"
FT                   /product="putative membrane protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0583"
FT                   /db_xref="GOA:B9DIT0"
FT                   /db_xref="InterPro:IPR021324"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIT0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27497.1"
FT                   /translation="MRYIMVLFWSVLLLEMVNFVLNSLAGGGKLNFIIPLVFAVIFTIV
FT                   VAILDVLMKPVKNSTSVEDSKQ"
FT   CDS_pept        586339..587280
FT                   /transl_table=11
FT                   /gene="FabH"
FT                   /locus_tag="SCA_0584"
FT                   /product="putative 3-oxoacyl-[acyl-carrier-protein]
FT                   synthase III"
FT                   /function="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="(Q8CPT4) 3-oxoacyl-[acyl-carrier-protein] synthase
FT                   III protein 1 (EC 2.3.1.41) (Beta-ketoacyl-ACP synthase III
FT                   1) (KAS III 1),InterPro: Beta-ketoacyl-acyl carrier protein
FT                   synthase III (FabH)"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0584"
FT                   /db_xref="GOA:B9DIT1"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIT1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27498.1"
FT                   /translation="MDVGIKGFGTYVPEKVVDNAYFETFLETSDEWISKMTGIKERRWA
FT                   GEDQETSDLAYEASVKAIKDAGIKPEDIDMVIVATSTGDFPFPTVANMLQERLGLGKVA
FT                   TMDQLAACSGFMYSLITAKQYIASGDYQNILVVGVDKLSKITDMTDRSTAILFGDGAGA
FT                   AVIGEVSEGRGIMSYEMGSDGSGGKYLYLNPENGKIFMNGREVFKFAVRIMGEASRNVV
FT                   EKAGITADDVDMFVPHQANIRIMESARERLGIPKEKMSVSVNKFGNTSAASIPLSIGQE
FT                   LENGRIKDDDVLVLVGFGGGLTWGAITLRWGK"
FT   CDS_pept        587292..588536
FT                   /transl_table=11
FT                   /gene="fab"
FT                   /locus_tag="SCA_0585"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase II"
FT                   /function="3-oxoacyl-(acyl-carrier-protein) synthase"
FT                   /EC_number="2.3.1.41"
FT                   /note="(P73283) 3-oxoacyl-[acyl-carrier-protein] synthase
FT                   II (EC 2.3.1.41) (Beta-ketoacyl-ACP synthase II) (KAS
FT                   II),InterPro: Beta-ketoacyl synthase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0585"
FT                   /db_xref="GOA:B9DIT2"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIT2"
FT                   /inference="similar to AA sequence:UniProtKB:P73283"
FT                   /protein_id="CAL27499.1"
FT                   /translation="MSKEQRVVITGLGALSPLGNDAKTSWENALNGVNGIDEITRIDTS
FT                   DYNVHLGGELKDFNIEDYIEKKEARRMDRFTQYAVVAAREAVKDAKLDINDTNANRIGV
FT                   WIGSGIGGMETFEVAHSQLLNRGPRRVSPFFVPMLIPDMATGQVSIDLGAKGPNGSTVT
FT                   ACATGTNSIGEAFKIIQRGDADAMITGGSEAPITHMAIAGFSASRALSTNDDKETACRP
FT                   FQEGRDGFVMGEGAGVLVIESLESAQARGAEIYAEIVGYGSTGDAYHITAPAPEGEGGS
FT                   RAMQAAMDDAGIQPSDVQYLNAHGTSTPVGDLNEVLAIKNTFGDAANNLKVSSTKSMTG
FT                   HLLGATGGLEAIFSALSIRDSKIAPTIHAVTPDPECDLDFVPNEAQDLDITYAMSNSLG
FT                   FGGHNAVLVFKKFED"
FT   CDS_pept        588792..590030
FT                   /transl_table=11
FT                   /locus_tag="SCA_0586"
FT                   /product="putative permease of the major facilitator
FT                   superfamily"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /note="(P31126) Hypothetical protein ydeE,InterPro: Major
FT                   facilitator superfamily"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0586"
FT                   /db_xref="GOA:B9DIT3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIT3"
FT                   /inference="similar to AA sequence:UniProtKB:P31126"
FT                   /protein_id="CAL27500.1"
FT                   /translation="MHQLNQLSRTLKARMLCDFLLTLSSSAILPFIALYLITMINAVFA
FT                   GIFLMATVIIGFIVSFIGGYVSDHFERKKVISFVHGIYTVCLVILIISVNMHGIGLILF
FT                   CITFFIFSITNSFEMPILEAAIMDAIQVQHRDFIYRFFYWMNNIAMAIGMLIGAALYAE
FT                   HRHLLFGLFLAANLISWYVFVFIYDVQQKFANHDSLDSVVKKFLHGYVQAFKNKPYIIL
FT                   MLAFSFVFMAEASLDTYVVVRLQKTFDPISFLGIRIDGVRIFTLIMIVNTVTVAFLTFY
FT                   VNRLMESYSKKAIFVIGIFCYTFGYIIITSANVLFFILVFAFIATIGEIIYSPIYNSER
FT                   FALTPEHARGVYSSIGSLGFTTAKILAQLGLVISTFLTPWMMSIYTGVIVLIGFVLMYL
FT                   VLFKMPKVQQVKE"
FT   CDS_pept        complement(590067..590441)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0587"
FT                   /product="putative membrane protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0587"
FT                   /db_xref="GOA:B9DIT4"
FT                   /db_xref="InterPro:IPR025007"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIT4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27501.1"
FT                   /translation="MNKYIQWLIWVLFAPIISLIIWGFRTHTWSNYIDILFIVSMILFI
FT                   AGFVVILVQDGIFDATSYGFRRIRYQMGGKKHRKAWENDEFMNPKQAKRDFYLVEAWAK
FT                   RMTIINAILILLCLCAIFTF"
FT   CDS_pept        590713..591639
FT                   /transl_table=11
FT                   /gene="oppB"
FT                   /locus_tag="SCA_0588"
FT                   /product="oligopeptide transport system permease protein
FT                   homolog OppB"
FT                   /function="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems permease components"
FT                   /note="(P24138) Oligopeptide transport system permease
FT                   protein oppB,InterPro: Binding-protein-dependent transport
FT                   systems inner membrane component"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0588"
FT                   /db_xref="GOA:B9DIT5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIT5"
FT                   /inference="similar to AA sequence:UniProtKB:P24138"
FT                   /protein_id="CAL27502.1"
FT                   /translation="MFRYILKRFGYMLISLFIIMTITFFLMKLMPGSPFNDAKLSADQK
FT                   EILNETYGLNDPVIVQYLHYLKNVVTGDFGVSFQYHNQPVWDLIQPRLIPSMEMGLTAM
FT                   VIGVILGLILGVAAATKQNTWVDYSSTVISVIAVSVPSFVLAVLLQYVFSVRLRWFPVA
FT                   GWEGISTAILPSLALSASVLATVARYIRAEMIEVLSSDYILLARAKGNSMMRVLFGHAL
FT                   RNALIPVITIIVPMLAGILTGTLTIENIFGVPGLGDQFVRSIQTNDFSVIMATTLLFST
FT                   LFIVSIFIVDILYGIIDPRIRVQGGKK"
FT   CDS_pept        591639..592703
FT                   /transl_table=11
FT                   /gene="oppC"
FT                   /locus_tag="SCA_0589"
FT                   /product="putative oligopeptide transport system permease
FT                   protein OppC"
FT                   /function="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems permease components"
FT                   /note="(P24139) Oligopeptide transport system permease
FT                   protein oppC,InterPro: Binding-protein-dependent transport
FT                   systems inner membrane component"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0589"
FT                   /db_xref="GOA:B9DIT6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIT6"
FT                   /inference="similar to AA sequence:UniProtKB:P24139"
FT                   /protein_id="CAL27503.1"
FT                   /translation="MAENKEHLHGDYSNAALTHTTDGENAPDFLLVEQDIEREPEIQRE
FT                   SKNFWQDAWSQLRRNKLAVIGMIGLILIIIMALVGPLMSGHDYAEQDVDRRNLPAKIPV
FT                   LDKIPFLPFDGQGADGTNAYKDAGVKENFWFGTDQLGRDLWSRTWQGAQVSLFIGVVAA
FT                   ALDIFIGVVYGAISGFFGGRIDDVMQRIIEIIASIPNLIVVILFVLIFEPSIWTIIIAM
FT                   AITGWIGMSRVVRGEFLKLKGQEFVLASRTLGASKTKLIFRHILPNTLGAIVVTSMFTV
FT                   PSAIFFEAFLSFIGIGVPAPKTSLGSLVNDGRAMLLIHPHELFIPALILSLLILFFYLF
FT                   SDGLRDAFDPKMRK"
FT   CDS_pept        592718..593800
FT                   /transl_table=11
FT                   /gene="oppD"
FT                   /locus_tag="SCA_0590"
FT                   /product="oligopeptide transport system ATP-binding protein
FT                   OppD"
FT                   /function="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system ATPase component"
FT                   /note="(P24136) Oligopeptide transport ATP-binding protein
FT                   oppD,InterPro: ABC transporter"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0590"
FT                   /db_xref="GOA:B9DIS1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIS1"
FT                   /inference="similar to AA sequence:UniProtKB:P24136"
FT                   /protein_id="CAL27504.1"
FT                   /translation="MAERILEVNDLHVSFDIDAGEVQAVRGVDFYLDKGETLAIVGESG
FT                   SGKSVTTKALTKLFQGDVGRIKKGKINFLGEDLVEKPESELIKLRGKDISMIFQDPMTS
FT                   LNPTMQIGKQVMEPLMKHRGYNKSQAKKRALEILNMVGLPNAKERFKAYPHQFSGGQRQ
FT                   RIVIATALACEPKVLIADEPTTALDVTMQAQILDLMKELQKKIDTSIIFITHDLGVVAN
FT                   IADRVAVMYGGQMVETGDVDEIFYDPQHPYTWGLLSSMPDLETGTDTELVAIPGTPPDL
FT                   LHPPKGDAFAARSQYALGIDFKEAPPWFQVSPTHFVKSWLLDERSPKVQPPELVVRRQR
FT                   EMPNKFEHAERVERVAFNEG"
FT   CDS_pept        593790..594833
FT                   /transl_table=11
FT                   /gene="oppF"
FT                   /locus_tag="SCA_0591"
FT                   /product="oligopeptide transport system ATP-binding protein
FT                   OppF"
FT                   /function="ABC-type oligopeptide transport system ATPase
FT                   component"
FT                   /note="(P24137) Oligopeptide transport ATP-binding protein
FT                   oppF,InterPro: ABC transporter,Reveals a N-terminal
FT                   extension of about 35 aa when compared to homologs in
FT                   databases"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0591"
FT                   /db_xref="GOA:B9DIQ6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIQ6"
FT                   /inference="similar to AA sequence:UniProtKB:P24137"
FT                   /protein_id="CAL27505.1"
FT                   /translation="MKDNQNKDFEETSGALEKQNEIEREQSELNAQRQPAGDKEVLVSV
FT                   KNLKQYFNVGKRNEVRAIEDISFDIFKGETFGLVGESGCGKSTTGKALIKLNDATSGEV
FT                   YYEGVNIQDIKNRKDMLKFNKKIQMIFQDPYASLNPRLKVMDIIAEGIDIHKLAKSTKE
FT                   RKKRVYDLLETVGLNKEHANRYPHEFSGGQRQRIGIARALAVEPEFIIADEPISALDVS
FT                   IQAQVVNLLLKLQREKNITFLFIAHDLSMVKYISDRIAVMHFGKIVEIGSADEIYNHPL
FT                   HPYTQSLLSAVPQPDPESERTRTRITYKENAEENPNRSLQEIKPEHYVFVTDKEAEELK
FT                   QRLKQTV"
FT   CDS_pept        594848..596512
FT                   /transl_table=11
FT                   /gene="oppA"
FT                   /locus_tag="SCA_0592"
FT                   /product="putative peptide binding protein OppA"
FT                   /function="ABC-type oligopeptide transport system
FT                   periplasmic component"
FT                   /note="(P26906) Dipeptide-binding protein dppE
FT                   precursor,InterPro: Bacterial extracellular solute-binding
FT                   protein family 5"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0592"
FT                   /db_xref="GOA:B9DIQ7"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIQ7"
FT                   /inference="similar to AA sequence:UniProtKB:P26906"
FT                   /protein_id="CAL27506.1"
FT                   /translation="MKKKLISFALMLGIAALVLSGCSQGGGIYDGKGQVYRSVLSQDMS
FT                   TLDTVLATDTVSFNVYNQVYEGLYSLDKKDQAIPAIAKGMPKKSDGGKTLTIKMRKNAK
FT                   WSNGDPVTANDFVYAWRKALDPQTASEYAYIMYDIKNAQKINEGKMPVNKLGAKALDKY
FT                   TVQIKLNKPLPYFNQMLAFGTYMPQNEKVAKKYGKQYGTTADKAVYNGPFELTDWKVED
FT                   KILMKKNPKYWDKKAVKLDKINFKILKDQQAGASLYDTGSVDNTGITSEQVDKYKDSPA
FT                   LFKRLKASTFFLKMNEKEQPEFKNKDMRYAIAQSIDKKAYVDNVLGDGSKPFDGFTSKK
FT                   TDILPDGKDYADLVKSPLKYNKSEAKTHLDKAKKALGKDQFTFTLNTEDTPSSKISAQF
FT                   IKSQIEKNLPGVTVNIKQLPFKQRVTAELTMNYSMSLSGWGPDYPDPMTYLDTMTTGNA
FT                   QNNTGWGSKKYDNMLKEANGPLLKKPNERINELKDAEEFMLSEAPVAPIYQQGAASLRN
FT                   PQLKGIVYHEIGGETTLKHAYIDKSIDRETGKKKKDQ"
FT   CDS_pept        596675..597676
FT                   /transl_table=11
FT                   /locus_tag="SCA_0593"
FT                   /product="hypothetical protein with nucleic acid binding
FT                   motif"
FT                   /function="Coenzyme F420-dependent N5N10-methylene
FT                   tetrahydromethanopterin reductase and related
FT                   flavin-dependent oxidoreductases"
FT                   /note="(O32254) Hypothetical protein yvbT,InterPro:
FT                   Bacterial luciferase,reporting nucleic acid binding motif"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0593"
FT                   /db_xref="GOA:B9DIQ8"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIQ8"
FT                   /inference="similar to AA sequence:UniProtKB:O32254"
FT                   /protein_id="CAL27507.1"
FT                   /translation="MLPMSILDQTPINKGQTVTEALNHTLELAQLADQSGYTRYFLSEH
FT                   HNLKDVVGTSPEILIMYLLDHTKQMRIGSGGVMLQHCHPLKVIEQFHLIDKLSHQRVDL
FT                   AVGKAPGGYPKVVDLLQEELQKPLKQFDEKFSLLNQLNTQKFTDHSEYEGIRTAHRDET
FT                   DKPVPVYLLGTSEHSAIQAAEAQTGIVYAYFINSDLSELENALKAYKKRYPKGRFIVSI
FT                   PAVVTTDGNQKMPMRFSQRHYELTFEDGSRIVLNTKQQVDEYRNESEKNFEVTEKRMRI
FT                   ISGSKEEVVDTLNEVNRSGLIDEWMLHMPVQSHKLRMNTIRELAPLNPNENV"
FT   CDS_pept        598054..599457
FT                   /transl_table=11
FT                   /gene="thiC'"
FT                   /locus_tag="SCA_0594"
FT                   /product="truncated thiamin biosynthesis protein ThiC
FT                   (fragment 1)"
FT                   /function="Thiamine biosynthesis protein ThiC"
FT                   /note="(Q9KBJ4) Thiamine biosynthesis protein
FT                   thiC,InterPro: Thiamine biosynthesis protein ThiC,Similar
FT                   to amino-terminal part of thiamin biosynthesis protein
FT                   [Bacillus halodurans C-125] (BAB05652)."
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0594"
FT                   /db_xref="GOA:B9DIQ9"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIQ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27508.1"
FT                   /translation="MRQDEIELKKGFPASRRIFKQGEDEDIRVPFREIELSDTVTEYDT
FT                   QVNEPFVVYDTAGPYHEEEYEVDVQNGIPDLRSNWILSRDDVESYEGRRVQSIDNGFKK
FT                   EGHKKFVETPFKYQPKRAQDGKRITQMHYARQGMITKEMKFVALREGVEPEFVRDEIAR
FT                   GRAIIPNNVNHPESEPMIIGKNFQVKINANIGNSAVSSSIEAEIEKLVWATHWGADTIM
FT                   DLSTGKNIHATREYLLRNSPVPVGTVPIYQALEKVNGVAEDLTWEIYRDTLIEQAEQGV
FT                   DYFTIHAGVLLQYVPLTVDRLTGIVSRGGSIMAQWCLAHHEESFLYEHFSDICEILNRY
FT                   DIAVSLGDGLRPGSIYDANDESQIAELKTLGELTDIAWQHDVQVMIEGPGHIPMHKIKE
FT                   NQDLADFYCKEAPFYTLGPLTTDIAQLMTTSLQQSEQHKLPVTVQRCFVTLRLKNILDY
FT                   QIKMMSEKV"
FT   CDS_pept        599388..599798
FT                   /transl_table=11
FT                   /gene="thiC''"
FT                   /locus_tag="SCA_0595"
FT                   /product="truncated thiamine biosynthesis protein ThiC
FT                   (fragment 2)"
FT                   /function="Thiamine biosynthesis protein ThiC"
FT                   /note="(Q82FI7) Thiamine biosynthesis protein
FT                   thiC,InterPro: Thiamine biosynthesis protein ThiC,Similar
FT                   to carboxy-terminal part of thiamin biosynthesis protein
FT                   [Bacillus halodurans C-125] (BAB05652)."
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0595"
FT                   /db_xref="GOA:B9DIR0"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIR0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27509.1"
FT                   /translation="MFCYVTPKEHLGLPNKDDVREGVITYKIAAHAADLAKGLPGAAER
FT                   DDAISKARFEFRWIDQFNLSLDPERAREYHDETLPKESAKVAHFCSMCGPKFCSMRISH
FT                   DLRQNHFDEKERKEAMKEKAQDFVEQGSRVYQ"
FT   CDS_pept        complement(600309..601304)
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="SCA_0596"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /function="Tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="(Q99V94) Tryptophanyl-tRNA synthetase (EC 6.1.1.2)
FT                   (Tryptophan--tRNA ligase) (TrpRS),InterPro:
FT                   Tryptophanyl-tRNA synthetase class Ib"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0596"
FT                   /db_xref="GOA:B9DIR1"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIR1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27510.1"
FT                   /translation="METLFSGIQPSGIPTLGNYIGALKQFSEVQDDYNCFFCIVDQHAI
FT                   TVPQDRLKLRERTRQLAAIYLASGIDPEKSTLFIQSEVPAHVQAGWMLTTISSVGELER
FT                   MTQFKDKSQKQTEGIPAGLLTYPPLMAADIVLYNTNIVPVGEDQKQHLELTRNLVDRFN
FT                   SRYNDILIKPEVRMPKIGGRVMSLQDPTKKMSKSDDNAKNFISLLDNPNTAAKKIRSAV
FT                   TDSDGIIKYDKDNKPGISNLLSIYSSLTDESIADLEVRYEGEGYGKFKGDLAEVVKQFL
FT                   TDFQERYESYYHSEKLDDILDLGRDKAIKASARTLEKMERAMGLGRKRRK"
FT   CDS_pept        601701..602099
FT                   /transl_table=11
FT                   /locus_tag="SCA_0597"
FT                   /product="putative ArsC family protein"
FT                   /function="Arsenate reductase and related proteins
FT                   glutaredoxin family"
FT                   /note="(P60378) Regulatory protein spx,InterPro: Conserved
FT                   hypothetical protein ArsC related"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0597"
FT                   /db_xref="GOA:B9DIR2"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR023731"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIR2"
FT                   /inference="similar to AA sequence:UniProtKB:P60378"
FT                   /protein_id="CAL27511.1"
FT                   /translation="MVTLFTSPSCTSCRKAKAWLQEHDIPYTERNIFSEHLTIDEIKQI
FT                   LKMTEDGTDEIISTRSKTYQKLNVDIDSLPLQELYTIIQDNPGLLRRPIILDEKRLQVG
FT                   YNEDEIRRFLPRKVRTFQLQEAQRMVDL"
FT   CDS_pept        602404..603120
FT                   /transl_table=11
FT                   /locus_tag="SCA_0598"
FT                   /product="putative MecA family protein"
FT                   /function="Negative regulator of genetic competence
FT                   sporulation and motility"
FT                   /note="(P60184) Adapter protein mecA,InterPro: Negative
FT                   regulator of genetic competence"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0598"
FT                   /db_xref="GOA:B9DIR3"
FT                   /db_xref="InterPro:IPR008681"
FT                   /db_xref="InterPro:IPR038471"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DIR3"
FT                   /inference="similar to AA sequence:UniProtKB:P60184"
FT                   /protein_id="CAL27512.1"
FT                   /translation="MRIERVDDTTVKLFITYGDIESRGFKREDLWTNRQRGEEFFWSMM
FT                   EEINEEEDFVVEGPLWIQVHAFEKGVEVVISKSKNEEMMNMADDNMNNEFDRQLNELLE
FT                   QSFEDENEESVQGNQQQRRSHASDHSKRARHTNGRLVIVKFEDLESVIDYAHHSNQPTD
FT                   DFEDLLYMLNNEYYYAIHFDDNVGEEVINDFYSQLLEFTQPSDRSEMYLNDYAKIIMSH
FT                   NVTAQVRRFFTDTEEI"
FT   CDS_pept        603409..605217
FT                   /transl_table=11
FT                   /gene="pepF"
FT                   /locus_tag="SCA_0599"
FT                   /product="oligoendopeptidase F"
FT                   /function="Oligoendopeptidase F"
FT                   /EC_number="3.4.24.-"
FT                   /note="(O31605) Oligoendopeptidase F homolog (EC
FT                   3.4.24.-),InterPro: Oligoendopeptidase F"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0599"
FT                   /db_xref="GOA:B9DIR4"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR004438"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="InterPro:IPR042088"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIR4"
FT                   /inference="similar to AA sequence:UniProtKB:O31605"
FT                   /protein_id="CAL27513.1"
FT                   /translation="MSQQLTREQQEQKYPEYTWDLTTIFESDEAFEKAFKDVESYLGAE
FT                   EKYKGHLADNAETLYDALALEDKIETELEKVYVYAHLKQDQDTGNDKYTGYEARAHQLA
FT                   IKLSSSWSFLVPEILQIDEDKIQSFIDENKDLERYAFDLKLINEQRPHILSADKEKLLT
FT                   EAQDALSTPSNVYGMFSNADLEFEDAVDKDGNKHPLTQGTFIKYLESDDRELRRSAFRN
FT                   LYKAYGAYNNTLAATLTGEVKKHVFNARTHNYKTAREQALSNNHIPEEVYDNLVKTVHK
FT                   YLPLLHRYTALRKEVLGLDDMKMYDLYTPLVKDIKFEMPYDEAVDWMLKALEPMGDEYL
FT                   EVVKEGLNNRWVDVYENKGKRSGGYSSGAHLTNPFILLNWSDTVSDLFTLIHEFGHSAH
FT                   SYFSRKNQPSNHSDYSIFVAEVASTTNEALLSDYMEKHLDDERRLLLLNQELERFRATL
FT                   FRQTMFAEFEHKIHQIEEAGEPLTANRMNEEYAKLNREYFGDIVDTDEDISKEWSRIPH
FT                   FYMNYYVYQYATGYSAAQSLSYQILNEGEPAVKRYINEFLKKGSSNYPIEILKNAGVDM
FT                   KSPEPIEQACQTFERKLDEFEKLIKA"
FT   CDS_pept        complement(605542..605871)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0600"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0600"
FT                   /db_xref="GOA:B9DIR5"
FT                   /db_xref="InterPro:IPR015113"
FT                   /db_xref="InterPro:IPR016085"
FT                   /db_xref="InterPro:IPR037296"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIR5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27514.1"
FT                   /translation="MDKININVKYLESLSKAEEELLNHFKGEWISQDDSLSVNIRILFA
FT                   EPSDLEDIYDIKTISTTDNELTLSQTSTQDFVVCLKKKDLQHISYEVMDIEGIGSSKPY
FT                   LLEKG"
FT   CDS_pept        complement(605902..606462)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0601"
FT                   /product="truncated thiol protease-like protein (fragment
FT                   2)"
FT                   /note="Similar to carboxy-terminal part of thiol protease
FT                   [Staphylococcus aureus] (BAB86291).,InterPro: Peptidase C47
FT                   staphopain peptidase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0601"
FT                   /db_xref="GOA:B9DIR6"
FT                   /db_xref="InterPro:IPR008750"
FT                   /db_xref="InterPro:IPR025660"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIR6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27515.1"
FT                   /translation="MDASQPISQQRSVATKYVNTLPHFQIRETQGNNGWCAGFTMAALL
FT                   NATKNTSQYRAQDIMRTIHPGLSGQRFQFTGLTPDEMIQYGRSQGKNPTYYNSMPSYDM
FT                   VDQYTSDNKGIAILSERVESTNGLHGRHAMAVVGNAVLANNQKVIVFWNPWDSDVSLQP
FT                   VDSNIIPVSDGSHFRWFASIPGY"
FT   CDS_pept        complement(606522..607061)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0602"
FT                   /product="truncated thiol protease-like protein (fragment
FT                   1)"
FT                   /note="Similar to amino-terminal part of thiol protease
FT                   [Staphylococcus aureus] (BAB86291)."
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0602"
FT                   /db_xref="GOA:B9DIR7"
FT                   /db_xref="InterPro:IPR028076"
FT                   /db_xref="InterPro:IPR037155"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIR7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27516.1"
FT                   /translation="MNNTKSLLKSFTIILFSLIMALSGLLSFSTSSQAQAVHKAPLKVK
FT                   VSNTEVPAKAEQQAETQFSSYAQALSQIDKSGTNGEYQLGKPFKIYKFNGQEDGNYYFP
FT                   VLQGEHIKYVLTVTPKNENDVNANKNSANYSVRISKFIADSLNQYRQANTPITIYTNKD
FT                   GYFAEHNHKIEMIKQN"
FT   CDS_pept        complement(607476..608261)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0603"
FT                   /product="putative dithiol-disulfide isomerase"
FT                   /function="predicted dithiol-disulfide isomerase involved
FT                   in polyketide biosynthesis"
FT                   /note="(Q81YT8) Probable disulfide bond formation protein D
FT                   precursor (Disulfide oxidoreductase D) (Thiol-disulfide
FT                   oxidoreductase D)"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0603"
FT                   /db_xref="GOA:B9DIR8"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIR8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27517.1"
FT                   /translation="MSEELKLICNNRQDETNLSPVSKIEIYSFFDPFDEDCFKLSAILS
FT                   KLRVEYKQYIRIRHILNPSLRILTKCQAQSSSENDNIALAYKAAELQGRSRAERFIHLM
FT                   QNEIIPKRDIITEQMIKDAAKNAGLDYEVFKEDLKSGKLKESLKVDLHIAREMEIDQAP
FT                   SLVFFNEDVTEEGLKVEGLYPYHIYTYIINELMGTPIEKELPPKLETYIKEQQFVTFEE
FT                   LLTIYEWPEKMLLKELKKLALQQKIEKLSNPEGDFWKAK"
FT   CDS_pept        complement(608277..608648)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0604"
FT                   /product="bacterial-like globin family protein"
FT                   /function="Truncated hemoglobins"
FT                   /note="(Q9CC59) Hemoglobin-like protein HbO,InterPro:
FT                   Protozoan/cyanobacterial globin"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0604"
FT                   /db_xref="GOA:B9DIR9"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR019795"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIR9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27518.1"
FT                   /translation="MAPKPYEVIGKERLYSMIDYFYSLVEKDERINYLFPGDFAETSRK
FT                   QKQFLTQFLGGPALYTEEHGHPMLKMRHMEFRITPFERDAWLDNMNKAIQHAELPAGVG
FT                   EYLYERLRITAHHMVNSEN"
FT   CDS_pept        complement(608751..609323)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0605"
FT                   /product="hypothetical protein with CYTH domain"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /note="(P30871) Hypothetical protein ygiF (ORFXE),InterPro:
FT                   Adenylate cyclase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0605"
FT                   /db_xref="InterPro:IPR009195"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIS0"
FT                   /inference="similar to AA sequence:UniProtKB:P30871"
FT                   /protein_id="CAL27519.1"
FT                   /translation="MAINQEIEYKQLLSEDQYNEIKKAFFSGQKPFTQTNFYIDTPNFE
FT                   LAEQLMALRIRQIDNNYEMTLKVPAKVGLTEYNHETEIVPEEGLHIQPEQLPDDIYSVL
FT                   QKNNINFKQLDILGSLTTHRIETKIKEGLLVLDHSEYLDTEDYELEFEVENPEIGLKKF
FT                   QEILKEFNIKSEIPKNKVARFFEAKSK"
FT   CDS_pept        609476..609823
FT                   /transl_table=11
FT                   /locus_tag="SCA_0606"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0606"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIQ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27520.1"
FT                   /translation="MRIYVNEIKVKDDGIYCYTDKSTEGLKEAGQMLVDSDNYGFAYIL
FT                   DDGQSYSYLIFVKETWSMLHENKGKTIYINDDLKLEEFDQELDYILSNIKGNSNYGKDF
FT                   VAEVEEAFELE"
FT   CDS_pept        609840..610475
FT                   /transl_table=11
FT                   /locus_tag="SCA_0607"
FT                   /product="conserved hypothetical protein"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /note="(Q49640) Probable GTP pyrophosphokinase (EC 2.7.6.5)
FT                   (ATP:GTP 3-pyrophosphotransferase) (ppGpp synthetase I)
FT                   ((P)ppGpp synthetase),InterPro: RelA/SpoT"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0607"
FT                   /db_xref="GOA:B9DIP4"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIP4"
FT                   /inference="similar to AA sequence:UniProtKB:Q49640"
FT                   /protein_id="CAL27521.1"
FT                   /translation="MNQWDRFLTPYRQAVDELKIKLKGLRKIYDLEQDASPIEFVTGRV
FT                   KPLTSIIEKATEREIPFDRLHEEMYDIAGLRIMCQFVDDIEIVVNLLRQRKDFKVVEER
FT                   DYINNTKESGYRSYHVIIEYPIETLEGQSKILAEIQIRTLAMNFWATIEHTLRYKYDGD
FT                   YPPEIQKRLENAAEAAFSLDEEMSEIKDEIQEAQRYYSKKRAKKHNQE"
FT   CDS_pept        610484..611293
FT                   /transl_table=11
FT                   /locus_tag="SCA_0608"
FT                   /product="putative kinase"
FT                   /function="predicted sugar kinase"
FT                   /note="(Q99V84) Probable inorganic polyphosphate/ATP-NAD
FT                   kinase (EC 2.7.1.23) (Poly(P)/ATP NAD kinase),InterPro:
FT                   ATP-NAD kinase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0608"
FT                   /db_xref="GOA:B9DIP5"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DIP5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27522.1"
FT                   /translation="MRYNIVSKGDHKSNSIKENMEAQMQDTKMIKDTETPEIVISVGGD
FT                   GTLLEAFHKYSYRLSETAFVGVHTGHLGFYADWLPHESDKLIREIIDGDYEVIKYPLID
FT                   ITVNYNDEKNPSHHIALNEATMKTEDNTTLVADVSLRGQHFERFRGDGLCISTPSGSTA
FT                   YNKALGGALIHPSLRAIQLTEIASINNRVFRTVGSPLVLPAHHYCLITPVDQRTIMTSI
FT                   DHVTTKHHNVKSIEYKVSEEEIRFARFRPFPFWKRVHDSFISDGRDD"
FT   CDS_pept        611293..612177
FT                   /transl_table=11
FT                   /locus_tag="SCA_0609"
FT                   /product="putative pseudouridylate synthase"
FT                   /function="Pseudouridylate synthases 23S RNA-specific"
FT                   /note="(O31613) Hypothetical pseudouridine synthase yjbO
FT                   (EC 4.2.1.70) (Pseudouridylate synthase) (Uracil
FT                   hydrolyase),InterPro: Pseudouridine synthase RluD"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0609"
FT                   /db_xref="GOA:B9DIP6"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIP6"
FT                   /inference="similar to AA sequence:UniProtKB:O31613"
FT                   /protein_id="CAL27523.1"
FT                   /translation="MEFRYKILSPIVLKNFLQQNQYSKKMISAIKRDGALIVNEVPVTV
FT                   RKTLEIGDVLVVKLPDEQASENLVPDYQPIDVLFEDQYFIAVSKGKKQNCAPSREHPHG
FT                   SLIEQVIGYLKDQAADGNYQSIPHIVTRLDRDTSGIVLFAKHGHLHHRMSSTEMKKVYH
FT                   CICNGKLENTSKIVAPIMRAGDSIIERKVDQAGKYAATSYQPINASEQYTLCEVRLHTG
FT                   RTHQIRVHFQYINHPIVGDGLYGGLHTFVTGQALACCYLSFKHPITHEQIELRDDAKRI
FT                   ELDNLFQQLCKAN"
FT   CDS_pept        612198..613580
FT                   /transl_table=11
FT                   /locus_tag="SCA_0610"
FT                   /product="putative divalent cation transporter"
FT                   /function="Mg/Co/Ni transporter MgtE (contains CBS domain)"
FT                   /note="(O67820) Inosine-5-monophosphate dehydrogenase (EC
FT                   1.1.1.205) (IMP dehydrogenase) (IMPDH) (IMPD),InterPro:
FT                   Divalent cation transporter"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0610"
FT                   /db_xref="GOA:B9DIP7"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIP7"
FT                   /inference="similar to AA sequence:UniProtKB:O67820"
FT                   /protein_id="CAL27524.1"
FT                   /translation="MAKDDKKFMDEKEVYNKELLDNLLLNNDIDKFREEFLSMHTYEQS
FT                   EYFEDSDNEIHQKMYHLLSPKEVADFFDQLEIDDDEYEEIFDQMKVNYAANILEDMSYD
FT                   NAVDIMNHLSKRKIATLLAIMDKDDAKEIKALMHYEEDTAGGIMTTEYISLKTTTPVKE
FT                   GLLLVKEQAPEAETIYVIFAVNDDKQLVGVLSLRDLIVAENDDYIEDIMSERVVSVNVA
FT                   DDQEDVAQTMRDYDFIALPVVDYQDHLLGIITIDDILDVMDEEALEDYSGLAGVSDIDS
FT                   TDDSIVKTASKRLPWLLILTFLGMITATILGSFEDTLEKVALLAAFIPIISGMSGNSGT
FT                   QSLAVSVRNITTGEVENQSKFKITLREAGAGFLSGLVCAIVLFTIIMILYRTPLLGLIV
FT                   AGSLTIAMTVGTIMGSIIPLIMNKLKIDPAVASGPFITTINDIVSMLIYFGLATTFMSY
FT                   LI"
FT   CDS_pept        613591..615447
FT                   /transl_table=11
FT                   /locus_tag="SCA_0611"
FT                   /product="putative cation transport system"
FT                   /function="Kef-type K+ transport systems membrane
FT                   components"
FT                   /note="(Q83SQ3) Glutathione-regulated potassium-efflux
FT                   system protein kefC (K(+)/H(+) antiporter),InterPro:
FT                   Sodium/hydrogen exchanger"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0611"
FT                   /db_xref="GOA:B9DIP8"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIP8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27525.1"
FT                   /translation="MEFVSLVIVVMAAFLTPIIVNRLNINFLPVVVAEILMGLVIGQSG
FT                   FHLVERDNVLNILSTLGFIFLMFLSGLEIDFSAFKSQPTQNTKKSKNKKKQPSHLQLAL
FT                   LVFGLIMVVSVILAYLFKWFGLIDDVLLMVIIISTISLGVVVPTLKEMNIMRTRIGQFI
FT                   LLTAVLADLFTMILLTVYGALNGKGGATLWLIGVLVIFTVIFYFLGGVFKKAQFLQKLN
FT                   DGTTQIGVRACFALIILLVALAEGVGAENILGAFLAGVIVSLLGPNEDMVEKLDSFGYG
FT                   FFIPIFFIMVGVDLNIPSLIKEPSILIIIPILIVAFLISKIIPVFAIRPWFDQKTTISS
FT                   AFLLTSTLSLVIAAAKIAEQLKTITPEISGILILSAVITCVFVPMVFKKTFPMPEEATR
FT                   RINVSLIGKNQLTIPIAQNLMSDLYAITLYYRKDLSDQRNLSNDITTVEIADYDEAMLD
FT                   KLGLFDSDIVVCSTNDDDINFNVATMAKEHGVNRVICRFEAGGERESNLREEGIEIFSS
FT                   FLSNKILLTGLIETPNMLNLLSNVETSLYEIQMLNYKFDHIQLRNFPFDGDIIFVRIVR
FT                   DNESIVPHGDTTLRYGDRLIVTGSKEYVDELKRDLEYYAFNS"
FT   CDS_pept        615660..616430
FT                   /transl_table=11
FT                   /gene="fabI"
FT                   /locus_tag="SCA_0612"
FT                   /product="putative trans-2-enoyl-ACP reductase"
FT                   /function="Enoyl-[acyl-carrier-protein] reductase (NADH)"
FT                   /EC_number="1.3.1.9"
FT                   /note="(P54616) Enoyl-[acyl-carrier-protein] reductase
FT                   [NADH] (EC 1.3.1.9) (NADH-dependent enoyl-ACP reductase)
FT                   (Cold-shock induced protein 15) (CSI15) (Vegetative protein
FT                   241) (VEG241),InterPro: Short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0612"
FT                   /db_xref="GOA:B9DIP9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIP9"
FT                   /inference="similar to AA sequence:UniProtKB:P54616"
FT                   /protein_id="CAL27526.1"
FT                   /translation="MFSLEGKTYVIMGVANKRSIGFGVAKVLDQLGAKLVFTYRKERSK
FT                   KQLEKLYDQLNQEQQHMYQIDVQSDEDVINGFKQIGEDLGNIDGVYHSIAFSNVEDLRG
FT                   RFSDTSREGFLLAQDISSYSLTIVAREAKKLMPEGGSIVATTYLGGELAIPNYNVMGVA
FT                   KASLEANVRYLALDLGGENIRVNSISAGPIRTVSAKGVGDLNVILREVEERAPLKRNVD
FT                   QEEVGKTAAYLLSDLSSGVTGENIHVDAGFHAIK"
FT   CDS_pept        616848..618086
FT                   /transl_table=11
FT                   /locus_tag="SCA_0613"
FT                   /product="putative transporter protein"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /note="(P71369) Hypothetical metabolite transport protein
FT                   HI1104,InterPro: General substrate transporter"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0613"
FT                   /db_xref="GOA:B9DIQ0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIQ0"
FT                   /inference="similar to AA sequence:UniProtKB:P71369"
FT                   /protein_id="CAL27527.1"
FT                   /translation="MVKKINQQDKSYSNKILTSSMLGFGLENMDVMFLAFALSSIINEF
FT                   HITSAEAGLISSITNFGMLFGGVIFGVLADKYGRIRIFTYTIFLFAIATALLSIAHNIY
FT                   IVYILRFIAGMGGGGEFGIGMALVAEVFAMKKLGRVSSVVAIGGQVGALTAALLAAAIL
FT                   PLWGWRALFLIGVIPVILAFYIRRNLDETDAWKRTKAKQTLEKKENSPITLLFNSKNKA
FT                   HTTIALTIMSSVQVAGYFGLMNWLPSILQKQHGLSVSNSSLWTISTIIGMSLGMLCFGQ
FT                   ILDKFGAKISYSIFLIASAASVFLYVFAQSSIALLIGGAFVGFFVNGMFAGYGAVISSF
FT                   YPTHIRSTANNVIFNVGRAVGGLSPIAIGFLMDHSGMLGTMIFLACLYMISLVMLLSLK
FT                   HIPLRGKRYLENA"
FT   CDS_pept        complement(618215..619300)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0614"
FT                   /product="putative membrane protein"
FT                   /function="predicted permease"
FT                   /note="(O34472) Hypothetical UPF0118 protein yrrI,InterPro:
FT                   Protein of unknown function UPF0118,UPF0118, Domain of
FT                   unknown function DUF20. This transmembrane region is found
FT                   in putative permeases and predicted transmembrane proteins
FT                   it has no known function. It is not clear what source
FT                   suggested that these proteins may be permeases and this
FT                   information should be treated with caution."
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0614"
FT                   /db_xref="GOA:B9DIQ1"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIQ1"
FT                   /inference="similar to AA sequence:UniProtKB:O34472"
FT                   /protein_id="CAL27528.1"
FT                   /translation="MLNKVWFRTGIMLIILFVLIKLIMEVHVIFNPIIIIVKSVLLPFI
FT                   LSGFLFYVFLPLQKLLEKYRVPRWGSITIIFVILIGIITAAVTVVAPLIMNQINNLIKQ
FT                   APQLQQETQTMIKYALDQMDKLPNDVTDRVNKVVKSFGDNVTNVLTNSISIVSQIISTL
FT                   FLLIMVPFFLIYMLKDHEKFIPSIAKLFNGDRKVFVVNLLKDLNHTLQSYIQGQVTVSF
FT                   ILGVILYIGYSIIGLDYTLLLVLFAGVANMIPFLGPWMSFAPAAIIGIIQSPTAFIWVC
FT                   VVTLVAQQLEGNVITPNVMGKSLSIHPLTIIVVILAAGNLGGFVLILVAVPLYAVIKTI
FT                   VRNVFKYRQSIMMKAQSDVKD"
FT   CDS_pept        complement(619553..621199)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0615"
FT                   /product="sodium:alanine symporter family protein"
FT                   /function="Na+/alanine symporter"
FT                   /note="(P30145) Sodium/proton-dependent alanine carrier
FT                   protein,InterPro: Sodium:alanine symporter"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0615"
FT                   /db_xref="GOA:B9DIQ2"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIQ2"
FT                   /inference="similar to AA sequence:UniProtKB:P30145"
FT                   /protein_id="CAL27529.1"
FT                   /translation="MLESIVAWFNEVVWSKPLVYGLLITGILFSLMMKFFQVRHFKEMI
FT                   RLMFHGEKSPTGISSFQAIALSLAGRVGTGNIVGVSTAIFIGGPGAVFWMWITAFLGAS
FT                   SAFIESTLGQIFKREEKGEYRGGPAYYIQYGIKGRLGKIYGLVFAIVTVISVGLLLPGV
FT                   QSNAIASSMHNAFKVPSWIIATILAVILGLIIFGGVKWIANVATAVVPFMAIIYILMAV
FT                   FIIILNIQAVPALFALIFKSAFGMQAAFGGIFGAMIEIGVKRGLYSNEAGQGTGPHAAA
FT                   AAEVSHPAKQGLVQAFSVYVDTLFVCTATALIILISGTYNTTNGDVGPGGLPKLIKDNG
FT                   IFVQSADGTKDYSGTAMYAQAGIDKALQGGSYHFDPTFSGVGSYFIAIALFFFAFTTIL
FT                   AYYYIAETNIAYMTRNSSRFTTTIWINVARVVLIGATVYGSIKTADIAWSMGDLGVGMM
FT                   AWLNIIAIWILHRPAVDALKDYESQMKRLGSGNHAIYHPDPKKLPNATFWLEDYPKRLK
FT                   KAHFNEEQDNDEDNDQNPEPNVPLGKNLKEV"
FT   CDS_pept        621503..622240
FT                   /transl_table=11
FT                   /locus_tag="SCA_0616"
FT                   /product="putative esterase family protein"
FT                   /function="Enterochelin esterase and related enzymes"
FT                   /note="(P31471) Protein yieL,InterPro: Putative esterase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0616"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIQ3"
FT                   /inference="similar to AA sequence:UniProtKB:P31471"
FT                   /protein_id="CAL27530.1"
FT                   /translation="MMTEFKIGTVNKTTFHSELLKRDITFSIYLPEDYTPLFKYKVIFC
FT                   FDGLDFFRYGRIHRTYEKLRKEDKIERAIIIGFHYETVDLRREEFSPNGSKAPLTVKAM
FT                   AKEILPYIDQNFPTYKVANGRILLGDSLAGSIALMTALSYPRLFSQVGMFSPMFNEVVD
FT                   VLADRCQFIDHLNIWQAVGKEEIDFALPTTGERADFLTPNRELNQVLNQKEVTHYYEEF
FT                   DGTHRWKSWKTLMEPLLIYFLAE"
FT   CDS_pept        622337..622846
FT                   /transl_table=11
FT                   /locus_tag="SCA_0617"
FT                   /product="conserved hypothetical protein with LigT-like
FT                   domain"
FT                   /function="2-5 RNA ligase"
FT                   /note="(O14080) Hypothetical protein UNK415 in chromosome
FT                   I"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0617"
FT                   /db_xref="GOA:B9DIQ4"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="InterPro:IPR022932"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIQ4"
FT                   /inference="similar to AA sequence:UniProtKB:O14080"
FT                   /protein_id="CAL27531.1"
FT                   /translation="MILGLALIPSKTFREKIDAYRKRYDERYAQIPPHITIKDSFEVED
FT                   GDFDKVKEEIKERVQGVEPLHIHATKASNFAPINNVIYFKVEKTPELEELDNRFNNGDF
FT                   YGKPEHSFVPHFTIAQGLTSQEFEDIFGQVALAGIDYKETIDALTLLQYDNDAEKWKEI
FT                   DTFSFK"
FT   CDS_pept        complement(623048..624253)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0618"
FT                   /product="putative permease"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /note="(P39843) Multidrug resistance protein 2
FT                   (Multidrug-efflux transporter 2),InterPro: Major
FT                   facilitator superfamily"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0618"
FT                   /db_xref="GOA:B9DIP3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIP3"
FT                   /inference="similar to AA sequence:UniProtKB:P39843"
FT                   /protein_id="CAL27532.1"
FT                   /translation="MQSSSSSRYNNKNYQRNFIIMLVILFLIEFARGMFVLSYLPILPT
FT                   VSSVAVGLTSAAVSVHYISDAATNFVIGFLLKRFGAKPVLTLGFLMAFGSLFLVIWFPF
FT                   NPYILFISAILLGIASSPIWVIMLSSVRDETRGKQMGHVYFAWLFGLLLGMIGMNLIMK
FT                   VHPTSFAFLMSLMVLIAWILYYFVKIRLTNYNTRKVSQQLKQIGGVAKKNGVLFPGIIL
FT                   QGASISALVPILPIYATKIIKVSTVEYTVALIIGGIGCAISMLFLSKIIDNHGKSFMYL
FT                   TIFTGFILYTLGIFGLSLITNIYIVWGIALFIGLMYGFLLPAWNTFMASFIHKDEQEET
FT                   WGVFNSIQGFGAMFGPIIGGMLYQFTGSVNNTFYFSAGVFIFLAIFYGVYFIKLRRHRI
FT                   SS"
FT   CDS_pept        complement(624231..625406)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0619"
FT                   /product="putative glycosyl transferase"
FT                   /function="UDP-N-acetylglucosamine:LPS N-acetylglucosamine
FT                   transferase"
FT                   /note="(P54166) Putative glycosyl transferase ypfP (EC
FT                   2.-.-.-)"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0619"
FT                   /db_xref="GOA:B9DQ98"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="InterPro:IPR009695"
FT                   /db_xref="InterPro:IPR023589"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DQ98"
FT                   /inference="similar to AA sequence:UniProtKB:P54166"
FT                   /protein_id="CAL27533.1"
FT                   /translation="MVTQNKKILIITGSFGNGHLQVTNSVVNQLNEMNLKHLSVIEHDL
FT                   FMEAHPILTSICKKYYINSFKYFRNSYKQFYYSRPEDVNKCFYKYYGLNKLINLLIKEK
FT                   PDLILLTFPTPVMSVLTEQFNMNIPIATVMTDYRLHKNWVTPHSSRYYVATPDLKQEFV
FT                   NVGVPEDIIKITGIPISEQFDEDIDTKVWMHKNHLDPNRPTILMSAGAFGVSKGFDVMI
FT                   SDILERSPETQIVMICGRNKELKRALRQQFKEYANVLILGYTHHMNEWMASSHLMVTKP
FT                   GGITISEALARKIPMIFLDPAPGQELENAHYFQSKGMGKIADTTEEAIQLITELTQDEN
FT                   ALAHMAEQMQDLKVKYPTYKLCRDLLHLLDHSSQFEEIYGKVPMYAKLFIK"
FT   CDS_pept        625803..627287
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="SCA_0621"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /function="UDP-N-acetylmuramyl tripeptide synthase"
FT                   /EC_number="6.3.2.13"
FT                   /note="(Q8CPR2) UDP-N-acetylmuramoylalanyl-D-glutamate--2
FT                   6-diaminopimelate ligase (EC 6.3.2.13)
FT                   (UDP-N-acetylmuramyl-tripeptide synthetase)
FT                   (Meso-diaminopimelate-adding enzyme) (UDP-MurNAc-tripeptide
FT                   synthetase),InterPro: UDP-N-acetylmuramyl-tripeptide
FT                   synthetase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0621"
FT                   /db_xref="GOA:B9DQ99"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B9DQ99"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27534.1"
FT                   /translation="MKANELFEKIKSKQVLGSLDREITDITTDSRTAEEGSVFVATKGY
FT                   TVDSHKFCQDVVNQGCKLIVVESEQEVEGDVTQVIVPKTRRVASLIVHKLYNYPSEQLT
FT                   TYGVTGTNGKTSIATMIHQIHRKLGKGSAYLGTNGFQINETVTKGENTTPETVTLTKKI
FT                   HEAVEAGAESMTLEVSSHGLALGRLSGVEFDVAIFSNLTQDHLDFHGTMEAYGHAKSLL
FT                   FSQLGEDLRKEKFAVVNADDDFSEYLTSVTPYEVFTYGIHRPAQFKAERIQESLTGASF
FT                   DFVTPDGTFHVDSPYVGKFNISNIMAAMTAVWGTGTPMQEIVDVVSQLEPVEGRLEVLD
FT                   PSLPIDLIIDYAHTTDGIEKLIDAVKPFVKQKLIFLIGMAGERDLTKTPEMGKQASRAD
FT                   YVIFTPDNPANDDPKMLTAELAKGATHDNYVEYTDRAEGIRHAIDVAEPGDTVVLASKG
FT                   REPYQIMPGHVKVPHRDDLIGLEAAYKKFGGGPSED"
FT   CDS_pept        627521..629083
FT                   /transl_table=11
FT                   /gene="prfC"
FT                   /locus_tag="SCA_0623"
FT                   /product="putative peptide chain release factor RF-3"
FT                   /function="Peptide chain release factor RF-3"
FT                   /note="(Q8CPR1) Peptide chain release factor 3
FT                   (RF-3),InterPro: Peptide chain release factor 3"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0623"
FT                   /db_xref="GOA:B9DQA0"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DQA0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27535.1"
FT                   /translation="MSIKDEIESRKTFAIISHPDAGKTTLTEKLLLFGGAIREAGTVKG
FT                   KKSGKFATSDWMKVEQERGISVTSSVMQFDYDDYNINILDTPGHEDFSEDTYRTLMAVD
FT                   SAVMVIDCAKGIEPQTLKLFKVCKMRGIPIFTFINKLDRVGKEPFELLDEIEETLNIKT
FT                   YPMNWPVGMGQNFFGIIDREQRTIEPFRDEEHLLHLNDDYELEEEHEITKDSTFSQAID
FT                   EFMLVEEAGEEFDNEMLLAGELTPVFFGSALANFGVQSFLNAYVDHAPMPNGRITKEAE
FT                   EVSPFTPDFSGFIFKIQANMDPKHRDRIAFMRIVSGAFERGMDVKLQRTNKKQKITRST
FT                   SFMADDKETVNHAVAGDIIGLYDTGNYQIGDTLVGGNQKFSFEDLPQFTPELFMKVSAK
FT                   NVMKQKHFHKGIEQLVQEGAIQYYKTLHTNQIILGAVGQLQFEVFEHRMKNEYNVDVVM
FT                   EPVGRKIARWVENEDDIKDKMSTSRSILVQDRYEQKVFLFENEFATRWFEEKFPEIKLY
FT                   SLL"
FT   CDS_pept        629356..630171
FT                   /transl_table=11
FT                   /locus_tag="SCA_0624"
FT                   /product="putative TerC family integral membrane protein"
FT                   /function="Membrane protein TerC possibly involved in
FT                   tellurium resistance"
FT                   /note="(O34447) Hypothetical protein yceF,InterPro:
FT                   Integral membrane protein TerC family"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0624"
FT                   /db_xref="GOA:B9DQA1"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022493"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9DQA1"
FT                   /inference="similar to AA sequence:UniProtKB:O34447"
FT                   /protein_id="CAL27536.1"
FT                   /translation="MDPSLILPYLWVLLVLVFLEGLLAADNAVVMAVMVRHLPPEQRKK
FT                   ALFYGLLGAFVFRFASLFLISYLVNFWFIQAAGAVYLLYMSARNLYQFFKVDQHGPESP
FT                   EAGDDHHYDQHGNEKKVGPKAFWGTVAKVEFADIAFAIDSMLAAMAIAFTLKPVGIHFG
FT                   GMDLGQFLVMFAGGMIGVILMRFAATWFVELLNKYPGLEGAAFAIVGWVGIKLVVLVLA
FT                   HPQVQIIPENFPHTILWQCIFWGVMIGLVIIGWLTSLRHNKKAAQDKNK"
FT   CDS_pept        630349..632100
FT                   /transl_table=11
FT                   /locus_tag="SCA_0625"
FT                   /product="putative protease"
FT                   /function="Trypsin-like serine proteases typically
FT                   periplasmic contain C-terminal PDZ domain"
FT                   /note="(P39668) Hypothetical serine protease yyxA (EC
FT                   3.4.21.-),InterPro: Peptidase S1 chymotrypsin family"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0625"
FT                   /db_xref="GOA:B9DQA2"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B9DQA2"
FT                   /inference="similar to AA sequence:UniProtKB:P39668"
FT                   /protein_id="CAL27537.1"
FT                   /translation="MAEDNHSNDKKNHKDGKQVIPKRHYKRKRRAFFHNKEREERVQRE
FT                   HEAKKLEKEREAKLAKNNEERVKDNLRKARIEKLTQEEIQHQKQKAHENTDKNSSSDDL
FT                   HSAESKNQKDKSEFATAESPKHHNQDKKEAIETGAAGIRPEDTGKDTQKEVHTAETKAT
FT                   ENKYENESASKEDTAHMSEYEEPKNKNMNSKRNDVSKNEGNSKVSDFLRRNWAKIAVVI
FT                   GAIILVLLLFAIFHNLQDRDGTSSGQVSSFGGSDKKQTAMMKAAKETIHSVVTVENKGS
FT                   NKSSVEKEAPKSDGEIGSGVVYKKVGDSIFILTNAHVVGDKSSQNILYDDKQETNGKVI
FT                   GKDKYSDIAVVKAKVKKNSNVQPIAIGDSNQLQLAEPIITVGNPLGADFKGSVSSGIIS
FT                   GLNRNVPVDMDKDGNYDTLTKAFQIDAPVNPGNSGGAVVDQNGKLIGIVSLKIDMQAVE
FT                   GMAFAIPVNHALDLAKQLEKHGHIDYPNTGVQISNVGDLSDSERQQFDLPSSVKQGAVV
FT                   RAVKDGSIAEKAGLKPDDVIVKLGGTNIEDSLRYRQIIFEHKDDKKSLSAKIYRNGKLK
FT                   DITIKLK"
FT   CDS_pept        632118..633476
FT                   /transl_table=11
FT                   /locus_tag="SCA_0626"
FT                   /product="putative sodium transport protein"
FT                   /function="Trk-type K+ transport systems membrane
FT                   components"
FT                   /note="(P43440) V-type sodium ATP synthase subunit J (EC
FT                   3.6.3.14) (Na(+)-translocating ATPase subunit J),InterPro:
FT                   Cation transporter"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0626"
FT                   /db_xref="GOA:B9DQA3"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:B9DQA3"
FT                   /inference="similar to AA sequence:UniProtKB:P43440"
FT                   /protein_id="CAL27538.1"
FT                   /translation="MSIFNQLFKKTSPQQGIVMYYLIAIVAAFLMLNLPYVHKPGVHVN
FT                   PIDTLFVAVSGISVTGLTSISIVDTYSTFGQIIILIILNIGGVGVMAMGTVLWLVLRKR
FT                   IGLRERQLIMLDNNRNTMSGAVKLIIEIVRAILLIELVGALLLAFYFYRDSSDIQYALM
FT                   QGFFVAISSTTNAGLDITGNSLIPYADDYFVQTIVMFLITLGSIGFPVLLEVKAYIKNR
FT                   IPNFRFSLFAKITTITYFALFAFGTIVILLLEANHAFQGASWHKALFYAMFQSTTTRSA
FT                   GLETIDITHFSDATNILMGLLMFIGSSPSSVGGGIRTTTFAILILFIINFRNDTNSTTI
FT                   KVFNREIQPSDIQKTFTVFGVATILTSVAIILTSAFEGTKLSFLQVFFEIMSAFGTCGL
FT                   SLGASGDGNDFTKVILMLLMFIGRVGLISFIIMIGGRKDPVMYHYPKEKIQIG"
FT   CDS_pept        633695..634159
FT                   /transl_table=11
FT                   /locus_tag="SCA_0627"
FT                   /product="putative transcriptional regulator"
FT                   /function="predicted transcriptional regulator"
FT                   /note="(P71047) Hypothetical UPF0074 protein ywgB
FT                   precursor,InterPro: Protein of unknown function UPF0074"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0627"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9DQA4"
FT                   /inference="similar to AA sequence:UniProtKB:P71047"
FT                   /protein_id="CAL27539.1"
FT                   /translation="MFKCNYKSYIKKVTTINLEFNIAVHFLAFLTKHADERFSSRALSE
FT                   LICINPVQLRRVTSQLVEHQYVETIRGKYGGYQANESTATANLGDLFQIFTAHSTQGRL
FT                   YTGTKESDCEISQKIEDTMKVHHAKEQALLKQYYDDFTIQDILEETVTTI"
FT   CDS_pept        634189..635511
FT                   /transl_table=11
FT                   /locus_tag="SCA_0628"
FT                   /product="putative pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /function="Pyruvate/2-oxoglutarate dehydrogenase complex
FT                   dihydrolipoamide dehydrogenase (E3) component and related
FT                   enzymes"
FT                   /note="(P77212) Probable pyridine nucleotide-disulfide
FT                   oxidoreductase ykgC,InterPro: FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0628"
FT                   /db_xref="GOA:B9DIN9"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIN9"
FT                   /inference="similar to AA sequence:UniProtKB:P77212"
FT                   /protein_id="CAL27540.1"
FT                   /translation="MEQYDLAVIGFGKAGKTLAKFAASQGKRVAMIERDQKMYGGTCIN
FT                   VGCIPSKTLIHDGLEGDSFESAFDRKRQVVSALNQKNYHMLADEPSIDVIDAVAQFKSN
FT                   HEIVLLDHENQDLGELTADDILINTGATPVIPDIEGIETSEHLYDSAGIMDLPFKPKQL
FT                   VIVGAEYIALEFASLFAHLDVDVTVLANHDDILPKEDPEIVELVKEDLTAAGVNLVFNV
FT                   DTKRFEDIENGTIVYTNDGEYEADAVLLATGRQPNTQGLGLENTDIKVGERGEIVVNDH
FT                   LQTDVPNVYAAGDVVGGMQFTYISLDDFRIIKDQLFGNGERSTQNRGAVPYTVFIDPPL
FT                   SRVGMTGDEAREAGYSVYETKLPVNNIPRHKINNDGRGMLKAVMDEKTGLILGATLYST
FT                   GSEELINLVKLAIDQKIPYSVLGNNIYTHPTMAEAFNDLFK"
FT   CDS_pept        complement(635575..636204)
FT                   /transl_table=11
FT                   /gene="hisIE"
FT                   /locus_tag="SCA_0629"
FT                   /product="putative histidine biosynthesis bifunctional
FT                   protein HisIE"
FT                   /function="Phosphoribosyl-AMP cyclohydrolase"
FT                   /EC_number="3.5.4.19"
FT                   /note="(Q8NUI4) Histidine biosynthesis bifunctional protein
FT                   hisIE [Includes: Phosphoribosyl-AMP cyclohydrolase (EC
FT                   3.5.4.19) (PRA-CH); Phosphoribosyl-ATP pyrophosphatase (EC
FT                   3.6.1.31) (PRA-PH)],InterPro: Phosphoribosyl-ATP
FT                   pyrophosphohydrolase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0629"
FT                   /db_xref="GOA:B9DIP0"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR023019"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:B9DIP0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27541.1"
FT                   /translation="MALKPDFSKGLVPAILQDNQTKQVLMLGYMNEEAYELTLRDKVCW
FT                   FYSRSKGRLWKKGESSKNYQHVEDIRLDCDQDTILVMVTPDGPTCHTGNTSCFNTEVPF
FT                   FVDSLEQIVTSRVNSDDEKSYTQYLLKSGVEKITKKFGEEAFEVVIAAMKKDKAELTNE
FT                   TADVLYHLFVLLNACGVSISEVKAVLQSRHQKSGNFKGERKDIKKW"
FT   CDS_pept        complement(636195..636959)
FT                   /transl_table=11
FT                   /gene="hisF"
FT                   /locus_tag="SCA_0630"
FT                   /product="putative imidazoleglycerol-phosphate synthase
FT                   hisF"
FT                   /function="Imidazoleglycerol-phosphate synthase"
FT                   /EC_number="4.1.3.-"
FT                   /note="(Q99QW8) Imidazole glycerol phosphate synthase
FT                   subunit hisF (EC 4.1.3.-) (IGP synthase cyclase subunit)
FT                   (IGP synthase subunit hisF) (ImGP synthase subunit hisF)
FT                   (IGPS subunit hisF),InterPro: Histidine biosynthesis
FT                   protein HisF"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0630"
FT                   /db_xref="GOA:B9DIP1"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DIP1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27542.1"
FT                   /translation="MIKKRIIPCLDVKDGRVVKGVQFKGLRDIGDPVALAAYYNAELAD
FT                   ELVFLDISRTENGHQMMLDIIEETASKLFIPLTIGGGISSTDDISTLLKHGADKVSLNS
FT                   SALRNPSLVKEASEKFGSQCICIAVDAKWEDERNDWFCYTHGGKQPTDIRVLDWVRQVE
FT                   YLGAGELLVTSMDYDGVKQGFDHQLLNQINTVVSIPVIASGGGGNAQHFVDLFQQTNVS
FT                   AGLAASIFHDKETTIGAVKTYLKDKGVDVRWH"
FT   CDS_pept        complement(636956..637660)
FT                   /transl_table=11
FT                   /gene="hisA"
FT                   /locus_tag="SCA_0631"
FT                   /product="putative phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase"
FT                   /function="Phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribonucleotide (ProFAR) isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /note="(Q8CQ93)
FT                   1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylidene
FT                   amino] imidazole-4-carboxamide isomerase (EC 5.3.1.16)
FT                   (Phosphoribosylformimino-5-aminoimidazole carboxamide
FT                   ribotide isomerase),InterPro: Histidine biosynthesis
FT                   protein"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0631"
FT                   /db_xref="GOA:B9DIP2"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DIP2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27543.1"
FT                   /translation="MIEVWPAIDLIDSTSVRLTEGDYETKEAMSRTAEEAIEFYSRYNC
FT                   VTRIHVIDLIAAKQQTPLETNYIEQLVGLTQLPFEVGGGIRTLETIETYFDKGIQNVII
FT                   GTKGIQDPEWLKTVAEKYPGRIYISVDAYIDEIKVNGWLEDTGLNLFDYVQQIDSAPLG
FT                   GIIYTDISKDGKLEGPNFELTAKLAASTKLPVIASGGIRSKEDLERLEKAGVAVAIVGK
FT                   AANTQSFWEGLS"
FT   CDS_pept        complement(637653..638234)
FT                   /transl_table=11
FT                   /gene="hisH"
FT                   /locus_tag="SCA_0632"
FT                   /product="putative amidotransferase HisH"
FT                   /function="Glutamine amidotransferase"
FT                   /EC_number="2.4.2.-"
FT                   /note="(Q8CTV0) Imidazole glycerol phosphate synthase
FT                   subunit hisH (EC 2.4.2.-) (IGP synthase glutamine
FT                   amidotransferase subunit) (IGP synthase subunit hisH) (ImGP
FT                   synthase subunit hisH) (IGPS subunit hisH),InterPro:
FT                   Glutamine amidotransferase class-I"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0632"
FT                   /db_xref="GOA:B9DQ97"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B9DQ97"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27544.1"
FT                   /translation="MIAIVDYGVGNIKNVERAIHHLSYETALTNDPEVIRSSSHIVLPG
FT                   VGHFKDAMQALKNSGLDKLLIELQNDKPFIGICLGMQLMFNHSAEGDTDGLGMINGEVV
FT                   PIKTDYPVPHLGWNNLESKHPLLNQDVYFIHSFYVQTDAPIIAAADYGIPITTIVQSGN
FT                   KIGIQFHPEKSGDYGLEILNQALKGGFIHD"
FT   CDS_pept        complement(638231..638812)
FT                   /transl_table=11
FT                   /gene="hisB"
FT                   /locus_tag="SCA_0633"
FT                   /product="putative imidazoleglycerol-phosphate dehydratase"
FT                   /function="Imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /note="(Q99QW5) Imidazoleglycerol-phosphate dehydratase (EC
FT                   4.2.1.19) (IGPD),InterPro: Imidazoleglycerol-phosphate
FT                   dehydratase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0633"
FT                   /db_xref="GOA:B9DQ86"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DQ86"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27545.1"
FT                   /translation="MSYRKQRETKETAIDIRMDLNDNQASSINTGVGFLDHMLTLFSFH
FT                   SGINLQINVQGDTEVDDHHTTEDIGIVLGQLLLEAIKDKQSFTRYGAFYIPMDETLARV
FT                   VTDISGRPYLSFNAEFSKEKVGTFDTELVEEFFRGLVINARLTTHIDLIRGGNTHHEIE
FT                   AIFKAFARSLKIALSDDGSKGVPSSKGVIE"
FT   CDS_pept        complement(638790..639794)
FT                   /transl_table=11
FT                   /gene="hisC"
FT                   /locus_tag="SCA_0634"
FT                   /product="putative histidinol-phosphate transaminase"
FT                   /function="Histidinol-phosphate/aromatic aminotransferase
FT                   and cobyric acid decarboxylase"
FT                   /EC_number="2.6.1.9"
FT                   /note="(Q8R5Q4) Histidinol-phosphate aminotransferase (EC
FT                   2.6.1.9) (Imidazole acetol-phosphate
FT                   transaminase),InterPro: Aminotransferase class I and II"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0634"
FT                   /db_xref="GOA:B9DQ87"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B9DQ87"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27546.1"
FT                   /translation="MININQNESPIPALTQEEILKIVGSSDFKVYPEGQYNDFLQAYAD
FT                   YYNLNVNQVLAANGSDEWIQKCMLTLPKGPVLALNPDFVMYTEFAQQTDRPIEYVESDE
FT                   NFRFSLDTILSRIEEVQPAFFIMSVPHNPTGVQYPTEFLLAISDKLKSIGSYFVLDEAY
FT                   IEFGKTIDIPLQSHLIIMKTLSKAFALAGLRIGIVISTPETIQQLNRLAHPYPMSTLSL
FT                   RLAEALFKDQKRVKQLIAEQRFLCRKLQDIFNQYVADKITIIPSQANFVFTYGKHAREL
FT                   GEYVKAHGFLPRIYKEPLLSEAVRYSIATEQELDQLEAIVKEWSDQFELQKTT"
FT   CDS_pept        complement(639791..641050)
FT                   /transl_table=11
FT                   /gene="hisD"
FT                   /locus_tag="SCA_0635"
FT                   /product="putative histidinol dehydrogenase"
FT                   /function="Histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /note="(Q99QW3) Histidinol dehydrogenase (EC 1.1.1.23)
FT                   (HDH),InterPro: Histidinol dehydrogenase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0635"
FT                   /db_xref="GOA:B9DQ88"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:B9DQ88"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27547.1"
FT                   /translation="MLSKKEFYHHFETASALNQKLINNVQNIIENVRVHQDEALFQYNQ
FT                   QFDNVELSTLEISQTDIDNSLDKISSELRDALKESYENIKSFQERIKHENVIGKNTSLI
FT                   YNPLESVGIYVPGGKAAYPSTVLMTATLAEAAGVENIIVVTPPQPEGVAPSILAACKIA
FT                   GVNRVFQVGGAQSIAALAFGTETIPKVDKIVGPGNQFVATAKQLLYGQVGIDQIAGPSE
FT                   IMIIADETSEPEFIVQDILAQAEHDENARTFLLSTSKVLLEKVEALLPEAINKAPRKAI
FT                   IEPSIQNFHYAILTKDNEENIEIANFVAPEHLSIQSSNPEQYIHKIKYAGAMFLGPYAP
FT                   EALGDYNAGPSHVLPTNQTSRFTNGLTVNDFLTSHSVISYNKSTFNQLAEGAMEIAHTE
FT                   GLYQHEESVRVRVNKVVQEE"
FT   CDS_pept        complement(641040..641657)
FT                   /transl_table=11
FT                   /gene="hisG"
FT                   /locus_tag="SCA_0636"
FT                   /product="putative ATP phosphoribosyltransferase HisG"
FT                   /function="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /note="(Q99QW2) ATP phosphoribosyltransferase (EC 2.4.2.17)
FT                   (ATP-PRTase) (ATP-PRT),InterPro: ATP
FT                   phosphoribosyltransferase"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0636"
FT                   /db_xref="GOA:B9DQ89"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR024893"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DQ89"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27548.1"
FT                   /translation="MLTVALSKGRLLKDFIKFLERNNNHVWADAIIHRERKLQITADSI
FT                   KFILVKGSDVPTYVEEGIADIGITGSDILKERPNRNINNYIDLPFGECHFSVAAKPNVT
FT                   NIQRVATTYVKTTRDYFNQKGTDISIIQLSGSVELAAVVDMVDAIVDIVQTGTTLKSNG
FT                   LEEREQIGEINARLITNKHSFFSKSKAIENFIQQLGVSIHAQ"
FT   CDS_pept        complement(641670..642500)
FT                   /transl_table=11
FT                   /gene="hisZ"
FT                   /locus_tag="SCA_0637"
FT                   /product="putative ATP phosphoribosyltransferase regulatory
FT                   subunit"
FT                   /EC_number="2.4.2.17"
FT                   /note="(Q99QW1) ATP phosphoribosyltransferase regulatory
FT                   subunit"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0637"
FT                   /db_xref="GOA:B9DQ90"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:B9DQ90"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27549.1"
FT                   /translation="MDYIEYQDKVLERKNLEFKFLNYFKNHHYTVIDLHFIERLNWQQL
FT                   TQDDLESMSTRSIWKNGQNFFALRNDWTDQLQHYARTFDLNFKRAVYAGPIANNEHIST
FT                   NLGIEVFNPSYEDMLTSFQYMLKFIKEEMQQPVDFAVIGHYQLLNLLLSESEQTPEILQ
FT                   LINERNISELSKKLSEIHPLVNLLKQPTHLQLDYIPSLIPNDHPTYLSLLRWSEELKRV
FT                   GIESIHLDITTMPPKSYYIGSFMQIFKNDQSEPIMSGGHYDGEIEGFGFGIKLD"
FT   CDS_pept        complement(642676..643491)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0638"
FT                   /product="putative hydrolase of alpha/beta fold family"
FT                   /function="predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily)"
FT                   /note="(P22862) Arylesterase (EC 3.1.1.2) (Aryl-ester
FT                   hydrolase),InterPro: Alpha/beta hydrolase fold"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0638"
FT                   /db_xref="GOA:B9DQ91"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9DQ91"
FT                   /inference="similar to AA sequence:UniProtKB:P22862"
FT                   /protein_id="CAL27550.1"
FT                   /translation="MKHRIQVSDEVALNVDDFGSGQPLVFLHGWPANNTMFEYQADFVV
FT                   ENGYRYVGIDHRGFGLSDRAADGYDYDTIADDIQKVVDELNLKDYIVVGFSVGGALALK
FT                   YGVKHNNDNLKKMVLLGPAGPSFVQRDGYPYGLKAEDVTALIDSINDDQPKAIGDFGEN
FT                   SFFNSDVEVSEEYKDYFNNMTLTSSLIGTVKLAESLRDEDLREEIKSLDLPVYGIHGTA
FT                   DHVCPIEFSEYLEKEAPDYTLSKVEGAGHALFFEKKDEVNRLLLEALKK"
FT   CDS_pept        643690..643941
FT                   /transl_table=11
FT                   /locus_tag="SCA_0639"
FT                   /product="truncated transcriptional regulator"
FT                   /function="Transcriptional regulator"
FT                   /note="Similarity to N-terminal part of transcriptional
FT                   regulator [Staphylococcus saprophyticus subsp.
FT                   saprophyticus ATCC 15305] (YP_300184)."
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0639"
FT                   /db_xref="GOA:B9DQ92"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B9DQ92"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27551.1"
FT                   /translation="MQKEDLRVIKTKMNIENAFLNLFYQKEIEQISVKEITTIAQIARK
FT                   TFYLHYLDKYDLLEKIFIKRLEELREICRNLKVENLKI"
FT   CDS_pept        644330..644683
FT                   /transl_table=11
FT                   /locus_tag="SCA_0640"
FT                   /product="truncated Fic protein family protein (fragment
FT                   1)"
FT                   /note="similar to amino-terminal part of hypothetical
FT                   protein CdifQ_02000652 [Clostridium difficile QCD-32g58]
FT                   ZP_01232326"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0640"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:B9DQ93"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27552.1"
FT                   /translation="MKLTGKQLFWLKKSNIDIYNKFKTEFLFHSNKLEGSKFSKSEIMK
FT                   LIADSEVTGPHELKDVIETANSIVVFDFMVETHNEKLTERLLKEFHSILFKNTLNTFAD
FT                   KLAGIYIDLYHLD"
FT   CDS_pept        644716..645051
FT                   /transl_table=11
FT                   /locus_tag="SCA_0641"
FT                   /product="truncated Fic protein family protein (fragment
FT                   2)"
FT                   /function="uncharacterized conserved protein"
FT                   /note="similar to carboxy-terminal part of hypothetical
FT                   protein CdifQ_02000652 [Clostridium difficile QCD-32g58]
FT                   ZP_01232326"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0641"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:B9DQ94"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAL27553.1"
FT                   /translation="MIHFDMEMLMEEYKKTKMDINKIAEFHSKFEKIHPFHDGNGRIGR
FT                   FIILKQCLDNDIELIVVNSEYEKEYKEALYIDQTGYGIDALVNIFGKFQRIFDKEVEIY
FT                   WDNKETN"
FT   tRNA            complement(645735..645823)
FT                   /gene="tRNA-Ser (GCT)"
FT                   /locus_tag="SCA_t0011"
FT                   /product="transfer RNA-Ser (GCT)"
FT                   /anticodon="(pos:645786..645788,aa:Ser)"
FT                   /note="tRNA-Sca_0011"
FT                   /inference="nucleotide motif:tRNAscan"
FT   tRNA            complement(645825..645899)
FT                   /gene="tRNA-Asn (GTT)"
FT                   /locus_tag="SCA_t0012"
FT                   /product="transfer RNA-Asn (GTT)"
FT                   /anticodon="(pos:645865..645867,aa:Asn)"
FT                   /note="tRNA-Sca_0012"
FT                   /inference="nucleotide motif:tRNAscan"
FT   CDS_pept        complement(646055..646627)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0642"
FT                   /product="putative ComK family protein"
FT                   /function="Genetic competence transcription factor"
FT                   /note="(P40396) Competence transcription factor (CTF)
FT                   (Competence protein K)"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0642"
FT                   /db_xref="GOA:B9DQ95"
FT                   /db_xref="InterPro:IPR010461"
FT                   /db_xref="UniProtKB/TrEMBL:B9DQ95"
FT                   /inference="similar to AA sequence:UniProtKB:P40396"
FT                   /protein_id="CAL27554.1"
FT                   /translation="MEEHYIFKSNDIAIIPIVKENGHYPVTKILTYEKEPRIFNISPRR
FT                   VLESSCKFYGSKFSILRSDTIRITDIKSKPPILLSPIISIILFSTQSISSTSNIWINIE
FT                   YVKDIKSIGSKETRINFIDGQFITAPVTTRTVNHQYKNAIYYEHLLKKRVKTIKWNIEQ
FT                   PIDYSKPALDVYETLCTYLIINQSKNS"
FT   CDS_pept        646840..647058
FT                   /transl_table=11
FT                   /locus_tag="SCA_0643"
FT                   /product="conserved hypothetical protein"
FT                   /note="(O31594) Hypothetical protein yhzC"
FT                   /note="Hypothetical protein"
FT                   /note="Sca_0643"
FT                   /db_xref="InterPro:IPR014957"
FT                   /db_xref="InterPro:IPR027393"
FT                   /db_xref="UniProtKB/TrEMBL:B9DQ96"
FT                   /inference="similar to AA sequence:UniProtKB:O31594"
FT                   /protein_id="CAL27555.1"
FT                   /translation="MNHNINVKNGTLQAFVANVNDLGVELVIDQALRNVRKEKLTELID
FT                   QALVNKDEEAFNRYTEEYNQLEDVLIG"
FT   CDS_pept        complement(647138..648124)
FT                   /transl_table=11
FT                   /locus_tag="SCA_0644"
FT                   /product="putative lipoate-protein ligase"
FT                   /function="Lipoate-protein ligase A"
FT                   /EC_number="6.-.-.-"
FT                   /note="(P47512) Probable lipoate-protein ligase A (EC
FT                   6.3.2.-),InterPro: Lipoyltransferase and lipoate-protein
FT                   ligase"
FT                   /note="Hypothetical protein"
FT                   /not