(data stored in ACNUC7421 zone)

EMBL: AM406670

ID   AM406670; SV 1; circular; genomic DNA; STD; PRO; 4376040 BP.
XX
AC   AM406670;
XX
PR   Project:PRJNA13217;
XX
DT   19-DEC-2006 (Rel. 90, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 4)
XX
DE   Azoarcus sp. BH72, complete genome
XX
KW   complete genome.
XX
OS   Azoarcus sp. BH72
OC   Bacteria; Proteobacteria; Betaproteobacteria; Rhodocyclales; Zoogloeaceae;
OC   Azoarcus.
XX
RN   [1]
RP   1-4376040
RA   Reinhold-Hurek B., Krause A.;
RT   ;
RL   Submitted (19-SEP-2006) to the INSDC.
RL   Reinhold-Hurek B., Krause A., University of Bremen, General Microbiology,
RL   PO. Box 33 04 40, D-28334 Bremen, GERMANY.
XX
RN   [2]
RP   1-4376040
RX   DOI; 10.1038/nbt1243.
RX   PUBMED; 17057704.
RA   Krause A., Ramakumar A., Bartels D., Battistoni F., Bekel T., Boch J.,
RA   Boehm M., Friedrich F., Hurek T., Krause L., Linke B., McHardy A.,
RA   Sarkar A., Schneiker S., Syed A.A., Thauer R., Vorhoelter F.-J.,
RA   Weidner S., Puehler A., Reinhold-Hurek B., Kaiser O., Goesmann A.;
RT   "Complete genome of the mutualistic, N2-fixing grass endophyte Azoarcus sp.
RT   strain BH72";
RL   Nat. Biotechnol. 24(11):1385-1391(2006).
XX
DR   MD5; f76cfb0fe33414a9a34379369a3e4101.
DR   BioSample; SAMEA3138261.
DR   EnsemblGenomes-Gn; EBG00001052579.
DR   EnsemblGenomes-Gn; EBG00001052580.
DR   EnsemblGenomes-Gn; EBG00001052581.
DR   EnsemblGenomes-Gn; EBG00001052582.
DR   EnsemblGenomes-Gn; EBG00001052583.
DR   EnsemblGenomes-Gn; EBG00001052584.
DR   EnsemblGenomes-Gn; EBG00001052585.
DR   EnsemblGenomes-Gn; EBG00001052586.
DR   EnsemblGenomes-Gn; EBG00001052587.
DR   EnsemblGenomes-Gn; EBG00001052588.
DR   EnsemblGenomes-Gn; EBG00001052589.
DR   EnsemblGenomes-Gn; EBG00001052590.
DR   EnsemblGenomes-Gn; EBG00001052591.
DR   EnsemblGenomes-Gn; EBG00001052592.
DR   EnsemblGenomes-Gn; EBG00001052593.
DR   EnsemblGenomes-Gn; EBG00001052594.
DR   EnsemblGenomes-Gn; EBG00001052595.
DR   EnsemblGenomes-Gn; EBG00001052596.
DR   EnsemblGenomes-Gn; EBG00001052597.
DR   EnsemblGenomes-Gn; EBG00001052598.
DR   EnsemblGenomes-Gn; EBG00001052599.
DR   EnsemblGenomes-Gn; EBG00001052600.
DR   EnsemblGenomes-Gn; EBG00001052601.
DR   EnsemblGenomes-Gn; EBG00001052602.
DR   EnsemblGenomes-Gn; EBG00001052603.
DR   EnsemblGenomes-Gn; EBG00001052604.
DR   EnsemblGenomes-Gn; EBG00001052605.
DR   EnsemblGenomes-Gn; EBG00001052606.
DR   EnsemblGenomes-Gn; EBG00001052608.
DR   EnsemblGenomes-Gn; EBG00001052609.
DR   EnsemblGenomes-Gn; EBG00001052610.
DR   EnsemblGenomes-Gn; EBG00001052611.
DR   EnsemblGenomes-Gn; EBG00001052612.
DR   EnsemblGenomes-Gn; EBG00001052613.
DR   EnsemblGenomes-Gn; EBG00001052614.
DR   EnsemblGenomes-Gn; EBG00001052615.
DR   EnsemblGenomes-Gn; EBG00001052616.
DR   EnsemblGenomes-Gn; EBG00001052619.
DR   EnsemblGenomes-Gn; EBG00001052622.
DR   EnsemblGenomes-Gn; EBG00001052625.
DR   EnsemblGenomes-Gn; EBG00001052626.
DR   EnsemblGenomes-Gn; EBG00001052630.
DR   EnsemblGenomes-Gn; EBG00001052632.
DR   EnsemblGenomes-Gn; EBG00001052634.
DR   EnsemblGenomes-Gn; EBG00001052638.
DR   EnsemblGenomes-Gn; EBG00001052642.
DR   EnsemblGenomes-Gn; EBG00001052644.
DR   EnsemblGenomes-Gn; EBG00001052646.
DR   EnsemblGenomes-Gn; EBG00001052648.
DR   EnsemblGenomes-Gn; EBG00001052650.
DR   EnsemblGenomes-Gn; EBG00001052654.
DR   EnsemblGenomes-Gn; EBG00001052656.
DR   EnsemblGenomes-Gn; EBG00001052657.
DR   EnsemblGenomes-Gn; EBG00001052659.
DR   EnsemblGenomes-Gn; EBG00001052662.
DR   EnsemblGenomes-Gn; EBG00001052664.
DR   EnsemblGenomes-Gn; EBG00001052666.
DR   EnsemblGenomes-Gn; EBG00001052668.
DR   EnsemblGenomes-Gn; EBG00001052670.
DR   EnsemblGenomes-Gn; EBG00001052673.
DR   EnsemblGenomes-Gn; EBG00001052677.
DR   EnsemblGenomes-Gn; EBG00001052679.
DR   EnsemblGenomes-Gn; EBG00001052680.
DR   EnsemblGenomes-Gn; EBG00001052682.
DR   EnsemblGenomes-Gn; EBG00001052685.
DR   EnsemblGenomes-Gn; EBG00001052687.
DR   EnsemblGenomes-Gn; EBG00001052689.
DR   EnsemblGenomes-Gn; EBG00001052691.
DR   EnsemblGenomes-Gn; EBG00001052694.
DR   EnsemblGenomes-Gn; EBG00001052697.
DR   EnsemblGenomes-Gn; EBG00001052701.
DR   EnsemblGenomes-Gn; EBG00001052705.
DR   EnsemblGenomes-Gn; EBG00001052708.
DR   EnsemblGenomes-Gn; EBG00001052712.
DR   EnsemblGenomes-Gn; EBG00001052713.
DR   EnsemblGenomes-Gn; EBG00001052716.
DR   EnsemblGenomes-Gn; EBG00001052718.
DR   EnsemblGenomes-Gn; EBG00001052722.
DR   EnsemblGenomes-Gn; EBG00001052726.
DR   EnsemblGenomes-Gn; azo_rrn1.
DR   EnsemblGenomes-Gn; azo_rrn2.
DR   EnsemblGenomes-Gn; azo_rrn3.
DR   EnsemblGenomes-Gn; azo_rrn4.
DR   EnsemblGenomes-Gn; azo_rrn5.
DR   EnsemblGenomes-Gn; azo_rrn6.
DR   EnsemblGenomes-Gn; azo_rrn7.
DR   EnsemblGenomes-Gn; azo_rrn8.
DR   EnsemblGenomes-Gn; azo_tRNA_0001.
DR   EnsemblGenomes-Gn; azo_tRNA_0002.
DR   EnsemblGenomes-Gn; azo_tRNA_0003.
DR   EnsemblGenomes-Gn; azo_tRNA_0004.
DR   EnsemblGenomes-Gn; azo_tRNA_0005.
DR   EnsemblGenomes-Gn; azo_tRNA_0006.
DR   EnsemblGenomes-Gn; azo_tRNA_0007.
DR   EnsemblGenomes-Gn; azo_tRNA_0008.
DR   EnsemblGenomes-Gn; azo_tRNA_0009.
DR   EnsemblGenomes-Gn; azo_tRNA_0010.
DR   EnsemblGenomes-Gn; azo_tRNA_0011.
DR   EnsemblGenomes-Gn; azo_tRNA_0012.
DR   EnsemblGenomes-Gn; azo_tRNA_0013.
DR   EnsemblGenomes-Gn; azo_tRNA_0014.
DR   EnsemblGenomes-Gn; azo_tRNA_0015.
DR   EnsemblGenomes-Gn; azo_tRNA_0016.
DR   EnsemblGenomes-Gn; azo_tRNA_0017.
DR   EnsemblGenomes-Gn; azo_tRNA_0018.
DR   EnsemblGenomes-Gn; azo_tRNA_0019.
DR   EnsemblGenomes-Gn; azo_tRNA_0020.
DR   EnsemblGenomes-Gn; azo_tRNA_0021.
DR   EnsemblGenomes-Gn; azo_tRNA_0022.
DR   EnsemblGenomes-Gn; azo_tRNA_0023.
DR   EnsemblGenomes-Gn; azo_tRNA_0024.
DR   EnsemblGenomes-Gn; azo_tRNA_0025.
DR   EnsemblGenomes-Gn; azo_tRNA_0026.
DR   EnsemblGenomes-Gn; azo_tRNA_0027.
DR   EnsemblGenomes-Gn; azo_tRNA_0028.
DR   EnsemblGenomes-Gn; azo_tRNA_0029.
DR   EnsemblGenomes-Gn; azo_tRNA_0030.
DR   EnsemblGenomes-Gn; azo_tRNA_0031.
DR   EnsemblGenomes-Gn; azo_tRNA_0032.
DR   EnsemblGenomes-Gn; azo_tRNA_0033.
DR   EnsemblGenomes-Gn; azo_tRNA_0034.
DR   EnsemblGenomes-Gn; azo_tRNA_0035.
DR   EnsemblGenomes-Gn; azo_tRNA_0036.
DR   EnsemblGenomes-Gn; azo_tRNA_0037.
DR   EnsemblGenomes-Gn; azo_tRNA_0038.
DR   EnsemblGenomes-Gn; azo_tRNA_0039.
DR   EnsemblGenomes-Gn; azo_tRNA_0040.
DR   EnsemblGenomes-Gn; azo_tRNA_0041.
DR   EnsemblGenomes-Gn; azo_tRNA_0042.
DR   EnsemblGenomes-Gn; azo_tRNA_0043.
DR   EnsemblGenomes-Gn; azo_tRNA_0044.
DR   EnsemblGenomes-Gn; azo_tRNA_0045.
DR   EnsemblGenomes-Gn; azo_tRNA_0046.
DR   EnsemblGenomes-Gn; azo_tRNA_0047.
DR   EnsemblGenomes-Gn; azo_tRNA_0048.
DR   EnsemblGenomes-Gn; azo_tRNA_0049.
DR   EnsemblGenomes-Gn; azo_tRNA_0050.
DR   EnsemblGenomes-Gn; azo_tRNA_0051.
DR   EnsemblGenomes-Gn; azo_tRNA_0052.
DR   EnsemblGenomes-Gn; azo_tRNA_0053.
DR   EnsemblGenomes-Gn; azo_tRNA_0054.
DR   EnsemblGenomes-Gn; azo_tRNA_0055.
DR   EnsemblGenomes-Gn; azo_tRNA_0056.
DR   EnsemblGenomes-Tr; EBT00001655261.
DR   EnsemblGenomes-Tr; EBT00001655262.
DR   EnsemblGenomes-Tr; EBT00001655263.
DR   EnsemblGenomes-Tr; EBT00001655264.
DR   EnsemblGenomes-Tr; EBT00001655265.
DR   EnsemblGenomes-Tr; EBT00001655266.
DR   EnsemblGenomes-Tr; EBT00001655267.
DR   EnsemblGenomes-Tr; EBT00001655268.
DR   EnsemblGenomes-Tr; EBT00001655269.
DR   EnsemblGenomes-Tr; EBT00001655270.
DR   EnsemblGenomes-Tr; EBT00001655271.
DR   EnsemblGenomes-Tr; EBT00001655272.
DR   EnsemblGenomes-Tr; EBT00001655273.
DR   EnsemblGenomes-Tr; EBT00001655274.
DR   EnsemblGenomes-Tr; EBT00001655275.
DR   EnsemblGenomes-Tr; EBT00001655276.
DR   EnsemblGenomes-Tr; EBT00001655277.
DR   EnsemblGenomes-Tr; EBT00001655278.
DR   EnsemblGenomes-Tr; EBT00001655279.
DR   EnsemblGenomes-Tr; EBT00001655280.
DR   EnsemblGenomes-Tr; EBT00001655281.
DR   EnsemblGenomes-Tr; EBT00001655282.
DR   EnsemblGenomes-Tr; EBT00001655283.
DR   EnsemblGenomes-Tr; EBT00001655284.
DR   EnsemblGenomes-Tr; EBT00001655285.
DR   EnsemblGenomes-Tr; EBT00001655286.
DR   EnsemblGenomes-Tr; EBT00001655287.
DR   EnsemblGenomes-Tr; EBT00001655288.
DR   EnsemblGenomes-Tr; EBT00001655289.
DR   EnsemblGenomes-Tr; EBT00001655290.
DR   EnsemblGenomes-Tr; EBT00001655291.
DR   EnsemblGenomes-Tr; EBT00001655292.
DR   EnsemblGenomes-Tr; EBT00001655293.
DR   EnsemblGenomes-Tr; EBT00001655294.
DR   EnsemblGenomes-Tr; EBT00001655295.
DR   EnsemblGenomes-Tr; EBT00001655296.
DR   EnsemblGenomes-Tr; EBT00001655297.
DR   EnsemblGenomes-Tr; EBT00001655298.
DR   EnsemblGenomes-Tr; EBT00001655299.
DR   EnsemblGenomes-Tr; EBT00001655300.
DR   EnsemblGenomes-Tr; EBT00001655301.
DR   EnsemblGenomes-Tr; EBT00001655302.
DR   EnsemblGenomes-Tr; EBT00001655303.
DR   EnsemblGenomes-Tr; EBT00001655304.
DR   EnsemblGenomes-Tr; EBT00001655305.
DR   EnsemblGenomes-Tr; EBT00001655306.
DR   EnsemblGenomes-Tr; EBT00001655307.
DR   EnsemblGenomes-Tr; EBT00001655308.
DR   EnsemblGenomes-Tr; EBT00001655309.
DR   EnsemblGenomes-Tr; EBT00001655310.
DR   EnsemblGenomes-Tr; EBT00001655311.
DR   EnsemblGenomes-Tr; EBT00001655312.
DR   EnsemblGenomes-Tr; EBT00001655313.
DR   EnsemblGenomes-Tr; EBT00001655314.
DR   EnsemblGenomes-Tr; EBT00001655315.
DR   EnsemblGenomes-Tr; EBT00001655316.
DR   EnsemblGenomes-Tr; EBT00001655317.
DR   EnsemblGenomes-Tr; EBT00001655318.
DR   EnsemblGenomes-Tr; EBT00001655319.
DR   EnsemblGenomes-Tr; EBT00001655320.
DR   EnsemblGenomes-Tr; EBT00001655321.
DR   EnsemblGenomes-Tr; EBT00001655322.
DR   EnsemblGenomes-Tr; EBT00001655323.
DR   EnsemblGenomes-Tr; EBT00001655324.
DR   EnsemblGenomes-Tr; EBT00001655325.
DR   EnsemblGenomes-Tr; EBT00001655326.
DR   EnsemblGenomes-Tr; EBT00001655327.
DR   EnsemblGenomes-Tr; EBT00001655328.
DR   EnsemblGenomes-Tr; EBT00001655329.
DR   EnsemblGenomes-Tr; EBT00001655330.
DR   EnsemblGenomes-Tr; EBT00001655331.
DR   EnsemblGenomes-Tr; EBT00001655332.
DR   EnsemblGenomes-Tr; EBT00001655333.
DR   EnsemblGenomes-Tr; EBT00001655334.
DR   EnsemblGenomes-Tr; EBT00001655335.
DR   EnsemblGenomes-Tr; EBT00001655336.
DR   EnsemblGenomes-Tr; EBT00001655337.
DR   EnsemblGenomes-Tr; EBT00001655338.
DR   EnsemblGenomes-Tr; EBT00001655339.
DR   EnsemblGenomes-Tr; azo_rrn1-1.
DR   EnsemblGenomes-Tr; azo_rrn2-1.
DR   EnsemblGenomes-Tr; azo_rrn3-1.
DR   EnsemblGenomes-Tr; azo_rrn4-1.
DR   EnsemblGenomes-Tr; azo_rrn5-1.
DR   EnsemblGenomes-Tr; azo_rrn6-1.
DR   EnsemblGenomes-Tr; azo_rrn7-1.
DR   EnsemblGenomes-Tr; azo_rrn8-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0001-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0002-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0003-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0004-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0005-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0006-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0007-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0008-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0009-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0010-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0011-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0012-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0013-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0014-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0015-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0016-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0017-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0018-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0019-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0020-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0021-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0022-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0023-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0024-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0025-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0026-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0027-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0028-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0029-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0030-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0031-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0032-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0033-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0034-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0035-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0036-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0037-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0038-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0039-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0040-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0041-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0042-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0043-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0044-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0045-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0046-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0047-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0048-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0049-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0050-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0051-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0052-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0053-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0054-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0055-1.
DR   EnsemblGenomes-Tr; azo_tRNA_0056-1.
DR   EuropePMC; PMC4029289; 24883196.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02194; HPnc0260.
DR   RFAM; RF02278; Betaproteobacteria_toxic_sRNA.
DR   SILVA-LSU; AM406670.
DR   SILVA-SSU; AM406670.
DR   StrainInfo; 49226; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4376040
FT                   /organism="Azoarcus sp. BH72"
FT                   /strain="BH72"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:62928"
FT   CDS_pept        1..1443
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="azo0001"
FT                   /product="chromosomal replication initiator protein"
FT                   /function="ATPase involved in DNA replication initiation"
FT                   /note="Chromosomal replication initiator protein dnaA.
FT                   Plays an important role in the initiation and regulation of
FT                   chromosomal replication. Binds to the origin of
FT                   replication; it binds specifically double-stranded DNA at a
FT                   9 bp consensus (dnaA box): 5-TTATC(C/A)A(C/A)A-3. DnaA
FT                   binds to ATP and to acidic phospholipids (By similarity).
FT                   InterPro: Bacterial chromosomal replication initiator
FT                   protein DnaA"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92619"
FT                   /db_xref="GOA:A1K1B4"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1K1B4"
FT                   /protein_id="CAL92619.1"
FT                   /translation="MNQDFWPFCLARLEQELPQQQFNTWIKTLQAAESDADGAVALTLT
FT                   APNRFVLQWVRERYMRRIGELGEEFHGQPIQLELQLPVAGAKSAPVAPARVRPAGANGG
FT                   AAANSPMAPPVSEAAPPQIIVRPSEPEPVSANELAYDKTRLNADFTFDTLVTGRANDLA
FT                   RAAAMQVAQNPGTSYNPLFVYGGVGLGKTHLVHAIGNAVYRHNPRMVIRYVHVEDYYAD
FT                   VVRAYQQKSFDAFKRYYRSLDMLIIDDIQFFNNKNRTQEEFFHAFNALTEAKKQIVITC
FT                   DTYPKDIQGLEDRLISRFDWGLTVQIEPPELEMRVAILQKKAEALRVSVDDDVAFLIAK
FT                   NLRSNVRELEGALNKVVAYARFHGRGISLEVAKEALKDLLHAHNRQLSIEHIQKTVADY
FT                   YKIKVADMHSKKRTRVIARPRQVAMWLAKELTPMSLPAIGEAFGGRDHTTVLHACRTIT
FT                   ELRLGDHQLNHDVHVLTQVLRG"
FT   CDS_pept        1502..2611
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="azo0002"
FT                   /product="DNA-directed DNA polymerase"
FT                   /function="DNA polymerase sliding clamp subunit (PCNA
FT                   homolog)"
FT                   /EC_number="2.7.7.7"
FT                   /note="DNA polymerase III beta chain (EC 2.7.7.7). DNA
FT                   polymerase III is a complex multichain enzyme responsible
FT                   for most of the replicative synthesis in bacteria. This DNA
FT                   polymerase also exhibits 3 to 5 exonuclease activity. The
FT                   beta chain is required for initiation of replication once
FT                   it is clamped onto DNA It slides freely (bidirectional and
FT                   ATP- independent) along duplex DNA (By similarity).
FT                   InterPro: DNA polymerase III beta chain dnan: DNA
FT                   polymerase III beta subunit"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92620"
FT                   /db_xref="GOA:A1K1B5"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1B5"
FT                   /protein_id="CAL92620.1"
FT                   /translation="MLLLNTTRDALLAPLQSVAGIVEKRHTLPILSNVLIEKRGDQLTL
FT                   LATDIEIQIRTTTAGHIGGEDSSITVGARKLQDILRALSDSVDIVLTLEDKRLTVKAGK
FT                   SRFQLQTLPAADYPRMNLPDGDAVRFSVPQRAFKRQLAQVSYSMAQQDIRYYLNGLLLI
FT                   ADGSELRMVATDGHRLAYAAGDLAVPVQARTEAILPRKTVLELARQLADTDDPLEIILA
FT                   GNQAVFRFGSIELVTKLIDGKFPDYERVIPQNHPRMVTFDRQPLLASLQRAAILTNEKF
FT                   RGVRMVLGEGALKIISSNTEQEEAQEELEIDYHDTPLDIGFNVTYLLDVLNNLSSEQVE
FT                   WRFNDGNSSALVTLPGNDKFKYVVMPMRI"
FT   CDS_pept        2821..5310
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="azo0003"
FT                   /product="DNA topoisomerase (ATP-hydrolysing)"
FT                   /function="DNA gyrase (topoisomerase II) B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="DNA gyrase subunit B (EC 5.99.1.3). DNA gyrase
FT                   negatively supercoils closed circular double- stranded DNA
FT                   in an ATP-dependent manner and also catalyzes the
FT                   interconversion of other topological isomers of
FT                   double-stranded DNA rings including catenanes and knotted
FT                   rings. InterPro: DNA topoisomerase II recJ:
FT                   single-stranded-DNA-specific ex"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92621"
FT                   /db_xref="GOA:A1K1B6"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1B6"
FT                   /protein_id="CAL92621.1"
FT                   /translation="MSEPQNTPAPSGNDYDESSIQQLEGLEAVRKRPGMYIGDTSDGTG
FT                   LHHMVFEVVDNAIDEALAGHCDDIVITIHADNSISVTDNGRGIPVGVKMDDKHEPKRSA
FT                   AEIVMCVLHAGGKFNQNSYKVSGGLHGVGVSCVNALSKWLRLTIRRDGKKHFMEFHRGA
FT                   PQDRVIDVVDGVEVSPLKVLGETSKRGTEVHYLADEEIFGTVEYHYEILAKRLRELSFL
FT                   NNGVKIRLVDQRTGKEEDFAFAGGVRGFVEYINRTKAVLHPSVFYAAGTTRIPTGAGEA
FT                   ELSVEVAMQWNDSYAEQVLCYTNNIPQADGGTHLTGLRTAMTRVINKYIEENEIAKKAK
FT                   VDITGDDMREGLACVLSVKMPDPKFASQTKMKLVSSEARPAVEEVVAAKLTDFLLENPI
FT                   DAKTICNKIVEAARARDAARKAREMTRRKGVLDGVGLPGKLADCQEKDPALSELYLVEG
FT                   DSAGGSAKQGRDRKFQAILPLKGKILNVEKARFDKLLQSQEIATLITALGTSIGKDDYK
FT                   PEKLRYHRIILMTDADVDGAHIRTLLLTFFYRQMPELVERGHIYIAQPPLYKIKHGKTE
FT                   LYIKDDHELNGHLLKLALDGAVLVPREGADAITDDALGGLARSYLLAEAVIKRLASYID
FT                   PEVLQAMLAHDLEISLDDEAAARASADRIQPHLPEGLRIYAEYHEETEAWRLTIERLHH
FT                   GNLKFGWVETAFLVSGDYRSIRTAAASIAGLIGPGAEIRRGEKRQTVTRFADAITWLLA
FT                   EVERGLSKQRYKGLGEMNPEQLWETTMDPAVRRLLRVQIDDAIAADEIFTTLMGDNVEP
FT                   RRAFIESNALYAQNIDV"
FT   CDS_pept        5505..7346
FT                   /transl_table=11
FT                   /gene="hsdM"
FT                   /locus_tag="azo0004"
FT                   /product="Site-specific DNA-methyltransferase
FT                   (adenine-specific)"
FT                   /function="Type I restriction-modification system
FT                   methyltransferase subunit"
FT                   /EC_number="2.1.1.72"
FT                   /note="METHYLATION OF SPECIFIC ADENINE RESIDUES; REQUIRED
FT                   FOR BOTH RESTRICTION AND MODIFICATION ACTIVITIES (BY
FT                   SIMILARITY), TREMBL:Q7VCN2 (55% identity). InterPro
FT                   (IPR002296): N6 adenine-specific DNA methyltransferase,N12
FT                   class. InterPro (IPR003356): N-6 DNA methylase. InterPro
FT                   (IPR003665): Type I restriction-modification system M
FT                   subunit. Pfam (PF02384): N-6 DNA Methylase. Pfam (PF02506):
FT                   Type I restriction modification system, M protein."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92622"
FT                   /db_xref="GOA:A1K1B7"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1B7"
FT                   /protein_id="CAL92622.1"
FT                   /translation="MNHQALSSFIWSVADLLRGDYKQSEYGKVILPFTVLRRLDCVLEA
FT                   TKPSVLAELEAKTKAGLNPDPFLLRKSGQSFYNTAPLDLVKLLGDQDHIRQNLYTYVQA
FT                   FSPAARDIFERFDFFTQVERLAKANLLYLVTEKFANIDLHPEAVDNTSMGLVFEELIRK
FT                   FAEISNETAGEHFTPREVIRLMVNLLFIEDDDVLTPGNAVVRTIYDPTAGTGGMLSVAG
FT                   EFLLEHNPQARLTMFGQELNDESYAICKADMLIKGQDVANIVAGNTLSDDGHGARKFDY
FT                   MLSNPPFGVEWKKVEKAVRQEHEQKGFDGRFGPGLPRVSDGSMLFLMHLLSKMRPAQDG
FT                   GSRFGIVLNGSPLFTGGAGSGESEIRRYVLENDLVEAIVGLPTDMFYNTGIATYVWIIS
FT                   NRKKADRKGQVQLIDASSFWQKMRKSLGSKRKEMSDAHIATVTRLFGSFTEAEYITVFD
FT                   AAGQQLGEPQLVTNTDTPPKAPEGGRLKRVPIARIFRNQDFGYTTITVERPLKDEAGKP
FT                   VLGSKGARRGKPQADSALRDTENVPLGEDISAYFKREVLPHAPDAWIDETKSKVGYEIP
FT                   FNRHFYVFEPPRSLHAIDEELKTVSANIMKMLEGLAE"
FT   CDS_pept        7453..8910
FT                   /transl_table=11
FT                   /gene="mloB"
FT                   /locus_tag="azo0005"
FT                   /product="putative restriction modification gene"
FT                   /function="predicted transcriptional regulator containing
FT                   an HTH domain and an uncharacterized domain shared with the
FT                   mammalian protein Schlafen"
FT                   /note="Putative restriction modification gene,"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92623"
FT                   /db_xref="GOA:A1K1B8"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1B8"
FT                   /protein_id="CAL92623.1"
FT                   /translation="MTKHWLKQAQAWLKASREPVPHEINELDWKADISGNKERLIEHLI
FT                   AFANHPNGGYLVFGIQDSGAELIGVSQSQVEEIVSRLTNLGRDAIEPPLLLDHAVVEQD
FT                   GTPLLFVHVREQPNKPAHRRGKTIEDAWVRSGGTTRAASRNEIGSLMLHSQAPSWETLR
FT                   ASALLPAEEVLARLDLPSIAKLLQRPLPEDPAELMHWLADEGMVVADGNGYYITNLGGI
FT                   AAARELDQFESLARKRIRVIHYRGTNKIDTIDELLGHKGYAVGFEGLIGYLKRLLPHSE
FT                   VIQQSLREQVTVYPEIALRELIANALIHQDFSVTGAGPTIEIFDDRISFTNPGTLLPSK
FT                   RLDRLIGTTPESRNERLASKFRLYRICEERGTGFQKIVAAVEIFGLPPVSFKPLENAFQ
FT                   VTLHAPRKFADMSQAERIEACYQHAVLQYFSSQTLTNTTLRTRFKVSERQRNQITNLIA
FT                   DAVEAGRIKRKDETSGNKFAEYLPYWA"
FT   CDS_pept        8919..9038
FT                   /transl_table=11
FT                   /locus_tag="azo0006"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="Hypothetical protein predicted by Glimmer/Critica.
FT                   No homology to the data bank no domains predicted no signal
FT                   peptide no TMHS"
FT                   /db_xref="EnsemblGenomes-Gn:azo0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92624"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1B9"
FT                   /protein_id="CAL92624.1"
FT                   /translation="MMKHPDRRAHPRPCSLHAIDEELKTVSANIMKMLEGLAE"
FT   CDS_pept        9035..10384
FT                   /transl_table=11
FT                   /gene="hsdS"
FT                   /locus_tag="azo0007"
FT                   /product="Type I site-specific deoxyribonuclease"
FT                   /function="Restriction endonuclease S subunits"
FT                   /EC_number="3.1.21.3"
FT                   /note="S subunit, DNA SPECIFICITY SUBUNIT REQUIRED FOR
FT                   RESTRICTION AND MODIFICATION, TREMBL:Q9AAH7 (31% identity);
FT                   TREMBL:Q8PIJ8 (28% identity). Pfam (PF01420): Type I
FT                   restriction modification DNA specificity domain. InterPro
FT                   (IPR000055): Restriction modification system DNA
FT                   specificity domain."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92625"
FT                   /db_xref="GOA:A1K1C0"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1C0"
FT                   /protein_id="CAL92625.1"
FT                   /translation="MSLPRYAEYKDSGVALLATIPAHWEPSPLKRVVALVESGVSVNAV
FT                   DEPAGPDAVGVLKTSCVYSGNFSHGENKAVVAEELDRVACPVRAGTLIVSRMNTPALVG
FT                   AAGLVEENADNLFLPDRLWQVHFSGAVPKFAHYWTASPSYRAQVQMACAGTSASMQNLS
FT                   QDEFLRFVMPLPPKDEQTAIAAFLDRETAKIDALIAKQEKLIALLAEKRQATISHAVTR
FT                   GLNPDAPMKDSGVAWLGEVPAHWSVSALSYLASLETGATPDRGEPSYWNGTIPWLKTGE
FT                   INWAPICEAEEFITDAGLENSAAKIAKPGTLLMAMYGQGVTRGRVALLEIEATYNQACA
FT                   AINFRSRIIPEFGRYFFMAAYDHVRDAGNETSQMNLSAGLISKIRLPVPPLDEQQAVVR
FT                   FLDVETAKLDVLGAESERGITLLKERRSALIAAAVTGQIDVRNTAERAST"
FT   CDS_pept        10381..11256
FT                   /transl_table=11
FT                   /locus_tag="azo0008"
FT                   /product="conserved hypothetical protein"
FT                   /note="Conserved hypothetical protein. Homology to RB11641
FT                   of R.baltica of 42% (tremble:Q7TTG8). No domains predicted.
FT                   No TMHs. No signal peptide."
FT                   /db_xref="EnsemblGenomes-Gn:azo0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92626"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR025579"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1C1"
FT                   /protein_id="CAL92626.1"
FT                   /translation="MKTQAKTIQIFLPGGDPQGIRVAEITTRIVQLIEVPRALLPEFLK
FT                   MPESNQVALYFLVGEAEDGAERRVYIGQTGDLPARLATHNKEKAFWTRALVLISRTNSL
FT                   TQTHALFLEWYSLQRAKQAARYDLSENRNGGSKPHTPAPLEADCLEIFETGQTLLATLG
FT                   YPVFEPVAKPSEAGNPAEFFHCKRSGIDGKGLYTPEGFVVLKGSLGHQADAPSITGTWA
FT                   GHLRQKLRDSGVVQVKGGNIEFLKDHLFASPSTAAVALLGRTANGWVEWKSAEGKTLDA
FT                   LKRQGVGGTD"
FT   CDS_pept        11468..11794
FT                   /transl_table=11
FT                   /locus_tag="azo0009"
FT                   /product="transcriptional regulatory protein"
FT                   /function="uncharacterized conserved protein"
FT                   /note="Transcriptional regulatory protein, 35% identity to
FT                   TrEMBL;Q89JK0. Has Prosite, PS01117; HTH_MARR_1 domain; The
FT                   marR-type HTH domain is a DNA-binding, winged
FT                   helix-turn-helix (wHTH)domain of about 135 amino acids
FT                   present in transcription regulators of the marR/slyA
FT                   family,involved in the development of antibiotic
FT                   resistance"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92627"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1C2"
FT                   /protein_id="CAL92627.1"
FT                   /translation="MRFFLKGVAETASKGRDVFGQILHLRTEAEQQILSLGKRAPTARQ
FT                   GLNLLYRNPVVSAGDLATGLAISTPTANALIKDFERLGILRESTGRQKDRVFVFDRYLR
FT                   LFVS"
FT   CDS_pept        11948..15061
FT                   /transl_table=11
FT                   /gene="hsdR"
FT                   /locus_tag="azo0010"
FT                   /product="Type I site-specific deoxyribonuclease"
FT                   /function="Type I site-specific restriction-modification
FT                   system R (restriction) subunit and related helicases"
FT                   /EC_number="3.1.21.3"
FT                   /note="SUBUNIT R IS REQUIRED FOR BOTH NUCLEASE AND ATPASE
FT                   ACTIVITIES BUT NOT FOR MODIFICATION (BY
FT                   SIMILARITY),TREMBL:Q9AAH5 (64% identity); TREMBL:Q8FUH0
FT                   (40% identity). InterPro (IPR001410): DEAD/DEAH box
FT                   helicase TIGRFAM (TIGR00348): Type I site-specific
FT                   deoxyribonuclease, HsdR family."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92628"
FT                   /db_xref="GOA:A1K1C3"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1C3"
FT                   /protein_id="CAL92628.1"
FT                   /translation="MNLHQEHHFEAEICAHLAANGWLYAEGDAALFDRATGLFLPDLLA
FT                   WVEETQPESFQRLTKTHGAALPQVLAERVRKSLNLPERGTLDVLRRGVEMLGLKEPLML
FT                   AQFKPALAINPATQAKYAANRLRVVRQVCHSPNNPKEELDLVLFLNGIAVATAELKSNF
FT                   TQSVQDAVDQYRYDRHPQPKGGVLEPLLGFPGGALVHFAVSQSEVMMSTRLAGKDSFFL
FT                   PFNRGNAGGAGNAPNPQGFATAYLWEEVWARESWLDILHRYIIGKRDDKKQLKSLIFPR
FT                   YHQLDATRKLVADVLQNGTGERYLIQHSAGSGKTNSIAWTAHFLADLHDAQHNKLFDSV
FT                   LVVSDRNVLDAQLQEAIFDFERTTGVVATITNEHGSKSAQLGQALKDGKKIIVCTIQTF
FT                   PFALQAVQELAATEGKRFAVIADEAHSSQTGEAAAKLKQLLSAEEWAELQDGGEVDTEA
FT                   LLAAQMEAKAGATKGLTYIAFTATPKGKTLELFGRRGEDGLPQPFHVYSMRQAIEEGFI
FT                   LDVLKNYTSYKLAFKLAHDGQEYDEKEVERSTAMKGIMQWVRLHPYNIAQKVQVVVEHY
FT                   RENVQPLLQGRAKAMVVVGSRREAVRWQKAIRAYIAKQNYPLGVLVAFSGEVNDAESFP
FT                   EPVTETNAQLNPGLKGRDIREVFKEPDFHLLLVANKFQTGFDQPLLCGMYVDKMLGGIQ
FT                   AVQTLSRLNRAHPGKDTTYILDFVNEPAEVLKAFKTYYETAELEATTDPHAVYDLRAKL
FT                   DATGYYDEFEVERVAKVDLDPNGTQKQLDAAIAPVADRLLKRYKAAQQDKAAAAEHGDE
FT                   NAAKTAKDTLEALVLFKNDMGAYVRLYAFLGQIFDYGNTDIEKRFLFYKRLIPLLEFGR
FT                   ERDTVDLSKVVLTHHHLKNRGKQTLSLNSDGNYKLPPMDAVGSGSVQDKQQAYLVEIIE
FT                   KVNGLFEGELSDDDQLVYVNGVLKGKLLENETLVKQAVNNTKEQFGNSPDLSQALLHAI
FT                   MDALEAHQSMSTQALGSERVRDGLKDVLLGPAQLYESLRARANQPARM"
FT   CDS_pept        complement(15231..16085)
FT                   /transl_table=11
FT                   /locus_tag="azo0011"
FT                   /product="Short-chain dehydrogenase family protein"
FT                   /function="Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /note="The short-chain dehydrogenases/reductases family is
FT                   a very large family of enzymes, most of which are known to
FT                   be NAD- or NADP-dependent oxidoreductases, similarity to
FT                   SWISSPROT:P37959 (35% identity); TREMBL:Q930L8 (44%
FT                   identity); TREMBL:Q9I3W5 (41% identity). Pfam (PF00106):
FT                   Short chain dehydrogenase. InterPro (IPR002198):
FT                   Short-chain dehydrogenase/reductase (SDR). InterPro
FT                   (IPR002347): Glucose/ribitol dehydrogenase."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92629"
FT                   /db_xref="GOA:A1K1C4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1C4"
FT                   /protein_id="CAL92629.1"
FT                   /translation="MNTKQTTFKRVWFITGASRGLGALIARAALDDGNAVVATGRNADV
FT                   VRERLGDHPGLLALALDVTVETQAQAAIEAAVRRFGRIDVLINNAGHGLLGAVEESSDA
FT                   DTRRMYETNVFGLLNVTRAVLPVMRAQRAGHLINFSSIGGYSSAVGFGVYCSTKFAVEG
FT                   LSEALHAELAPLGVAVTVVEPGYFRTDFLDSTSLVVAPQVIPDYAATAGQVREGAKQLN
FT                   HKQPGDPVRLAQAMLRLVDAERPPLRLALGSDTLRAIAEKNARVDAETAEWAELSRSTD
FT                   FPG"
FT   CDS_pept        16203..17150
FT                   /transl_table=11
FT                   /gene="bdhR"
FT                   /locus_tag="azo0012"
FT                   /product="transcriptional regulator, LysR family"
FT                   /function="Transcriptional regulator"
FT                   /note="Transcriptional regulator, LysR family,"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92630"
FT                   /db_xref="GOA:A1K1C5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1C5"
FT                   /protein_id="CAL92630.1"
FT                   /translation="MNEVRALSLFVRAATLGSLRRAAIDQGISPQAASHAVMQLEKSLG
FT                   VRLFHRTTRRLSLTEDGRMLFERSSPALDVLFAAIEDVRKARDDVGGLLTLSAPTALGR
FT                   TMLWPLIVEFARLHPEIRVDAHFDDHLTDLVAERADVGFRGGASPAEGTIARRLLPIQL
FT                   IVCAAPDYLARHGAPRTIDDLVHHRCSGYRQANTGKLAPWEFLVDGETIRRDVPAVLSC
FT                   NDVDAEVDAVLSGSAIGQLASFSAVTHIRAGRLVPLLVRHVAERDGIHLYYRRRSEQPR
FT                   RTRAFIDFIVGRLADHPDFHLGREELERLVAEQS"
FT   CDS_pept        17232..17876
FT                   /transl_table=11
FT                   /gene="rluA1"
FT                   /locus_tag="azo0013"
FT                   /product="pseudouridine synthase A"
FT                   /function="Pseudouridylate synthases 23S RNA-specific"
FT                   /EC_number="4.2.1.70"
FT                   /note="Ribosomal large subunit pseudouridine synthase A (EC
FT                   4.2.1.70) (Pseudouridylate synthase) (Uracil hydrolyase).
FT                   Responsible for synthesis of pseudouridine from uracil-746
FT                   in 23S ribosomal RNA and from uracil-32 in the anticodon
FT                   stem and loop of transfer RNAs ."
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92631"
FT                   /db_xref="GOA:A1K1C6"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1C6"
FT                   /protein_id="CAL92631.1"
FT                   /translation="MPQLTPTLLYTDDSLIVADKPAGLLSVPAGGEDRQDCLAHRVQAQ
FT                   FDDALIVHRLDAATSGLVLLARGMEMLRRMSLGFEQRVVGKRYVALVHGRVAQDDGEIA
FT                   LPLAADPLNRPRQIVDAARGRPALTRYRVLERSGAGDAAVSRLELKPMTGRSHQLRVHL
FT                   MAIGHPIVGDPLYAPPESAAAHPRMFLHAAGIAFMHPDRRVPMQFDSPVPF"
FT   CDS_pept        complement(18010..18567)
FT                   /transl_table=11
FT                   /gene="nifF1"
FT                   /locus_tag="azo0014"
FT                   /product="probable flavodoxin"
FT                   /function="Flavodoxins"
FT                   /note="Probable flavodoxin. Homology to nifF of A.
FT                   vinelandii of 49% (pir|FXAVEP) Flavodoxins are
FT                   electron-transfer proteins that function in various
FT                   electron transport systems. Flavodoxins bind one FMN
FT                   molecule,which serves as a redox-active prosthetic group
FT                   and are functionally interchangeable with ferredoxins.
FT                   InterPro: Flavodoxin (IPR001226) Pfam: Flavodoxin no signal
FT                   peptide no TMHs"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92632"
FT                   /db_xref="GOA:A1K1C7"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010086"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1C7"
FT                   /protein_id="CAL92632.1"
FT                   /translation="MNKIGMFFGTETGTTRLIAKKIHKKLGDEIADKPVNVNRIEPADM
FT                   LKYDVLILGTPSYGIEEVPGLSAGCLEPNWAEFLVKMDKPDFSGKRIALFGLGAQERYS
FT                   ERFCSSLMRIYEIFKGYGAEIVGDDWPTDGYTFQQSAAVKDGRFVGLVIDERTQGMYTN
FT                   ERIDTWVAKVKPLLLEKLGVEA"
FT   CDS_pept        complement(18971..19501)
FT                   /transl_table=11
FT                   /locus_tag="azo0015"
FT                   /product="conserved hypothetical protein"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /note="Conserved hypothetical protein, 50% identitcal(67%
FT                   similarity) to TrEMBL;Q888U7.TrEMBL;Q747X0(33% identity).
FT                   Has PF03473, MOSC domain;IPR005302; The MOSC (MOCO
FT                   sulfurase C-terminal) domain is a superfamily of
FT                   beta-strand-rich domains identified in the molybdenum
FT                   cofactor sulfurase and several other proteins from both
FT                   prokaryotes and eukaryotes. These MOSC domains contain an
FT                   absolutely conserved cysteine and occur either as
FT                   stand-alone forms such as P32157, or fused to other domains
FT                   such as NifS-like catalytic domain in Molybdenum cofactor
FT                   sulfurase. The MOSC domain is predicted to be a
FT                   sulfur-carrier domain that receives sulfur abstracted by
FT                   the pyridoxal phosphate-dependent NifS-like enzymes, on its
FT                   conserved cysteine,and delivers it for the formation of
FT                   diverse sulfur-metal clusters."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92633"
FT                   /db_xref="GOA:A1K1C8"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1C8"
FT                   /protein_id="CAL92633.1"
FT                   /translation="MDADDDLRALTARFPRAGRLDAVLLRSARRGEVVRAEAAEAIAGR
FT                   GLAGDHRTSGGRGGGKRQVTLIQAEHLPVIAALVGRDALDPALLRRNLVVSGINLHAAR
FT                   SLFDDQALVLRIGEVVLEVTGPCDPCSRMEAVLGPGAYNAMRGHGGMTARVLVGGPLRV
FT                   GDVVRCSLEAAAS"
FT   CDS_pept        complement(19505..19855)
FT                   /transl_table=11
FT                   /locus_tag="azo0016"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="Conserved hypothetical membrane protein. Homology to
FT                   Daro03002995 of Dechloromonas aromatica of 34%
FT                   (ZP_00348572.1). No signal peptide present. TMHMM reporting
FT                   one transmembrane helix. No domains predicted."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92634"
FT                   /db_xref="GOA:A1K1C9"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1C9"
FT                   /protein_id="CAL92634.1"
FT                   /translation="MQFDRDPAAGPGSLPPPSARPAGVLKKALAIVVAAALFVLAMMAS
FT                   VVLFAVVLTAGAVLWGYLWWKTRAARKAMAERMAEAQAWQQRQQQGSSGAGGLVLEGEV
FT                   IREIRPGDEDRR"
FT   CDS_pept        complement(19882..20355)
FT                   /transl_table=11
FT                   /locus_tag="azo0017"
FT                   /product="Hypothetical protein"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /note="Hypothetical protein, 28% identity to TrEMBL;Q8E8U4.
FT                   Has PF07049, Protein of unknown function (DUF1332);
FT                   IPR010755;This family consists of several hypothetical
FT                   bacterial proteins of around 165 residues in length. The
FT                   function of this family is unknown."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92635"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1D0"
FT                   /protein_id="CAL92635.1"
FT                   /translation="MLRTLKELFASFAAPDDSAPATEHRLQLAAAVLLVEVMRADAVSG
FT                   AVEREAVIDALRNKFGLGEDEVARLLELAEATADDAPDFYAFTSQLNKGFSPEQKLRMV
FT                   EHLWQVAFADGALSHFENQLMLKLGDLLYIPRGEFVAAKQRARATAPSLDPSP"
FT   CDS_pept        complement(20480..21061)
FT                   /transl_table=11
FT                   /locus_tag="azo0018"
FT                   /product="ThiJ/PfpI family protein"
FT                   /function="Putative intracellular protease/amidase"
FT                   /note="InterPro (IPR002818): ThiJ/PfpI. Pfam (PF01965):
FT                   DJ-1/PfpI family."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92636"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1D1"
FT                   /protein_id="CAL92636.1"
FT                   /translation="MAAKKILMITGDYTEDYETMVPFQALLMAGHTVHAACPGKKAGEQ
FT                   VRTAIHDFEGDQTYSEKPGHNFTLNAEFDSLRAEDYDALVIPGGRAPEYLRLNPKVIAA
FT                   VQHFFAADKPVAAICHGAQVLAAAGVLKGRTCSAYPACAPEVKAAGGEYAEIPVDKARV
FT                   DGKLVTAPAWPAHPDWLAKFLQVLGTTITP"
FT   CDS_pept        21263..22402
FT                   /transl_table=11
FT                   /locus_tag="azo0019"
FT                   /product="extracellular ligand binding protein"
FT                   /function="ABC-type branched-chain amino acid transport
FT                   systems periplasmic component"
FT                   /note="This family includes extracellular ligand binding
FT                   domains of a wide range of receptors and it also includes
FT                   the bacterial amino acid binding proteins of known
FT                   structure. Similar to trembl|Q8XVG7 (38%). Pfam (PF01094):
FT                   Receptor family ligand binding region SignalP reporting
FT                   Signal peptide."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92637"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1D2"
FT                   /protein_id="CAL92637.1"
FT                   /translation="MIGRRSFALALCCALVAALSFHTLPARAEPGAITVGQSIVLSGPQ
FT                   AANGLLYARGIKLQLDAVNAAGGVNGKPVRLVTLDDGYDPERCKENTRRLIAQDKVVAL
FT                   FGYTGTGPTAACAPLAEAARVPLLAPLTGAPELREDTARYLFHTRASYLDEMRKMVEYL
FT                   TTVGVRDIAVVYQDDGFGRSGLRSAETVLAAYQLKPAAVGSIPPQTYDPAQAVAALGSR
FT                   APGAVILATAGQASVNFIRAYLKSGKRTQFFGLSVVSSNQLLKELGQDTDGVVISQVVP
FT                   SPWSQSTQVVRDFQRDAAAAKDVEVNHTTLEGYIAARVLVEGLRRAGPDPSPEKLTQAL
FT                   ENLHSLNLGGYEVGFGPGRRAGSRYVDLSLVRGSGRYVQ"
FT   CDS_pept        complement(22404..23309)
FT                   /transl_table=11
FT                   /locus_tag="azo0020"
FT                   /product="probable transcriptional regulator, LysR family"
FT                   /function="Transcriptional regulator"
FT                   /note="Probable transcriptional regulator, LysR family,"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92638"
FT                   /db_xref="GOA:A1K1D3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1D3"
FT                   /protein_id="CAL92638.1"
FT                   /translation="MIEPSLLPALAAFECVARHASFSRAAAELGLSASALSQSVSTLER
FT                   RLGLRLLARTTRHVGLTEEGARLLDGVRRGLAELGGALASVDHAREQPSGTVRITLPRL
FT                   AFALYFAPHVDEFARRYPEVGIEFSLDDKLADLVADRFDIGLRMADNIAGDMVAIPLGR
FT                   PQRLIVAAAPAYFARHPVPLQPADLAEHDCIRFRFPTSGRNARWLFRQDDGDFELEVRG
FT                   RFTVNDADAELDLLRRGLGISQVVESMVQDDLAAGRLREVLAEYAWPMPVAHLYFPSRA
FT                   QMPARLRVFIDFFRAMNAPA"
FT   CDS_pept        23470..23928
FT                   /transl_table=11
FT                   /gene="iorA"
FT                   /locus_tag="azo0021"
FT                   /product="probable isoquinoline 1-oxidoreductase, alpha
FT                   subunit"
FT                   /function="Aerobic-type carbon monoxide dehydrogenase small
FT                   subunit CoxS/CutS homologs"
FT                   /EC_number="1.3.99.16"
FT                   /note="Probable isoquinoline 1-oxidoreductase, alpha
FT                   subunit Homology to iroA of B. diminuta of 58%
FT                   (sprot|IORA_BREDI). InterPro: [2Fe-2S] binding domain
FT                   (IPR002888); Ferredoxin (IPR001041) Pfam: 2FE-2S
FT                   iron-sulfur cluster binding domein, [2Fe-2S] binding domain
FT                   no signal peptide no TMHs"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92639"
FT                   /db_xref="GOA:A1K1D4"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1D4"
FT                   /protein_id="CAL92639.1"
FT                   /translation="MTRFTLNGKPVETALPDDTPLLWVLRDGLDQTGTKFGCGMGLCGA
FT                   CTVHLDGQPIRSCSTPLSAAAGKKITTIEGVGKARVGAAVQKAWQKLDVVQCGYCQSGQ
FT                   IMSATALLTANPKPTDADIDAAMGGNICRCATYVRIRAAIHEAAKSLA"
FT   CDS_pept        23939..26152
FT                   /transl_table=11
FT                   /gene="iorB"
FT                   /locus_tag="azo0022"
FT                   /product="putative isoquinoline 1-oxidoreductase, beta
FT                   subunit"
FT                   /function="Aerobic-type carbon monoxide dehydrogenase large
FT                   subunit CoxL/CutL homologs"
FT                   /note="Putative isoquinoline 1-oxidoreductase, beta subunit
FT                   Homology to iorB of B. diminuta of 34% (sprot|IORB_BREDI).
FT                   InterPro: Aldehyde oxidase and xanthine dehydrogenase C
FT                   terminus (IPR000674) Pfam: Aldehyde oxidase and xanthine
FT                   dehydrogenase signal peptide no TMHs"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92640"
FT                   /db_xref="GOA:A1K1D5"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012368"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1D5"
FT                   /protein_id="CAL92640.1"
FT                   /translation="MKMQITNVSRRDFLKAGAGLTLSVSLPGAVLAAAGGPGIAGSATA
FT                   AGDFTPNAFVRIGADSTVTVLSKHLEMGQGVYTGLTTLVAEELDADWAQVVVEGAPAEA
FT                   KRYNNLFWGPVQGTGGSTAIGNSFEQLRQAGAAARAMLVQAAAERWKVPAAEISVKNGV
FT                   VSHAKSGRKARFGELAEAAAALPVPQQVTLKDPKNFSLIGRHVPRKDSVAKTTGTAQFT
FT                   QDVKLPGMLVAVVAHPPRFGGKVRSVDDKAARAVPGVADVVTIPNGVAVLAGDYWTAKK
FT                   GRDALQVVWDESAAYHGSSDAILADYRKLAGTPGLVARKDGDGDGAAALAKATKVIEAE
FT                   YAFPFLAHAAMEPINCVMRLGPDSCEVWNGEQFQTVDQANLAAFFGLKPEQVTLHMLYA
FT                   GGSFGRRANPMSDYLLETAQIVKAIGGRAPVKLVWSREDDMRAGYYRPAFLHRLRATLG
FT                   ADGTPQAWEQRIVGQSIIKGSPFEGVMIKDGIDATSVEGAANLPYAIPNLQIELHTTND
FT                   AVKVPVQWWRSVGSTHTGHATEVFLDELATAAGADPVAYRMALLGSHPRHAGVLKLAAD
FT                   KAGWGKPLAAARDKGARRGRGVAVHESFHSYVAQVVEVTVAADGGFKVDRVVCAVDCGV
FT                   AVNPDVIRAQMEGGIGFALAAALTGVVTLKDGVVEQSNFHDYPVLRIGEMPKVEVHIVP
FT                   SAEKPTGVGEPGVPPLAPALANALHAATGKRIRSLPIAEQLKA"
FT   CDS_pept        26175..27197
FT                   /transl_table=11
FT                   /locus_tag="azo0023"
FT                   /product="conserved hypothetical protein"
FT                   /function="Xanthine and CO dehydrogenases maturation factor
FT                   XdhC/CoxF family"
FT                   /note="Conserved hypothetical protein (Xanthine
FT                   like-dehydrogenase accessory factor). Homology to Rsc1464
FT                   (hyp. protein) of R. solanacearum of 66% (CAD15165).
FT                   InterPro: DUF182 Pfam: uncharacterized BCR, COG1975 no
FT                   signal peptide no TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:azo0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92641"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1D6"
FT                   /protein_id="CAL92641.1"
FT                   /translation="MDSLDHDVLTRARDWLAAGRRVLLATVVRTWGSSPRPPGALLALR
FT                   DDGRAVGSVSGGCIEDDLIDRLHRDGLPATPQLVSYGVGAEEARRFGLPCGGTMELVLE
FT                   PLADPAPLDALLARLAAGELVERRLGMASGRATLAAAHPEQGLAYDGRTLTSVFGPRYR
FT                   LLLIGAGQLSESLARIALGLDFAVTVCDPREEYHEEWRVAGTTLTRDMPDDVVIAMRPD
FT                   ARTAVIALTHDPKLDDLALMEALRSPAFYVAALGSRRNNAARRERLREFDLSEAQVATL
FT                   RGPAGLYIGSRTPAEIAVSIAAELVAVKNGVTPERVLPVAEAKAALELAADTLSSCAAR
FT                   "
FT   CDS_pept        27194..27763
FT                   /transl_table=11
FT                   /locus_tag="azo0024"
FT                   /product="conserved hypothetical protein"
FT                   /function="uncharacterized MobA-related protein"
FT                   /note="Purine catabolism protein pucB. TREMBL:Q8XZ0: 40%
FT                   identity, 47% similarity Required for xanthine
FT                   dehydrogenase activity. Could be involved in formation of
FT                   the molybdenum cofactor required by xanthine dehydrogenase.
FT                   FUNCTION: Links a guanosine 5'-phosphate to molydopterin
FT                   (MPT) forming molybdopterin guanine dinucleotide (MGD) (By
FT                   similarity). PATHWAY: Molybdenum cofactor biosynthesis.
FT                   SUBCELLULAR LOCATION: Cytoplasmic (By similarity).
FT                   SIMILARITY: Belongs to the mobA family.
FT                   Pfam:UPF0007:Uncharacterized protein family UPF000 ispD:
FT                   4-diphosphocytidyl-2C-methyl-D-er Non-secretory protein
FT                   with signal peptide probability: 0 No TMH's (TMHMM
FT                   predicted)."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0024"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92642"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1D7"
FT                   /protein_id="CAL92642.1"
FT                   /translation="MMQGILLAAGYGRRFDPDGVQDKLLAPLADGRPVIWHAARALCAA
FT                   LPASIAVLRPRQRERELWLRDAGCEVVKSTAAETGMGAALAAAIAASANADGWVVALAD
FT                   MPWLPVEAVAAVAGAIDDPQRVAAAMHAGRRGHPVGFGAAWGAKLMTLTGDSGARELLR
FT                   ETEILLIDNADPGVLRDVDTPADLGR"
FT   CDS_pept        28052..28618
FT                   /transl_table=11
FT                   /locus_tag="azo0025"
FT                   /product="conserved hypothetical protein"
FT                   /function="Conserved protein/domain typically associated
FT                   with flavoprotein oxygenases DIM6/NTAB family"
FT                   /note="Hypothetical protein yddH. TREMBL:Q7NTI1:66%
FT                   identity, 76% similarity InterPro:IPR002563; Flavin_Reduct.
FT                   Pfam:PF01613; Flavin_Reduct; InterPro: Flavin
FT                   reductase-like domain Non-secretory protein with no signal
FT                   peptide. No transmembrane helices TIGR00357: PilB-related
FT                   protein"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92643"
FT                   /db_xref="GOA:A1K1D8"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1D8"
FT                   /protein_id="CAL92643.1"
FT                   /translation="MTPPHTLPVPLEKSYRLINHGPTVLVASAHGGRRNVMAAAWNMPL
FT                   DFAPPKVAVVIDKATYSRGLIEASGEFVLAVPTRAAAAQALATGSRSGRDEDKFAALGI
FT                   EAYSADKVGAPLPGGCIAWLECRVIPEPHIQQTYDLFLGEVVAARADARLFRDGHWHFD
FT                   EAGTRSIHYIAGGNFFATGDAFTVE"
FT   CDS_pept        complement(28631..29569)
FT                   /transl_table=11
FT                   /gene="acbB"
FT                   /locus_tag="azo0026"
FT                   /product="putative dTDP-glucose 4-6-dehydratase"
FT                   /function="dTDP-glucose 4-6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /note="dTDP-glucose 4,6-dehydratase, AcbB,probably involved
FT                   in the biosynthesis of the acarviose moiety of the
FT                   alpha-glucosidase inhibitor acarbose. Belongs to the sugar
FT                   epimerase family. dTDP-glucose dehydratase subfamily. 30%
FT                   dTDP_gluc_dehyt.IPR001509; Epimerase_Dh. Pfam:PF01370;
FT                   Epimerase; 1. TIGRFAMs:TIGR01181; dTDP_gluc_dehyt; 1."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92644"
FT                   /db_xref="GOA:A1K1D9"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1D9"
FT                   /protein_id="CAL92644.1"
FT                   /translation="MRVLVTGGAGFIGSHLCRRLLADGHEVLSADNYFTGSRRNIHDLL
FT                   GNPDFEALRHDITFPLYVEVDRIYNFACPASPVHYQYDPVQTTKTSVHGAINMLGLAKR
FT                   TGARVLQASTSEVYGDPEVHPQTEDYWGRVNPIGPRSCYDEGKRCAETLFFDYHRQHRV
FT                   EIKVVRIFNTYGPGMQPNDGRVISNFIVQALRGEDITLYGDGAQTRSFCHVSDLVDGVV
FT                   RMMDSPAGFTGPVNLGNPTEYRIDALAELILRLCGSRSRLVFRPLPEDDPCQRQPDITL
FT                   ARERLAWTPRVALEDGLRDTIDHFRRLLETQ"
FT   CDS_pept        29590..30477
FT                   /transl_table=11
FT                   /gene="exoU"
FT                   /locus_tag="azo0027"
FT                   /product="Glycosyltransferase"
FT                   /EC_number="2.4.1.-"
FT                   /note="Putative glycosyl transferase. Weak Homology with
FT                   hits spanning the entire length of protein. 24% identitcal
FT                   to TrEMBL;Q8F209.TrEMBL; Q89D69(33% identity) Has
FT                   PF00535,Glycosyl transferase:IPR001173;Diverse
FT                   family,transferring sugar from UDP-glucose,
FT                   UDP-N-acetyl-galactosamine, GDP-mannose or CDP-abequose, to
FT                   a range of substrates including cellulose, dolichol
FT                   phosphate and teichoic acids. The biosynthesis of
FT                   disaccharides,oligosaccharides and polysaccharides involves
FT                   the action of hundreds of different glycosyltransferases.
FT                   These are enzymes that catalyse the transfer of sugar
FT                   moieties from activated donor molecules to specific
FT                   acceptor molecules,forming glycosidic bonds."
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92645"
FT                   /db_xref="GOA:A1K1E0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR027791"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1E0"
FT                   /protein_id="CAL92645.1"
FT                   /translation="MQQIAFVTTSKGRLHHIRETLPRIVGQAPHEIIVVDYGCPDGTAA
FT                   WVETHYPDVKVLRVDDDPGFCLPRARNLGARLSSARWICFIDADIRIQPGWVEWMRQRL
FT                   VPGHFYRAAADAKGKRDGETFGTVICERAAFERIGGYDEAFRGWGGEDTDLYARLAAQP
FT                   GLREAGYPAHFVEPIPHDDGERTQFHEVKRKDTQGRINVAYIRIKQQLLAHHVDALSIE
FT                   VRRALMEQIKRQLGGNGDAAPRKTYAARVLTGQVLSRTGLPRSFVVDIARRRRFVLFGP
FT                   RRFVIRVRPEPVEG"
FT   CDS_pept        complement(30502..30732)
FT                   /transl_table=11
FT                   /locus_tag="azo0028"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="Conserved hypothetical membrane protein Homology to
FT                   cv0580 of C. violaceum of 41% (trembl|Q7P0I7(SRS)) no
FT                   domains predicted no signal peptide 2 TMHs"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92646"
FT                   /db_xref="GOA:A1K1E1"
FT                   /db_xref="InterPro:IPR021529"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1E1"
FT                   /protein_id="CAL92646.1"
FT                   /translation="MQIKPQHVQPVIMSGIMAFLMTAVITWLNLGFPPDFLSRWLHAFV
FT                   VAWPLAALAAFIAIPIAQRATRRIVAAFGTR"
FT   CDS_pept        30906..31676
FT                   /transl_table=11
FT                   /locus_tag="azo0029"
FT                   /product="conserved hypothetical membrane protein"
FT                   /function="Membrane protein TerC possibly involved in
FT                   tellurium resistance"
FT                   /note="Similar to a tellurium resistance protein TerC.
FT                   Belongs to the terC family. This family contains a number
FT                   of integral membrane proteins that also contains the TerC
FT                   protein. TerC has been implicated in resistance to
FT                   tellurium. Similar to a putative membrane protein TerC,80%
FT                   identity to TrEMBL; Q5P410 from Azoarcus sp EnN1. 50%
FT                   RNA_rec_mot.IPR005496; TerC. Pfam:PF03741; TerC; 1.
FT                   TIGR:SPTO2691. TMHelix:5."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92647"
FT                   /db_xref="GOA:A1K1E2"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1E2"
FT                   /protein_id="CAL92647.1"
FT                   /translation="MLEFLTDPQLLVAFLTLTMLELVLGIDNIIFISILVDKLPPERRT
FT                   FARRLGLFLAMFMRIGLLAALAWLAGLTKPLFELFGAGFSGRDLILICGGLFLVWKSTG
FT                   EIHQLLEGEEGEASSAVKATFGAVILQIIVIDLVFSLDSIITAIGMVNNLPVMIAAVVA
FT                   SVGLMMVASAPIGEFVSRHPTVKMLALSFLMVVGVVLIADGFGHHVPKGYIYSAMAFSV
FT                   VVEMLNIRLRKNAEKPVDLHEAYVPEQTPAPEKR"
FT   CDS_pept        complement(31735..32625)
FT                   /transl_table=11
FT                   /gene="gltR"
FT                   /locus_tag="azo0030"
FT                   /product="probable transcriptional regulator, LysR family"
FT                   /function="Transcriptional regulator"
FT                   /note="HTH-type transcriptional regulator gltR. POSITIVE
FT                   REGULATOR OF GLUTAMATE BIOSYNTHESIS (GLTAB GENES).
FT                   NEGATIVELY REGULATES ITS OWN EXPRESSION. Similar to
FT                   SWISSPROT: sprot|GLTR_BACSU (33% Bacillus subtilis,
FT                   HTH-type transcriptional regulator GltR) InterPro:
FT                   IPR000847 HTH_LysR. IPR009058 Winged helix DNA-binding.
FT                   Pfam: PF00126 Bacterial regulatory helix-turn-helix
FT                   protein,lysR family. HTH reporting nucleic acid binding
FT                   motif."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92648"
FT                   /db_xref="GOA:A1K1E3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1E3"
FT                   /protein_id="CAL92648.1"
FT                   /translation="MLSPTRFNPQLLRYFRAVVEQGSLSAASRQLNCVPSNVSARLRQL
FT                   EEQLGSVLLERNGPQFTLTAAGERLLPHARQLDALCSAAWNSVHLDTLQGRLRLGSMET
FT                   TAAMRLPDVLARFHRHAPRVEVELETGTSATLIERVLGHELDAALVAGPLEHPRLLANE
FT                   VWREELRLVVPPGEPAPAPGTEVSLIAFPEGCHYRARLFTHARDCGWRVRGQQSYASVE
FT                   AIIGCVGAGLGLGVLPASLLAAHPRGRQVASHPLPPSLAVSPTVLVRRRVAEPHPALDA
FT                   WVEVLLGGASGTQTQ"
FT   CDS_pept        32784..34019
FT                   /transl_table=11
FT                   /locus_tag="azo0031"
FT                   /product="putative permease member of the MFS transporters"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /note="Permease member of the Major Facilitator Superfamily
FT                   (MFS).MFS are single-polypeptide secondary carriers capable
FT                   only of transporting small solutes in response to
FT                   chemiosmotic ion gradients. 25% MFS.IPR005828;
FT                   Sub_transporter. Pfam:PF00083; sugar_tr; 1. TMHelix: 10."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92649"
FT                   /db_xref="GOA:A1K1E4"
FT                   /db_xref="InterPro:IPR010645"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1E4"
FT                   /protein_id="CAL92649.1"
FT                   /translation="MTAPPPSPPPSPPRLWIPLLAAALALVVVHGIGRFAYTPLLPLLV
FT                   GDGFMGLDTGAAVATWNYVGYLLGAMLAIRLHEPAQIRRILPLALLINAACTLAQGFTD
FT                   NATAFLVLRLINGISNGVVFVQAPALVLEWLARHGLASLSGLMYFGVGGGLLLSNALAN
FT                   LPAELLHGAARWWPMALAALPLALWSARQLAHLDRPQAGAPAPAAAPRATALLDRASLP
FT                   VFMAYAGAGLGYILPTTFLPVVAREQLPAGHWLQSGAWLILALCTLAAAWLWNRLGTRM
FT                   GDRNALVLNYVVQGIGVAGPLLWPGTVGILACALMVGSTFLGSVLLTQRLARALHPHQG
FT                   PRISAALITLYGFAQLTGPWMARMWLERGGSMSDTYWLGAGALVWATVWTLKTQQAPEH
FT                   AGAPKLQAVRGD"
FT   CDS_pept        complement(34326..34814)
FT                   /transl_table=11
FT                   /locus_tag="azo0032"
FT                   /product="conserved hypothetical protein"
FT                   /note="Conserved hypothetical protein. Homology to nfa21510
FT                   of Nocardia farcinica of 31% (trembl:Q5YXU4). No domains
FT                   predicted. No TMHs. No signal peptide.,"
FT                   /db_xref="EnsemblGenomes-Gn:azo0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92650"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR025979"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1E5"
FT                   /protein_id="CAL92650.1"
FT                   /translation="MSVMLCTAESQKTHGSAARDRITLPYPKFQKLDPIPWRPWVMDGV
FT                   QYKLLSVNSRTGGFTCMLKVLPGVEAPIHHHLGAIEVMVMEGDICYEDADIGGPGDYMF
FT                   EPAGDIHQPRTKAGCVLFCVFDGPIAGLAPDGSIAGIVDYKVMLEMAARDGVAEGVHR"
FT   CDS_pept        35113..35601
FT                   /transl_table=11
FT                   /locus_tag="azo0033"
FT                   /product="conserved hypothetical protein"
FT                   /note="Conserved hypothetical protein. Homology to nfa21510
FT                   of Nocardia farcinica of 42% (trembl:Q5YXU4). No domains
FT                   predicted. No TMHs. No signal peptide.,"
FT                   /db_xref="EnsemblGenomes-Gn:azo0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92651"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR025979"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1E6"
FT                   /protein_id="CAL92651.1"
FT                   /translation="MTAAVLSHSPSSQAALSARHGKDFVNLAEVPWTPWVMEGTHFKLL
FT                   AINELSGGFSMLLKVDPGVQAPVHGHLGSAEAYLVEGGFYYEEDDPGYAGYYTYERGGS
FT                   IHQPVSPQGCVMFAVTHGPLAGCNPDGSVSAVVDCRLMLQLAEANAAAGHVVQLVSGR"
FT   CDS_pept        35640..37502
FT                   /transl_table=11
FT                   /locus_tag="azo0034"
FT                   /product="conserved hypothetical secreted protein"
FT                   /note="Conserved hypothetical secreted protein. Homology to
FT                   PP2042 of P. putida of 34% (TrEMBL;Q88L93) Has
FT                   PF06980:(IPR010727)Protein of unknown function
FT                   (DUF1302);This family contains a number of hypothetical
FT                   bacterial proteins of unknown function that are
FT                   approximately 600 residues long. Most family members seem
FT                   to be from Pseudomonas. No TMHs signal peptide present."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0034"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92652"
FT                   /db_xref="InterPro:IPR010727"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1E7"
FT                   /protein_id="CAL92652.1"
FT                   /translation="MNGTFRRPGLRPAVLAAAVAACGGAHAGDFRLGDELTGTWTLNAS
FT                   LGTNVRTQDRDAKLTSFGNANHNGGKPGGGGGSTDDGDLNFDRGDVTSTTLKLVGDVEL
FT                   RYRNYGALLRAKAWHDFTLANKKVDHGHFDNGYVPNERLNDGHYDSAAKFTGAELLDAF
FT                   VFADWELGNDSRLNMRLGNQVVNWGESIFIQGVNVVNPIDVPAARRAGAQVREILLPVP
FT                   LLYGNLGLPGGVSLEAFYQLKWKKTVIDGCGTFFSPADVINCGGSQFGPDVFSDREQYE
FT                   GVAALGGLNLRSLRLNDDKPSDAGQYGLALHWLEPNSETDIGLYYINYHTRTPFLSLSS
FT                   RPSEPSSLYGTAAPLSYLLDYSAEDIKTFGLSLSNTLGGVSVMAELSYTRDLPVQINGG
FT                   DLVQFGVSGGTQGPLVGKRIYDPAGATIRGYDRMDKIQLQFGAINVFSQVLGAQSLLAV
FT                   GEVGMSWLPDLPNAKTDVRYGRAFTFGTAWHPAYTNPALSTRAGCNAANSAGMVTPANC
FT                   AQDGFVTPFSWGYRLFGELEYPNAVAGWTAKPRLYWAHDVKGNAADGAFMENRRTLGTG
FT                   VGLSRLVDGQRWTVDLAYTRFIDAARWDTNRDKDFLAASLSVAF"
FT   CDS_pept        37514..38869
FT                   /transl_table=11
FT                   /locus_tag="azo0035"
FT                   /product="conserved hypothetical secreted protein"
FT                   /note="Conserved hypothetical secreted protein. Homology to
FT                   PA3421 of P. aeruginosa of 50% (TrEMBL;Q9HYI4) Has
FT                   (IPR010752)PF07044:Protein of unknown function
FT                   (DUF1329);This family consists of several hypothetical
FT                   bacterial proteins of around 475 residues in length. The
FT                   majority of family members are from Pseudomonas species but
FT                   the family also contains sequences from Shewanella
FT                   oneidensis and Thauera aromatica. No TMHs signal peptide
FT                   present"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92653"
FT                   /db_xref="InterPro:IPR010752"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1E8"
FT                   /protein_id="CAL92653.1"
FT                   /translation="MTRLHPALRLASLLLPLAAGAAHAAMSAEEIARLGKDLTPLGAER
FT                   AGNAAGTIPAWTGGLTKPPAGFDIAQGHANPYADEKPLYTITAQNWEQHKDKLSDGHIA
FT                   MLKRYPETYRLNVYPTHRSAALPQAEYDRIREQAGRIAVTASGTGLENWDRSATPFPIP
FT                   KNGLEAIWNHQVRSRAGGIERRHLIGAVNPNGSFNAYGVDESWIFAQNMDRQEDNRFWY
FT                   FMARMYSPADVTGEVVMVHEPLDFARDGRLAWVYNAGLRRVRRAPQIIYDSPGSFSEGT
FT                   RTEDDYDMFNGPTDRYEWKLVGKREMLIPYNSYAIHSKKLKAKDVVKPHHLDPALTRYE
FT                   LHRVWVVEATLKDGARHIYGKRVFYLDEDSWTIAVKEQYDGRGQLWRVGEAQLMQYYDL
FT                   PLPYYAFENMYDLQDGRYYVAGLSNEEGPWRFGAKARRADFDPDALRRSGTK"
FT   CDS_pept        38945..40102
FT                   /transl_table=11
FT                   /locus_tag="azo0036"
FT                   /product="conserved hypothetical BNR domain protein"
FT                   /function="uncharacterized protein related to plant
FT                   photosystem II stability/assembly factor"
FT                   /note="Conserved hypothetical BNR domain protein. Homology
FT                   to pp3201 of P. putida of 40% (trembl|Q88I01). InterPro:
FT                   BNR repeat (IPR002860) Pfam: BNR repeat BNR repeats are
FT                   short repeats never found closer than 40 residues together,
FT                   which suggests that the repeat is structurally longer.
FT                   These repeats are found in many glycosyl hydrolases as well
FT                   as other extracellular proteins of unknown function. singal
FT                   peptide no TMHs"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92654"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR028203"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1E9"
FT                   /protein_id="CAL92654.1"
FT                   /translation="MTRLPLATLAAAAVLVAAAASAGLAPRPAAAPPIDLLETAAPQSP
FT                   RAAAQLMNALVHAGHRLVAAGARGTIVYSDDGGRSWTQAAVPVAVMLTALHFPTPQLGW
FT                   AVGHDGVILHSRDSGASWARQFDGNQANAQMLAWAQTRVEAARAALEAAPAPQREAAED
FT                   ALAAAEDGLAGIEQTAGFGPSRPFMSVWFRDAREGYAVGAFGMAFATTDGGEHWTLFAD
FT                   RLPNPEDLHLYAVASPAPEVVLIAGERGLVLRSEDAGAHWQAQADLADGGLYGLVTLPD
FT                   GSATLAYGFDGAVLRSTDLGASWQALDSGTRSALYGAALADGELQLVGNNGARLRLAGE
FT                   RFETLPAGDGRPLTAAARGKDGWVLAGWGGLARIETATAGDGRHE"
FT   CDS_pept        40095..42521
FT                   /transl_table=11
FT                   /locus_tag="azo0037"
FT                   /product="probable exporter of RND superfamily"
FT                   /function="predicted exporters of the RND superfamily"
FT                   /note="Putative membrane protein MJ1562. TREMBL:Q88LB6: 47%
FT                   identity, 63% similarity InterPro:IPR000731; SSD_5TM
FT                   InterPro: HMGCR/Patched 5TM box Pfam:Patched:Patched family
FT                   2A067: efflux transporter putative Signal peptide absent.
FT                   Presence of 12 transmembrane helices"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0037"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92655"
FT                   /db_xref="GOA:A1K1F0"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1F0"
FT                   /protein_id="CAL92655.1"
FT                   /translation="MSETTVTSARAPHGGLLKRLERRLEGALFRHRAATVAVFALLTVW
FT                   LGWVALGLRPDASFEKMIPTHHPAIANYLAHEDNLRGLSNVVRVVVENRKGDIFDPGFQ
FT                   EVLRKVNDEVFYIPGVDRAGMRSLWTPNVMWGEVTAEGFEAGPVIPDGYDGSPRALEQL
FT                   RANVFRSGEVGTLVANDLRSALVLVPLMERNPETGERLDYGRFATDLEERIRARYENEA
FT                   VGIRIVGFAKVIGELIDGAVPILGYFLLTLVLTAALLFWYSRCLRSTLTTLVCCLIAVV
FT                   WQLGIVRLLGYGLDPYSILVPFLTFAIGISHAVQNINATANAALDGADRVEAAKRSFRS
FT                   LFVAGTVALLCDAVGFATLLVIRIGVIQELAISASIGVAVIIFSKMFLLPVLMSWTGVS
FT                   PAAVAHARRRRDHLPWLWQQVARCAQPRPAVVVTLAGAALLALGYWGARDLQIGDLDPG
FT                   APELRTDSRYNRDAAFLVEHYATSTDVFVVMAETPPQGCRDYQVLAGMDLLAAELERVP
FT                   GVQRTVSMSDFAYRVLAGNNEGNPKWYAISRNKYALGGAFQKTPKEYIGNGCAMTPFVV
FT                   YLNDHKAATLSAVMATVRDFAARHDSDKVRFTLVGGNAGIEAATNEVIRDAERTMLMLV
FT                   YAIVALLLLIEFRSLRVTICIVVPLYITSVLCEAIMAWMGLGVKVATLPVIALGVGIGV
FT                   DYGIYIYNRLQSCLDRGLPLAEAYLLTVATTGRAVAFTGLTLAVGVLTWIGSDIKFQAD
FT                   MGLLLTFMFLWNMVGALVLLPALARLLLPATRPAAATATPRHPEPHLRLADAQRS"
FT   CDS_pept        42527..43336
FT                   /transl_table=11
FT                   /locus_tag="azo0038"
FT                   /product="Short-chain dehydrogenase family protein"
FT                   /function="Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /note="The short-chain dehydrogenases/reductases family
FT                   (SDR) is a very large family of enzymes, most of which are
FT                   known to be NAD- or NADP-dependent oxidoreductases. EntA,a
FT                   2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase enzyme,is
FT                   involved in the third stage of enterobactin biosynthesis
FT                   and converts isochorismate to 2,3-dihydroxybenzoic acid
FT                   (DHBA), SWISSPROT:Q10855 (37% identity); TREMBL:Q89M15 (36%
FT                   identity). InterPro (IPR002198): Short-chain
FT                   dehydrogenase/reductase (SDR). InterPro (IPR002347):
FT                   Glucose/ribitol dehydrogenase. InterPro (IPR003560):
FT                   2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase. Pfam
FT                   (PF00106): Short chain dehydrogenase."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0038"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92656"
FT                   /db_xref="GOA:A1K1F1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1F1"
FT                   /protein_id="CAL92656.1"
FT                   /translation="MTTTIETRLMDLTGRVAFVTGGASGIGRATAHALAAQGARVIVAD
FT                   INETGGWETADAIGTAAGFVHLDVTEETAWCRALDYVISTEGRLDILANVAGIGLGGDF
FT                   EDLALADWNRLMAVNATGPFLGCKHAIRAMAGSGRPGAIINVGSIAATHAAPDLGGYCA
FT                   SKGALRMLSKSVALYCAHKGYPIRCNAVHPTYVDSEMLDPIAALYGSREAMVQAMARLV
FT                   PVGRLAKPADVAAAVVYLASDAAGMVTGTELFVDGGQTAGIAPSHFG"
FT   CDS_pept        43466..45670
FT                   /transl_table=11
FT                   /locus_tag="azo0039"
FT                   /product="conserved hypothetical protein"
FT                   /function="uncharacterized conserved protein"
FT                   /note="Conservd hypothetical protein, 79% identity(85%
FT                   similarity) to TrEMBL;Q88GU7. Has PF02566, OsmC-like
FT                   protein; IPR003718; Osmotically inducible protein C (OsmC)
FT                   (P23929) is a stress -induced protein found in E. Coli.
FT                   This family also contains a organic hydroperoxide
FT                   detoxification protein (O68390) that has a novel pattern of
FT                   oxidative stress regulation. Has PF02624, YcaO-like fatty
FT                   acid binding protein;IPR003776, DUF181;This is a family of
FT                   proteins of unknown function."
FT                   /db_xref="EnsemblGenomes-Gn:azo0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92657"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR003776"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019938"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="InterPro:IPR041080"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1F2"
FT                   /protein_id="CAL92657.1"
FT                   /translation="MEIKVNFLDKLRLEAKFDDFTVIADQPIRYKGDGSAPGPFDYFLA
FT                   SSALCAAYFVKLYCNTRNIPTDNIRLSQNNIVDPENRYQQTFKIQVELPEDISAKDRLG
FT                   ILRSIERCTVKKVVQTGPEFVIEEVENLDADAQALLTLRPDPAHRTYIAGKDLPLEQTI
FT                   ANMSEVLAGLGIKIEIASWRNLVPNVWSLHIRDAHSPMCFTNGKGASKESALASALGEY
FT                   IERLNCNHFYNDQFWGEDIANAPFVHYPDERWFKPGPADALPAGLLDDYCLQIYNPDGD
FT                   LRGSHLYDTNSGNVRRGICALPYVRQSDGAVVYFPSNLIDNLFLSNGMSAGNTLAEAQV
FT                   QCLSEIFERAVKREILEGELALPDVPPEVLAKYPGILAGIEALEKQGFPVLVKDASLGG
FT                   TYPVMCVTLMNPHTGGVFASFGAHPSLEVALERSLTELLQGRSFEGLNDLPRPTFNSNA
FT                   VTEPNNFVEHFIDSSGVVSWRFFSARADFDFVEWDFSSQGQNANAQEAARLLGILEDMG
FT                   KEVYMAVYDQLGAIACRILVPDYSEIYPVEDLIWDNTNKALAFRADILNLHRLDDAGLE
FT                   ALLERLEDSELDDYTDIITLIGIEFDENTVWGQLTILELKLLIHLALQQFEAAKERVEA
FT                   FLQYNENTVERVLFYQALDAVLEVVLDDALELDDYVVNFRRMFGDARMDAVLGSVDGSV
FT                   RFFGLTPTSMKLEGLDRHQRLIDSYRKLHTARARRASAPA"
FT   CDS_pept        complement(45701..46612)
FT                   /transl_table=11
FT                   /locus_tag="azo0040"
FT                   /product="putative AraC-family transcriptional regulator"
FT                   /function="AraC-type DNA-binding domain-containing
FT                   proteins"
FT                   /note="Putative AraC-family transcriptional regulator,"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92658"
FT                   /db_xref="GOA:A1K1F3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1F3"
FT                   /protein_id="CAL92658.1"
FT                   /translation="MTGVFASTPQLIARATASAPDYVMEGHNGDIFGARWNHPAGESQL
FT                   RRNAEHVLVYHLSGNTDVERLQQGVVTGFRSRVGSVTFMPRDSESDWRLGGNTQVIHLY
FT                   LSQDLMDAFARDTLERDACPEIDDFFAVNDTWLDGFFRMLASEAPPSAGAGTRLETLVL
FT                   DQIQSLLVRHLVTRYARERRADTERALVRGGSGSQLRQSVLKKITALIHERLHEDICLQ
FT                   DLADLACISKDHFLRAFRDTVGQTPYHYVLSQRLERARALLREEPNLPVAEIARRCGFK
FT                   NLSHFSATFRRMTGVSPKGYRG"
FT   CDS_pept        46800..47561
FT                   /transl_table=11
FT                   /locus_tag="azo0041"
FT                   /product="Short-chain dehydrogenase family protein"
FT                   /function="Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /note="The short-chain dehydrogenases/reductases family
FT                   (SDR) is a very large family of enzymes, most of which are
FT                   known to be NAD- or NADP-dependent
FT                   oxidoreductases,TREMBL:Q9I376 (49% identity);
FT                   SWISSPROT:P50197 (44% identity). InterPro (IPR002198):
FT                   Short-chain dehydrogenase/reductase (SDR). InterPro
FT                   (IPR002347): Glucose/ribitol dehydrogenase. Pfam (PF00106):
FT                   Short chain dehydrogenase."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92659"
FT                   /db_xref="GOA:A1K1F4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1F4"
FT                   /protein_id="CAL92659.1"
FT                   /translation="MQGMLEQKVVIVTGAGSGIGRAAAELMAREGAIVIASDLKLDTVE
FT                   DTAHRITLAGGRAVAVRTDVAKLAELDALHDLAIAEFGRLDGAFNNAGIPGPGVALADH
FT                   EEAAFDALIAINLKAVWYGMKRQIELMLPGGGGAIVNTASVGGIVGKPGLSVYCATKHA
FT                   VIGLTKTAALEYGSRGVRVNAVCPGVIRTPMVDQVIAGQPGAEEEWNRLQPIGRMGTPE
FT                   ELAETVVWLMSPRASLVHGHALVADGGLTVA"
FT   CDS_pept        47901..48494
FT                   /transl_table=11
FT                   /locus_tag="azo0042"
FT                   /product="conserved hypothetical secreted protein"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /note="Conserved hypothetical secreted protein. Homology to
FT                   bll2189 of B. japonicum of 48% (trembl|Q89T61). Has
FT                   PF06577, Protein of unknown function
FT                   (DUF1134);IPR008325,UCP033924; This family consists of
FT                   several hypothetical bacterial proteins of unknown
FT                   function. Signal peptide. TMH present in signal peptide."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92660"
FT                   /db_xref="InterPro:IPR008325"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1F5"
FT                   /protein_id="CAL92660.1"
FT                   /translation="MFTPTHPVRSGHSWVLALIAALGLAFAVPAVAAGDDASTYDKDSI
FT                   IKDAAEFFGETTEGLAKVIEKAFNEQGRPNGYIKGEEIAGAVGVGLRYGDGTLTLKKGG
FT                   SAKVYWQGPSIGFDVGANASKVFILVYNLPRTQDIYQRFPGIDGSVYYVAGAGINYQQR
FT                   DNIVLAPIRVGVGLRTGASVGYMHYTPTKTLNPL"
FT   CDS_pept        complement(48804..49574)
FT                   /transl_table=11
FT                   /locus_tag="azo0043"
FT                   /product="conserved hypothetical protein"
FT                   /function="uncharacterized proteins homologs of lactam
FT                   utilization protein B"
FT                   /note="Hypothetical UPF0271 protein PYRAB09930. This family
FT                   includes LamB. The lam locus of Aspergillus nidulans
FT                   consists of two divergently transcribed genes,lamA and
FT                   lamB, involved in the utilization of lactams such as
FT                   2-pyrrolidinone. Both genes are under the control of the
FT                   positive regulatory gene amdR and are subject to carbon and
FT                   nitrogen metabolite repression [1]. The exact molecular
FT                   function of the proteins in this family is unknown.
FT                   SPROT:Q89LH6: 47% identity, 62% similarity
FT                   InterPro:IPR005501; LamB_YcsF. Pfam:PF03746; LamB_YcsF
FT                   urease_gam: urease gamma subunit Nonsecretory protein with
FT                   Signal peptide probability 0 No transmembrane helices"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92661"
FT                   /db_xref="GOA:A1K1F6"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1K1F6"
FT                   /protein_id="CAL92661.1"
FT                   /translation="MMKINLNADLGESFGAWKMGEDDALLQVVRSANIACGFHAGDPLV
FT                   MRNTVRMALAAGVSLGAHPAYPDLQGFGRRPMKMAPAELEAAVIYQLGALAGIAAAEGG
FT                   RLSHVKPHGALSNQACEDAELAATVVRAVRAFDRELILLAPALSELHAVGERAGLRVAA
FT                   EIFADRAYTDAATLAARTQPGAVIHDHDEIIAHVLRMLDAGGIVAQSGKVMKTVMHSVC
FT                   VHGDTPGAVQSARRLAETLAAKGWELVGLPEMGE"
FT   CDS_pept        complement(49571..50671)
FT                   /transl_table=11
FT                   /locus_tag="azo0044"
FT                   /product="conserved hypothetical urea amidolyase-related
FT                   protein"
FT                   /function="Allophanate hydrolase subunit 2"
FT                   /note="Conserved hypothetical urea amidolyase-related
FT                   protein. Homology to ybgK of E. coli of 36%
FT                   (sprot|YBGK_ECOLI). InterPro: DUF183 (IPR003778)
FT                   Uncharacterized domain in proteins of unknown function.
FT                   This domain is found in a multifunctional enzyme, urea
FT                   amidolyase, from yeast. Pfam: DFU182, uncharcterized
FT                   ACR,COG1984 no signal peptide no TMHs"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92662"
FT                   /db_xref="GOA:A1K1F7"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1F7"
FT                   /protein_id="CAL92662.1"
FT                   /translation="MSAVQLEVLAPGAYASLQDGGRRGYRRIGVPWAGVLDTRLMRIAN
FT                   VLVGNAEGAPVIECFDGGLLLAARGGPLRLAVAGDAVLEIERGGERSALAPWRSLTLGD
FT                   GELLRLRRMSGGRIAVVAVEGLVLTPVLGSVSTYARAGLGGLDGPLAGRALTTGMLLPA
FT                   QAARADGERMLPLPPQVDEGPIRVVPGPQADHFSAAAFATLLGEEYRVSAEADRMGLRL
FT                   EGPALEHAGAREIVSDATVPGAIQVPGNGQPIVLLADAQTAGGYPKIATVIGADLGRLA
FT                   ALRPGQVLRFATVTAGEGEHLARAAEAGTRALLAGVRPLAADGIDLAALQAANLVSGVV
FT                   HALAAEYRPLTAAADQAAAPTPPEPR"
FT   CDS_pept        complement(50668..51462)
FT                   /transl_table=11
FT                   /locus_tag="azo0045"
FT                   /product="conserved hypothetical protein"
FT                   /function="Allophanate hydrolase subunit 1"
FT                   /note="Conserved hypothetical protein ybgJ. Homology to
FT                   ybgJ of E. coli of 41% (sprot|YBGJ_ECOLI) InterPro: DUF213
FT                   (IPR003833) Pfam: DUF213, uncharacterized ACR, COG2049 no
FT                   signal peptide no TMHs"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92663"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1F8"
FT                   /protein_id="CAL92663.1"
FT                   /translation="MKPRVLDAGDAAFTVEFGDAIEPRLLAAVNALDAAIARLQADGGL
FT                   PGVIETMPTFRSLTVFFDPLVTGRAALLAALQPLLAGDADRAAAPGRRWRLPVCYEGEA
FT                   APDLAVTARATGLDEAAVVALHSGTEYRVYMLGFLPGFPFMGDLPEPLRLPRRAEPRLR
FT                   VPSGSVAIATGLTAIYPWESPGGWHLLGRCPVPLFDVRRAAPALLAAGDRVVFAPVSGA
FT                   EYVRLAAALQGGEIDPQEWLCSGVAEGDGTAAPSAAPEGGAR"
FT   CDS_pept        complement(51590..52516)
FT                   /transl_table=11
FT                   /gene="dehH"
FT                   /locus_tag="azo0046"
FT                   /product="haloacetate dehalogenase"
FT                   /function="predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily)"
FT                   /EC_number="3.8.1.3"
FT                   /note="Hypothetical haloacetate dehalogenase H-1 (EC
FT                   3.8.1.3). Haloacetate + H(2)O = glycolate + halide
FT                   TREMBL:Q8Y2S9: 58% identity, 67% similarity Gene name:dehH
FT                   from Ralstonia solanacearum genome project. InterPro:
FT                   Alpha/beta hydrolase fold InterPro:IPR000073;
FT                   A/b_hydrolase. IPR000379: Ser_estrs. Pfam:PF00561;
FT                   Abhydrolase_1 nadp_idh_euk: isocitrate dehydrogenase No TMH
FT                   present absence of signal peptide."
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0046"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92664"
FT                   /db_xref="GOA:A1K1F9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1F9"
FT                   /protein_id="CAL92664.1"
FT                   /translation="MSVVTEVAAAADAVLFPGFARRRIEVGAGVSIPCVSGGDGPPLLL
FT                   LHGHPQTHAIWHKVAARLARHFTVVASDLRGYGDASRPATTADHVRYSKREMAADQVAL
FT                   MRALGHDRFSVLAHDRGARVAHRLAADHPQAVSRMVLLDIAPTLAMYEQTTETFARAYW
FT                   HWFFLIQRAPLPERLIEADPTAYLRDVMGSRHAGLAAFDPTAFAEYARCLSQPGAAHSL
FT                   CEDYRAAATIDLEHDRADRAAGRRLAMPLQVLWGQSGIVQRCFRPLDEWRRVADDVRGG
FT                   TLPCGHYIPEEAPAELLAAALPFLLAD"
FT   CDS_pept        complement(52582..53337)
FT                   /transl_table=11
FT                   /locus_tag="azo0047"
FT                   /product="conserved hypothetical secreted protein"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /note="Conserved hypothetical secreted protein Homology to
FT                   pa4487 of P. aeruginosa of 52% (trembl|Q9HVT4(SRS)) no
FT                   domains predicted signal peptide no TMHs"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92665"
FT                   /db_xref="InterPro:IPR019220"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1G0"
FT                   /protein_id="CAL92665.1"
FT                   /translation="MSKPSCSERALSALLLALAAAPALAEIEMPVGGWRQGNAEAPYSQ
FT                   EVNYPASRPAIDAGVPGVAQIRGRIARHTKGPATLVVNGNAMPLEVDEEGRYGRAYSFA
FT                   TGSNSVEVRAGDGRPQRVQFYQTAAGQAEARLRVVLSWDTDGTDLDLHLITPDGEHAWY
FT                   GNRAVKGGAIDVDVTTGYGPEIFASPAPLKGPYQIWVNYYGGGRGEMLTTARVAVISNE
FT                   GTSSERRQEFDVPMRAAGELTLVRQFVYP"
FT   CDS_pept        complement(53315..54151)
FT                   /transl_table=11
FT                   /locus_tag="azo0048"
FT                   /product="conserved hypothetical secreted protein"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /note="Conserved hypothetical secreted protein. Homology to
FT                   rsc3028 of R. solanacearum of 57% (trembl|Q8XV04(SRS)) no
FT                   domains predicted signal peptide no TMHs"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92666"
FT                   /db_xref="InterPro:IPR012039"
FT                   /db_xref="InterPro:IPR019220"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1G1"
FT                   /protein_id="CAL92666.1"
FT                   /translation="MTAFPSRPWWRLCVALWAVAAAGAAAAMPPATLEAPSGGWNRGTL
FT                   TDHSGDGAVAYPNPPIDRGVQAGRTLIRGRLAAEHRARDANRRPRTPPTLVVNGNPMPL
FT                   YSDADGHFARPYAFGPGSNSVEIRSADGQPLRRLQFFEADPGRPRAQLRAILAWDDDQA
FT                   EVDLHVLTPDGQHAFWAHPVLANGGGMDVDSVDGAGPEMFSMTAPLRGPYQLYVNYWGN
FT                   FGDAGYHFDESTRQKKIITCRITLVFHENTPQERRESFVVPLRKIGDLTHVKTVMF"
FT   CDS_pept        complement(54285..56000)
FT                   /transl_table=11
FT                   /locus_tag="azo0049"
FT                   /product="conserved hypothetical secreted protein"
FT                   /note="Conserved hypothetical secreted protein. Homology to
FT                   PA4488 of P. aeruginosa of 47% (trembl|Q9HVT3(SRS)) No
FT                   domains predicted. No TMHs. Singal Peptide Present."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92667"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="InterPro:IPR018748"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1G2"
FT                   /protein_id="CAL92667.1"
FT                   /translation="MFPHLSSAFRLRLLVALACALLIRPAAAALDLAYRDPASGELVLQ
FT                   RVDGEGRPLAGVQPPAAVPLGSVWKLFVFAWLVEHGVPAPDYACRAGRGSDAASRRLRE
FT                   EESYCCESGGSIGRDAALVASCGLFFEPARLGIDAADWRAFWTARAPALPWLADLGALV
FT                   PDTAVSPAALIGALEAVPPRARAEAASVLLARAFAPGGEAGAVGTLGGRLRVKTFSWYL
FT                   PGTRTRYGGGAGWLADGTPLWFGGAGTGQQVLVRDAAALAAALPAGVGSLAPGCVDVAF
FT                   FSRYPLRRVDGADGRPARAGALRGRHVAVFANGVSLPFRASGQMRLDLADGAPRVYGRF
FT                   GVDEYVARVLDREADAGETEAARALAVVARSYLFNEARRAGNCLAIADSSRTQRVSPNP
FT                   PSVAALAVAGFTTELVLRGAPVGYHLDTPGPDRLVWREAVAEARAGARWDAMLRRAFPA
FT                   ADLVAARDPAGLPCDRLEVAERWLAEQVPRWRPQLAALPGFETPAPPRVCRLAWGTPFS
FT                   ELDRGRIHVRALHSVEDRITLAHEYLHLGLRHHPASGDENWVEGWARRLVLGTP"
FT   CDS_pept        complement(56050..57162)
FT                   /transl_table=11
FT                   /gene="phaZ"
FT                   /locus_tag="azo0050"
FT                   /product="Poly (3-hydroxybutyrate) depolymerase"
FT                   /function="Poly(3-hydroxybutyrate) depolymerase"
FT                   /EC_number="3.1.1.75"
FT                   /note="This protein degrades water-insoluble and
FT                   water-soluble PHB to monomeric
FT                   D(-)-3-hydroxybutyrate,TREMBL:Q9LBN6 (35% identity);
FT                   TREMBL:Q46334 (34% identity). SignalP predicting signal
FT                   peptide."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92668"
FT                   /db_xref="GOA:A1K1G3"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1G3"
FT                   /protein_id="CAL92668.1"
FT                   /translation="MKKTVRIIAGAALAVAFQATAAPPLPAFNIDIAETSISGISSGAF
FT                   MAVQFQVAHSSIIKGAGIIAGGPYYCARDDFFRATTTCSCTGEPFLDCKVTDASAEVPA
FT                   LVEATRRFHAERRIDDPANLARQRVVTVVGTADGLVPPTITAQLHAYYAASGMPWSSVS
FT                   PVVVDGAGHTLPTLDFGRDCGLTETPYIGRCRFDSAKAILDWIYGQGVPLPPAPVRAPR
FT                   RPTGRFVEFDQRPYLPADAPSPFTWGNGLDNSGWLYVPAACARGERCRLHIALHGCKQG
FT                   QNFLPLRPPPGGGLYYGTTFVKNAGYHRWADDNRLVVLYPQAVSIPGWNPNGCWDWWGY
FT                   TGAHYADRDGVQIRTIRAMVDRLASGRRDN"
FT   CDS_pept        complement(57268..58020)
FT                   /transl_table=11
FT                   /locus_tag="azo0051"
FT                   /product="conserved hypothetical membrane protein"
FT                   /function="Small-conductance mechanosensitive channel"
FT                   /note="Conserved hypothetical membrane protein. Homology to
FT                   ebA624 of Azoarcus sp. EbN1 of 52%
FT                   (gnl|keqq|eba:ebA624(KEGG)) . no domains predicted. no
FT                   signal peptide. 3 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:azo0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92669"
FT                   /db_xref="GOA:A1K1G4"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1G4"
FT                   /protein_id="CAL92669.1"
FT                   /translation="MELAHQRRCRCKRGMPSDMHRGRGAAPQGPAAAGLRWRRATVPPP
FT                   VMTPPYNHGLAAFPPAFRECVMKQLLPAWADPWLDLIHLGLQIALILFGAALLRMVLRR
FT                   LLRRLGEHYNLPPELVIGARRTISFVIYSGALLLVLDRFGVSGTVLWTAFTGFAAVAAV
FT                   AFFAAWSVLSNIFCTLLIFTTRPFRLYDHIELLENGEKPGLKGQVVDINLIYTTLQESA
FT                   GEHGDTVLQVPNSLFFQRCLRRWRGNPG"
FT   CDS_pept        58066..59952
FT                   /transl_table=11
FT                   /locus_tag="azo0052"
FT                   /product="hypothetical secreted protein"
FT                   /function="predicted acetyltransferases and hydrolases with
FT                   the alpha/beta hydrolase fold"
FT                   /note="Hypothetical secreted protein. No homology of the
FT                   entire protein to the data bank.
FT                   InterPro:Esterase/lipase/thioesterase family active site
FT                   Pfam:Putative serine esterase (DUF676) This family of
FT                   proteins are probably serine esterase type enzymes. Signal
FT                   peptide present (Signal P predicted) No transmembrane
FT                   helices."
FT                   /db_xref="EnsemblGenomes-Gn:azo0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92670"
FT                   /db_xref="InterPro:IPR007751"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1G5"
FT                   /protein_id="CAL92670.1"
FT                   /translation="MPRWLRLLGLAGACLALAGCTLIRLGDEAQAFYTSTVLVGRVAAP
FT                   AGWSGPVIVAAHREEDGDAPPAHRTLLHEAGGFELIVPAGDYRLFAFGDTNRNGRFDAG
FT                   EPAGEYSGGKPVAASGSGVIALLDFALGDAAAASAAARRAAGWPPLDSRHSTQAGALAE
FT                   LDAPAFSAANGVDGYWAPMAFFRASGGNVYFLEPYDPARIPVLFVHGAAGSAQDWRYFY
FT                   EHLDRSRYQAWIFQYPSGAAVDSMAYLLYWKLFNLQLRHRFERLHIVAHSMGGLVARSF
FT                   LINHGSQVRGLSLFISISTPWAGEPTAALGVKHAPAVVPSWHDMAPGGSFMRALFARPL
FT                   PAGLDYYLLFGHRGGYSLLRPNHDGTVTLASQLRQAAQAEARMIYGFDEDHVGILSSPQ
FT                   VLAQVQALLDSHAGGPRADIASGGQLRAAFATADGVLPAGVPLLVLQPLGEGARVAPIT
FT                   VPLAATDSGRSLGPFPPGDYAASLLVQGYRAEPARQPLHIGDGAAATARFRLLPRGELA
FT                   GYVGDEADAVGNPAGSYRRPHDTVRIREVDLRGAGVQRTLRPLDTAADDALALHLRGED
FT                   SAERAHFAFFDLAAGDYELTIRADGYETHRSRHTVVPGQGGPMAPIVLQPRR"
FT   CDS_pept        complement(59974..61287)
FT                   /transl_table=11
FT                   /gene="rstB"
FT                   /locus_tag="azo0053"
FT                   /product="probable sensor histidine kinase"
FT                   /function="Signal transduction histidine kinase"
FT                   /EC_number="2.7.13.1"
FT                   /note="Probable two component sensor histidine kinase,"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92671"
FT                   /db_xref="GOA:A1K1G6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1G6"
FT                   /protein_id="CAL92671.1"
FT                   /translation="MKSLAGRVFLILVVATVLIQVLSFGGALAVSARDSRHQMFEFMGA
FT                   DIAFLHRLLGRMPPAERETWIPALDRGFYQPALEPAGRTHPPADTPHLRESMVPMRRLL
FT                   GPAIDVRAVMLAPPVPGEDGIPALAVALDEAHTLLVRFPTRKAPLAPPPLGVIAAYVAA
FT                   VSLAVMLAAWGAVRLATRPLRRLADAARALGHNLDAPALPERGASELVEASRAFNAMQA
FT                   ALQKNLAERTQILAAISHDLKTPLTRLRLRVGALPADEQARARIEADIDAMSHLVEEGL
FT                   DYARSARPSEASTRVDLQALVESLAEQAADLGQAVRIEGRLAAPVRCAPRALQRALQNL
FT                   LDNALKYGGGATTLRLAHEGDGVEIRIEDDGPGLPPALLEQVFEPFFRAEDSRSRQTGG
FT                   AGLGLAIARNLLRAQGGDIRLENRGGGGLAAIVSLPQG"
FT   CDS_pept        complement(61284..62054)
FT                   /transl_table=11
FT                   /gene="rstA"
FT                   /locus_tag="azo0054"
FT                   /product="probable two-component response regulator"
FT                   /function="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /note="Two component response regulator,"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0054"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92672"
FT                   /db_xref="GOA:A1K1G7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1G7"
FT                   /protein_id="CAL92672.1"
FT                   /translation="MNRPDHVLIVDDDPDIRDLLADYLGKQALQVSAAADGRQMRAALL
FT                   AGPVDVVVLDLMLPGEDGMALFRWLRETPAHAQIPVVMLTARADDVDRIIGLEMGADDY
FT                   LGKPFVARELLARVRAVLRRARMLPPGTVRTEVARYLAFGDWLLDTVERHLVARGGTVT
FT                   LLQAAEYTLLRFLLDHPQCVVNRDQLLVGLAGREADVFDRSIDLRVSRLRKRLGDDARE
FT                   PAYIKTVRNEGYVLCKTVAAHVTRPPGFGDGDGA"
FT   CDS_pept        62241..62975
FT                   /transl_table=11
FT                   /locus_tag="azo0055"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /function="ABC-type antimicrobial peptide transport system
FT                   ATPase component"
FT                   /note="ATP-binding cassette (ABC) transporters form a large
FT                   family of proteins responsible for translocation of a
FT                   variety of compounds across biological membranes. They are
FT                   composed of two transmembrane domains responsible for
FT                   binding and transport and two nucleotide-binding domains
FT                   responsible for coupling the energy of ATP hydrolysis to
FT                   conformational changes in the TMDs, TREMBL:O54136 (41%
FT                   identity); TREMBL:Q8RCZ7 (40% identity). Pfam (PF00005):
FT                   ABC transporter. TC (3.A.1): The ATP-binding Cassette (ABC)
FT                   Superfamily."
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0055"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92673"
FT                   /db_xref="GOA:A1K1G8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1G8"
FT                   /protein_id="CAL92673.1"
FT                   /translation="MTTESPAAAVRTEPVAVLRGIRKRYRLDNTAVLALDGVDLDIPPA
FT                   RFTVITGPSGSGKSTLLHLLGALDRADAGTLHVDGRDLARLDDDALSAFRARHIGFVFQ
FT                   SFNLLPVLTALENVEYPLRLGMLSAAARRARALDLLGAVGLADKARHRPAELSGGQRQR
FT                   VAIARALANSPRLLLADEPTANLDRATGAGIIALLRRLQRETGTSVVFSSHDAAVLDAA
FT                   DLRVTLVDGRVARLETGAEVAA"
FT   CDS_pept        62972..64369
FT                   /transl_table=11
FT                   /locus_tag="azo0056"
FT                   /product="conserved hypothetical membrane protein"
FT                   /function="ABC-type transport system involved in
FT                   lipoprotein release permease component"
FT                   /note="Conserved hypothetical membrane protein. Homology to
FT                   cv3942 of C. violaceum of 30% (trembl|Q7NR42) InterPro:
FT                   DUF214 (IPR003838) Pfam: Predicted permease This is a
FT                   family of predicted permeases and hypothetical
FT                   transmembrane proteins. One member has been shown to
FT                   transport lipids targeted to the outer membrane across the
FT                   inner membrane, a step which requires ATP. Signal peptide 3
FT                   TMHs"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92674"
FT                   /db_xref="GOA:A1K1G9"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1G9"
FT                   /protein_id="CAL92674.1"
FT                   /translation="MSTLFLAWRNVLRNRRRSAITLATIAVAAMAVVMLGGYVAATIKG
FT                   LETLTVRQVGHLQVMSRGYLEFGRANPARHALRDYAPLAGRLRADPQLAPLLHVVTPTL
FT                   QVQGVAGHFASASSSTFSAAGWVADDRARMLAWDGLRLGTPPLPTALRADRPDDGVIGV
FT                   GLAQLLDLCDALAIADCVRAPAAVPAAAAAIDADLAALSRQAREAGPAAPAAGAVVVDL
FT                   LAAGASGAPNIVRMTATRAERQGVRELDMVHVGLPLALAQRLVFGTGAAGASALVLQLE
FT                   DSARLDEARARVAAVVHDYAGDTLEVRTFAEVSPSYNQVVRMFRTLFGFVSLLMAVVTL
FT                   FAVANTVNMAVSERTGEIGSLRAIGLPRARIRRMFVLEGGLVGAFGAVLGVALAVVLAG
FT                   GLINHAGFSWTPPGNITPVPITIDVQGSARLCLGTVLAMTLIACISSWWPARRAARLEI
FT                   VEALRHA"
FT   CDS_pept        64362..65171
FT                   /transl_table=11
FT                   /locus_tag="azo0057"
FT                   /product="conserved hypothetical secreted protein"
FT                   /note="Conserved hypothetical secreted protein. Homology to
FT                   BPSS2323 of Burkholderia pseudomallei of 45%
FT                   (trembl:Q63HU7). no domains predicted. singal peptide. no
FT                   TMHs"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92675"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011220"
FT                   /db_xref="InterPro:IPR033399"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1H0"
FT                   /protein_id="CAL92675.1"
FT                   /translation="MRDVLFPRGGRRRLLLAACCLAAGAALPGWVRADDDALALLAGSD
FT                   RVRNLPGSFSVQIALTEFRHGKQTGSSVLTVYSRPAPDSGQYNNLVRFVAPARDAGKLM
FT                   LRRGLDLWFHDPASGASVRISPQQRLLGQASNGDVMSTNLARDYRAELLGRESLRDGEG
FT                   QPREAARLRLTALRDDVPYPLADYWIEPGSHHPLMARYHSAEGRLLKTAYFRKYREVLG
FT                   VLRPTETVIIDGLDPDWVTLMQLSRHTAREVPEAWLQRDYLPRFSGE"
FT   CDS_pept        65168..66349
FT                   /transl_table=11
FT                   /locus_tag="azo0058"
FT                   /product="hypothetical secreted protein"
FT                   /note="Hypothetical secreted protein. No homology to the
FT                   data bank. No domains predicted. signal peptide TMHs inside
FT                   of the signal peptide."
FT                   /db_xref="EnsemblGenomes-Gn:azo0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92676"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1H1"
FT                   /protein_id="CAL92676.1"
FT                   /translation="MSAAARPARMLRVLGAALPLLLGAAGAPAAAAFDPLALQPEPPAD
FT                   DTTTAPPPWHGSGPGLRLELAREQQDRAGGGSQGYSSVVLDFRGEWRTEAGLRLALSDR
FT                   YERRIGGDAARNRNALREAYASLAAAPGWYVDFGRINWRNGVGSGYNPTDYLKRGADIE
FT                   QGSLDPRAQRENRLGTVMLRQQWVGAAGSAQLALIPALADGPESSLTAPGWSRTNRERA
FT                   ALLKLAPTVDERTSLDLLAYTRAGDAPQVGANLTRLLGDAWVLHAEFSRGRRAAAPGAP
FT                   LRQADDSAIGLAWTTPPGAVLTLEHQHDGGARQRALFARLAWDDAFGLAGLDVSAFVRR
FT                   TLDSRARRWQIELGWAAGDRDDLRLRWAGSDGTTDPAAPTPRHSLNLAWLHAF"
FT   CDS_pept        complement(66440..71053)
FT                   /transl_table=11
FT                   /locus_tag="azo0059"
FT                   /product="conserved hypothetical secreted protein"
FT                   /function="Large extracellular alpha-helical protein"
FT                   /note="Conserved hypothetical secreted protein. Homology to
FT                   rsc3030 of R. solanacearum of 48% (sprot|YU30_RALSO) Pfam:
FT                   Alpha-2-macroglobulin family Nterminal region (PF01835,
FT                   PF07703) signal peptide no TMHs"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0059"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92677"
FT                   /db_xref="GOA:A1K1H2"
FT                   /db_xref="InterPro:IPR001599"
FT                   /db_xref="InterPro:IPR002890"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR011625"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR041246"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1H2"
FT                   /protein_id="CAL92677.1"
FT                   /translation="MTTLLRPSLPRLLSAALLALACTVAPPPAAAQSELGLSSGYVPFE
FT                   SMPFFILADRQFGSGDEALLRVEVPARDGGRQMLEAYGGVDVVLYRVPKPLDFLKAQKN
FT                   LHRVDVRARPRDEGLPNTLSYLWDNAWKKSRFAWRDLFDPRTRSTVTAAAPALQSRRAL
FT                   LEPTEFRAPQRFKALEGYELVDRFRYPVWQAQPIKPPEVKLQGSSSDFIPASEGNIHVP
FT                   LGKLKPGLYLVEAIIGTHRALTLLFVSDTVAVTKIAAGALTVWTANRNDGRPVADSRLL
FT                   WTDGVGTLKSATTAADGLATLAHASPERTYLLGEDAAGGVFVSENFYYDSEIHDTKLYA
FT                   VTDRPLYRPGDLVRIKFLGRDFQSASRSRPARAGELRIEVHDPNGTPVLTTSAPLVPDS
FT                   GADTAFRLPDNAVAGGYDIRIGYEDKQYGAAFRVAEYVKPHFEIELLADQKSYKTGEPV
FT                   SGKVRLAYPDGKPVKNAAVELTLRAQTLTMVQGELRYSGLFPVQLSTASLTTDGSGEAK
FT                   FTLPAAKEPSRLILTLLATDGAAYRVRSSRELLVERAAASWKLASTRSFTMAGDKPAFR
FT                   LEAEGENAAAPVKWEIVRLEDQSRSGGDFDPAQREWKPALDRPGSYSLMLRDAAGNIVA
FT                   ATAHWVGGATDKDSLKVAPGSIEMVTDKVSYQPGDTAEVLISFPEPVDEALLTLERDGV
FT                   DATALLSRPGSWLRTERLAPNQWRARIPVSEAHAPNITFSAVYVKHGDYVFQNAGLVVE
FT                   PPRIALDIRSDHETVQPGDTVTVDIQAQLRGKPAPALLTVSVVDEMVYALQPEIAPSLP
FT                   EFLQHIRRNNVRTSASLNFIAYDEAADWSAAASRQPPARHQYNERGVKVLERPRRDDTD
FT                   TAAWLPALKTDAQGRARFSFRMPDALSRWRITVRAVGLDAADGVPGQRTAYVRSDKPLY
FT                   AKWTSPDWLREGDKPQAALAVFNNAAEERKAEVVLTLAGKEIKQEASLHRGVNYLQFAL
FT                   PDFKGRETARVEVKEGGKTVDALETPLDARGAKWRGPREQILALHGDAPAAFTLPADAR
FT                   DLRLRLVAGGGEHFLRIADDLIDYPWGCTEQTASRLIPLALVTPLLAPDRRAEGEGGRL
FT                   WQTLYSQRLRLAALAGPQAVFGWWGDGTENSALMTAYAYYADWYAARTLGITLPAAHWE
FT                   RVLTAYRNHANHEPLLHRALALWFAQEIGLPVRTQSEGLLQALAEAKAPEDGRTGGESW
FT                   SPFLAAPDSALGIAHARVLAAVVAQRAQAPLPAGFEATVAEAQAQLAASNRPAARALLL
FT                   LAGKEARTAAADILASAGSAAPTLDRALTLVWTRKALGEIAPGASAARPAGAWQAARAA
FT                   FGLAEWRWPSSSPLPNGLQVEGGRGGEALTAVLRYEAEEGAGPGTLPVTVERRLYRLER
FT                   TDKGYTRTPVKPADGLSVQSLYLDEIVLKSDAGYRRGLLEAALPPGAAVERGTWGIALA
FT                   DDGPQPVALERARAEERSGSYGVPVDRLEGTVTIRHLLRVAQPGRFVLPPARYYRMYQP
FT                   EEKALADKGESGVWVVK"
FT   CDS_pept        complement(71064..71747)
FT                   /transl_table=11
FT                   /locus_tag="azo0060"
FT                   /product="conserved hypothetical secreted protein"
FT                   /note="Conserved hypothetical secreted protein. Homology to
FT                   RS04726 of R. solanacearum of 55% (trembl|Q8XV01(SRS)) Has
FT                   PF06672;(IPR009558)Protein of unknown function
FT                   (DUF1175):This family consists of several hypothetical
FT                   bacterial proteins of around 210 residues in length. The
FT                   function of this family is unknown. No TMHs signal peptide
FT                   present."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92678"
FT                   /db_xref="InterPro:IPR009558"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1H3"
FT                   /protein_id="CAL92678.1"
FT                   /translation="MSVRLAARRRALGAGLLLLGAATPLRALMPVAPGRAAEPVAQLDA
FT                   EQSRALRAWVVRIAEAQIRRGPTPRWTHRDCAGLVRFAVAEALAEHDARWRQAMGISRR
FT                   LPPDTVPAALRAELRHRWKRPDGSTGAYVNAIGLVQENSRPVGRDLRLARPADLLFFDQ
FT                   GDAQHLMLWTGYRIVYHNGAEPRPGDDGLRAVTPRELLQWTDTRWRPDATNPNFAGVHT
FT                   LAFLA"
FT   CDS_pept        complement(71744..73438)
FT                   /transl_table=11
FT                   /locus_tag="azo0061"
FT                   /product="conserved hypothetical secreted protein"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /note="Conserved hypothetical secreted protein. Homology to
FT                   RS04725 of Ralstonia solanacearum of 43%
FT                   (trembl|Q8XV00(SRS)) No domains predicted. Signal Peptide
FT                   Present. NO TMH reported present."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92679"
FT                   /db_xref="GOA:A1K1H4"
FT                   /db_xref="InterPro:IPR018671"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1H4"
FT                   /protein_id="CAL92679.1"
FT                   /translation="MTSASRSPRRKLLFGVIVLALVVGAVALFWLKRFDGHVNALALDL
FT                   ARPDALIRTRSLARLPADLLRVPLARDVLTEDFVDYYERHEQRLALSGTLRRIAFEHRL
FT                   SLPERVLESVFDEPAEVALWRGADGSLKHFVVAMTRNGLARALQMALPVLPDTQLESAG
FT                   TLRGGKARLLVLQYGYGRQLLLAVEGDRVVALSDPGMLLVADDGDEHAGEEGAEPVQDA
FT                   RAAALVARLLESDAERDSPFDAHFALAPAGADEGHQLVVSSAFYTFGYGAFAPGVEALS
FT                   FAFDDKGGWRTAALIDGARLPAGGLDGAGLWPALPHGPSLCALLPADWGALAPLAARIG
FT                   AGAGGESARAGVGELARELFGGPAAVCWYGESRHYTPLFATTLRRDVDEAWAKELAALF
FT                   DSAIGKGEPAQRAPVEAGQRGSARLWRRTVETPYGARRGEDEPALAPTLAVSGRTLVFS
FT                   PDAALVDKALDVGAKLYPAVGDSLPDGARTLALLEPAALAKLVRKEVFAALPRDEEAVL
FT                   RNAADANLLPRLEALAKYPPLRLVRAEGALEGRGWHALQWESAGNRP"
FT   CDS_pept        73627..75072
FT                   /transl_table=11
FT                   /locus_tag="azo0062"
FT                   /product="conserved hypothetical protein"
FT                   /function="Fe-S oxidoreductases"
FT                   /note="Conserved hypothetical protein. Homology to MCA0287
FT                   of Methylococcus capsulatus of 48% (trembl:Q60C24). no
FT                   domains predicted. no signal peptide. no TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:azo0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92680"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1H5"
FT                   /protein_id="CAL92680.1"
FT                   /translation="MNGTALASYPCGLPPCLFRPPAPEPDRIRRAHMKHQLDWSSYETA
FT                   GQGDAYAGIPATGGDFAKAVAVCISDRSCLKKPKGVMCPSFRATDEAAHSPGERVKVLK
FT                   DALNGEFGDNPFADPRIRDALELCVGCKGCKRECANQVDMAAIKIEVLAQRNAALGVSP
FT                   RDRLFASLPRLLGERRWLASLVRWRNRSPWLARLGERWLGIAAGRALPEPAAQPYAAPA
FT                   ARATAPADTADDRRVILFVDTFARHFEPEIAAAAHAVLDAAGYQVEVLAPAAADGEQRP
FT                   LCCGRTWLSLGQVDAARAEARRMQAALRPALEKGWPVVGLEPSCILSLRDDHLKLGLGA
FT                   EAEALAKQVYLFEEFIAREHDRKRLQLKLKPLAGGKTLVHGHCHQKAVGAMKSLRKVLR
FT                   LIPEFDFEFVEASCCGMAGHFGLEAEHAEISRRMAELDLLPALRAAPDAPVLANGFSCR
FT                   HQIREGVARQPRHVALLLQAALA"
FT   CDS_pept        75089..75535
FT                   /transl_table=11
FT                   /locus_tag="azo0063"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical protein. No good homology to the data
FT                   bank. No domains predicted. No TMHs Probable signal
FT                   peptide."
FT                   /db_xref="EnsemblGenomes-Gn:azo0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92681"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1H6"
FT                   /protein_id="CAL92681.1"
FT                   /translation="MSDSSDAFRAAGALPIHPATAAVPAADIGRALWCAGLLGNLHDAG
FT                   VAISLCTSGWDQAAFFESRAARKKALQCLNVMVDSARDLPDAVTARLGRIDWLAWEALR
FT                   AVLKARTADERDRLWYAIGTLVPATVIELRRYRRQMPQLFEFSL"
FT   CDS_pept        complement(75546..76649)
FT                   /transl_table=11
FT                   /locus_tag="azo0064"
FT                   /product="probable permease"
FT                   /function="predicted permease"
FT                   /note="Hypothetical protein ydiK.Integral membrane protein
FT                   (potential). similarity:belongs to the upf0118 (perm)
FT                   family TREMBL:Q7WQ94: 68% identity; 81% similarity.
FT                   PIR:AD2790; AD2790.C97569; C97569. InterPro:IPR000585;
FT                   Hemopexin. IPR002549; UPF0118. Pfam: PF01594; UPF0118;
FT                   2A0604s01: protein-export membrane pro Pfam: presence of
FT                   DUF20 domain and branched chain amino acid transport.
FT                   TIGRFAM: general nitrate transport. Signal P predicted
FT                   signal peptide and TMHMM predicted transmembrane helices."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92682"
FT                   /db_xref="GOA:A1K1H7"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1H7"
FT                   /protein_id="CAL92682.1"
FT                   /translation="MPSIFPAHLVARWLLFLLLLAGVYFLSGFIVPVLAALIIGFASWP
FT                   LYERLLRRCGGRSAVAASLALMTVILVLVVPLSLAGSYAMREADTLIEWLLAANRNGMA
FT                   PPRWVEALPLVGGRLAALWQEYLGAPQALGEWVQILSGQHLGNIYRILLAATGDLLHAV
FT                   LTLLFMLITLFFIYKDGDRIAAQLDRVGEQVLPARWQRFSRVVPATVSATVTGMGLIAI
FT                   GEGVVLGLAYWIAGVPSPVLLGVATAFMALIPGGAPLAFTLVSLYLVGSGDPMAGLALF
FT                   TWGTCELFIVDKTLRPRLVGGPVKLPFLPTFFGLVGGVKTMGLVGLFVGPVLMALLVAI
FT                   WREWLHHTEEEAAAAVGIEDGRPASDA"
FT   CDS_pept        complement(76751..77287)
FT                   /transl_table=11
FT                   /locus_tag="azo0065"
FT                   /product="conserved hypothetical protein"
FT                   /note="64% similarity with ABC-type multidrug transport
FT                   system, ATPase and permease components [Dechloromonas
FT                   aromatica RCB]. and"
FT                   /db_xref="EnsemblGenomes-Gn:azo0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92683"
FT                   /db_xref="InterPro:IPR021332"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1H8"
FT                   /protein_id="CAL92683.1"
FT                   /translation="MSTDGTACSPRPWPQVPACYGWLSLDRRGRWRLQGEPVTHRGLLA
FT                   FLNQHYASEEDGAWFVQNGPQRVFVRLDYTPFVLRMGADGGLLTHTEAAAGPASAVHVD
FT                   DEGSVLIATAAGIGLLDDRELPAFVDECRGADGAAAEIEAVLACAGVSWRGLPLQPIGR
FT                   AEVAARYGFRADPQP"
FT   CDS_pept        complement(77284..78402)
FT                   /transl_table=11
FT                   /locus_tag="azo0066"
FT                   /product="probable enoyl-CoA hydratase/isomerase"
FT                   /function="Enoyl-CoA hydratase/carnithine racemase"
FT                   /EC_number="4.2.1.17"
FT                   /note="Enoyl-CoA hydratase and 3-2trans-enoyl-CoA isomerase
FT                   are two enzymes involved in fatty acid metabolism. ECH
FT                   catalyzes the hydratation of 2-trans-enoyl-CoA into
FT                   3-hydroxyacyl-CoA and ECI shifts the 3- double bond of the
FT                   intermediates of unsaturated fatty acid oxidation to the
FT                   2-trans position.In Escherichia coli (gene fadB) and
FT                   Pseudomonas fragi (gene faoA), ECH and ECI are also part of
FT                   a multifunctional enzyme which contains both a HCDH and a
FT                   3-hydroxybutyryl-CoA epimerase domain. InterPro: Enoyl-CoA
FT                   hydratase/isomerase Entry name TREMBL:Q8PMW0 Prim.
FT                   accession # Q8PMW0 InterPro IPR001753; EnCoA_hydrtse. Pfam
FT                   PF00378; ECH; 1 Identities = 169/379 (44%) Number of
FT                   predicted TMHs: 0 Signal peptide probability: 0.000"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92684"
FT                   /db_xref="GOA:A1K1H9"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR032259"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1H9"
FT                   /protein_id="CAL92684.1"
FT                   /translation="MTAAVLLREIPTACGRRFGHATLNAERALNALSLEMIDLLAPQLD
FT                   AWAADPDIVGVVLDGSGDKAFCAGGDVAALYRALRAHDGDAPPQAVTDFFEREYRLDYR
FT                   IHTYPKPLLCWGHGIVMGGGIGLLAGASHRVATLQTRMAMPEITIGLYPDVGGSWFLPR
FT                   MPGRAGLFLALTGAPLNAADARFAGLADFVLDHGARGGVLAALGATRWAGDAAADRLRL
FT                   DHLLGEFSVREGMPAAPLRTHLDRIEAVVGRGSLAEIAVRLHALAADPDPWLAAAAGSF
FT                   VRGAPSSAALSLELWRRARHLSLAEVFRLEYIVSVAATGRADFVEGVRALLIDKDRKPR
FT                   WQHADVGAVDTAFIADNFRARFDGAHPLADLA"
FT   CDS_pept        78461..79156
FT                   /transl_table=11
FT                   /gene="polC"
FT                   /locus_tag="azo0067"
FT                   /product="DNA-directed DNA polymerase"
FT                   /function="DNA polymerase III alpha subunit (gram-positive
FT                   type)"
FT                   /EC_number="2.7.7.7"
FT                   /note="DNA polymerase III polC-type (EC 2.7.7.7) (PolIII).
FT                   Required for replicative DNA synthesis. This DNA polymerase
FT                   also exhibits 3 to 5 exonuclease activity (By similarity).
FT                   InterPro: Exonuclease dnaq: DNA polymerase III epsilon
FT                   subun"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92685"
FT                   /db_xref="GOA:A1K1I0"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1I0"
FT                   /protein_id="CAL92685.1"
FT                   /translation="MHHGLRRRAIVRALRWISLTLVAAEDHLDTYAVIDFETTGMAPEH
FT                   GARPTEIAVVLVRNGCVIDRYQSLMNAGVHVPYEIQALTGITNAMVRAAPPLAQVMAQA
FT                   ADFVGSHALVAHNAAFDRKFWDAELDRLGRRREADFVCSLLLSRRVFPDSPNHKLGTLV
FT                   RTLGLPASGRFHRALADAEATAQLFARIAHTLCERYALAALDHALLMKIQKTARGALDG
FT                   CIARHRAAA"
FT   CDS_pept        complement(79164..79916)
FT                   /transl_table=11
FT                   /locus_tag="azo0068"
FT                   /product="Hypothetical protein"
FT                   /note="Hypothetical protein. No good homology with any hits
FT                   of this length protein. No Domains/Features/motifs/signal
FT                   peptide present."
FT                   /db_xref="EnsemblGenomes-Gn:azo0068"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92686"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1I1"
FT                   /protein_id="CAL92686.1"
FT                   /translation="MIESAPPSPRPGSLAAVRAQFVAAGRTLRNVRRDFAEWHGGRPRY
FT                   ALWAIPLDLPAVAARVAAADAHLAGLLLTGYRRQPHVTLALCGFPQRQPRRRDDYGPAA
FT                   LAAQLGSLRSAPPGPFEIEIGGLATFGSAPFLTVHDSGGGLAMVRARLAAADLNRPDGP
FT                   YTPHVTVGLYAGAWPAAEVLCRIDGFVAPPPLRLRVDRIALLTYDTRDIAGPLLQAAEF
FT                   DLRDGALLPGGAAAAGFDEAFFAPAEID"
FT   CDS_pept        80013..80393
FT                   /transl_table=11
FT                   /locus_tag="azo0069"
FT                   /product="conserved hypothetical globin-like protein"
FT                   /function="Truncated hemoglobins"
FT                   /note="Conserved hypothetical globin-like protein. Homology
FT                   to rpa2719 of R. palustris of 46% (tremblnew|CAE28161).
FT                   Interpro: IPR009050 Globin-like. Globins are
FT                   heme-containing proteins involved in binding and/or
FT                   transporting oxygen. This family of heme binding proteins
FT                   are found mainly in bacteria. No signal peptide. No TMHs"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92687"
FT                   /db_xref="GOA:A1K1I2"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1I2"
FT                   /protein_id="CAL92687.1"
FT                   /translation="MTELTEQHIRNLVHTFYGRARQHPSLGPVFNAAVSDWDHHLGVIV
FT                   DFWSNSLLHTQRYKGHAFPVHMNLPIKREHFGQWLELFREAARETLPEEAARAAIGRAE
FT                   FMAESFRAGLFPLDPPGRPLAG"
FT   CDS_pept        complement(80397..80645)
FT                   /transl_table=11
FT                   /locus_tag="azo0070"
FT                   /product="hypothetical membrane protein"
FT                   /note="Hypothetical membrane protein. no homology to the
FT                   data bank. no domains predicted.signal peptide. 1 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:azo0070"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92688"
FT                   /db_xref="GOA:A1K1I3"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1I3"
FT                   /protein_id="CAL92688.1"
FT                   /translation="MPRATPTLRQRKIFALTRILGGLVAALYLGYVVVANLAAGAPFDR
FT                   TLMFTAAVAAAGFGYAAWYLRDLQAVAREERAAANKE"
FT   CDS_pept        80784..82139
FT                   /transl_table=11
FT                   /locus_tag="azo0071"
FT                   /product="sigma-54 dependent response regulator"
FT                   /function="Response regulator containing CheY-like receiver
FT                   AAA-type ATPase and DNA-binding domains"
FT                   /note="Sigma-54 dependent response regulator,"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92689"
FT                   /db_xref="GOA:A1K1I4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1I4"
FT                   /protein_id="CAL92689.1"
FT                   /translation="MNPESAPASAPQQSVLVVDDEQGMRNFLSRALALRGFVVDTAESA
FT                   EEGAEKLAATRFDLVILDIALPGKAGIEWLQDLTAAGFAGEVILITAFADMQTAIDALR
FT                   AGAADFILKPFRIDQILNSIHRSTERARLARENFLLRRQVAGSGSASDGMIGASPAIGQ
FT                   LRQILHRIAPTPSTVLIQGESGVGKEVVARALHQLSPRAEQPFVAVNCAAISAELIESE
FT                   LFGHVKGAFTGAREARNGLFHYAHGGTLFLDEIGELPLALQSRLLRVLEERKVRPVGTE
FT                   QEVPVDVRVLAATNRDLRAEVAACRFREDLFYRLEVITLTVPPLRERAEDVPALAAAFM
FT                   QQLAMQLGLPPLLISPEVSARLMAHPWPGNVRELRNFVERSLLFGDFPLASLAGAVAPP
FT                   PPASAAPLLLEEVEKRHILAVLDQCGGNKTRAAELLGVSRKTLERKCAEWSV"
FT   CDS_pept        82158..84344
FT                   /transl_table=11
FT                   /locus_tag="azo0072"
FT                   /product="putative sensor histidine kinase"
FT                   /function="Signal transduction histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="Putative two component sensor histidine kinase,"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92690"
FT                   /db_xref="GOA:A1K1I5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1I5"
FT                   /protein_id="CAL92690.1"
FT                   /translation="MAERALRRWRKRWPVPRSVRARLLLLVLAPLLIGVPVLLGIVWVW
FT                   GTHGYDRLLVNKVSADLLTARQYFERVQQGVAGDLAAVASSHALALALQGQGPDSVEVL
FT                   LDTSASRLGLDYLLFLDPQGRVTVPSAPLPSALAERGNWPAVRSALQGRAEHTLAVFPP
FT                   EHLEALDPALRAHATLGLVPTQRAAPDPRPREERGLMVQVAVPVTDLGGRLLGVLEGGV
FT                   MLNRNLGIVDRINAAVYQDSSLPLDSQGTATLFLDDIRIATNVRLFEGSRALGTRVSAA
FT                   VRDKVLGRGETWLGSAFVVNADYISGYAPLFDGDGKAVGMLYVGFLQAPLQQALYLALG
FT                   GLFLVFLLLSGLGTLAAVRWARSIFQPIERMAAVMGRIESGEEQARVGAVVRDDELGGL
FT                   ARSFDRLLDLLAARRAELQRWGQELDSKVAARTAELEAANATLRRAHQQLVMNEKLTAI
FT                   GELTAGVAHEINNPVAVIQGNLELVRELLGGDSAPVADELAQIDAQVGRIHGIVTKLLQ
FT                   FARPGDFAGYTEQVDASGLVGDCLLLTRHNLSRGRIEVTTALDARGTVEINRGELQQVL
FT                   INLIVNAMQAMPDGGRLRLSTADIDEGGEDDDAGHGAGRNGKSEHRHGFAGVCIRVEDT
FT                   GCGIAADDLDRIFDPFFTTKKQEGTGLGLSISYAIVTRYGGHLNVDSQPGQGTRFTVCL
FT                   RREARFDGEPSAPGFASRFFRSAGIDNLNDGHHD"
FT   CDS_pept        84372..85583
FT                   /transl_table=11
FT                   /locus_tag="azo0073"
FT                   /product="putative MFS permease"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /note="Permease,member of the Major Facilitator
FT                   Superfamiliy (MFS)transporters. MFS are single-polypeptide
FT                   secondary carriers capable only of transporting small
FT                   solutes in response to chemiosmotic ion gradients. Probable
FT                   sugar-proton symporter transmembrane protein ProP
FT                   proline/betaine transporter. Low homology to the
FT                   hypothetical protein ycxA (ORF5)involved in the
FT                   biosynthesis of the pepitde antibiotic Bacitracin in B.
FT                   subtilis. Signal peptide"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92691"
FT                   /db_xref="GOA:A1K1I6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1I6"
FT                   /protein_id="CAL92691.1"
FT                   /translation="MLRTLNQPGLWLITLTAAGILMVTMGVRQSTGLFVSPLNSATGLG
FT                   ITTISFALAIAQFTWGAVQPLAGAAADRYGPGPVLAGGILLLALGSALTPFMQSSFGLV
FT                   VSLGLLSAMGSGAASFSVLIGAAAQRLPLEARGAASGVVNAGGSFGQFVFAPIAQKLIQ
FT                   GVGWMGAMWGLALLTLAALPLVRKLVPPGSHPRHTASDGSLRRALGEALRDRSYRLLHL
FT                   GFFTCGFHIAFLVTHLPGEVALCGLPADVASWSLAIIGLANIAGSIYAGGCVARYRSKH
FT                   ILFWMYASRAVLVALYLMAPKTAMTFYLFAAGLGFTWLATVPPTAAIVGKLFGVRHLGT
FT                   LFGLTLLSHQIGGFLGAWLGGIAVSLQGDYTWMWYADMALAAAAALVNLPIREAPVAVA
FT                   PAAA"
FT   CDS_pept        85691..87382
FT                   /transl_table=11
FT                   /locus_tag="azo0074"
FT                   /product="conseved hypothetical exported protein"
FT                   /function="uncharacterized protein containing a von
FT                   Willebrand factor type A (vWA) domain"
FT                   /note="Hypothetical protein yfbK. The von Willebrand factor
FT                   is a large multimeric glycoprotein found in blood plasma.
FT                   Mutant forms are involved in the aetiology of bleeding
FT                   disorders [1]. In von Willebrand factor, the type A domain
FT                   (vWF) is the prototype for a protein superfamily.
FT                   trembl:Q8P6Q2: 55% identity; 66% similarity
FT                   InterPro:IPR002016; Peroxidase. IPR002035; VWF_A. Pfam:
FT                   PF00092; VWA; 1. SMART: SM00327; VWA; 1. cdhD: CO
FT                   dehydrogenase/acetyl-CoA syn Signal peptide present (0.927
FT                   probability); SignalP predicted. No transmembrane helices
FT                   (TMHMM predicted)."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92692"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR021908"
FT                   /db_xref="InterPro:IPR022156"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1I7"
FT                   /protein_id="CAL92692.1"
FT                   /translation="MNTARHRIVLLALPLLFACSAQEPLRPLVQEPAAASASGEQADRA
FT                   AEAAAPAAPPPVAPARVQRHDAMGAAKIAPPAVAPLPLAEPADRERYQAIERHGIQRVA
FT                   EAPVSTFSIDVDTGSYSNLRRMLNAGQLPPRDAVRVEELVNYFPYRYSLPQGDAPFAVD
FT                   TEIAPTPWNPRSLLLRVGIQAADPAKQALPPANLVFLVDVSGSMNSPDKLPLLQNALKL
FT                   FVAQLRPQDRVALVTYASGTRVVLEPTAGDRKAAITAAIDGLVPGGATAGAAGIDLAYR
FT                   MAEQGFVEHGINRILLATDGDFNVGITRFETLKDRVAERRKSGIALSTLGFGGGNYNDQ
FT                   LMEQLADAGDGAYRYIDSLAEAQKVLVDEFTSTLATVASDVKIQLEFNPAQVAEYRQIG
FT                   FENRKLRREDFANDKVDAGEIGAGHRVTALYEITLAGQPGAIEPLRYGQRAATPARATS
FT                   GELAFLRLRYKPAHGAASRLLEVPLARSQIRSQGSDDFRFAAAVAAFGQRLGDGGRYLG
FT                   DFDFAAIGALAAAARGDDRYGHRGEFLNLVRLAGSLASAPQAAARE"
FT   CDS_pept        87379..87978
FT                   /transl_table=11
FT                   /gene="rpoE"
FT                   /locus_tag="azo0075"
FT                   /product="probable RNA polymerase sigma-E factor
FT                   (sigma-24)"
FT                   /function="DNA-directed RNA polymerase specialized sigma
FT                   subunit sigma24 homolog"
FT                   /note="Probable RNA polymerase sigma-E factor (sigma-24),"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0075"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92693"
FT                   /db_xref="GOA:A1K1I8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1I8"
FT                   /protein_id="CAL92693.1"
FT                   /translation="MNDGALSGGAADDGALMLAYAAGDAAAFEQLYARHRRGLYAYLQR
FT                   QAPRPGWVDDLFQETWLAVIGARAGYRPSAAFRTWLYGIARNKLIDRIRRSDAVLLSDF
FT                   LADDGDDGELLDRLGADAGHDPAQLLARRRDGDALHAALRTLPAPQREVFLLREQADMS
FT                   LTEIAALVGVPLETAKSRLRYAIARLRAALAEEVAG"
FT   CDS_pept        87975..88751
FT                   /transl_table=11
FT                   /locus_tag="azo0076"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="Conserved hypothetical membrane protein. Homology to
FT                   BB3269 of Bordetella bronchiseptica of 31%
FT                   (trembl|Q7WHD9(SRS)). No domains predicted. no signal
FT                   peptide 1 TMH"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0076"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92694"
FT                   /db_xref="GOA:A1K1I9"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1I9"
FT                   /protein_id="CAL92694.1"
FT                   /translation="MTRPTPEHEPQDAAVSAAFRGLDTPEPPPALDAAILAAARAAVAE
FT                   APPSSAEVVAFPRRRRETRRWLALAATLVLAVGVSWQLRDSADHGLPAPAPATAPVEQE
FT                   APAVLATPPATEAEQRAAKPAAPAPARRAESAAAPAPRAEPQAAAEAAPPVAAPPAPAA
FT                   TAPAAPPLAAPAAAEATADAAAPAAKALAPAIAAQRARADHTDGAEAEREAAITTIRRL
FT                   LAAGRPDEARERLQDFRRRWPDAVLPPDLTALAAAP"
FT   CDS_pept        complement(88772..88993)
FT                   /transl_table=11
FT                   /locus_tag="azo0077"
FT                   /product="Hypothetical protein"
FT                   /note="Hypothetical protein. No Good homologs. No
FT                   Domains/Features/Motifs reported present."
FT                   /db_xref="EnsemblGenomes-Gn:azo0077"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92695"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1J0"
FT                   /protein_id="CAL92695.1"
FT                   /translation="MSRKHKQRRDLPLVVPPSPPPRNPLATAPKMRRGVQVHDKSRGAL
FT                   RRAEHMALRRLAVPAVHGEEGDDSDEDG"
FT   CDS_pept        complement(89004..89966)
FT                   /transl_table=11
FT                   /locus_tag="azo0078"
FT                   /product="Hypothetical protein"
FT                   /note="Hypothetical protein. Weak homology with hits over
FT                   entire length. PS50821; PAZ domain present(Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:azo0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92696"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1J1"
FT                   /protein_id="CAL92696.1"
FT                   /translation="MQMQEIDSLRALLPRGRTLFPYFKDKYSLQLLRYALPRPTAVAAL
FT                   RGHAAAQLLQKPALRALLAGCGGMLDRATVDAAWLPGMLQPEHYTLSLGVWGNGRWRAA
FT                   QTSRRGANLVLQLNFNHGHNRAFGRLVRPHGGEDPFNAWGHPALRDPTAPEPRYTLAWA
FT                   RLDVDFERGEALIEELQTDWLRRAARVRDNALRLDDATFARRYQRSFGGSRADVVAYHD
FT                   RHLAPHRALWDEALLAATLFFLREELGIADIWMHTPRSGVLLKDIRHGAAPPVSVYSSL
FT                   PQRFCFRPGTTLPAFLAADRSVLRRLRRAEGVQLLKFSL"
FT   CDS_pept        complement(90144..91352)
FT                   /transl_table=11
FT                   /gene="rtcB"
FT                   /locus_tag="azo0079"
FT                   /product="rtcB protein"
FT                   /note="rtcB protein, 57% identical(70% similairty) to
FT                   TrEMBL;Q7NZ85 TrEMBL;Q8FCS7(56% identity). Has
FT                   IPR001233;UPF0027(PF01139, Uncharacterized protein
FT                   family):A number of uncharacterized proteins including
FT                   Escherichia coli rtcB, Mycobacterium tuberculosis
FT                   MtCY441.01., Caenorhabditis elegans F16A11.2 and
FT                   Methanococcus jannaschii MJ0682 belong to this family. Has
FT                   no Signal peptide or TMH present."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0079"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92697"
FT                   /db_xref="GOA:A1K1J2"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1J2"
FT                   /protein_id="CAL92697.1"
FT                   /translation="MAIQLTLNKGRVPIKLWTRDIEHEALQQLVNLSQLPIVDHPIAAM
FT                   PDVHAGIGATIGSVIPTAHAIIPAAVGVDIGCGMNALRLSLDAGRLPDNLGRLRSAIEA
FT                   AVPVGFEQHDESRVRGSAHARQARRLGDRLDAIVGRHPGLMKMQRRFNTTWICQLGSLG
FT                   GGNHFIELCVDEADQLWVMLHSGSRGIGNVIGRYFIAAAKKDMGRHLHALPDKDLAYFS
FT                   EGSALFDDYVDAVHWAQDYAMENRRMMMALVVEAIRPLLPAFSITEEAINCHHNYVARE
FT                   THFGESLYVTRKGAIRAGAGELGIIPGSMGVKSYIVRGLGNAASYCSCSHGAGRRMSRS
FT                   EAKRRFSRFDLEAQTAGVECRKDGGVIDEIPAAYKNIDEVMANQTDLVEVVHTLKQVLC
FT                   VKG"
FT   CDS_pept        91812..93434
FT                   /transl_table=11
FT                   /gene="prfC"
FT                   /locus_tag="azo0080"
FT                   /product="peptide chain release factor"
FT                   /function="Peptide chain release factor RF-3"
FT                   /note="Peptide chain release factor 3 (RF-3). Increases the
FT                   formation of ribosomal termination complexes and stimulates
FT                   activities of RF-1 and RF-2. It binds guanine nucleotides
FT                   and has strong preference for UGA stop codons. It may
FT                   interact directly with the ribosome. The stimulation of RF-
FT                   1 and RF-2 is significantly reduced by GTP and GDP but not
FT                   by GMP"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92698"
FT                   /db_xref="GOA:A1K1J3"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1J3"
FT                   /protein_id="CAL92698.1"
FT                   /translation="MSSTPFPPELLRDVDKRRTFAIISHPDAGKTTLTEKLLLFGGAIQ
FT                   LAGTVKARKSARHATSDWMEVEKQRGISVTSSVMQFEYQDHTINLLDTPGHEDFSEDTY
FT                   RVLTAVDAAVMVIDAAKGVEAQTIKLLEVCRLRNTPIITFVNKMDREVREPFELLAEIE
FT                   DVLKISCAPVTWPIGMGKAFRGVYHLLQDHVLTFTPGEERRSDAEVLSGIGNPELDARF
FT                   PMEIGQVRENVDLLNDASPPFDLDEFLAGKQSPVFFGSGINNFGVQEILQALIDWAPPP
FT                   QQRIAGTKGNDTRMVQPAEPAFTGFVFKIQANMDPKHRDRIAFFRICSGRYQSGMKVKH
FT                   VRAGREMKLANALTFMANERVLKDDGVAGDIIGIHNHGQLQIGDTLTEGEILGFKGIPY
FT                   FSPEMFRAARLRDPLKSKQLQKGLQELGEEGAIQVFEQDGGQMLLGAVGQLQFEVVAQR
FT                   LKDEYKVDAIFETADIHTARWLTFPDDLTRRNFEREQALRLGKDVDGNLVYLASSRYNL
FT                   EVTREKWPTVGFHATREHGQVIA"
FT   CDS_pept        93454..93981
FT                   /transl_table=11
FT                   /locus_tag="azo0081"
FT                   /product="conserved hypothetical membrane protein"
FT                   /function="predicted aspartyl protease"
FT                   /note="Conserved hypothetical membrane protein. Homology to
FT                   pa4965 ao P. aeruginosa of 50% (trembl|Q9HUK0) Pfam:
FT                   Retroviral aspartyl protease no signal peptide 1 TMHs"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0081"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92699"
FT                   /db_xref="GOA:A1K1J4"
FT                   /db_xref="InterPro:IPR011969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR034122"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1J4"
FT                   /protein_id="CAL92699.1"
FT                   /translation="MSNTDHADTRRLGRVMAWLAALALLGLLWLYFENELEHRNNPNRG
FT                   LVADPGGGAELVLKRNRAGHYVAPGTINGRPVTFLLDTGASQVSVPARLADQLDLKPGA
FT                   PAQVMTANGAVQVRLTRIDELVLGPFRVRGVQGHLNPGMNAHDEILLGMSVLKALEFTQ
FT                   RGDTLILRAPTP"
FT   CDS_pept        complement(94431..95405)
FT                   /transl_table=11
FT                   /gene="rdgC"
FT                   /locus_tag="azo0082"
FT                   /product="recombination associated protein RdgC"
FT                   /function="DNA recombination-dependent growth factor C"
FT                   /note="Recombination associated protein rdgC. Not known;
FT                   may be involved in recombination (By similarity). hemC:
FT                   porphobilinogen deaminase."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92700"
FT                   /db_xref="GOA:A1K1J5"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1J5"
FT                   /protein_id="CAL92700.1"
FT                   /translation="MWFKNLQLYRLPAPWDISLERFEEQLAKRRFQPCGSQDMESRGWV
FT                   APVADDVLVHPVGDQWLIALGVEGKLLPSSVVKQVADERAEEIAEQQGYKLGRKQLKEL
FT                   REQVTQELLPRAFTRRRRIHAWIDPVHGWLAVDASSAARAEDVLEHLRQTLDSLPLALL
FT                   RTERSPSSAMADWLAGGEAPANFTIDQDCELRSVTEDKAAVRYVRHTLEGDEIKGHLTA
FT                   GKLPTRLAMTFDDRVSFVLTEKLEIKRLDFLDVVRDQIDGEAEDAIALFNAEFALMTGE
FT                   LQKLLPAVVDALGGELATPEVQPAVTAFDRPAVEPALAGDPPF"
FT   CDS_pept        complement(95476..95943)
FT                   /transl_table=11
FT                   /locus_tag="azo0083"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92701"
FT                   /db_xref="InterPro:IPR015075"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1J6"
FT                   /protein_id="CAL92701.1"
FT                   /translation="MKFEHLVEVNDLADPHTTRLTREELWFGLLCRAEDARPFLPGLES
FT                   CRIVERSPNELVRDLHFGAAVIRDRVRFAELEWISFESEANAEHAGGSLTIRIEEPQPG
FT                   ALFLRFIYATTLPDVGGEDAKYADIVRSAYHQSDLDTLKMIRMIAESGRLQ"
FT   CDS_pept        96022..96768
FT                   /transl_table=11
FT                   /gene="rsuA"
FT                   /locus_tag="azo0084"
FT                   /product="pseudouridylate synthase"
FT                   /function="16S rRNA uridine-516 pseudouridylate synthase
FT                   and related pseudouridylate synthases"
FT                   /EC_number="4.2.1.70"
FT                   /note="Ribosomal small subunit pseudouridine synthase A (EC
FT                   4.2.1.70) (16S pseudouridylate 516 synthase) (16S
FT                   pseudouridine 516 synthase) (Uracil hydrolyase).
FT                   Responsible for synthesis of pseudouridine from uracil-516
FT                   in 16S ribosomal RNA."
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0084"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92702"
FT                   /db_xref="GOA:A1K1J7"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1J7"
FT                   /protein_id="CAL92702.1"
FT                   /translation="MQAMQIERLLHSQGFGSRKDCRALLRAGYVSVAGVPCDDPRAEFD
FT                   PGSKDGSPGLEFTVDDEIWHFRAQAYLMLHKPAGYECSHKPTFHPSVFTLLPPQLLNRG
FT                   VQCIGRLDQDTTGLLLLSDDGQFIHQWSSGKKRTPKVYEIGLKHAADDALVAALLAGVE
FT                   LHDEPTPIAAAACEITASHALRLTITEGKYHQVKRMVAAAGNRVETLHRSRVGGLTLDP
FT                   ALKPGEWRWLEAADIAALAAGAADGD"
FT   CDS_pept        97020..98186
FT                   /transl_table=11
FT                   /locus_tag="azo0085"
FT                   /product="conserved hypothetical protein"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /note="Conserved hypothetical protein. Homology to RS04117
FT                   of R.solanacearum of 52% (tremble:Q8Y0H4) No domains
FT                   predicted. No signal peptide. No TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:azo0085"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92703"
FT                   /db_xref="InterPro:IPR016633"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1J8"
FT                   /protein_id="CAL92703.1"
FT                   /translation="MNPIAPQTPPEWEIFCRVVDNYGDIGVCWRLARMLAATGATVRLW
FT                   VDDWSALGRLCPAVADATGAALLAGVELRQWSSPFPAPAPGANVIEAFACELPSSQVHA
FT                   MARCSPPPAWINLEYLSAEDWVAGCHRLASPHPALGLVKHFFFPGFDAGSGGLLREPGL
FT                   LAARDRYRAGGGRAALLQGLGLGADTADALVVSLFAYEQPALAELVGAWRHSPQPLVLL
FT                   VPEGRVLADLAGALGGDPLAVGERRRLDALQVAVLPFSDQDGYDRLLWSCDLNFVRGED
FT                   SFVRAQWAAAPFVWQIYRQPDDAHADKLDAFLARYAAGLDDAPRTALGRFWKAWNGEGS
FT                   AAAAWPDFAAALPLLADHTARWSAALAAQDDLATQLKRFCNHIRQPAG"
FT   CDS_pept        98247..98804
FT                   /transl_table=11
FT                   /gene="efp"
FT                   /locus_tag="azo0086"
FT                   /product="putative elongation factor P"
FT                   /function="Translation elongation factor P
FT                   (EF-P)/translation initiation factor 5A (eIF-5A)"
FT                   /note="Elongation factor P (EF-P). Involved in peptide bond
FT                   synthesis. Stimulates efficient translation and
FT                   peptide-bond synthesis on native or reconstituted 70S
FT                   ribosomes in vitro. Probably functions indirectly by
FT                   altering the affinity of the ribosome for aminoacyl-tRNA
FT                   thus increasing their reactivity as acceptors for peptidyl
FT                   transferase."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0086"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92704"
FT                   /db_xref="GOA:A1K1J9"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1K1J9"
FT                   /protein_id="CAL92704.1"
FT                   /translation="MKTAQELRSGNVIMVGSDPLVVQKAEYNKSGRNAAVVKMKLKNLL
FT                   TGAPSESVYKADDKFEVVQLDRKEVTYSYFADPMYVFMDADYEQFEVEAENMTDALKYL
FT                   EDGLQCEVVFYNGKAISVELPTTVVREVVYTEPAVKGDTSGKVMKPAKIATGFELPVPA
FT                   FVEIGDKIEIDTRTDEYKNRVK"
FT   CDS_pept        98928..99359
FT                   /transl_table=11
FT                   /locus_tag="azo0087"
FT                   /product="hypothetical secreted protein"
FT                   /note="Hypothetical secreted protein. Homology to RS00193
FT                   of R. solanacearum of 26% (tremble:Q8XVC9) PF02987, Late
FT                   embryogenesis abundant protein;IPR004238;Different types of
FT                   LEA proteins are expressed at different stages of late
FT                   embryogenesis in higher plant seed embryos and under
FT                   conditions of dehydration stress. The function of these
FT                   proteins is unknown. No TMHs Signal peptide present"
FT                   /db_xref="EnsemblGenomes-Gn:azo0087"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92705"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1K0"
FT                   /protein_id="CAL92705.1"
FT                   /translation="MSVRSSPTRVVALSLALTMLPLLPACSDGPGSEARRSAQEAASAA
FT                   REALDKAGEAAQKAGEAGKAALEAVEQGTRAGTERGGEKLEALTDATGEHARDAQEAAE
FT                   RAAQRIADATRDAARRLATAGRDAVEAVRRPDQGETGPR"
FT   CDS_pept        99435..105044
FT                   /transl_table=11
FT                   /gene="uvrA1"
FT                   /locus_tag="azo0088"
FT                   /product="putative excinuclease ABC subunit"
FT                   /function="Excinuclease ATPase subunit"
FT                   /note="UvrABC system protein A (UvrA protein) (Excinuclease
FT                   ABC subunit A). The UvrABC repair system catalyzes the
FT                   recognition and processing of DNA lesions. UvrA is an
FT                   ATPase and a DNA-binding protein. A damage recognition
FT                   complex composed of 2 uvrA and 2 uvrB subunits scans DNA
FT                   for abnormalities. When the presence of a lesion has been
FT                   verified by uvrB the uvrA molecules dissociate (By
FT                   similarity). InterPro: Excinuclease ABC A subunit"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92706"
FT                   /db_xref="GOA:A1K1K1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1K1"
FT                   /protein_id="CAL92706.1"
FT                   /translation="MSEPKDSIRIRGARQNNLRNLSLDLPLNRLTVVTGVSGSGKSSLV
FT                   FDTLYAEGQRRYVETFSPYARQFLDRMDKPQVDRIEGVPPAIAIDQTNPVRTSRSTVGT
FT                   MTELADHFKLLYARAAHLHCRQCGEPVRRDTPASIAADLAQRAAATGDPRLVVCFPVTV
FT                   PKNFSEAEVTALLNAQGYTRIQQRIEAADGDLLQVVQDRFRLSNVEPARLAEALEAALQ
FT                   RGHGRLAVYASGDAVPGGEAVWRYSSDLHCAPCDIHYAEPTPALFSFNSPIGACDTCRG
FT                   FGRVIGVDFGLVIPDESKTLAEGAVKPWQTQSFRECQDDLAKMAKKHGVAMDVPFRDLP
FT                   EEHRRWVLEGDDKWKSWDSSWPRYFYGVRHFFEWLETKAYKMHIRVLLSRYRSYTECPA
FT                   CHGARLKPEALLWRLPTAEGGLPIHSLFNLPVDKVRALIAALELPGLADEATELVLGEI
FT                   RSRLDYLADVGLGYLTLDRQSRTLSGGEVQRINLTTALGTSLVNTLFVLDEPSIGLHPR
FT                   DIGRILGVMTRLRDAGNTLVVVEHDPQLIVAADELLEIGPGPGERGGAIVARGTPAELA
FT                   ANPDSITGPWLAGRKTITVARPPLPVDTATPRLVLHGAREHNLKSLTVGFPLQRLVCLT
FT                   GVSGSGKSTLIQDVLHPALAKHFGEATESAANPAGAFERLTGTETLRGVVMVDQTPIGK
FT                   SSRSNPVSYVGAWDPIRNLFAALPEARQRGYTPGTFSFNSGNGRCPTCTGSGFEHVEMQ
FT                   FLSDVWLRCPDCEGKRYRPEVLELSWHGRSVADVLDMTVREALLFFIDQPKVLAALAPL
FT                   ADVGLDYLRLGQPVPTLSGGEAQRLKLAGHLAEAAQKKPARGRSADEAAPGLLFLFDEP
FT                   TTGLHFEDVATLLGAFGKLLEAGHSLVVIEHNLDVIAAADWIIDLGPEGGDGGGEIVAE
FT                   GPPAAVQQHPASHTGLALRDYAAALAETRRAATPAALAAAEPRAAYRPVAAPAIEIRHA
FT                   REHNLKNVSLQIPRDQFTVITGLSGSGKSTLAFDIVFGEGQRRYLESLNAYARQFVQPA
FT                   SRPDVDGLFGIPPTVAIEQRTSRGGRKSTVATLTEIHPFLRLLYVKLGTQYCPTCDVPV
FT                   TPQSFEAIVAQLMRDYRGASIEVLAPLVVNRKGLYTDLAKWARGKGYAQLRVDGDYLPT
FT                   AKWPRLDRYKEHNIELPVGMVVVEPDNEAALRQQVGEALEHGKGVLKVIELGKLGATPV
FT                   TFSTLRACPSCGTGFPEPDPRLFSYNAKHGWCPGCYGTGLKVAGKVEDPDALDLGDSEE
FT                   TIAGDEVCPSCEGARLNPVARAVRFRERGLHQLAALAVDKAADFFAALELAPREADIAR
FT                   DLVAEIRGRLDFLHHVGLGYLALDRAAPTLSGGEAQRIRLAAQLGSNLRGVCYILDEPT
FT                   IGLHPRDNHLLLGTLEALRDRGNTLLVVEHDEDTIRRADHVIDLGPGAGVRGGQVVAEG
FT                   RLPDLIAAPASATGACLRAPLQHPLRPRRAVPAGHPAIHVEGAHLHNLRDIAVRIPLAR
FT                   LTVVTGVSGSGKSSLARDVIHANLRGLLGDPDAVRARRRGQAQPAESAHALAGCRSISG
FT                   WQQVGRVLEVDQTPIGKTPRSCPATYVGFWDAIRKLFADTFDARTHGWNASRFSFNTGA
FT                   GRCPVCDGAGQTTVEMNFLPDVKTPCEACDGARFNPETLSVRWRGKTVAEVLAMPVDEA
FT                   VAFFAAHPAIAHPLQLLQDVGLGYLTLGQPSPTLSGGEAQRIKLVTELAKVRKRPGDAD
FT                   DTDGLPLPADKHSLYVLDEPTVGLHMADVDKLIRVLHRLTDAGHTVLVIEHDLDVMAEA
FT                   DWLIDLGPEGGDGGGAVVAEGPPEVAIATAASHTGRHLREFLASRAAAAEPNPA"
FT   CDS_pept        105090..105788
FT                   /transl_table=11
FT                   /locus_tag="azo0089"
FT                   /product="conserved hypothetical hydrogenase cytochrome
FT                   b-type subunit"
FT                   /function="Cytochrome b"
FT                   /note="Conserved hypothetical hydrogenase cytochrome b-type
FT                   subunit. Homology to C. vinosum of 56% (trembl|Q46471).
FT                   Involved in electron transfer from hydrogen to oxygen.
FT                   probable signal peptide probable 4 TMHs"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92707"
FT                   /db_xref="GOA:A1K1K2"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1K2"
FT                   /protein_id="CAL92707.1"
FT                   /translation="MNKKLIRVWDLPTRLFHWLLLALVVAAFVTGMIGGNFIVWHGWLG
FT                   IAISGLLAFRLTWGLVGSTYARFAHFVPGPQRILAYLRGHWRGVGHNPLGALSVLALLG
FT                   VLAFQVGSGLVANDDIAFSGPLAPLVSEEVGAWLTGLHRQNIWVILALVGLHVGAIVFY
FT                   VRAKKDNLVKPMITGMKEVADGGVKSAEGGGVIPFVIALAVAAAVVWVTAGGLVPPPPP
FT                   PAPAEAAPAW"
FT   CDS_pept        complement(105850..106314)
FT                   /transl_table=11
FT                   /gene="cycA1"
FT                   /locus_tag="azo0090"
FT                   /product="probable cytochrome c'"
FT                   /function="Cytochrome c556"
FT                   /note="Probable cytochrome c'. Homology to cycA of C.
FT                   vinosum of 61% (sprot|CYCP_CHRVI). CYTOCHROME C IS THE MOST
FT                   WIDELY OCCURRING BACTERIAL C-TYPE CYTOCHROME. CYTOCHROMES C
FT                   ARE HIGH-SPIN PROTEINS AND THE HEME HAS NO SIXTH LIGAND.
FT                   THEIR EXACT FUNCTION IS NOT KNOWN. Pfam: Cytochrome c.
FT                   signal peptide no TMHs"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0090"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92708"
FT                   /db_xref="GOA:A1K1K3"
FT                   /db_xref="InterPro:IPR002321"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="InterPro:IPR012127"
FT                   /db_xref="InterPro:IPR015984"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1K3"
FT                   /protein_id="CAL92708.1"
FT                   /translation="MKKIIARIAFGMAAFALASAASAQVKPEDQIKYRKAGYSYMMSWN
FT                   MGKIKANLEGSYNKDQVAAAANAIAGIANSGMGALYGPGTEKAVGGQTTRVKPAMFTDK
FT                   EGVTKVAVDFNKAANNLAKVAADGDAAAVKVAFGEVGKTCKACHDQYREE"
FT   CDS_pept        106574..108199
FT                   /transl_table=11
FT                   /locus_tag="azo0091"
FT                   /product="probable methyl-accepting chemotaxis protein"
FT                   /function="Methyl-accepting chemotaxis protein"
FT                   /note="Methyl-accepting chemotaxis protein,"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0091"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92709"
FT                   /db_xref="GOA:A1K1K4"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1K4"
FT                   /protein_id="CAL92709.1"
FT                   /translation="MGRLANTPIWLRLTGAIWLMLVLAWGSMIAWETRANRDIAIEQAK
FT                   DFARSVNEMTMAGLTGMMITGTVAQRDVFLDQIKELSAVRDLEVIRGEAVSKLFGPGAG
FT                   AASEPPDAVEREVLAGGEPVMRVENDAQNGEHLRVVIAARASHNYLGKDCILCHQVAEG
FT                   TPLGAVSMRISLDKVNAAVTSFRNQSIVFAVLVSLPLLAVVFLFIRRFVIRPLDHLGAG
FT                   MAEIAQGEGDLTRRLARDGDDEIGRTAEVFNRMLATLAGLVRQVGESASQVTGSAASLA
FT                   SGAARVAESSHRQNDRSLSAAGAVEALTVDIARIAESTERVRERSRESLARSLEGQHSL
FT                   AQLIGEVGHVEGAVQHMATAVDAFMQSTSAITRMTQEVREIAEQTNLLALNAAIEAARA
FT                   GEQGRGFAVVADEVRKLAEKSAHSAGGIDAITREIGQQSDSVNQAIARGLEHLASSRRA
FT                   ADVVSGVLDAANAAVSEVGEGLDHIAATTAEQRRSSESVTASIEAIAGMARDNNAAIEE
FT                   TVAAARELEQLAARLQDSVSRFRV"
FT   CDS_pept        complement(108207..109646)
FT                   /transl_table=11
FT                   /gene="mucD1"
FT                   /locus_tag="azo0092"
FT                   /product="probable serine protease MucD"
FT                   /function="Trypsin-like serine proteases typically
FT                   periplasmic contain C-terminal PDZ domain"
FT                   /EC_number="3.4.21.-"
FT                   /note="Probable serine protease. Homology to mucD of P.
FT                   aeruginosa of 55% (AAC43718). Pfam: Trypsin; PDZ domain
FT                   (also known as DHR or GLGF) signal peptide no TMHs"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0092"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92710"
FT                   /db_xref="GOA:A1K1K5"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1K5"
FT                   /protein_id="CAL92710.1"
FT                   /translation="MRHPLAVTALALSLAGWIPAASLSSSAHAALFGDSSPASNRYGLP
FT                   DFGDLVEQVGPAVVNISVVQQQAGGDGGLANDPFYDFLRRFGVPTPEMPGQGAPRISRG
FT                   IGSGFIVSADGYVLTNAHVVGESGAEVTVTLVDKREFKARVVGTDKRTDVAVIKIDARN
FT                   LPTVKIGDAERSRVGEWVIAVGSPFGFDHSVTAGIISAKARRLPDENYVPFLQTDVAIN
FT                   PGNSGGPLFNLGGEVIGINSQIYSRSGGFMGISFAIPIDVAMKVKDQLVTHGRVQRGRL
FT                   GIAIQGVDKELAQSFGLPDARGALVANVEPDSAADKAGVKAGDVVLAVDGTRINDSADL
FT                   PRIIGDKRPGTRVRLEVWRDGRSREVSATLDELGAETAAAAPARPGRGESTGGKLGLTA
FT                   RPLSSQEAAQLGINGGLVVEAASGPAAKAGLERGDIVLAINNQPVTTVAQFRQLAEKAG
FT                   NRFALLVQRGSARIFVPVRLD"
FT   CDS_pept        complement(109778..111763)
FT                   /transl_table=11
FT                   /gene="irgA1"
FT                   /locus_tag="azo0093"
FT                   /product="putative TonB-dependent receptor"
FT                   /function="Outer membrane receptor for ferrienterochelin
FT                   and colicins"
FT                   /note="23% TonB_boxC. Pfam:PF00593; TonB_dep_Rec; 1."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0093"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92711"
FT                   /db_xref="GOA:A1K1K6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1K6"
FT                   /protein_id="CAL92711.1"
FT                   /translation="MSAHAEEGYFETLPVVLSVSRLPQAMEDTPGAVTVIDSELIAATG
FT                   YRDLARLFRLVPGMQVGQERANHHWVTYHGLGSDYPNQMQVLVDGRSVYSPYFFGGADW
FT                   GSLPIALEDIDRIEVVRGSDSAAYGSNAFLGVVNILTRHTGAETGNSVSLRGGTNGIAD
FT                   ATGRAVLHDGAMGLRVTAQHIEDRGMADLHDSQRIDVLNLRADLRVSAVDEVTVTAGMS
FT                   SGARSAGYEGTQFDVVAPRTARHEDGAVHLKWRRTLSPDDEWSLSWYRNREQSREDWLL
FT                   DSHKNLRPEVAYLRNLPRLVVTVDNDRDSLRDNIEFSQRLRPLDDLRLLWGTEWRRDWL
FT                   RAPMLFYGGDSHSQQEWRLFGNAEWRMAPRWLWNIGAMAEQIEGDRLRLAPRVFLNWQP
FT                   SPTQTWRAGYSRAWRQPTLFERSADIRVVHPQLGLIMLDHLPNPDIRPQRIDAWEVGFL
FT                   GQLPQQGSFDLRLFHERIEDFIVRRAVDPAELPDNDIQRAAGATRWVNSGDGVRLVGLE
FT                   YQLRTRPWSGGQLVLSHSLIRAHSDDDAVRRSVAPYTASLTWLQRYGPWQSTLSLLRMG
FT                   ASDSGSGYVPGYRYKVPAYTTLDWSIARTLQVGPNPVELRLTGINLLGKHQELVLRPLQ
FT                   SMPGYGDDRPANELDRQLHLSVRVGF"
FT   CDS_pept        111975..112913
FT                   /transl_table=11
FT                   /gene="oxyR"
FT                   /locus_tag="azo0094"
FT                   /product="putative oxyR"
FT                   /function="Transcriptional regulator"
FT                   /note="oxyR, Hydrogen peroxide-inducible genes activator.
FT                   BELONGS TO THE LYSR FAMILY OF TRANSCRIPTIONAL REGULATORS
FT                   REQUIRED FOR THE INDUCTION OF A REGULON OF HYDROGEN
FT                   PEROXIDE INDUCIBLE GENES SUCH AS CATALASE
FT                   GLUTATHIONE-REDUCTASE ETC. (BY SIMILARITY). mreB: cell
FT                   shape determining protein M 51% HTH_LysR. IPR005119;
FT                   LysR_subst. IPR009058; Wing_hlx_DNA_bnd. PF00126; HTH_1; 1.
FT                   PF03466; LysR_substrate; 1. HTH reporting nucleic acid
FT                   binding motif"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92712"
FT                   /db_xref="GOA:A1K1K7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1K7"
FT                   /protein_id="CAL92712.1"
FT                   /translation="MTLTDLRYLVALAHERHFGRAAEKCHVSQPTLSVAIKKVEDELGI
FT                   ALFERSASEVKITETGRRIVAQAEKVLVEASQIHEIAAAGKDPLAGPLRVGVIYTIGPY
FT                   LLPRLIPRVHQLAPRMPLIIQENYTTRLAEALKRGELDVIIISLPFEEAGIVAQPVYDE
FT                   PFRVLLPAAHPWTALDSIDPEHLAEDQLLLLGSGNCFREQVLEVCPHCRNVGGLQRTLE
FT                   GSSLETIRHMVATGLGVTVLPSSAADELTIQNPLVAVRPFTAPEPSRRVALAWRVTYPR
FT                   SGAIDILRTAILESELPGVRPIGRVPAVEAA"
FT   CDS_pept        complement(112981..115554)
FT                   /transl_table=11
FT                   /locus_tag="azo0095"
FT                   /product="DNA topoisomerase III"
FT                   /function="Topoisomerase IA"
FT                   /EC_number="5.99.1.2"
FT                   /note="DNA topoisomerase I (EC 5.99.1.2) (Omega-protein)
FT                   (Relaxing enzyme) (Untwisting enzyme) (Swivelase). THE
FT                   REACTION CATALYZED BY TOPOISOMERASES LEADS TO THE
FT                   CONVERSION OF ONE TOPOLOGICAL ISOMER OF DNA TO ANOTHER. MAY
FT                   PLAY AN IMPORTANT ROLE IN EITHER THE MAINTENANCE OF OR
FT                   EXPRESSION FROM THE VIRULENCE PLASMID. ITS INFLUENCE ON
FT                   EXPRESSION COULD BE SPECIFIC TUNING LOCAL SUPERHELICITY OR
FT                   MORE GENERALLY MODIFYING THE SUPERHELICITY OF THE ENTIRE
FT                   PLASMID IN RESPONSE TO ENVIRONMENTAL STIMULI THUS COULD BE
FT                   A FUNDAMENTAL FACTOR INVOLVED IN VIRULENCE. InterPro:
FT                   Prokaryotic DNA topoisomerase I"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0095"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92713"
FT                   /db_xref="GOA:A1K1K8"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1K8"
FT                   /protein_id="CAL92713.1"
FT                   /translation="MSKQLIIAEKPSVAQDIARALGGFTKEKDYFESDDYVLSSAVGHL
FT                   LELAVPEEFEVKRGKWTFAHLPVIPPHFALKPIEKTDDRLKLLTRLIKRKDVTGLINAC
FT                   DAGREGELIFNFIAQHAGTNKPMQRLWLQSMTPAAIRDGFAHLRAARDVEGLRNAAICR
FT                   AESDWLIGINGTRAMTAFNSKTGGFHLTTVGRVQTPTLAIVVEREDKIRKFKPRDYWEL
FT                   EATFGCAAGEYTGRWLDENFRKPEGDEHANAHRLWDKARAEAIRAKCEGKPGVVTEEAK
FT                   PSTQLSPLLFDLTSLQREANGRFGFSARVTLQLAQALYEKHKVLTYPRTDARALPEDYL
FT                   GTVKDVMAGLPDTYAPFANEIAKQGWVRPNKRIFNNAKISDHFAIIPTGTLPKSLSEAE
FT                   HKIYDLVTRRFLSVFYPAAEYQITTRITRVEGEAFKTEGKVLVNAGWLAVYGKEAANED
FT                   GEGKDAGKDSGRQLVAVKPGETVSTDDILVKALQTKPPARFNEATLLSAMEGAGKMVDD
FT                   EELRAAMAERGLGTPATRAQIIEGLIAEQYIHREGRELIPSAKAFSLITLLTGLGVNAL
FT                   TSPELTGGWEYKLSRMERGELSREAFMHEIAEMAREVVERAKRYESDTVPGDFVTLKTP
FT                   CPKCGGTVKENYKKFACQACDWSTWKIVAGRQFEIDEIETLLRDGKVGPLLGFRNKMGR
FT                   LFNAEIKLNDDKQPEFDFGQPKEGEEGGEAVDFSGQQSIGACPKCGANVFEHGLAYVCE
FT                   KSVGPGKNCDFRSGKIILQQPIEREQMAKLLTDGKTDLLKGFVSARTRRKFSAFLVRGK
FT                   DGKVGFEFEAKTPKAGAKSTPAKAAANEETGKPAPRKRAGGKTAG"
FT   CDS_pept        complement(115666..116133)
FT                   /transl_table=11
FT                   /locus_tag="azo0096"
FT                   /product="conserved hypothetical protein"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /note="Protein smg homolog, 45% identity (65% similarity)
FT                   to SwissProt;P30853 43% identity to SwissProt;Q8X8F6,E.coli
FT                   smg protein. Has PF04361(IPR007456):Protein of unknown
FT                   function (DUF494);Members of this family of uncharacterised
FT                   proteins are often named Smg. No signal peptide or TMH
FT                   reported present."
FT                   /db_xref="EnsemblGenomes-Gn:azo0096"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92714"
FT                   /db_xref="InterPro:IPR007456"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1K1K9"
FT                   /protein_id="CAL92714.1"
FT                   /translation="MFDILVYLFESYIHANACPASDQLARKLSAAGFEDEEINEALDWL
FT                   AGLRRVAAETHPCVAPSRSAVRLYSDYECTRLSAACRGFLTFLEGAGVLDAVSRELIVE
FT                   RAVALSNFTITLGRLKVIVLMVLWQREQPVDTLIIDELLSSDDDEGAPLLH"
FT   CDS_pept        complement(116194..117312)
FT                   /transl_table=11
FT                   /gene="drpA"
FT                   /locus_tag="azo0097"
FT                   /product="putative DNA processing protein DrpA"
FT                   /function="Protein involved in DNA uptake"
FT                   /note="Putative DNA processing protein DrpA (Smf protein).
FT                   Homology to drpA of H. influcenzae The SMF family (DNA
FT                   processing chain A, dprA) are a group of bacterial
FT                   proteins. In Helicobacter pylori, dprA is required for
FT                   natural chromosomal and plasmid transformation InterPro:
FT                   SMF family Tigerfam: dprA: DNA processing protein
FT                   DprA,putative Pfam SMF family no signal peptide no TMHs"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0097"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92715"
FT                   /db_xref="GOA:A1K1L0"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1L0"
FT                   /protein_id="CAL92715.1"
FT                   /translation="MPPGKDLAGWLRLALAPGLGPERQRRLLAAFGLPEAVFQSSRSAI
FT                   ASVIGNEAADRLLAPPDGKAIDAALAWADEPGNHILTLADADYPPALLEISDPPALLYL
FT                   KGEPALLQRPALAVVGARSATANGEANAAAFARALGEAGLVIVSGLAAGIDAAAHRGAL
FT                   AASGGAGTVAVIGTGPDRIYPASNAELARQIAQAGAILSEFPLGAPALRHHFPRRNRLI
FT                   AGLSLGVLVVEAAVGSGSLITARLATETGREVFAIPGSIHSPLARGCHRLIRDGAKLVE
FT                   TAEDVLEELRGRFSPAQHAPSTAAAGPDSAPPPPADPAAALVLALIGHEPVDIELLVQR
FT                   SGLTVDALYAILLPMELDGRIGRCAGSRFQRL"
FT   CDS_pept        complement(117316..118503)
FT                   /transl_table=11
FT                   /locus_tag="azo0098"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="Conseved hypothetical membrane protein. Homology to
FT                   RSO2271 of R. solanacearum of 36% (trembl|Q8Y3B1(SRS)).
FT                   Pfam: Lysin motif (SM00257) This domain is about 40
FT                   residues long and is found in a variety of enzymes involved
FT                   in bacterial cell wall degradation. This domain may have a
FT                   general peptidoglycan binding function. No signal peptide 1
FT                   TMH"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92716"
FT                   /db_xref="GOA:A1K1L1"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1L1"
FT                   /protein_id="CAL92716.1"
FT                   /translation="MQNFKRFDMHAHVLCRAGFRRRWGGLRSPCFDPWRQSGVPGRREP
FT                   SRTYRKRAMIRIIFPLLVSIATLFAGAAAAQGVQLADDAPDSYTVVKGDTLWGISGRFL
FT                   KQPWRWPEVWRFNRDQIRNPHLIYPGQVILLDRSGPWLTVGRRVGSRDEKLFPQVYSES
FT                   GTQPVPSIPLHVIDPFLTRPLIVDGARIANSATIVATETSRVYTGTGDTVFAKNVREGV
FT                   DSWQIYRPARALHDPVTQELLGYEAEYLGSARVTERGNPTTLEILNANEEIGVGDLMVP
FT                   SEPPSVFSYAPHAPEQAVEGRVVSIYRGVTETGRLHVVALGAGAQQGVERGHVLALYRN
FT                   RGVAEYKDDQGRESFQLPEKRYGLVFVFRVFDRISYGLIMETDGQVSIGDSIRKP"
FT   CDS_pept        118530..119033
FT                   /transl_table=11
FT                   /gene="def1"
FT                   /locus_tag="azo0099"
FT                   /product="probable peptide deformylase"
FT                   /function="N-formylmethionyl-tRNA deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="Probable peptide deformylase (EC 3.5.1.88). Homology
FT                   to def of E. coli of 54% (sprot|DEF_ECOLI(SRS)). Removes
FT                   the formyl group from the N-terminal Met of newly
FT                   synthesized proteins. Requires at least a dipeptide for an
FT                   efficient rate of reaction. N-terminal L-methionine is a
FT                   prerequisite for activity but the enzyme has broad
FT                   specificity at other positions Interpro: Formylmethionine
FT                   deformylase (IPR000181) Pfam: Polypeptide deformylase
FT                   Tigrfam: pept_deformyl: polypeptide deformylase no signal
FT                   peptide no TMHs"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0099"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92717"
FT                   /db_xref="GOA:A1K1L2"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1L2"
FT                   /protein_id="CAL92717.1"
FT                   /translation="MALLPILRYPDPRLHRRAAPVDTVDDDVRKLIDDMAETMYEAPGI
FT                   GLAATQVDVHRRVVVIDISEDKSGLMALINPQILERDGEQVCEEGCLSVPGVYEKVTRA
FT                   ERVTVRALDRNGHPFEVAAEGLLAVCIQHEIDHLDGKVFVEYLSPLKLGRIKSKLAKKA
FT                   RITA"
FT   CDS_pept        119079..120044
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="azo0100"
FT                   /product="Fmt protein"
FT                   /function="Methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="Methionyl-tRNA formyltransferase (EC 2.1.2.9).
FT                   Modify the free amino group of the aminoacyl moiety of
FT                   methionyl-tRNA(fMet). The formyl group appears to play a
FT                   dual role in the initiator identity of
FT                   N-formylmethionyl-tRNA by: (I) promoting its recognition by
FT                   IF2 and (II) impairing its binding to EFTu-GTP (By
FT                   similarity). InterPro: Methionyl-tRNA formyltransferase
FT                   fmt: methionyl-tRNA formyltransferase"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0100"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92718"
FT                   /db_xref="GOA:A1K1L3"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1L3"
FT                   /protein_id="CAL92718.1"
FT                   /translation="MSLPLRVAFAGTPEFAASALAAILDAGYSVPLVLTQPDRPAGRGM
FT                   KLTPSPVKQLALARGLDVDQPEKLRTDEQRQRLAACEPDVLVVAAYGLILPAAVLQLPR
FT                   YGCINIHASLLPRWRGAAPIHRAVEAGDAETGITIMQMDEGLDTGDMLLRRAIPIRPDD
FT                   TTGTLHDKLAALGAECIVEALAALPGGTLSRTPQPAAGVTYANKIHRDEAAIDWTRPAA
FT                   DIERAVRAFNPFPVAVGSLRDTVIKVWAAEVVAVPAPDAAPGTVLAADAEGVVVACGAQ
FT                   ALRLRELQRPGSRRFAAGEFLRGFPVCAGERFAVGGAQAG"
FT   CDS_pept        120104..120946
FT                   /transl_table=11
FT                   /gene="htpX"
FT                   /locus_tag="azo0101"
FT                   /product="putative protease HtpX"
FT                   /function="Zn-dependent protease with chaperone function"
FT                   /EC_number="3.4.24.-"
FT                   /note="Putative protease HtpX Homolog to htpX of E. coli of
FT                   30% (AAA62779) InterPro: Peptidase family M48 (IPR001915)
FT                   Pfam: Peptidase family M48 signal peptide TMHs3"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0101"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92719"
FT                   /db_xref="GOA:A1K1L4"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1L4"
FT                   /protein_id="CAL92719.1"
FT                   /translation="MFGNWIKTSILMAGIVALFGAVGGVIGGKQGMLLALVLGGAMNLW
FT                   AYWFSDKMVLKMYNAREVDEATSPYLYNMVRGLAQRAGLPMPKVYIIDEDQPNAFATGR
FT                   NPEHAAVAATTGIMRMLSERELRGVMAHELAHVKNRDILISTISATVAGAISSLAQFGM
FT                   FFGGSRDGEDRPNPVVSIIVMILAPIAGMLIQMAISRTREFGADRGGAEISGDPQALAS
FT                   ALAKIDAYARGIPMHTAEAHPETAQMMIMNPLSGGSLRGLFSTHPSTEERIARLRAMG"
FT   CDS_pept        120960..121487
FT                   /transl_table=11
FT                   /gene="helX"
FT                   /locus_tag="azo0102"
FT                   /product="putative thiol:disulphide oxidoreductase"
FT                   /function="Thiol-disulfide isomerase and thioredoxins"
FT                   /EC_number="1.8.4.7"
FT                   /note="Putative thiol:disulfide oxidoreductase. Homology to
FT                   helX of R. casulata of 35% Periplasmic protein
FT                   thiol:disulphide oxidoreductase is involved in the
FT                   biogenesis of c-type cytochromes as well as in disulphide
FT                   bond formation in some periplasmic proteins. Tigrfam: dsbE:
FT                   periplasmic protein thiol:disulfide signal peptide no TMHs"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0102"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92720"
FT                   /db_xref="GOA:A1K1L5"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1L5"
FT                   /protein_id="CAL92720.1"
FT                   /translation="MTSRRLLRRFFCALAVCLAPASAFAVDLEPLATLPPAPAALQAEL
FT                   ARVQGRAVLINFWASWCEPCRDEMPALVELDEQEPGIALITVAVADRAADSRRFLDDYL
FT                   LDNVVLINDPEQLIARAWGARLLPTTIMLDAAHRPRFRVRGEADWRAPELRARLRALTA
FT                   SESTPIPKGKTP"
FT   CDS_pept        121484..122596
FT                   /transl_table=11
FT                   /locus_tag="azo0103"
FT                   /product="conserved hypothetical secreted protein"
FT                   /function="Transglutaminase-like enzymes putative cysteine
FT                   proteases"
FT                   /note="Conserved hypothetical secreted protein. Homology to
FT                   SMa0025 of S. meliloti of 46% pir|D95263(SRS). Pfam:
FT                   Transglutaminase_like Superfamily signal peptide no TMHs"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0103"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92721"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1L6"
FT                   /protein_id="CAL92721.1"
FT                   /translation="MKRRDFLKTSALAAGLALPAWARAADTAAPLFAPSPAAGWREFEV
FT                   VTRIEPVQAAGVVRAWLPLPYTEETDWFRPLGNAWQGNAGLARVVRDPRYGAAMLYAEW
FT                   AADAGVPELEITSRFATRDRAVDFSRPAARPLALSAAEHALYTGATELLPTDGIVRDTA
FT                   LQITAGAKTDEDKARAIYEWVVDNTFRNPKTRGCGIGDIKAMLETGNLSGKCADLNALY
FT                   VGLARAAGIPARDVYGVRVADSRFGYKSLGKSGNISKAQHCRAEVFLARFGWVPVDPAD
FT                   VRKVVLEEPPGNLALDDAKVRAARKQLFGAWEMNWLAYNVAHDLELPGSGGAPVPFLMY
FT                   PQGESAQGRFDSLDPDSFRYTLTAREVVRA"
FT   CDS_pept        122689..123570
FT                   /transl_table=11
FT                   /locus_tag="azo0104"
FT                   /product="conserved hypothetical secreted protein"
FT                   /note="Conserved hypothetical secreted protein. Homology to
FT                   ebA582 of Azoacrus sp EbN1 (trembl:Q5P8D6). No domains
FT                   predicted. SignalP reporting signal peptid. no TMHs"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0104"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92722"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1L7"
FT                   /protein_id="CAL92722.1"
FT                   /translation="MPVSRRRVLGLATALCAAASLQSSVLRAATPEPARLSERWDEKRA
FT                   ARLLDRAVKHIEAKGEAGVADFSRQGPFVDRDLYVYALGSDGRFLASGGSSAALIGQNV
FT                   AATTDAAGKPFFREMLDTAASRGEGRIEYRWLNPADQREEPKVTLFRKVGGIIVAVGFY
FT                   TPRATPAQARALLDQAAAALARDSGAALGEFQQVGGRFIQDDLYVFVVDMGDGRFLAHG
FT                   ATPALVGRDARELRDPKGKALITDMINVARKKGEGELDYAWQNPVTAKLESKHTYFRVV
FT                   DGKLLGVGYYTR"
FT   CDS_pept        123626..124126
FT                   /transl_table=11
FT                   /gene="tpx"
FT                   /locus_tag="azo0105"
FT                   /product="probable thiol peroxidase"
FT                   /function="Peroxiredoxin"
FT                   /EC_number="1.11.1.-"
FT                   /note="Probable thiol peroxidase. Homology to E. coli of
FT                   62% (sprot:TPX_ECOLI) Has antioxidant activity. Could
FT                   remove peroxides or H(2)O(2) (By similarity). Pfam:
FT                   AhpC/TSA family no signal peptide no TMHs"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0105"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92723"
FT                   /db_xref="GOA:A1K1L8"
FT                   /db_xref="InterPro:IPR002065"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR018219"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1L8"
FT                   /protein_id="CAL92723.1"
FT                   /translation="MATVTLGGNPISIAGRFPQVGESAPAFALTTPELADVGLDTWAGK
FT                   RKVLNIVPSLDTPTCATSTRRFNAEAGALANTVVLVISGDLPFAAKRFCAAEGLDNVKT
FT                   LSTFRNPGFARDYGVAISSGPLAGLTARAVVVVDENDKVIHAELVSEIKNEPDYAAALA
FT                   VLK"
FT   CDS_pept        124218..125105
FT                   /transl_table=11
FT                   /locus_tag="azo0106"
FT                   /product="conserved hypothetical membrane protein"
FT                   /function="Permeases of the drug/metabolite transporter
FT                   (DMT) superfamily"
FT                   /note="Conserved hypothetical membrane protein. Homology to
FT                   an orf of R. palustris (tremblnew|CAE28417). Tigrfam: 2A78:
FT                   Carboxylate/Amino Acid/Amine Tranporter InterPro: Integral
FT                   membrane protein DUF6 Pfam: Integral membrane protein DUF6
FT                   no signal peptide probable 10 TMHs"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0106"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92724"
FT                   /db_xref="GOA:A1K1L9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1L9"
FT                   /protein_id="CAL92724.1"
FT                   /translation="MQPARIPPRTLLALVLLTLFWGVNWPVMKFSLREITPLYFRALTV
FT                   SGGLLLLIAWFRLRGVSLRVPRREWGRVMLLALPNIAGWYCFSIFGVQALASGRAAILG
FT                   FTMPIWTVLLGVLFFRERMNPRLWLATACAAAAVLLLLWHELGQLSGRPLGMAWMLAAA
FT                   ASWALGTLLLKRLAPAVSTEALTVGMLVCALPVLWALAVLKEPVPTLQFSLPMWVAVVY
FT                   GVVIACAAAQVLWFSIARSLPPVASALSVMMIPVIGLASAMPITGERPHPQDLAAAVLI
FT                   MLALSAALLPRRAG"
FT   CDS_pept        complement(125118..125834)
FT                   /transl_table=11
FT                   /locus_tag="azo0107"
FT                   /product="conserved hypothetical membrane protein"
FT                   /function="uncharacterized conserved protein"
FT                   /note="conserved hypothetical membrane proteins, 42%
FT                   identity (59% similarity) to TrEMBL;Q73PF0 Has
FT                   PF02592;Uncharacterized ACR, YhhQ family
FT                   COG1738;IPR003744:This is a family of uncharacterized
FT                   proteins. Conserved regions of hydrophobicity suggest that
FT                   all members of the family may be integral membrane
FT                   proteins. no signal peptide. 4 TMH."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0107"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92725"
FT                   /db_xref="GOA:A1K1M0"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1M0"
FT                   /protein_id="CAL92725.1"
FT                   /translation="MNPTPAAPRQYRYYEFVMAAFVAVYLCSNLIGPAKAAQIELPLIG
FT                   AVTFGAGVLFFPISYIFGDVLTEVYGYARARRVIWAGFGAMIFASLMAWVVVKLPPAPG
FT                   WQNQAAYEIAYGSTWRIVAASLTAFFCGEFVNSFVLAKMKVWTEGRHLWARTIGSTVVG
FT                   EGVDSLLFYPLAFWNSGLIPNELLPAVMVGQFVSKVMVEVVFTPLTYRIVAFLKRAERE
FT                   DYYDRDTDFTPFSIRA"
FT   CDS_pept        126088..127293
FT                   /transl_table=11
FT                   /locus_tag="azo0108"
FT                   /product="conserved hypothetical secreted protein"
FT                   /function="Beta-galactosidase/beta-glucuronidase"
FT                   /note="Conserved hypothetical secreted protein. Homology to
FT                   XCC0740 of Xanthomonas campestris of 33%
FT                   (trembl|Q8PCI6(SRS) Pfam: Glycosyl hydrolases family 2,TIM
FT                   barrel domain This family contains
FT                   beta-galactosidase,beta-mannosidase and beta-glucuronidase
FT                   activities. No TMHs Signal peptide: present."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0108"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92726"
FT                   /db_xref="GOA:A1K1M1"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1M1"
FT                   /protein_id="CAL92726.1"
FT                   /translation="MERGGLRRLALLGWLAVSAAALPAAGAQWQGAAFEGDRAALERLA
FT                   RAGARVIRVYRESDAWVLDAAQQLGLKVVMGLWVGHPRHGVRLEDETVLRAHEAALRDF
FT                   VTRHRDHPALLAWGVGNEVETGTADHLAVWRRIDRLAGVVKAADPSHPTLMVVADTGMA
FT                   QLRQLADCCAHVDMLGINVYAGAVFDLPQRLAEAGIAKPVVVAELGPLGQWQAGRKPWG
FT                   APVELTSSQKAAFYRDALAFLRQQPQIAGVFPFLWGAKQEQTATWHGLLLADGSATAMS
FT                   DALAAAWGRPETHAAPVIRGIGIAADEFAPGQEISAGVDAIAPDGAPLVTDWAVFAEAT
FT                   DLRKGGDVETAPPRVAVQLRHADAASVRFVAPQAPGAYRLFLTVRDGRGKVATANLPFL
FT                   VR"
FT   CDS_pept        127357..127812
FT                   /transl_table=11
FT                   /gene="yihZ"
FT                   /locus_tag="azo0109"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /function="D-Tyr-tRNAtyr deacylase"
FT                   /EC_number="3.1.-.-"
FT                   /note="D-tyrosyl-tRNA(Tyr) deacylase (EC 3.1.-.-).
FT                   Hydrolyzes D-tyrosyl-tRNA(Tyr) into D-tyrosine and free
FT                   tRNA(Tyr). Could be a defense mechanism against a harmful
FT                   effect of D-tyrosine."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92727"
FT                   /db_xref="GOA:A1K1M2"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1K1M2"
FT                   /protein_id="CAL92727.1"
FT                   /translation="MMALLQRVTRARVTVDGATTGEIGTGLLALVCAEQGDTEAEADKL
FT                   LAKLLKLRVFADEGGRMNRSLQEVGGGLLVVSQFTLAADTSGGNRPSFANAAPADTGRA
FT                   LYEHFVARARAQHGEVATGRFGAMMQVELVNDGPVTIPLRIPPASAA"
FT   CDS_pept        complement(127825..128703)
FT                   /transl_table=11
FT                   /locus_tag="azo0110"
FT                   /product="probable pirin-related protein"
FT                   /function="Pirin-related protein"
FT                   /note="Pirin-like protein. TREMBL:Q8P799: 52% identity,65%
FT                   similarity. InterPro: DUF209 his region is found the
FT                   C-terminal half of the Pirin protein. The function of Pirin
FT                   is unknown but the gene coding for this protein is known to
FT                   be expressed in all tissues in the human body although it
FT                   is expressed most strongly in the liver and heart. Pirin is
FT                   known to be a nuclear protein, exclusively localised within
FT                   the nucleoplasma and predominantly concentrated within
FT                   dot-like subnuclear structures. A tomato homologue of human
FT                   Pirin has been found to be induced during programmed cell
FT                   death. Human Pirin interacts with Bcl-3 and NFI and hence
FT                   is probably involved in the regulation of DNA transcription
FT                   and replication. It appears to be an Fe(II)-containing
FT                   member of the Cupin superfamil InterPro:IPR007113;
FT                   Cupin_sup. IPR008778; Pirin_C. IPR003829; Pirin_N. Pfam
FT                   PF02678; Pirin; 1. PF05726; Pirin_C molyb_syn: molybdenum
FT                   cofactor synthesis Absence of transmembrane helices (TMHMM
FT                   predicted)"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0110"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92728"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1M3"
FT                   /protein_id="CAL92728.1"
FT                   /translation="MPELLIEPRRADLGHGLVVQRILPYARRRMVGPFIFLDHAGPVRL
FT                   PPELARLADVRPHPHIGLATVSYLLGGEITHRDSLGMEQPIRPGEVNWMTAGRGIVHSE
FT                   RFDSPAAFAGTGLELLQSWVALPAEHEETAPAFDHYPAALLPTATEGGLWLRVIAGKAF
FT                   GLASPVRTLSPMFYLHVKLTAGSAVALPGDYSERAAYVVDGRIEIDGTAYGAGRMLVFG
FT                   QAEAPTLRALDDATVMLLGGEPVGERHIWWNFVSSRKDRIEQAKADWRAGRIPLPPNDN
FT                   AEFIPLPETVA"
FT   CDS_pept        128838..129824
FT                   /transl_table=11
FT                   /gene="adhA"
FT                   /locus_tag="azo0111"
FT                   /product="putative alcohol dehydrogenase"
FT                   /function="Zn-dependent alcohol dehydrogenases"
FT                   /EC_number="1.1.1.1"
FT                   /note="Putative Alcohol dehydrogenase. Homology to adh-HT
FT                   of B. stearothermophilus (sprot|ADH3_BACST) THERMOSTABLE
FT                   AND THERMOPHILIC NAD(+)-DEPENDENT ALCOHOL DEHYDROGENASE.
FT                   BEARS MAINLY AN ETHANOL-DEHYDROGENASE ACTIVITY. CATALYTIC
FT                   ACTIVITY:An alcohol + NAD(+) = an aldehyde or ketone +
FT                   NADH. COFACTOR: Binds 2 zinc ions per subunit (By
FT                   similarity). Pfam: Zinc-binding dehydrogenase Tirgfam: tdh:
FT                   L-threonine 3-dehydrogenase no signal peptide no TMHs"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0111"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92729"
FT                   /db_xref="GOA:A1K1M4"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014187"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1M4"
FT                   /protein_id="CAL92729.1"
FT                   /translation="MRAMVLDTPGQPLRPAVLPQPTPGPGQVLLKVEACGVCRTDLHLV
FT                   DGELPEPRLPVVPGHEIVGRVVATGPGVTALRIGQRAGVPWLGWTCGECSYCRGGHENL
FT                   CDAARFTGYTLDGGYAEYTVADQRYCFPLPDPLPAVELAPLLCAGLIGYRALAMAGDAE
FT                   RIGIYGFGAAAHILAQVLVHQGRAFYAFTRPGDLAGQGFACRLGAAWAGGSDEAPDQAL
FT                   DAALIFAPAGPLVPAALRAVRKGGTVVCAGIHMSDIPAFPYDILWGERVLRSVANLTRA
FT                   DGERFLRIVADNPVRSHVQVYRLDQANEALDALRLGRIEGAAVLVPE"
FT   CDS_pept        complement(129841..130737)
FT                   /transl_table=11
FT                   /gene="gstR1"
FT                   /locus_tag="azo0112"
FT                   /product="putative transcriptional regulator"
FT                   /function="Transcriptional regulator"
FT                   /note="Putative transcriptional regulator. Homology to gstR
FT                   of R. leguminosarum of 37% (tremble:Q52827). Has PF00126,
FT                   HTH_1,Bacterial regulatory helix-turn-helix protein, lysR
FT                   family.IPR000847, HTH_LysR; Numerous bacterial
FT                   transcription regulatory proteins bind DNA via a
FT                   helix-turn-helix (HTH) motif. These proteins are very
FT                   diverse, but for convenience may be grouped into
FT                   subfamilies on the basis of sequence similarity. One such
FT                   family, the lysR family, groups together a range of
FT                   proteins, including ampR, catM, catR, cynR, cysB,
FT                   gltC,iciA, ilvY, irgB, lysR, metR, mkaC, mleR, nahR,
FT                   nhaR,nodD, nolR, oxyR, pssR, rbcR, syrM, tcbR, tfdS and
FT                   trpI. The majority of these proteins appear to be
FT                   transcription activators and most are known to negatively
FT                   regulate their own expression. All possess a potential HTH
FT                   DNA-binding motif towards their N-termini. Has PF03466,
FT                   LysR substrate binding domain;IPR005119, LysR_subst; The
FT                   structure of this domain is known and is"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0112"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92730"
FT                   /db_xref="GOA:A1K1M5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1M5"
FT                   /protein_id="CAL92730.1"
FT                   /translation="MDKLKAMQIAVAIADSGSLTAAADSLDISLPVVVRTLAALEAGLG
FT                   VRLFNRSTRRLSLTDEGRDYLARCRQILADIHDAEAALASDAVVPSGRVVVTAPVMFGQ
FT                   QHVAPALTRFVQHYGQMRVELRLHDRVVNLLEEHIDVAVRIGAIEDQSLVAHALGTLRR
FT                   IVVAAPAYLAARGTPQHPRELAAHECIVFNGNSAGWWRFIDDGHEFGMTVDGRLTYNHV
FT                   APALDACRAGMGLGTFIAYQIADDLHAGRLLPVLEAFELPPRPVHVAFPHARLLPTRTR
FT                   VLVDWLRRDLGEQLAAL"
FT   CDS_pept        130842..131489
FT                   /transl_table=11
FT                   /gene="gstA"
FT                   /locus_tag="azo0113"
FT                   /product="probable glutathione transferase"
FT                   /EC_number="2.5.1.18"
FT                   /note="Probabe glutathione transferase. Homology to gstA of
FT                   R. leguminosarum of 58% (sprot:GSTA_RHILE) Conjugation of
FT                   reduced glutathione to a variety of targets. Pfam: PF02798,
FT                   GST_N, Glutathione S-transferase, N-terminal domain;
FT                   PF00043, GST_C, Glutathione S-transferase, C-terminal
FT                   domain Interpro: IPR004045, GST_Nterm; IPR004046,GST_Cterm;
FT                   no signal peptide no TMHs"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0113"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92731"
FT                   /db_xref="GOA:A1K1M6"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1M6"
FT                   /protein_id="CAL92731.1"
FT                   /translation="MTRSIPQGELVLYGLPLSGHCHRVALFLSLLRLPYRYENVDLAGG
FT                   AHRRPDFLALNPFGQIPVLKDGEQVIADSNAILVYLARRYGGGEEIEWLPDEPVAAAEV
FT                   QRWFSAAAGLLAFGPARARLKHVFGAPIDYDAAVELANRLLPVMEAELARRPYLAADAP
FT                   TLADIALYSYTAHAPEGGISLQPYPHIRAWLARVEALPGFVGMPRSALPAGA"
FT   CDS_pept        131492..132490
FT                   /transl_table=11
FT                   /locus_tag="azo0114"
FT                   /product="conserved hypothetical protein"
FT                   /function="predicted flavin-nucleotide-binding protein
FT                   structurally related to pyridoxine 5-phosphate oxidase"
FT                   /note="Conserved hypothetical protein. Homology to bp2124
FT                   of B. pertussis of 48% (trembl|Q7VWS5). Pfam: Pyridoxamine
FT                   5-phosphate oxidase no signal peptide no TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:azo0114"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92732"
FT                   /db_xref="GOA:A1K1M7"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1M7"
FT                   /protein_id="CAL92732.1"
FT                   /translation="MAPVEPVAGTAAFHAGERLLQERVGKAAQMAEIGARVIRDYMPEQ
FT                   HRSFFAQLPFVVLGAADGEGRPCATLLTGPPGFVSSPDSHTLRIDALPGAGDPLIGAIR
FT                   VGATVALLGLEPPTRRRNRMNGRVVAADTAGFSVAVRESFGNCPKYIQARSAEFVAGAR
FT                   ASAPPQTLEPADDSLRRVVAAADTLFIATAHPPGGDDPAARYGADVSHRGGKPGFVRWD
FT                   AAADGTVTLTLPDFAGNNFFNTFGNIVLDPRVGLVFVDIAGAAEDGVADIFHVAGHAEI
FT                   VEDAAAVAAFAGALRLLRVRVDAVLRRPKALPLRWGAEVEFSPFLEGTGVW"
FT   CDS_pept        complement(132910..133359)
FT                   /transl_table=11
FT                   /locus_tag="azo0115"
FT                   /product="conserved hypothetical protein"
FT                   /function="Acyl dehydratase"
FT                   /note="MaoC protein (Phenylacetic acid degradation protein
FT                   paaZ). Entry name :- TREMBL:Q8XXS0 Prim. accession # Q8XXS0
FT                   InterPro:-IPR002539; MaoC_dehydratas. Pfam:-PF01575;
FT                   MaoC_dehydratas; 1. Identities = 77/145 (53%) Number of
FT                   predicted TMHs: 0"
FT                   /db_xref="EnsemblGenomes-Gn:azo0115"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92733"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1M8"
FT                   /protein_id="CAL92733.1"
FT                   /translation="MDTRYLDDLQPGERFCTGGVTLTEAEIIDFAWRYDPQPFHLDTGA
FT                   AEQSPYGGLIASGFQSLALCFRLFIQTGVLAQSSLGSPGIDELRWLAPVRPGDTLHCEV
FT                   EVLETRPSSSKPDRGIARLRYAALNQRGETVMTFVIAHLLRRRMG"
FT   CDS_pept        complement(133377..134873)
FT                   /transl_table=11
FT                   /gene="amn"
FT                   /locus_tag="azo0116"
FT                   /product="AMP nucleosidase"
FT                   /EC_number="3.2.2.4"
FT                   /note="AMP nucleosidase InterPro: Purine and other
FT                   phosphorylases family 1"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0116"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92734"
FT                   /db_xref="GOA:A1K1M9"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR011271"
FT                   /db_xref="InterPro:IPR018953"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="InterPro:IPR037109"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1M9"
FT                   /protein_id="CAL92734.1"
FT                   /translation="MSPDAPYFAPERFDDAAAALARVATIYDASVNHLRTTLQRFVAGE
FT                   DIGRHVRACYPFVRVRTGTVARADSRLSYGFVAGPGTYETTLTRPDLFADYYLEQFRLL
FT                   LQNHGVALEIGTGTQPIPLHFSVGAHDHIEGELGLARREQLRDLFDLPDLNAMDDGIAN
FT                   GTHEPRPGEAHPLALFTAPRVDYSLHRLRHYTGTVPEHFQNFVLFTNYQFYIDEFIKLG
FT                   HALMAEGGSHGYEAFVEPGNVVTRPADQPPRPGDELGSAPPRLPQMPAYHLVRGDRAGI
FT                   TMVNIGVGPANAKTITDHIAVLRPHAWIMLGHCAGLRNTQQLGDYVLAHGYVREDHVLD
FT                   EELPLWVPIPPLAEVQLALEAAVEDVTRLSGYELKRLMRTGTVATTDNRNWELLPSHGM
FT                   ASSPERRFSQSRAVALDMESATIAANGFRFRVPYGTLLCVSDKPLHGEIKLPGMANHFY
FT                   RERVDQHLRIGIRALERLRDQGVDRLHSRKLRSFAEVAFQ"
FT   CDS_pept        135086..135853
FT                   /transl_table=11
FT                   /gene="braF"
FT                   /locus_tag="azo0117"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /function="ABC-type branched-chain amino acid transport
FT                   systems ATPase component"
FT                   /note="ATP-binding cassette (ABC) transporters are
FT                   multidomain membrane proteins, responsible for the
FT                   controlled efflux and influx of substances (allocrites)
FT                   across cellular membranes. ATP-binding protein is for
FT                   coupling the energy of ATP hydrolysis to conformational
FT                   changes in the transmembrane domains. Similar to
FT                   trembl|Q8XU49 (72%) and to sprot|BRAF_PSEAE (40%). Pfam:
FT                   ABC transporter Smart: AAA ATPases"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0117"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92735"
FT                   /db_xref="GOA:A1K1N0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1N0"
FT                   /protein_id="CAL92735.1"
FT                   /translation="MSEFILETTGLTKEFKGFVAVSGVDLKVQRGHIHALIGPNGAGKT
FT                   TVFNLLTKFLPPTAGTIRFEGEDITREAPAVTARRGLIRSFQISATFPKLTVLENVRIG
FT                   LQRKLGTGFHFWRSEKSLNVLNDRAMALLESVDLGKFADTITGEMPYGRKRALEIATTL
FT                   ALEPTMMLLDEPTQGMGHEDIERVVALIRKVAENRTILMVEHNLSVVANLCDRITVLTR
FT                   GSILAEGSYEEVSKNPKVLEAYVGSDDMADAHH"
FT   CDS_pept        135870..136592
FT                   /transl_table=11
FT                   /locus_tag="azo0118"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /function="ABC-type branched-chain amino acid transport
FT                   systems ATPase component"
FT                   /note="ATP-binding cassette (ABC) transporters are
FT                   multidomain membrane proteins, responsible for the
FT                   controlled efflux and influx of substances (allocrites)
FT                   across cellular membranes. ATP-binding protein is for
FT                   coupling the energy of ATP hydrolysis to conformational
FT                   changes in the transmembrane domains. Similar to
FT                   trembl|Q7W5F6 (63%) and to trembl|Q8U8G7 (59%). Pfam
FT                   (PF00005): ABC transporter Smart (SM00382): ATPase
FT                   superfamily"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0118"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92736"
FT                   /db_xref="GOA:A1K1N1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1N1"
FT                   /protein_id="CAL92736.1"
FT                   /translation="MTSAFESHAEMLRISDLHAFYGESHILHGIDLQVARGECVTLLGR
FT                   NGSGRSTTLKSILGLVGRRSGSIMVNGNEVIAEPTHRMARHGVGYVPEERAIFASLTAE
FT                   ENLLLPPQVSSGGMSVDEIYGMFPNLLERRNSPGTKLSGGEQQMLAMARVLRTGAKLLL
FT                   LDEITEGLAPVIVKKLGEVITELKSRGFTIVLVEQNFRFAAPLADRHYVLEHGEIIATI
FT                   QKDELPGRMDWLHQTLGV"
FT   CDS_pept        136627..137841
FT                   /transl_table=11
FT                   /locus_tag="azo0119"
FT                   /product="probable ABC transporter substrate binding
FT                   protein"
FT                   /function="ABC-type branched-chain amino acid transport
FT                   systems periplasmic component"
FT                   /note="ABC transporter substrate binding proteins count to
FT                   the family of extracellular ligand binding proteins. It is
FT                   a component of the high affinity amino acid transport
FT                   system. Similar to trembl|Q8XU51 (58%) and to
FT                   tremblnew|CAE27314 (45%). Pfam (PF01094): Receptor family
FT                   ligand binding region SignalP reporting Signal peptide."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0119"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92737"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1N2"
FT                   /protein_id="CAL92737.1"
FT                   /translation="MHTKKLLTAACTAALAMLATGAHAQFSGNTVKIGVLTDMSGTYSD
FT                   LAGQGAVVATQMAIEDFVAKEKPGFKVEMVSADHQNKADIASNKAREWFEREGVDTATE
FT                   LVTTSTALAVMKVAKEMNKVVLMNGPGSTPITNEQCNDVSVHYTYDTYALANGTAKAVT
FT                   QQGGKNWFFLTADYAFGQALEKDSSAVVTANGGKVVGSVRHPFPASDFSSFLLQAQASN
FT                   AQIIGLANAGADTTNAIKQAAEFGITPKQQLAGLLMFISDVHSLGLKNAQGMFLTTGFY
FT                   WDLNDETRAWSKRFFDKQKRMPTMVQAGQYSSVMHYLKAVKAAGTDDTTKVMAQMKKTP
FT                   INDFFAKNGQIREDGRMVHDMYLVQVKKPEESKYPWDYYHVKQVIPGAEAFQPLSLSRC
FT                   PLVKK"
FT   CDS_pept        137898..138782
FT                   /transl_table=11
FT                   /locus_tag="azo0120"
FT                   /product="ABC transporter permease protein"
FT                   /function="Branched-chain amino acid ABC-type transport
FT                   system permease components"
FT                   /note="Branched-chain amino acid transport system typically
FT                   composed of a periplasmic substrate-binding protein, one or
FT                   two reciprocally homologous integral inner-membrane
FT                   proteins and one or two peripheral membrane ATP-binding
FT                   proteins that couple energy to the active transport
FT                   system.The integral inner-membrane proteins translocate the
FT                   substrate across the membrane. Similar to trembl|Q92LQ5
FT                   (71%) and to trembl|Q8XU52 (69%). Pfam (PF02653):
FT                   Binding-system dependent bacterial transporters (araH,
FT                   livH/limM families) TMHMM reporting eight Tmhelix."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0120"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92738"
FT                   /db_xref="GOA:A1K1N3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1N3"
FT                   /protein_id="CAL92738.1"
FT                   /translation="MEIFGVPSALFGSQLLIGLINGSFYAILSLGLAIIFGLLNIINFA
FT                   HGAQYMMGAFVAWIALTKFGVNYWVALLLSPILIGALGVVLERTMLRKLYKLDHLYGLL
FT                   LTFGLALIFEGIFRDQYGISGQAYEVPDALKGGVNLGFMFMPIYRGWVVVAALAVCFGT
FT                   WFMIEKTKLGAYLRAGTENPQIVQALGINVPLLITFTYGYGVALAAFAGVLAAPIYQVS
FT                   PQMGANLIIVVFAVVVIGGMGSIMGSIVTGLGLGLIEGLTRVFYPEASAVVVFFIMVIV
FT                   LLVRPAGLFGKAA"
FT   CDS_pept        138807..139763
FT                   /transl_table=11
FT                   /gene="livM1"
FT                   /locus_tag="azo0121"
FT                   /product="putative branched-chain amino acid transport
FT                   permease"
FT                   /function="ABC-type branched-chain amino acid transport
FT                   system permease component"
FT                   /note="Putative branched-chain amino acid transport
FT                   permease. Homology to livM of S. typhimurium of 25%. Part
FT                   of the binding-protein-dependent transport system for
FT                   branched-chain amino acids. Probably responsible for the
FT                   translocation of the substrates across the membrane. Pfam:
FT                   branch-chain amino acid transport system probable signal
FT                   peptide probable 6 TMHs"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0121"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92739"
FT                   /db_xref="GOA:A1K1N4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1N4"
FT                   /protein_id="CAL92739.1"
FT                   /translation="MSYNDKSLFDRATPVLFGALFIIGLVAPFAVYPTFLMKILCFGLF
FT                   ACAFNLLLGFAGLLSFGHAAFLGSAGYVCGMLVRDLGVTPEVGIIGGTLAAGVLGWVFG
FT                   VLAIRRSGIYFAMITLALSQMVFFFALQWKATGGEDGLQGVPRGHLFGLIDLSNNLAMY
FT                   YLVFAVFCAGFFIIYRAIHSPFGQILKAIRENEPRAISLGYDVSKYKLLAFVLSAALAG
FT                   LAGATKTLVFQLASLTDVHWHMSGEVVLMTLLGGLGTILGPLVGASVIVSLQSELADKV
FT                   GSWVTVIMGVIFVLCVLLFRRGIVGELQALIRRSGIN"
FT   CDS_pept        complement(139919..141091)
FT                   /transl_table=11
FT                   /locus_tag="azo0122"
FT                   /product="probable Fe-S cluster redox enzyme"
FT                   /function="predicted Fe-S-cluster redox enzyme"
FT                   /note="Region start changed from 140962 to 141091 (129
FT                   bases)"
FT                   /db_xref="EnsemblGenomes-Gn:azo0122"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92740"
FT                   /db_xref="GOA:A1K1N5"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1K1N5"
FT                   /protein_id="CAL92740.1"
FT                   /translation="MEDQDRVGEQAENGRGFHPAIVAASAAQRHSARPPVRATIHPLMR
FT                   IDDLTQRLRALGAKPAHEQRVLRAWVQRSSMDNRRQAAKDFLPLALREALPALTAELEG
FT                   LARLRSQHPGEDGSARLLVELADGQTVESVLLLRDGLCVSTQLGCAVGCVFCMTGREGL
FT                   LRQLGSAEIVAQVVLARSLRPVKKVVFMGMGEPAHNLDNVLEAIDLLGTAGGIGHKNLV
FT                   FSTVGDYRVFERLPRQRVKPALALSLHTTRADLRAQLLPRAPQIAPQELVELGERYARS
FT                   TGYPIQYQWTLIEGVNDSPEEMDGIVRLLRGKYALMNLIPYNSVPELEFRRPGREAAVA
FT                   LAAYLHRHGVLAKLRQSAGQDVEGGCGQLRARVVKMDRRPRTARATPPTA"
FT   CDS_pept        141038..141463
FT                   /transl_table=11
FT                   /locus_tag="azo0123"
FT                   /product="putative threonine efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0123"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92741"
FT                   /db_xref="GOA:A1K1N6"
FT                   /db_xref="InterPro:IPR021218"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1N6"
FT                   /protein_id="CAL92741.1"
FT                   /translation="MESAAVFRLLANAVLVLHAGFVLFVVAGLVLILVGGALDWRWVRD
FT                   VRLRVLHLAAIGVVVAESWLGVVCPLTTLELWLRRLGGQTFYEGDFVAFWLRRLLFFDA
FT                   PGWVFVLAYTGFAALVLLAWWRYPPRRPRQPAQDDGN"
FT   CDS_pept        141533..141742
FT                   /transl_table=11
FT                   /locus_tag="azo0124"
FT                   /product="hypothetical secreted protein"
FT                   /note="Hypothetical secreted protein. no homology to the
FT                   data bank. no domains predicted signal peptide no TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:azo0124"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92742"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1N7"
FT                   /protein_id="CAL92742.1"
FT                   /translation="MNTSTLLRLAVVACAPALLTACSTQSWYEGARVHAENECRRQPGS
FT                   AAEECMARVNTQRYEDYERARKAQ"
FT   CDS_pept        141717..142061
FT                   /transl_table=11
FT                   /locus_tag="azo0125"
FT                   /product="conserved hypothetical secreted protein"
FT                   /note="Conserved hypothetical secreted protein,"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0125"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92743"
FT                   /db_xref="InterPro:IPR007077"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1N8"
FT                   /protein_id="CAL92743.1"
FT                   /translation="MSARARRSSGAAAQGLAALPNLGVRSASMLDAAGIHSEAELRALG
FT                   AVAAYVRVKRSGARPGLNLLWALEGALSGTPWQVVAREHRTSLLLALEDEDRGPSAGVP
FT                   GKIDENRSGE"
FT   CDS_pept        142061..142369
FT                   /transl_table=11
FT                   /locus_tag="azo0126"
FT                   /product="conserved hypothetical protein"
FT                   /note="Conserved hypothetical protein with 74%
FT                   similarity(57% identity)to Conserved hypothetical protein
FT                   [Sinorhizobium meliloti]. No Signal peptide reported to be
FT                   present. No TMH reported to be present. Has PF07045,Protein
FT                   of unknown function (DUF1330)This family consists of
FT                   several hypothetical bacterial proteins of around 90
FT                   residues in length. The function of this family is unknown.
FT                   TIGRFAM:acolac_sm: acetolactate synthase,small s"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0126"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92744"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1N9"
FT                   /protein_id="CAL92744.1"
FT                   /translation="MKGYWIVRVDVADSERFMNYAQLAGPALKLYGARFLARVGPHTVV
FT                   EGAARARNTVVEFPSYQAALDCWHSPEYQAARALRLGAAEVDIVVIEGFEGTQPGER"
FT   CDS_pept        142468..142659
FT                   /transl_table=11
FT                   /locus_tag="azo0127"
FT                   /product="Hypothetical protein"
FT                   /note="Hypothetical protein, 40% identity to TrEMBL;Q73S36
FT                   Weak Homology with most protein hits in the database. No
FT                   Domains/Features/Motifs predicted present."
FT                   /db_xref="EnsemblGenomes-Gn:azo0127"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92745"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1P0"
FT                   /protein_id="CAL92745.1"
FT                   /translation="MDQTLALEQAGRRYHLSIEFDTPVPSPELRDIEVDLSGVLPSSRR
FT                   PPLPVIRFVPGQWKEGYT"
FT   CDS_pept        complement(142690..143106)
FT                   /transl_table=11
FT                   /locus_tag="azo0128"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="Conserved hypothetical membrane protein, 50%
FT                   identity (62% similarity) to TrEMBL;Q7NQ67. No domains
FT                   predicted TMHMM2 reporting 1 TMH's present. No signal
FT                   peptide reported present."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0128"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92746"
FT                   /db_xref="GOA:A1K1P1"
FT                   /db_xref="InterPro:IPR012427"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1P1"
FT                   /protein_id="CAL92746.1"
FT                   /translation="MFSEAEEWVRMGVEWLRLLVETIGAAIIAVGIVVALHGLARHWLH
FT                   HCRDEFNPVRLAFARYLAMALEFQLAADILSTAVAPSWEQLGKLATVAVIRTGLNFFLM
FT                   REIRDEHRGTAEDAGAEHPRPGRPPPGTEKSASA"
FT   CDS_pept        143294..144907
FT                   /transl_table=11
FT                   /gene="tap"
FT                   /locus_tag="azo0129"
FT                   /product="putative dipeptide chemoreceptor"
FT                   /function="Methyl-accepting chemotaxis protein"
FT                   /note="The Tap (taxis toward peptides) receptor and the
FT                   periplasmic dipeptide-binding protein (DBP) of Escherichia
FT                   coli together mediate chemotactic responses to dipeptides.
FT                   Similar trembl|Q7P0E0 (32%) and to SWISSPROT:MCPC_SALTY
FT                   (23%). Pfam(PF00015): Bacterial chemotaxis sensory
FT                   transducer Pfam (PF00672):HAMP domain TMHMM reporting two
FT                   TMH. SignalP reporting Signalpeptid."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92747"
FT                   /db_xref="GOA:A1K1P2"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1P2"
FT                   /protein_id="CAL92747.1"
FT                   /translation="MSIARRIALLLAILIGALVALGTMGVVQMSRVNEGLVYQNEKILP
FT                   KLDLIAATQRRAITYRLLVLRHVLTTDARAMEAAEAPLRQLASEIDADLRKYESMTDSD
FT                   EDRRLLRADREALTAYAAVAERSLAHSRANRNEEASALANGEAAERGNALIAALDAHAR
FT                   YNRELNEAFATGAEETFRSSRALTVALVVLALAAGGGFGFLAYRRIVGALLAMSAAVEG
FT                   VSSTLDFSRRVPADGKDEVAQTGRAFNALLERVQQSLRKMSTHAGEVSAAGSQLASSAR
FT                   QVSIGSSAQSEAAAAMAAAVEQMTVSINHVADRAGEARRLAVLAGDEARGGAEVIGLTL
FT                   ADIRRIDVSVRQAAERVQQLDEDSARVSAVVTVIKEVADQTNLLALNAAIEAARAGEQG
FT                   RGFAVVADEVRKLAERTAQSTQEISSTMEAMQAGARNATGGMSAAVELVGVGVAHAQQA
FT                   EASVRQIEDGARRTVDIVAEISDAIREQSVASSSIAQQVERVAQMTDENSAAAASTSDT
FT                   AVGLEGLAQEMQGEVARYRV"
FT   CDS_pept        145152..146765
FT                   /transl_table=11
FT                   /gene="nahY"
FT                   /locus_tag="azo0130"
FT                   /product="putative aromatic hydrocarbon chemotaxis
FT                   transducer"
FT                   /function="Methyl-accepting chemotaxis protein"
FT                   /note="The ability of bacteria to recognize and swim toward
FT                   aromatic hydrocarbons is possibly an important prelude to
FT                   their degradation. In Pseudomonas putida G7,NahY is the
FT                   receptor required for the chemotaxis to naphthalene.
FT                   Similar to trembl|Q7NU44 (38%) and to trembl|Q7NY58 (33%).
FT                   Smart: HAMP domain Pfam (PF00015): Methyl-accepting
FT                   chemotaxis protein (MCP) signalling domain SignalP
FT                   reporting Signal Peptide."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0130"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92748"
FT                   /db_xref="GOA:A1K1P3"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1P3"
FT                   /protein_id="CAL92748.1"
FT                   /translation="MTIAKRIALLLALFTLALLTVGATGVLQVRSLNQGLLYQTSNILP
FT                   SLARIGDLQLQVMRFRSIVLSHVLATEAKEMAEIEVELGKVRQGIEEGLVKYQTLVSDE
FT                   EDGRRLAAVSAALRGYLTLADHEIELSRQNRNEEARRMIATEGAKHSAELIGALERLAE
FT                   YNRELAERFEHEAERSFRNGLVLSVGMTLVAIAGGALLGFATYRRVVGSLVAMSGAVQD
FT                   VSTTLDFSRRVPVEGRDEVAQTARAFNALLERVQQSLRQMSQHASSVFAAGTSLAASAQ
FT                   QVSAGSSEQSEAAGAMAAAVEEMTVSVNHVADRASEASELAASAGRDAHAGAEVIGKTL
FT                   ADIRRIDASVRQAAERVQQLDADSARVSAVVAVIKDVADQTNLLALNAAIEAARAGEQG
FT                   RGFAVVADEVRKLAERTAQSTQEISSTMEAMQSGARNAVSGMTEAVEQVARGVGHAQQA
FT                   EESIRQIEAGSRRTVERVAEISDAIREQSEASSNIARQVERVAQMTDENSAAAASTSDT
FT                   AAALNGLARDMQSEVSRYRV"
FT   CDS_pept        146889..147092
FT                   /transl_table=11
FT                   /gene="dmpI"
FT                   /locus_tag="azo0131"
FT                   /product="probable 4-oxalocrotonate tautomerase"
FT                   /function="uncharacterized protein 4-oxalocrotonate
FT                   tautomerase homolog"
FT                   /EC_number="5.3.2.2"
FT                   /note="Probable tautomerase lin2709 (EC 5.3.2.2).
FT                   TREMBL:Q7UE84: 67% identity, 86% similarity
FT                   InterPro:IPR004370; Taut. ProDom: PD404143 InterPro:
FT                   4-oxalocrotonate tautomerase taut: 4-oxalocrotonate
FT                   tautomerase No signal peptide no TMH's"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0131"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92749"
FT                   /db_xref="GOA:A1K1P4"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="InterPro:IPR018191"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1P4"
FT                   /protein_id="CAL92749.1"
FT                   /translation="MPYVNIQVTAGVTRAQKAQLVREVTDALVRVLGKKPEHTHVVIQE
FT                   IDEENWGYAGMLTDDWRRQQGS"
FT   CDS_pept        147273..148154
FT                   /transl_table=11
FT                   /locus_tag="azo0132"
FT                   /product="transcriptional regulator, LysR family"
FT                   /function="Transcriptional regulator"
FT                   /note="Transcriptional regulator, LysR family,"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0132"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92750"
FT                   /db_xref="GOA:A1K1P5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1P5"
FT                   /protein_id="CAL92750.1"
FT                   /translation="MRLPPLHALVAFEAAARAGSFLAAAAELHLTPSAVSHRIKALEDW
FT                   LGTALFERRQRLVVLTEAGRDYLAQIQPALADIETASAAMQAPHSRVLRLSVAPAIGAK
FT                   WFVGQLAAYREVDPGLEFVLSTASTMAPVAAGKADVGLCYGEPPWPGLEAYELRRETVF
FT                   PVCNPALAARLGDPPAAAALAALPLLRHPLLAWRPWFAAVGLDRAEPAEGPLFEDAMMM
FT                   LEAASAGVGVALTVELLARPYLASGALQRPFAVAVPGKAFHAVLRADAYGRPWVRRFVR
FT                   WLQGRARRDTAA"
FT   CDS_pept        148401..149321
FT                   /transl_table=11
FT                   /gene="ilvE1"
FT                   /locus_tag="azo0133"
FT                   /product="branched-chain-amino-acid transaminase"
FT                   /function="Branched-chain amino acid
FT                   aminotransferase/4-amino-4-deoxychorismate lyase"
FT                   /EC_number="2.6.1.42"
FT                   /note="Branched-chain amino acid aminotransferase (EC
FT                   2.6.1.42) (BCAT). Acts on leucine isoleucine and valine (By
FT                   similarity). InterPro: Aminotransferases class-IV"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0133"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92751"
FT                   /db_xref="GOA:A1K1P6"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1P6"
FT                   /protein_id="CAL92751.1"
FT                   /translation="MSMEDRDGWIWMDGQWLPWRDAKVHALTHTLHYGLGCFEGIRAYP
FT                   TAHGPAVFRLDDHIERLFDSAHILGLAMPCTPAEVRAACLEAVRRNGLDGGYIRPLVFL
FT                   GAEKVGVDPAGAATHVMVAAWQWGAYLGAQALERGIRVKVASFARHHVNVQMCRAKSVS
FT                   TYTNSILACREARAEGYDEALLLDTDGFVAEGPGENVFVVKRGVIYEPEITSALDGITR
FT                   RTLQTLASEAGYEIRARRITRDELYIADEVFFTGTAAEITPVVEVDRRRVGSGRPGPVT
FT                   QALQRRFFACVRGEDPAHADWLAPA"
FT   CDS_pept        complement(149318..150751)
FT                   /transl_table=11
FT                   /gene="ydaM"
FT                   /locus_tag="azo0134"
FT                   /product="putative response regulator"
FT                   /function="Response regulator containing a CheY-like
FT                   receiver domain and a GGDEF domain"
FT                   /note="Hypothetical response regulator, TREMBL:
FT                   trembl|Q7MSI2 (24% Wolinella succinogenes, hypothetical
FT                   protein ws0414) InterPro: IPR001610 PAC. IPR000014 PAS.
FT                   IPR001789 Response_reg. IPR000160 GGDEF. Pfam: PF00990
FT                   GGDEF domain. PF00072 Response_reg. PF00785 PAC. PF00989
FT                   PAS. TIGRFAM: TIGR00254 putative diguanylate cyclase
FT                   (GGDEF) domain. TIGR00229 PAS domain S-box."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92752"
FT                   /db_xref="GOA:A1K1P7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1P7"
FT                   /protein_id="CAL92752.1"
FT                   /translation="MSGRYAIVCIDDEETILESLSMELAGRFPGVDLELLQDNADAEGL
FT                   IGSLLAAGVEVPVVVCDYIMPGRRGDAVLAAVHRLAPAARTIMLTGQSNLEGVTHAINH
FT                   ANLYRYIAKPWNKEDLALTLQGALESYIQEATIQRQNQALVALNDGLERKVAERTEALR
FT                   AANANLTEANRKIGEYLEIIDRQVLICRINRAGLVTYASEAFCRRSGYTRADLIGLNYW
FT                   HALYSATTETLMREILARIEAGAGWEGEILHQCRNGEYYWARETIAPDVGEHGAVIGFT
FT                   SIRQDITDKKAVEALSVTDPLTGLANRRQFQQVLEGEIARASRGARALAFCLVDVDHFK
FT                   AYNDHYGHAAGDKVLQRLGRLLTDTFRRSTDFTFRIGGEEFALLFPVRDSAEAATTAAE
FT                   LVALVEAQAIVHAFGSPGPHLTISMGVRVISPREQPLDVDRIFQEADALLYQAKHEGRN
FT                   RYVLGGEAVAAAPASSGDA"
FT   CDS_pept        complement(150748..151149)
FT                   /transl_table=11
FT                   /locus_tag="azo0135"
FT                   /product="putative response regulator"
FT                   /function="FOG: CheY-like receiver"
FT                   /note="Putative response regulator,"
FT                   /db_xref="EnsemblGenomes-Gn:azo0135"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92753"
FT                   /db_xref="GOA:A1K1P8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1P8"
FT                   /protein_id="CAL92753.1"
FT                   /translation="MTDGVILCVDDEETILTALEMQLDELFDARFIVELAQGAAEAYEV
FT                   LESYEAGELPLLVIISDWQMPQIKGDEFLIEAHRRFPHVVKIMLSGHADPAAVDNAREH
FT                   ADLYCFLSKPWDKDELRNAILDGIRDKRP"
FT   CDS_pept        complement(151184..153406)
FT                   /transl_table=11
FT                   /locus_tag="azo0136"
FT                   /product="putative hybrid sensor and regulator protein"
FT                   /function="Signal transduction histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="Putative hybrid sensor and regulator protein,"
FT                   /db_xref="EnsemblGenomes-Gn:azo0136"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92754"
FT                   /db_xref="GOA:A1K1P9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1P9"
FT                   /protein_id="CAL92754.1"
FT                   /translation="MSRLKSIGAELGLLFLVVALAPIVTAYYVANDIFGEAIRQEKREA
FT                   LTAIADAAHGRIESYVRTLISDTTTLAKSPKVGELLSALEHLPGPSPATAEFLRAYREE
FT                   KGYYDVMLVDHLGNIRLSLSQPEVVGQSIQGELLRGSALARTIDAANTLLQTEVSNFAH
FT                   FPPSKGHAAFLAAPVFAGGVIIGNAVLQIDNRELDGIINRFGGLGESGEVLVGTIENAQ
FT                   LLITAPPRHDATLRNRQVDAARFAPLRAALEGSQGTGGYTDYRGHDTLAVWRYLPSLNW
FT                   GMLVKIDTAELYAPIRRFEAISLMVMVASVLLVLFGVALSNRLVSRPLVRFAQTVKALD
FT                   EESLPAAVNIDARHEIRDLVTAFNTLIGSVRSHQHQLEARVSERTAELATANAGLARAN
FT                   LDLQESNAELAVTLDELQRTHRQLVESEKLATLGQLIAGIAHEINTPLGSIASSIDTII
FT                   AGGQQQTAFLALYAGLGEDHRALVCSLLNVAATGSSLSLKEKRALKKDYETRLAEHPAV
FT                   DARKAAELLSHLPPLDLERYLPLLTHPEAGAILDQVKHAMNLHRASHNIKLASEKARKV
FT                   VFALKNFARFGDHGSKTPTRLRDSIDTVLTLYHNQIKQAVDLRAELPDLPPIPAYADEL
FT                   GQVWMNLIHNALQAMDYCGRLDITLEQDAERAVVRISDTGCGIPEEIRERIFQPFFTTK
FT                   PAGEGSGLGLDIVRKILDKHGGSIRVESAVGRGSTFEVTLPATETA"
FT   CDS_pept        complement(153403..154701)
FT                   /transl_table=11
FT                   /gene="amiC1"
FT                   /locus_tag="azo0137"
FT                   /product="putative aliphatic amidase expression-regulating
FT                   protein"
FT                   /function="ABC-type branched-chain amino acid transport
FT                   systems periplasmic component"
FT                   /note="Aliphatic amidase expression-regulating protein,AmiC
FT                   regulates the expression of the inducible aliphatic amidase
FT                   activity in Pseudomonas aeruginosa. Similar to
FT                   sprot|AMIC_PSEAE (31%) and to trembl|P74390 (50%).Pfam
FT                   (PF01094): Receptor family ligand binding region SignalP
FT                   reporting Signal peptide."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0137"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92755"
FT                   /db_xref="InterPro:IPR017777"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1Q0"
FT                   /protein_id="CAL92755.1"
FT                   /translation="MKSRILAAVAVLLVAGIAAAVAIWPSAGPARAGQVQPIRVGVLHS
FT                   LSGTMAISERSVAAATRLAIDHINAAGGVLGRPLEAVVRDGASDWSTFAREADALIARE
FT                   KVEVVFGCWTSASRKTVKPVFERHDHLLFYPVQYEGLESSPNIVYTGAAPNQQIIPAVK
FT                   WALDNIGRRFFLVGSDYVFPHSANAIMKDQIRSLRGEVVGEHYVLLGSSAVEAAVEAIA
FT                   ATRPDVILNTLNGDSNVAFFKALRAYGITPQVIPTISFSIAEAELQAMGSADFAGDYAA
FT                   WNYFQSLPGEANADFVAAYKARYGEQEVVTDPMEAAWIGVHLWARAVESAGSADPRAVR
FT                   LALQGKSMAAPEGAVSIDPHSQHLWKSVRIGRILPGGQFEVVWSTPKPVRPLPYPGYRP
FT                   PHEWDAFLGRLNERWNGHWANPGATPSTVEARS"
FT   CDS_pept        154860..155846
FT                   /transl_table=11
FT                   /locus_tag="azo0138"
FT                   /product="conserved hypothetical protein"
FT                   /function="Sphingosine kinase and enzymes related to
FT                   eukaryotic diacylglycerol kinase"
FT                   /note="Conserved hypothetical protein.Similarity to
FT                   b.subtilis bmru and to synechocystis pcc 6803 sll0036.
FT                   Identities = 29/85 (34%) Entry name SWISSPROT:YEGS_ECOLI
FT                   Prim. accession # P76407 InterPro IPR005218;
FT                   Cons_hypoth147. IPR001206; DAGKc. Pfam PF00781; DAGKc; 1.
FT                   Prediction: Non-secretory protein Signal peptide
FT                   probability: 0.00 Number of predicted TMHs: 0"
FT                   /db_xref="EnsemblGenomes-Gn:azo0138"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92756"
FT                   /db_xref="GOA:A1K1Q1"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1Q1"
FT                   /protein_id="CAL92756.1"
FT                   /translation="MNADAKPALPADSVQSVAEGAIDGPLLIVLNPGSGAQDADDARRR
FT                   IAAVLDAAGRAHEFIAVEDPAQLGGIAADCALRAAASGGAVVAAGGDGTINAVAHAVLE
FT                   AGCRFGVLPMGTFNYFGRTHHIPEDLEAAARVLVEGELRPVQVGEVNGRIFLVNASVGM
FT                   YPQLLEERETAKRQFGRSRAVAFVSALYTLLRNHRVLRLWLRCDDATGRVETPTLFVGN
FT                   NRLQLEQIGMAEAACVDAGALAVIGLRPVSPLGMLALALRGTLGRLGDADNVFSFPCAA
FT                   LFVSAGGGRRPPRVKVATDGEVLWMRLPLQFRVAPARLQLLCPPPAP"
FT   CDS_pept        155860..156708
FT                   /transl_table=11
FT                   /gene="cpdA"
FT                   /locus_tag="azo0139"
FT                   /product="probable phosphodiesterase"
FT                   /function="predicted phosphohydrolases"
FT                   /EC_number="3.1.4.17"
FT                   /note="Serine/threonine (S/T) phosphatases catalyse the
FT                   dephosphorylation of phosphoserine and phosphothreonine
FT                   residues. In mammalian tissues four different types of PP
FT                   have been identified and are known as PP1, PP2A, PP2B and
FT                   PP2C. Except for PP2C, these enzymes are evolutionary
FT                   related. The catalytic regions of the proteins are well
FT                   conserved TREMBL:Q7VZQ9: 41% identity, 50% similarity
FT                   InterPro:IPR004843; M-ppestrase. Pfam:PF00149; Metallophos
FT                   InterPro: Serine/threonine specific protein phosphatase No
FT                   transmembrane helices sbcd: exonuclease SbcD"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92757"
FT                   /db_xref="GOA:A1K1Q2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1Q2"
FT                   /protein_id="CAL92757.1"
FT                   /translation="MAALLHLSDPHFGTERAPVVEALLHCVARQTIDVAVISGDITQRA
FT                   RRHQFDAARAFVERLRAGLNGAPVLVLPGNHDIPLYALQRRLLRPFAGFRRVFGPQLEA
FT                   CHEDDSLQLQLVNTVSRWRHTDGVVRADQVERVARRLEAARPGQLRVIVTHQPAAVVRP
FT                   QDASDLLRGRERALRRWAAAGADLLLGGHIHLPYVQPLALPGPDGAPRPLWVVQAGTAL
FT                   SHRIRHEAGNSFNLIRHGAGASACVVERWDYDEAEHRFACRAQTPLALECGPAEATTRA
FT                   S"
FT   CDS_pept        complement(156692..157861)
FT                   /transl_table=11
FT                   /locus_tag="azo0140"
FT                   /product="conserved hypothetical protein"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /note="Conserved hypothetical protein. Homology to an orf
FT                   of Ralstonia eutropha of 61% (ZP_00167955). No domains
FT                   predicted. No TMHs. No signal peptide."
FT                   /db_xref="EnsemblGenomes-Gn:azo0140"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92758"
FT                   /db_xref="InterPro:IPR013702"
FT                   /db_xref="InterPro:IPR019494"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1Q3"
FT                   /protein_id="CAL92758.1"
FT                   /translation="MTAPTFLAAHAAAPQWRRALDVCLARLEHGARNAGRPLGDYTLGW
FT                   CYFTDAYTAAAEPLLAELQRRVPGASWVGTAGSGVAASGVEYIDQPALVLMLAPLPRSA
FT                   FRVFSGRQPLHPERDGFPAHAALVHADGNTPDLQELLPELAARTATGYLFGGLSSASRH
FT                   LQLADAVLSGGLSGVAFSDEVGLISRVTQGCQPIGPLRTATRVDDNVLLTLDGLPALAC
FT                   VLQDLGLANDIPVAEMADALSGTLVGLRAPGEAQPGAPGRFGADTVVRHIVGVDPRARV
FT                   LVVADEVAAGSRLAFCHRNPDAAMADLHRIAGEIRDELATRGQRAAGAVYASCIGRGGP
FT                   HFGRPNAELAAIREVLGDMPLAGFFAGGEIARDRLYGYTGVLTVFTMPA"
FT   CDS_pept        158045..159949
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /locus_tag="azo0141"
FT                   /product="glucose inhibited division protein A"
FT                   /function="NAD/FAD-utilizing enzyme apparently involved in
FT                   cell division"
FT                   /note="Glucose inhibited division protein A."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0141"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92759"
FT                   /db_xref="GOA:A1K1Q4"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1K1Q4"
FT                   /protein_id="CAL92759.1"
FT                   /translation="MLYPTRFDVIVVGGGHAGTEAALAAARMGCRTLLLSHNIETLGQM
FT                   SCNPSIGGIGKGHLVKEVDALGGAMAAATDEGGIQFRILNASKGPAVRATRAQADRVLY
FT                   KAAIRKRLENQPNLWLFQQAVDDLTVAGDRVTGVVTQIGLRFEAPAVVLTAGTFLNGLI
FT                   HVGLEHYSAGRAGDPPAISLGQRLKELALPQGRLKTGTPPRLDARSIDFSVMTVQPGDD
FT                   PVPVFSFLGSAAQHPAQLPCWMTHTNTRTHDVIRANLDRSPMYSGVIEGVGPRYCPSIE
FT                   DKIHRFADKDSHNIFLEPEGLTTHEIYPNGISTSLPFDVQLEIVRSIRGLENAHILRPG
FT                   YAIEYDYFDPRNLKSSLETKSIGGLFFAGQINGTTGYEEAAAQGLLAGANAALQVQGRE
FT                   AWCPRRDEAYLGVLVDDLITRGVSEPYRMFTSRAEYRLQLREDNADLRLTEKGRELGLV
FT                   DDVRWAAFCAKREAIERETARLKTSLARPDLIPVADQERVLGKTLEREARYFELLRRPE
FT                   TTYASLMSLPGAPEQPETDPQVVEQLEIAAKYQGYIDRQQDEVAKQLQAESTRLPADLD
FT                   YAEVRGLSKEVQQKLNLHKPETIGQAGRIQGITPAAISLLLVWLKRRDLAARSERRSA"
FT   CDS_pept        159946..160584
FT                   /transl_table=11
FT                   /gene="gidB"
FT                   /locus_tag="azo0142"
FT                   /product="probable methyltransferase GidB"
FT                   /function="predicted S-adenosylmethionine-dependent
FT                   methyltransferase involved in bacterial cell division"
FT                   /EC_number="2.1.-.-"
FT                   /note="Probable methyltransferase GidB. Homology to gidB of
FT                   E. coli of 47% (sprot|GIDB_ECOLI) Probable
FT                   S-adenosyl-L-methionine dependent methyltransferase
FT                   specific for a sterol and/or lipid substrate (By
FT                   similarity). InterPro: Glucose inhibited division protein
FT                   (IPR003682) Pfam: Glucose inhibited division protein
FT                   Tigrfam: gidB: glucose-inhibited division protein no signal
FT                   peptide no TMHs"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92760"
FT                   /db_xref="GOA:A1K1Q5"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1K1Q5"
FT                   /protein_id="CAL92760.1"
FT                   /translation="MSVLTPYAGRLADGIAALGLDIPTATQARLIAFGELLLKWNKVYN
FT                   LTAIRAPQEVITHHLLDSLAVLPYLSAVTRLADIGSGGGLPGIPLAIVRPELSVISVET
FT                   VNKKASFQQQAKIELGLGNFQPLNARVENLKPEQPCDGVISRAFSSLKDFVELSGHLVG
FT                   DGGALYAMKGVRPDDEVAALPAGWTVRATHPLAVPGLDAERHLLVIARG"
FT   CDS_pept        160716..161486
FT                   /transl_table=11
FT                   /gene="parA1"
FT                   /locus_tag="azo0143"
FT                   /product="ParA family protein"
FT                   /function="ATPases involved in chromosome partitioning"
FT                   /note="putative chromosome partitioning protein"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0143"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92761"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1Q6"
FT                   /protein_id="CAL92761.1"
FT                   /translation="MARIFCVANQKGGVGKTTTCVNLAAALHQCGQRTLLVDLDPQGNA
FT                   TMGSGVDKRSLEQSVYHLLVGLTGLAEARVTSPTGGYDVLPANRDLAGAEVELVSLENR
FT                   ENRLREALQQFDADYDFVLIDCPPSLSMLTLNGLCAAHGVIIPMQCEYYALEGLSDLVN
FT                   TIKKVHANLNRDLKIIGLLRVMFDPRVTLQQQVSAQLEGHFGDKVFSAIVPRNVRLAEA
FT                   PSHGMPGVVFDKAAKGAQAYMAFAGEMIERAKAF"
FT   CDS_pept        161496..161789
FT                   /transl_table=11
FT                   /locus_tag="azo0144"
FT                   /product="probable nucleotidyltransferase"
FT                   /function="predicted nucleotidyltransferases"
FT                   /EC_number="2.7.7.-"
FT                   /note="Hypothetical protein MJ0435. trembl:Q8DGT1:51%
FT                   identity, 64% similarity InterPro: IPR002934; NTP_transf.
FT                   Pfam: PF01909; NTP_transf_2 No signal peptide (Signal P
FT                   predicted) No transmembrane helices (TMHMM predicted).
FT                   hstdl_phs_rel: histidinol phosphatase-r"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92762"
FT                   /db_xref="GOA:A1K1Q7"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1Q7"
FT                   /protein_id="CAL92762.1"
FT                   /translation="MGRLFEQLIARREEVLACLARHRASNPRVFGSVARGEEGADSDID
FT                   LLVDLPRDISSFEVVRLNQELDDMLAHRVDLVIEDELHPALRVRVLAEARTL"
FT   CDS_pept        161786..162148
FT                   /transl_table=11
FT                   /locus_tag="azo0145"
FT                   /product="conserved hypothetical secreted protein"
FT                   /function="uncharacterized conserved protein"
FT                   /note="Conserved hypothetical secreted protein. Homology to
FT                   TLL2231 of Thermosynechococcus elongatus of 34%
FT                   (tremble:Q8DGT2). Signal peptide present. No TMH reported
FT                   present. Has (IPR008201)PF01934 Protein of unknown function
FT                   DUF86;The function of members of this family is unknown."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0145"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92763"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1Q8"
FT                   /protein_id="CAL92763.1"
FT                   /translation="MTRERDALLLVGDMLAALAEIESFAQVGEAAFMADLRTQRAIERS
FT                   FEILGEAASQLSTELRARYAEVPWRVVIDHRNRLIHGYASIEPARVWQTIVRDLPGLRA
FT                   SLEQAQTLIRGEQPGD"
FT   CDS_pept        162150..163013
FT                   /transl_table=11
FT                   /gene="parB"
FT                   /locus_tag="azo0146"
FT                   /product="probable chromosome partitioning protein ParB"
FT                   /note="Probable chromosome partitioning protein,"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0146"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92764"
FT                   /db_xref="GOA:A1K1Q9"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1Q9"
FT                   /protein_id="CAL92764.1"
FT                   /translation="MTPPKLKGLGRGLDALLAANRDDEAEKGELQTLATAALQPGKYQP
FT                   RTRMDPGSLEELAASIKAQGVMQPVLVRPLPQLNGAPRYEIIAGERRWRASQIAGLAEL
FT                   PCLVREIPDEAALAMSLIENIQREDLNPLEEAGGIQRLIDEFAMTHQQAADAVGRSRPA
FT                   ASNLLRLLNLARPVQELLMAGDIDMGHARALLPLDGASQIQLANLVAARQLSVRETERL
FT                   VQHTLNPRQKKAAAAPDRDLVRLEEEIADAIGATVKIKANKKGAGEVTIRFGSLDQLDG
FT                   LLGRLR"
FT   CDS_pept        complement(163114..165879)
FT                   /transl_table=11
FT                   /locus_tag="azo0147"
FT                   /product="conserved hypothetical membrane protein"
FT                   /function="predicted membrane protein"
FT                   /note="Conserved hypothetical membrane protein. Homology to
FT                   RS05051 of Ralstonia solanacearum of 45%
FT                   (trembl|Q8Y1A4(SRS)). TMHMM2 reporting the presence of 26
FT                   TMH's. Signal P reporting Signal Peptide present. Coils2
FT                   program reporting presence of Coiled coil."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0147"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92765"
FT                   /db_xref="GOA:A1K1R0"
FT                   /db_xref="InterPro:IPR014600"
FT                   /db_xref="InterPro:IPR019286"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1R0"
FT                   /protein_id="CAL92765.1"
FT                   /translation="MAMVIWIAAGALVGLIGGPAGILAGAVLGGLVAQLRKDGQQTASR
FT                   QDQRIAALEREVATLSRRVAAITAPPASAGAAPAGPVEEPAPLHLDLDLPPLQTASADV
FT                   AAPAGSPPADDALVPAKAGPALPPRSPSVAPLDADAPDLDALYLRCRDWLLGGNTLVRV
FT                   GILVLFFGLAFLARYAVEHDLLPPALRLAGIGGGGLALAALGWRLRRRRPGYALTLQGG
FT                   GVAVLYLTVFAAFRLYALLPAGAAFALMLLIVAAAAWFAVRQDAPALAVIGTAGGFAAP
FT                   ILASTGGGTHVELFTYYALLNTGVLALAWWRAWRSLNLTGFLFTFAIGLAWGAADYHPW
FT                   HFATTEPFLVLFFLMYVAAAVAYAWKRAPALGDPVDGTLVFGVPVVGFGLQAALVHGMP
FT                   DALAWSAAAVGVFYLVLAAALHRLRKPALELLVASFTALGIAFLTLAIPLAFDGRWSAA
FT                   AWALEGAALWWVGLRQQRRLAAACGLLLQAGAGLLFAADLAQHPGLRDLAVLNSAFLGT
FT                   TMIAGAGFVSAWLAARETRWPAWLQAVGHALLAWAWLWWLGGGWAEIDAQVFTGTRPAA
FT                   HLLLFAASGAVAVGLAARLRWADLQSAVALPAAGMLLAIAQVMNYGVPPSGHGGWLAWP
FT                   AALALHAFALYRADAHPARGLLGWTHAAGVWLLALAAAQEVGQRVATLGWGNGWETPAF
FT                   ALPPVLVLALLTRMASGARWPFATWRPAYLVAGAVPLAIGLVLWSLVVLPLADGSTRPY
FT                   GYVPLANPLDLTVIAALGTIAGWLRRARPQLEARFGPLQPLQAGLALVAFIAANGSLLR
FT                   AVHHATGLPWELPRLLAADTTQTALSLMWAVLGLGLMLLANRRASRPTWVAGAALMAAV
FT                   VAKLFLVDMAASGTLTRIVSFIGAGLLLLVVGYFSPLPPKQTVPAERAPE"
FT   CDS_pept        complement(165901..167784)
FT                   /transl_table=11
FT                   /locus_tag="azo0148"
FT                   /product="putative acyltransferase family protein"
FT                   /function="bifunctional protein"
FT                   /EC_number="2.3.1.-"
FT                   /note="Similar to the Aas bifunctional protein [includes:
FT                   2-acylglycerophosphoethanolamine acyltransferase
FT                   (2-acyl-gpe acyltransferase); acyl-acyl carrier protein
FT                   synthetase (acyl-acp synthetase)].Plays a role in
FT                   lysophospholipid acylation. 25% Acyltransferase.IPR000873;
FT                   AMP-bind. Pfam:PF01553; Acyltransferase; 1.PF00501;
FT                   AMP-binding; 1. TMhelix:10"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0148"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92766"
FT                   /db_xref="GOA:A1K1R1"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1R1"
FT                   /protein_id="CAL92766.1"
FT                   /translation="MSQQFELMKQRRFLPFFLTQFLGAFNDNVYKNALVVLLTFQAARY
FT                   TTLAPGVLVNLCAGLFILPFFLFSATAGQIADKYEKSRLIRFTKLLEIGVMLLGCIAFA
FT                   AESLVLMLATLFLMGAQSTLFGPVKYAILPQHLRENELVGGNALVESGTFVAILIGTLA
FT                   GGVMVSMPDGTLWVSAAIVTLALAGYLSSRGIPTAPAAAPELRINWNPVTETWRNLAFT
FT                   RGNRSVFLAVLGISWFWFYGAVFLSQFPAYAKDVLGGDEHAVVLLLAVFSVGIGIGSLL
FT                   CERLSTGHIEIGLVPFGSLGLSLFALDLWWASPAAVVPGTPAAPLSALLAQPANWRVVA
FT                   DLVAIGIFGGFYIVPLYALIQSRSEPGHRSRIIAGNNILNAAFMVVAAGMGAALLAAGL
FT                   DVTALFLVTALLNAVVAIYIYTLVPEFLLRFLVWLLVHSVYRLQVRGVQHIPEQGAAVL
FT                   VCNHVSFVDALVIMAASRRPIRFVMHHQIFRLPLLRFVFREGRAIPIASAREDPAMMER
FT                   AFDEIARALEAGELIAIFPEGHITEDGDISPFRPGIRRILERTPVPVVPLALRGLWGSF
FT                   FSRKDGRPMSRPLRRGLFSRIELVAGEPLAAAAASPEALQGRVAELRADWR"
FT   CDS_pept        complement(167781..169031)
FT                   /transl_table=11
FT                   /gene="uxuA"
FT                   /locus_tag="azo0149"
FT                   /product="putative mannonate dehydratase"
FT                   /function="predicted metal-dependent hydrolase of the
FT                   TIM-barrel fold"
FT                   /EC_number="4.2.1.8"
FT                   /note="tremblnew|AAR36422:35% identity, 46% similarity
FT                   EMBL:AE017218; AAR36422.1; TIGR:GSU3030; This
FT                   Fe2+-requiring enzyme plays a role in D-glucuronate
FT                   catabolism in Escherichia coli. Mannonate dehydratase
FT                   converts D-mannonate to 2-dehydro-3-deoxy-D-gluconate. An
FT                   apparent equivalog is found in a glucuronate utilization
FT                   operon in Bacillus stearothermophilus T-6.
FT                   Interpro:IPR004628;Man_dehyd SignalP predicted signal
FT                   peptide present. No. of transmembrane helices: 1 (TMHMM
FT                   predicted) pyrC_dimer: dihydroorotase homodimeric"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0149"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92767"
FT                   /db_xref="GOA:A1K1R2"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1R2"
FT                   /protein_id="CAL92767.1"
FT                   /translation="MSRPTCNTRRRLLLAAGGVALAGTAAGFAAARPLLMNECRAQLPA
FT                   DPAVQALLTAAWADLDPARVWDVHVHLAGTGDSGRGIELSERMQTPLRPFDYAQRLFYL
FT                   NAGCAHRAPGQVDESYIARLQNLCADAPAGFKLMLFAFDRAYDEHGRVLPLEGSMYIPN
FT                   DYASEVARRAPERFEWVCSIHPWRTNAVAQLQAAAEQGARAVKWLPPAMGIDPASPRCD
FT                   AFYDALARLDLPLLTHVGEEKAVHGPGLPEWGNPLRLRRALERGVRVIAAHCGSLGSDV
FT                   DTDRASRPRVPTFDLFARLMDDEAHASRLLGDVSAITLINRDPEVIRTIVERREWHERL
FT                   LFGSDYPLPGIVPLIPLAKLVRERLLDAGAVPALDALRHHNPILFDFALKRQLASRGRR
FT                   LPASVFETRRHFDRSVA"
FT   CDS_pept        complement(169028..171166)
FT                   /transl_table=11
FT                   /gene="aas"
FT                   /locus_tag="azo0150"
FT                   /product="bifunctional Aas protein"
FT                   /function="Acyl-CoA synthetases (AMP-forming)/AMP-acid
FT                   ligases II"
FT                   /EC_number="6.2.1.20"
FT                   /note="AAS bifunctional protein [Includes:
FT                   2-acylglycerophosphoethanolamine acyltransferase
FT                   (2-acyl-GPE acyltransferase); Acyl-acyl carrier protein
FT                   synthetase (Acyl-ACP synthetase)]. PLAYS A ROLE IN
FT                   LYSOPHOSPHOLIPID ACYLATION. TRANSFERS FATTY ACIDS TO THE
FT                   1-POSITION VIA AN ENZYME-BOUND ACYL-ACP INTERMEDIATE IN THE
FT                   PRESENCE OF ATP AND MG(2+). ITS PHYSIOLOGICAL FUNCTION IS
FT                   TO REGENERATE PTDETN FROM 2-ACYL-GPE FORMED BY
FT                   TRANSACYLATION REACTIONS OR DEGRADATION BY PHOSPHOLIPASE
FT                   A1, TREMBL:Q8FEA6 (52% identity); SWISSPROT:P31119 (52%
FT                   identity). Pfam (PF00501): AMP-binding enzyme. Pfam
FT                   (PF01553): Acyltransferase. TIGRFAM (TIGR00530):
FT                   1-acyl-sn-glycerol-3-phosphate acyltransferases. SignalP
FT                   reporting signal peptide."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0150"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92768"
FT                   /db_xref="GOA:A1K1R3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1R3"
FT                   /protein_id="CAL92768.1"
FT                   /translation="MPVIRFVLRLLLGTLFSVRVRGDNASLSARRLLIVANHESFLDGL
FT                   LLGLFLPADPVFVVHTGVTRRFWFRLALRLVDHLAVDPTNPMAMKRVIRLLEEGRPVVI
FT                   FPEGRITVTGSLMKVYEGPAFVAAKTGATIVPVRLDGAARSYFSRVAGRHPRRMLPRIT
FT                   LSIQPPTRIEMPEAPTAKARRQKAGEAMRRLMQEMLFASRPSQTLFDALLDTAALHGRQ
FT                   RAVVEDVKQVEYSYGDLIKMSLALGRLGSRLGGPGERIGVLLPNLAPTLGLVFGLNAFG
FT                   RTPAMLNYTAGTEGLQAACTAACLRTVITSRAFLEQARLTERVTALEGVRIVYLEDLRA
FT                   TLGLADKLWLMLWALHFPRLATCRQQPGDPAVVLFTSGSEGKPKGVVLSHQALLANVAQ
FT                   IRAVVDISPDDKILNALPLFHSFGLTAGSLLPVLSGADVFLYPSPLHYRVIPELAYDRG
FT                   CTVLLGTSTFLGNYARFAHPYDFFRLRYVIAGAEKLSEAVRTSWFEKFGIRIFEGYGAT
FT                   ETAPVLAVNTPMAYRSGTVGQLLPGLHAKLLAVPGIDRGGILHVSGPNLMSGYLRVEQP
FT                   GVLQPPSSAAGEGWYETGDVVDIDDDGFLRIVGRVKRFAKVAGEMVSLESVEKLAVQTA
FT                   SEFAHAASTQPDPARGESIVLFSTDPALTRERLQAAARDGGWPEIAVPRRIVPVDALPL
FT                   LGTGKIDYVTLKRWAEAA"
FT   CDS_pept        complement(171247..171558)
FT                   /transl_table=11
FT                   /gene="smtB"
FT                   /locus_tag="azo0151"
FT                   /product="putative transcriptional repressor"
FT                   /function="predicted transcriptional regulators"
FT                   /note="Putative transcriptional repressor,"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0151"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92769"
FT                   /db_xref="GOA:A1K1R4"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1R4"
FT                   /protein_id="CAL92769.1"
FT                   /translation="MNPDYSREIPQPWRQMSRVFTALGDEHRQRILLTFERDERLNVSQ
FT                   IAGVSTLSRPAVSHHLKILREAGVLSSEKVGKEIYFWVNTSFLTETFDNVRDYLASRL"
FT   CDS_pept        171735..172085
FT                   /transl_table=11
FT                   /locus_tag="azo0152"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="Conserved hypothetical membrane protein. Homology to
FT                   BB4612 of Bordetella bronchiseptica of 37%
FT                   (trembl|Q7WEM2(SRS)). No domains predicted. signal peptide
FT                   3 TMHs"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0152"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92770"
FT                   /db_xref="GOA:A1K1R5"
FT                   /db_xref="InterPro:IPR005598"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1R5"
FT                   /protein_id="CAL92770.1"
FT                   /translation="MTSPMLRSVLLQLGAGLVATAIAAVFFGPRGAISAAYGALACIVP
FT                   AAMFALRLGALARRSGATVTAFVVGEFVKIASIVGLLVLFPALYPGVHWGALLIGLILA
FT                   LKANLFAFLVRN"
FT   CDS_pept        172088..172936
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="azo0153"
FT                   /product="probable ATP synthase A chain"
FT                   /function="F0F1-type ATP synthase subunit a"
FT                   /EC_number="3.6.3.14"
FT                   /note="Probable ATP synthase A chain (Protein 6). Homology
FT                   to atpB of E. coli of 47% (sprot|ATP6_ECOLI). Key component
FT                   of the F-type ATPases (EC 3.6.3.14). The ATPase has 2
FT                   components, CF(1) - the catalytic core - and CF(0) -the
FT                   membrane proton channel. CF(1) has five subunits: alpha,
FT                   beta, gamma, delta, epsilon. CF(0) has three main subunits:
FT                   a, b and c. Subunit A might be component of the proton
FT                   channel; it may play a direct role in the translocation of
FT                   protons across the membrane. InterPro: ATP synthase A
FT                   subunit (IPR000568) Pfam: ATP synthase A chain no signal
FT                   peptide probable 6 TMHs"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0153"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92771"
FT                   /db_xref="GOA:A1K1R6"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1K1R6"
FT                   /protein_id="CAL92771.1"
FT                   /translation="MATEHAPTASEYVVHHLTHLNSTGHAQTSIVDFSVINVDSMFYSV
FT                   LLGLLTVFLLWLAARKATAGVPGRFQGFVELLVEMVADQAKGIIHSAESRKFVAPLALT
FT                   VFVWIFLMNAMDMLPVDLLPRIWEGVYASAGGDPHHAYMRVVPTADLSATLGMSCGVLL
FT                   LCLYYNVKIKGVSGWVHELFTAPFGSHPLLYPINFAMQIIEFVAKTVSHGMRLFGNMYA
FT                   GELIFILIALLGSTATVFGFVGHIVAGSIWAIFHILIITLQAFIFMMLTLVYIGQAHEG
FT                   H"
FT   CDS_pept        172992..173237
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="azo0154"
FT                   /product="probable ATP synthase C chain"
FT                   /function="F0F1-type ATP synthase subunit
FT                   c/Archaeal/vacuolar-type H+-ATPase subunit K"
FT                   /note="ATP synthase C chain. Homology to atpE of E. coli of
FT                   48% (sprot|ATPL_ECOLI). Key component of the F-type ATPases
FT                   (EC 3.6.3.14). The ATPase has 2 components, CF(1) - the
FT                   catalytic core - and CF(0) - the membrane proton channel.
FT                   CF(1) has five subunits: alpha, beta, gamma,delta, epsilon.
FT                   CF(0) has three main subunits: a, b and c. Pfam: ATP
FT                   synthase subunit C probable signal peptide probable 1 TMH"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0154"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92772"
FT                   /db_xref="GOA:A1K1R7"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1K1R7"
FT                   /protein_id="CAL92772.1"
FT                   /translation="MENVLGFVALAAGLIIGLGAIGACIGIGIMGSKYLEASARQPELM
FT                   NALQTKMFLLAGLIDAAFLIGVGIAMMFAFANPFQL"
FT   CDS_pept        173279..173752
FT                   /transl_table=11
FT                   /gene="atpF"
FT                   /locus_tag="azo0155"
FT                   /product="probable ATP synthase B chain"
FT                   /function="F0F1-type ATP synthase subunit b"
FT                   /note="Probable ATP synthase B chain. Homology to atpF of
FT                   E. coli of 43% (sprot|ATPF_ECOLI) Key component of the
FT                   F-type ATPases (EC 3.6.3.14). The ATPase has 2
FT                   components,CF(1) - the catalytic core - and CF(0) - the
FT                   membrane proton channel. CF(1) has five subunits: alpha,
FT                   beta,gamma, delta, epsilon. CF(0) has three main subunits:
FT                   a, b and c. Pfam: ATP synthase B/B' CF(0) no signal peptide
FT                   1 TMHs"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0155"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92773"
FT                   /db_xref="GOA:A1K1R8"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1K1R8"
FT                   /protein_id="CAL92773.1"
FT                   /translation="MNLNATLIAQLVVFFILAWFTMKFVWPPIVKALDERAKKIADGLA
FT                   AADKAKADLALAEKKVVEELRKARESAGDVRASAEKQASQLVDEARAEASRIIAQAREA
FT                   AEAEAGAAAQRAKEALRDQVAHLAVAGAEKILRREINAQVHAELLANLKQELQ"
FT   CDS_pept        173756..174289
FT                   /transl_table=11
FT                   /gene="atpH"
FT                   /locus_tag="azo0156"
FT                   /product="putative ATP synthase delta chain"
FT                   /function="F0F1-type ATP synthase delta subunit
FT                   (mitochondrial oligomycin sensitivity protein)"
FT                   /note="putive ATP synthase delta chain. Homology to atpH of
FT                   E. coli of 32% (sprot|ATPD_ECOLI). Key component of the
FT                   F-type ATPases (EC 3.6.3.14). The ATPase has 2
FT                   components,CF(1) - the catalytic core - and CF(0) - the
FT                   membrane proton channel. CF(1) has five subunits: alpha,
FT                   beta,gamma, delta, epsilon. CF(0) has three main subunits:
FT                   a, b and c. Subunit delta seems to be part of the stalk
FT                   that links CF(0) to CF(1). It either transmits
FT                   conformational changes from CF(0) into CF(1) or is
FT                   implicated in proton conduction. InterPro: ATP synthase
FT                   delta (OSCP) subunit (IPR000711) Pfam: ATP synthase delta
FT                   (OSCP) subunit no signal peptide no TMHs"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0156"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92774"
FT                   /db_xref="GOA:A1K1R9"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1K1R9"
FT                   /protein_id="CAL92774.1"
FT                   /translation="MAENVTIARPYADAAFELARGAGALGPWSEALDRLAAVAADSSMR
FT                   ACINDPKLSADQLNTLVQEVGGNLTAEQQNFVRVLVDNERLQVLPEIRDLFVALKNEHE
FT                   GVLEAEIASAFPLDDAALAALKADLEARFQARLNVTVSIDPELIGGVRIAVGDEVIDAS
FT                   VRGKLANMAAALKN"
FT   CDS_pept        174303..175841
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="azo0157"
FT                   /product="ATP synthase alpha chain"
FT                   /function="F0F1-type ATP synthase alpha subunit"
FT                   /note="ATP synthase alpha chain. Homology to atpA of E.
FT                   coli of 70% (sprot|ATPA_ECOLI). Key component of the F-type
FT                   ATPases (EC 3.6.3.14). The ATPase has 2 components,CF(1) -
FT                   the catalytic core - and CF(0) - the membrane proton
FT                   channel. CF(1) has five subunits: alpha, beta,gamma, delta,
FT                   epsilon. CF(0) has three main subunits: a, b and c.
FT                   Produces ATP from ADP in the presence of a proton gradient
FT                   across the membrane. The alpha chain is a regulatory
FT                   subunit. Pfam: ATP syntahse alpha/beta family,beta barrel
FT                   domain; ATP synthase alpha/beta chain, C terminal domain;
FT                   ATP synthase alpha/beta chain, nucleotide binding domain no
FT                   signal peptide no TMHs"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0157"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92775"
FT                   /db_xref="GOA:A1K1S0"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1K1S0"
FT                   /protein_id="CAL92775.1"
FT                   /translation="MQLNPSEISDLIKSRIQNLQLAATSRNEGTVVSVTDGITRIHGLT
FT                   DVMQGEMLEFPGNTFGLALNLERDSVGAVVLGEYEHITEGDTVKATGRILEVPVGPELI
FT                   GRVVNALGQPIDGKGPINAKLTDKIEKVAPGVIARQSVSQPVQTGLKSVDSMVPIGRGQ
FT                   RELIIGDRQTGKTAVAVDAIINQKGQNMFCVYVAIGQKASTIANVVRKLEENGAMEYTI
FT                   VVAATASESAAMQYLSAYAGCTMGEYFRDRGQDALIVYDDLTKQAWAYRQVSLLLRRPP
FT                   GREAYPGDVFYLHSRLLERAARVNADYVEKFTNGEVKGKTGSLTALPVIETQAGDVSAF
FT                   VPTNVISITDGQIFLETDLFNAGIRPAINAGISVSRVGGAAQTKVVKKLSGGIRTDLAQ
FT                   YRELAAFAQFASDLDDATRKQLERGRRVTELMKQPQYAPLSVAEMAITLYAVNNGYFDD
FT                   VEVARVLAFESGLQQFVKAKAPELVAKITDTKELDADGEKTLVAAIAEFKKSWA"
FT   CDS_pept        175863..176732
FT                   /transl_table=11
FT                   /gene="atpG"
FT                   /locus_tag="azo0158"
FT                   /product="probable ATP synthase gamma chain"
FT                   /function="F0F1-type ATP synthase gamma subunit"
FT                   /note="Probable ATP synthase gamma chain. Homology to atpG
FT                   of E. coli of 58% (sprot|ATPG_ECOLI) Key component of the
FT                   F-type ATPases (EC 3.6.3.14). The ATPase has 2
FT                   components,CF(1) - the catalytic core - and CF(0) - the
FT                   membrane proton channel. CF(1) has five subunits: alpha,
FT                   beta,gamma, delta, epsilon. CF(0) has three main subunits:
FT                   a, b and c. PRODUCES ATP FROM ADP IN THE PRESENCE OF A
FT                   PROTON GRADIENT ACROSS THE MEMBRANE. THE GAMMA CHAIN IS
FT                   BELIEVED TO BE IMPORTANT IN REGULATING ATPASE ACTIVITY AND
FT                   THE FLOW OF PROTONS THROUGH THE CF(0) COMPLEX. InterPro:
FT                   ATP synthase gamma subunit(IPR000131) Pfam: ATP synthase no
FT                   TMHs no signal peptide"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0158"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92776"
FT                   /db_xref="GOA:A1K1S1"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1K1S1"
FT                   /protein_id="CAL92776.1"
FT                   /translation="MASGKEIRTKIKSVQNTRKITKAMEMVAASKMRKAQDRMRAARPY
FT                   ADKIRRLAANLSQANVTDYKHPFLVRKDQVKRVGLILVTTDKGLCGGLNTNVQRVAVNA
FT                   MKEWEAAGATEIRACCIGNKGFGFMQRIGAKVVSHVTQLGDTPHLEKLIGPVKVMLDAF
FT                   QNGELDAVYVAYTRFINTMKQEPQLEQLLPLTGEKLGTPDNSWDYLYEPDPQVVIDELL
FT                   VRYVEALVYQAVAENMASEQSARMVAMKAASDNAKNVIGELQLVYNKTRQAAITKELSE
FT                   IVGGAAAV"
FT   CDS_pept        176757..178157
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="azo0159"
FT                   /product="ATP synthase beta chain"
FT                   /function="F0F1-type ATP synthase beta subunit"
FT                   /note="ATP synthase beta chain. Key component of the F-type
FT                   ATPases (EC 3.6.3.14). The ATPase has 2 components,CF(1) -
FT                   the catalytic core - and CF(0) - the membrane proton
FT                   channel. CF(1) has five subunits: alpha, beta,gamma, delta,
FT                   epsilon. CF(0) has three main subunits: a, b and c.
FT                   Produces ATP from ADP in the presence of a proton gradient
FT                   across the membrane. The beta chain is the catalytic
FT                   subunit. InterPro: ATP synthase alpha and beta subunit
FT                   central region(IPR000194); ATP synthase alpha and beta
FT                   subunit, N-terminal (IPR004100); ATP synthase alpha and
FT                   beta subunit, C-terminal (IPR000793); AAA ATPase
FT                   superfamily (IPR003593) Pfam: ATP synthase alph/beta
FT                   family, beta-berrel domain; ATP synthase alph/beta
FT                   family,nucleotid binding domain; ATP synthase alpha/beta
FT                   chain, C terminal domain no signal peptide no TMHs"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0159"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92777"
FT                   /db_xref="GOA:A1K1S2"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1K1S2"
FT                   /protein_id="CAL92777.1"
FT                   /translation="MSNGTIVQCIGAVVDIQFPRDSMPKVYDALKLEDAADSFAEAGLT
FT                   FEVQQQLGDGVVRTIALGSSDGLRRGMKVSNTGKPISVPVGHGTLGRIMDVLGRPIDEA
FT                   GPVETDELRAIHQKAPKFDELSPSVELLETGIKVIDLICPFAKGGKVGLFGGAGVGKTV
FT                   NMMELINNIAKQHSGLSVFAGVGERTREGNDFYHEMKDSNVLDKVAMVFGQMNEPPGNR
FT                   LRVALTGLTMAERFRDEGRDILFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEM
FT                   GRLQERITSTKVGSITSIQAVYVPADDLTDPSPATTFLHLDSTVVLSRDIAALGIYPAV
FT                   DPLDSTSRQLDPLVVGEEHYSVARAVQQTLQKYKELRDIIAILGMDELSPDDKLAVARA
FT                   RKIQRFLSQPFHVAEVFTGSPGKYVSLKDTIAGFKAIVNGEYDHLPEQAFYMVGGIEEV
FT                   LEKAKKLQ"
FT   CDS_pept        178210..178635
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /locus_tag="azo0160"
FT                   /product="probable ATP synthase epsilon chain"
FT                   /function="F0F1-type ATP synthase epsilon subunit
FT                   (mitochondrial delta subunit)"
FT                   /note="Probable ATP synthase epsilon chain. Key component
FT                   of the F-type ATPases (EC 3.6.3.14). The ATPase has 2
FT                   components, CF(1) - the catalytic core - and CF(0) - the
FT                   membrane proton channel. CF(1) has five subunits:
FT                   alpha,beta, gamma, delta, epsilon. CF(0) has three main
FT                   subunits: a, b and c. InterPro: ATP synthase Delta/Epsilon
FT                   chain (IPR001469) Pfam: ATP synthase, Dleta/Epsilon chain
FT                   no signal peptide no TMHs"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0160"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92778"
FT                   /db_xref="GOA:A1K1S3"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1K1S3"
FT                   /protein_id="CAL92778.1"
FT                   /translation="MAMTVHVDIVSAEEQIFSGLAEFVALPGEAGELGILPGHMPLMTR
FT                   IKPGAVRVKVQNQAEEEVVFVAGGLLEVQPGLVTVLADTAIRGKDLDEAKALEAKRKAE
FT                   EALANQSSQLDYAKAQAELAEAIAQIAAIQRLKKGIH"
FT   CDS_pept        complement(178705..179283)
FT                   /transl_table=11
FT                   /locus_tag="azo0161"
FT                   /product="conserved hypothetical protein"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /note="Conserved hypothetical protein. Homology to rsc0460
FT                   of R. solanacearum of 39% (trembl|Q8Y276(SRS) Pfam: DUF1243
FT                   This family consists of a number of hypothetical bacterial
FT                   proteins of around 200 residues in length. The function of
FT                   this family is unknown. no signal peptide no TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:azo0161"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92779"
FT                   /db_xref="GOA:A1K1S4"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1S4"
FT                   /protein_id="CAL92779.1"
FT                   /translation="MIEQAVLATINHLLAQSGWARTRLVPHAGRTAHLDLAPVHVGFSV
FT                   ANDGYLAQWAHEGEQPDVRLRVAATELLPDLVARGPAGVMQRVHLEGNAEFADALGFVF
FT                   RNLRWDAEEDLSRVVGDILAHRAVTTARALVAGQQRAAANAAANVAEFLTAEERLLLGR
FT                   PALGGFTAEIVDIRDQLGRLDKRITKLGG"
FT   CDS_pept        complement(179327..180064)
FT                   /transl_table=11
FT                   /gene="ubiE1"
FT                   /locus_tag="azo0162"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /function="Methylase involved in ubiquinone/menaquinone
FT                   biosynthesis"
FT                   /EC_number="2.1.1.-"
FT                   /note="Ubiquinone/menaquinone biosynthesis
FT                   methyltransferase ubiE (EC 2.1.1.-). Methyltransferase
FT                   required for the conversion of dimethylmenaquinone (DMKH2)
FT                   to menaquinone (MKH2) and the conversion of
FT                   2-polyprenyl-6-methoxy-14-benzoquinol (DDMQH2) to
FT                   2-polyprenyl-3-methyl-6-methoxy-14-benzoquinol (DMQH2) (By
FT                   similarity). InterPro: ubiE/COQ5 methyltransferase
FT                   hemK_rel_arch: methylase putative"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0162"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92780"
FT                   /db_xref="GOA:A1K1S5"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1S5"
FT                   /protein_id="CAL92780.1"
FT                   /translation="MNDKTTHFGFETVAENQKQRRVAEVFSSVASRYDVMNDLMSFGLH
FT                   RLWKAFTIQVSGVRSGDRVLDVAGGTADLSLAFARKVGPTGQVWLTDINHAMLSRGRDR
FT                   VLDHGFALPVAQCNAERLPFPDDWFDCVTVAFGLRNMTHKDVALAEMRRVLRPGGRLLV
FT                   LEFSKVWKPLAPLYDLYSFKLLPWMGDKVAKDADSYRYLAESIRMHPGQDELRDMMEQA
FT                   GLARVDYFNLSAGVVALHRGYKT"
FT   CDS_pept        complement(180072..180494)
FT                   /transl_table=11
FT                   /locus_tag="azo0163"
FT                   /product="conserved hypothetical protein"
FT                   /note="Conserved hypothetical protein. Homology to rs04443
FT                   of R. solanacearum of 69% (trembl|Q8Y279). Pfam:
FT                   PF06155,Protein of unknown function (DUF971) Interpro:
FT                   IPR010376; This family consists of several short bacterial
FT                   proteins and one sequence (Q8RZ62) from Oryza sativa. The
FT                   function of this family is unknown. No Signal Peptide. No
FT                   TMH present."
FT                   /db_xref="EnsemblGenomes-Gn:azo0163"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92781"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1S6"
FT                   /protein_id="CAL92781.1"
FT                   /translation="MAGLDKDTPLPTDITLHRQSRVLEIGFEDGRSFRLPFEFLRVYSP
FT                   SAEVRGHGPGQETLQQGKRDVDITGLEPVGNYAIKPVFSDGHDSGLYSWDYLYELGLQH
FT                   DELWQQYLDRLAAAGGSREAGAVPPAAPKSGCGHHH"
FT   CDS_pept        180644..181354
FT                   /transl_table=11
FT                   /gene="phoB"
FT                   /locus_tag="azo0164"
FT                   /product="phosphate regulon transcriptional regulatory
FT                   protein"
FT                   /function="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /note="Phosphate regulon transcriptional regulatory
FT                   protein,"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0164"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92782"
FT                   /db_xref="GOA:A1K1S7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011879"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1S7"
FT                   /protein_id="CAL92782.1"
FT                   /translation="MPANILLVEDEPAIQELIAANLSRAGHHVVRAADAEAAQRLVRDA
FT                   LPDLVLLDWMLPGMSGIDFARRLRAEERTREIPIIMLTARGEEQDKVAGLETGADDYIT
FT                   KPFSPRELVARIKAVLRRRAPQATEDAVELGGLRLDPATHRVTAGERALSLGPTEFRLL
FT                   HFLMTHAERVHSRAQLLDQVWGDHVFVEERTVDVHIRRLRCALEPSAHDALIQTVRGSG
FT                   YRFSAQVDVTSATR"
FT   CDS_pept        181446..182717
FT                   /transl_table=11
FT                   /gene="phoR"
FT                   /locus_tag="azo0165"
FT                   /product="phosphate regulon sensor protein"
FT                   /function="Signal transduction histidine kinase"
FT                   /EC_number="2.7.13.1"
FT                   /note="Phosphate regulon sensor protein, 3 Signal P
FT                   reporting signal peptide TMHMM reporting 1 transmembrane
FT                   helices. MEMBER OF THE TWO-COMPONENT REGULATORY SYSTEM
FT                   PHOR/PHOB INVOLVED IN THE PHOSPHATE REGULON GENES
FT                   EXPRESSION. PHOR MAY FUNCTION AS A MEMBRANE-ASSOCIATED
FT                   PROTEIN KINASE THAT PHOSPHORYLATES PHOB IN RESPONSE TO
FT                   ENVIRONMENTAL SIGNALS."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0165"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92783"
FT                   /db_xref="GOA:A1K1S8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR014310"
FT                   /db_xref="InterPro:IPR021766"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1S8"
FT                   /protein_id="CAL92783.1"
FT                   /translation="MAGLAALVGGSLAALLAALVGLLAAGWYHLVNLYRLVQWTREPVG
FT                   TPLPRAAGTWGKVFADMSRRSRLAYDMRERLAATLDRFRDASQAMPDGVMYLAESDTIE
FT                   WMNLKAEQHFGLDHTRDIGAPVTNLVRQPAFVQYLHGGHYEESLVLPSTRPGGLTLQVQ
FT                   VIPFGDGQKMVLSRDISQLERLETMRQDFVANVSHELRTPLTVVGGFLETLIDGAGDFE
FT                   PDDVQRYLRLALEQSNRMRHLIEDLLTLSALETGAPAPAEERVGVATLVRDVYAEAEAL
FT                   SSGRHQLSLVLDTDAVLLGSHKELRSAFANLCSNAVRYTPDGGRIEVGWRQDDAGGEFW
FT                   VRDDGIGIDAQHIPRLTERFYRVDRGRSRETGGTGLGLAIVKHILTRHQAELHVVSTPG
FT                   AGSRFSVRFPRARLMQPKAAALRS"
FT   CDS_pept        complement(182683..184287)
FT                   /transl_table=11
FT                   /locus_tag="azo0166"
FT                   /product="conserved hypothetical protein"
FT                   /note="Conserved hypothetical protein. Homology to ebA3023
FT                   of Azoarcus sp. EbN1 of 61% (trembl:Q5P4D4). No domains
FT                   predicted. No TMHs. No signal peptide."
FT                   /db_xref="EnsemblGenomes-Gn:azo0166"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92784"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1S9"
FT                   /protein_id="CAL92784.1"
FT                   /translation="MDYRNAAECLNLLHRLHASNVDETHAALSTVVFGMLDALPPPNQH
FT                   LEVLEAARPMIARVQAEMSRRYTAQPLPPDSLENEILLRVVTLWRNLARSYARIVRHDA
FT                   RDGTLDDQRALLFQRRMHYAGQGVVEYFRAHRAVPAGQWAEAHECFAAAEEADLAQIRV
FT                   ADSLNEVWKAQSTLEAYVAVLLVDLANPFGRTERELAWICRWAQRFAPYCALGTPESQK
FT                   PTLYGVDLGADHGLRPLGLLPASPRLRRFDGSTLAGQIRAVLAQFKQGLKPASLGLGED
FT                   CTVEAGNRLLLSLYRPWGLASAGRRFPRRGSRGQVELTGDWLAIGFHVDGKVFTQPRTY
FT                   GVASSLNSDMNLLTFGERAPQADDPARREALRQHEAEQLGFVCEQWEILDQSVGGFRLQ
FT                   QRPRAERLEHHQLVGVRPQDGDRFLLGHVSWLMYRADGLLEAGVHVLPGVPSLVAARPV
FT                   SLHSGRSPFHQAFLLPATPALKTGPSLVLPSRWYHPSAVIEIHVEGKSSQVRLEQLVLR
FT                   GANFDQVSFEALPPSVA"
FT   CDS_pept        complement(184317..184733)
FT                   /transl_table=11
FT                   /locus_tag="azo0167"
FT                   /product="conserved hypothetical protein"
FT                   /note="55% HIT. Pfam:PF01230; HIT; 1. The Histidine Triad
FT                   (HIT) motif, His-phi-His-phi-His-phi-phi (phi, a
FT                   hydrophobic amino acid) was identified as being highly
FT                   conserved in a variety of organisms."
FT                   /db_xref="EnsemblGenomes-Gn:azo0167"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92785"
FT                   /db_xref="GOA:A1K1T0"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR026026"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1T0"
FT                   /protein_id="CAL92785.1"
FT                   /translation="MQVDCPLCQIDRAKLVWQDERCSVIRVDDAAHPGFCRVVWRDHVA
FT                   EMTDLAAADRRHLMDVVFATEAALRQLMQPAKINLASFGNMVPHLHWHVIPRFADDRHF
FT                   PESVWGPAQREGVAHPGPDTAVLARAVQAALDAR"
FT   CDS_pept        complement(184801..185625)
FT                   /transl_table=11
FT                   /locus_tag="azo0168"
FT                   /product="conserved hypothetical glutamine
FT                   amidotransferases class-II (Gn-AT),YafJ-type"
FT                   /function="COG: Predicted glutamine amidotransferase"
FT                   /note="Conserved hypothetical glutamine amidotransferases
FT                   class-II (Gn-AT), YafJ-type. Homology to ebA3026 of
FT                   Azoarcus sp. EbN1 of 75% (gnl|keqq|eba:ebA3026(KEGG)).
FT                   Pfam: Glutamine amidotransferases class-II. YafJ is a
FT                   glutamine amidotransferase-like protein of unknown function
FT                   found in prokaryotes, eukaryotes and archaea. YafJ has an
FT                   Ntn hydrolase"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0168"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92786"
FT                   /db_xref="GOA:A1K1T1"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1T1"
FT                   /protein_id="CAL92786.1"
FT                   /translation="MCQLLGMNCNVPTDICFSFTGFRARGGLTDHHRDGWGIAFFEGKG
FT                   VRLFLDPCASADSAVAELVRQYPIRSLNVIAHIRKATQGEIRLENTHPFQRELWGRYWI
FT                   FAHNGNLLNYAPALSGRFQPVGGTDSETAFCHILDELARRFGDRPPPAPALHACLAELA
FT                   TAIGRHGEFNFLLSDGERLFAHCSSRLAYVLRQAPFALAHLADEDLAVDFSEVTTPNDR
FT                   VAVIATIPLTDNETWHRMPSGTLMSFRHGVPDELGMLPTVAAPPCATPIRSA"
FT   CDS_pept        complement(185689..186207)
FT                   /transl_table=11
FT                   /locus_tag="azo0169"
FT                   /product="conserved hypothetical secreted protein"
FT                   /note="Conserved hypothetical secreted protein. Homology to
FT                   bll7463 of B. japonicum of 30% (tremble:Q89DH6). No domains
FT                   predicted. No TMHs. Signal peptide present."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92787"
FT                   /db_xref="InterPro:IPR022061"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1T2"
FT                   /protein_id="CAL92787.1"
FT                   /translation="MQRRLSILAGALAALVAASTLAEPPADMPRRKPGLWEMKTTLVEL
FT                   GGLTQMLQMCVGPNTDDILYQRGGKQGGCEQQTWRREGERSTFSAVCRIEGSLANLRGS
FT                   FTGDFTTRYSGELYSTYNPPLQGMASMTMRQDSRWLGECQPGQKPGDIVRQGVGGIDLD
FT                   AMMKGMQRR"
FT   CDS_pept        complement(186300..187760)
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="azo0170"
FT                   /product="glutamyl-tRNA(GLN) amidotransferase subunit B"
FT                   /function="Asp-tRNAAsn/Glu-tRNAGln amidotransferase B
FT                   subunit (PET112 homolog)"
FT                   /EC_number="6.3.5.-"
FT                   /note="Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B (EC 6.3.5.-) (Asp/Glu-ADT subunit B). Allows the
FT                   formation of correctly charged Asn-tRNA(Asn) or
FT                   Gln-tRNA(Gln) through the transamidation of misacylated
FT                   Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack
FT                   either or both of asparaginyl-tRNA or glutaminyl-tRNA
FT                   synthetases. The reaction takes place in the presence of
FT                   glutamine and ATP through an activated
FT                   phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln)"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0170"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92788"
FT                   /db_xref="GOA:A1K1T3"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1K1T3"
FT                   /protein_id="CAL92788.1"
FT                   /translation="MSRSDWEVVIGLEVHAQLNTASKIFSGASTAFGAEPNVQASAVDI
FT                   ALPGVLPVLNRGAVERAIRFGLAIGATVAPTSVFARKNYFYPDLPKGYQISQFELPVVQ
FT                   GGTITIRVGEGENAYEKTVNLTRAHLEEDAGKSLHEDFHGMSGIDLNRAGTPLLEIVSE
FT                   PDMRSSAEAVAYARTLHALVRWIDICDGNMQEGSFRCDANVSVRKKGAEKFGTRREIKN
FT                   LNSFRFLQQAIDYEVQWQIDTIEDGGTIQQATVLFDPDTGETRMMRSKEDAHDYRYFPD
FT                   PDLLPLVISPEWKARVQGEMPELPEAMKARFIEQLGLSAYDATTLTASKEVATYYQATV
FT                   DAAGAALAKPCANWVMGDLAARLNKAELDIAVSPVSPAQLAGLVARIADNTISNAIAKK
FT                   VFEALWNGEGASADEIIDKQGLKQVTDSGAIEAMIDEVLAANQKSVEEFRAGKDKAFNA
FT                   LVGQVMKASKGKASPAQVNELLKKKLAG"
FT   CDS_pept        complement(187818..188330)
FT                   /transl_table=11
FT                   /locus_tag="azo0171"
FT                   /product="conserved hypothetical secreted protein"
FT                   /note="Conserved hypothetical secreted protein. Homology to
FT                   an orf of Dechloromonas aromatica of 41%
FT                   (gi|46141061|ref|ZP_00152875.2|(NBCI ENTREZ)). No domains
FT                   predicted. Signal P reporting signal peptide present. NO
FT                   TMH present."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0171"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92789"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1T4"
FT                   /protein_id="CAL92789.1"
FT                   /translation="MARFALRLAGRIAAAEFALWLAACATPPAGTEPATRQEAEEMEEA
FT                   PTAARGRLKPMPIRPLTVQADCTFRDEAGYAASTRLDVSASQVRGFAANVEVPRRGSCH
FT                   FDLADFRQVPAETHVELRARDGCTVRMWEQGDQVTVAFTQCANRCSKGTFEYVWPILVD
FT                   RPSGQCN"
FT   CDS_pept        complement(188336..189799)
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="azo0172"
FT                   /product="glutamyl-tRNA(GLN) amidotransferase subunit A"
FT                   /function="Asp-tRNAAsn/Glu-tRNAGln amidotransferase A
FT                   subunit and related amidases"
FT                   /EC_number="6.3.5.-"
FT                   /note="Glutamyl-tRNA(Gln) amidotransferase subunit A (EC
FT                   6.3.5.-) (Glu-ADT subunit A). Furnishes a means for
FT                   formation of correctly charged Gln-tRNA(Gln) through the
FT                   transamidation of misacylated Glu- tRNA(Gln) in organisms
FT                   which lack glutaminyl-tRNA synthetase. The reaction takes
FT                   place in the presence of glutamine and ATP through an
FT                   activated gamma-phospho-Glu-tRNA(Gln) (By similarity).
FT                   InterPro: Glutamyl-tRNA(Gln) amidotransferase A subunit
FT                   gatA: glutamyl-tRNA(Gln) amidotransferase"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0172"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92790"
FT                   /db_xref="GOA:A1K1T5"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1K1T5"
FT                   /protein_id="CAL92790.1"
FT                   /translation="MINASVSELRRALDTRQVSSVELATLFLDRIAERNPALNAFITID
FT                   REGALAAARAADARIAAGTAGPLTGIPLAHKDLFCTEGVLTTCGSKMLADFVSPYDAHV
FT                   VSRLKDAGAVSLGKTNMDEFAMGSSNESSHYGAVRNPWDTTRIPGGSSGGSAAAVAARL
FT                   VPLATGSDTGGSVRQPASHTGVTGIKPTYGVVSRYGMIAYASSLDQGGAFGASAEDCAL
FT                   LLTAMAGFDPRDSTCLDRPAEDYAAALAPTAGGKPLAGLRIGLPREFFAEGMADDVRAA
FT                   VDAALDQYRALGAVTVEVSLPNAKLAVPAYYVIAPAEASSNLSRFDGVRYGHRAAEYGD
FT                   LNDMYCKSRAEGFGAEVKRRILVGTYVLSHGYYDAYYLQAQKLRRLIAQDFQAAFAQCD
FT                   VIAGPTSPTTAWAIGEKADDPVQMYLSDIYTIAVNLAGLPGLSHPCGFGAGRLPVGLQL
FT                   IGNYFGESRLLATAHQYQQASDWHLQRPE"
FT   CDS_pept        complement(189852..190139)
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="azo0173"
FT                   /product="glutamyl-tRNA(GLN) amidotransferase subunit C"
FT                   /function="Asp-tRNAAsn/Glu-tRNAGln amidotransferase C
FT                   subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="Glutamyl-tRNA(Gln) amidotransferase subunit C (EC
FT                   6.3.5.-) (Glu-ADT subunit C). Allows the formation of
FT                   correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through
FT                   the transamidation of misacylated Asp- tRNA(Asn) or
FT                   Glu-tRNA(Gln) in organisms which lack either or both of
FT                   asparaginyl-tRNA or glutaminyl-tRNA synthetases. The
FT                   reaction takes place in the presence of glutamine and ATP
FT                   through an activated phospho-Asp-tRNA(Asn) or
FT                   phospho-Glu-tRNA(Gln)."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0173"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92791"
FT                   /db_xref="GOA:A1K1T6"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1K1T6"
FT                   /protein_id="CAL92791.1"
FT                   /translation="MSLSNEQVGRIARLARLAISEGEIDAVRAKLDGIFGLIEQMQAVD
FT                   TAGVEPMSHPQELATRLRDDVVTETDRRSAFQSVAPQTEAGLYLVPKVIE"
FT   CDS_pept        190256..191299
FT                   /transl_table=11
FT                   /gene="mreB"
FT                   /locus_tag="azo0174"
FT                   /product="rod shape-determining protein MreB"
FT                   /function="Actin-like ATPase involved in cell
FT                   morphogenesis"
FT                   /note="Rod shape-determining protein mreB. INVOLVED IN
FT                   FORMATION OF THE ROD SHAPE OF THE CELL. MAY ACT AS A
FT                   NEGATIVE REGULATOR OF FTSI. InterPro: Cell shape
FT                   determining protein MreB/Mrl mreB: cell shape determining
FT                   protein"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0174"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92792"
FT                   /db_xref="GOA:A1K1T7"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1T7"
FT                   /protein_id="CAL92792.1"
FT                   /translation="MFGFLRSYFSNDLAIDLGTANTLIYVRGKGIVLDEPSVVAIRTEG
FT                   GPNAKRTIQAVGHAAKQMLGKTPGNITAIRPMKDGVIADFVVTEQMIKQFIKKVHDSRL
FT                   LSPSPRIIICVPCGSTQVERRAIRDAALAAGASQVYLIEEPMAAAIGAGLPVSDATGSM
FT                   VVDIGGGTTEVGVISLGGMVYAGSVRVGGDKFDDAIVNYIRRNYGMLIGDTTAENIKKN
FT                   IGSAFPGSEVREMEVKGRNLAEGIPRSFTISSNEILEALTEPLNQIVSAVKIALEQTPP
FT                   ELGADIADRGMVLTGGGALLRDLDRLLMEETGLPVIVAEEPLTCVARGCGLALDKMDKL
FT                   GSIFTSD"
FT   CDS_pept        191345..192262
FT                   /transl_table=11
FT                   /gene="mreC"
FT                   /locus_tag="azo0175"
FT                   /product="rod shape-determining protein"
FT                   /function="Cell shape-determining protein"
FT                   /note="Rod shape-determining protein mreC. Involved in
FT                   formation of the rod shape of the cell. May also contribute
FT                   to regulation of formation of penicillin-binding proteins."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0175"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92793"
FT                   /db_xref="GOA:A1K1T8"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1T8"
FT                   /protein_id="CAL92793.1"
FT                   /translation="MSLAGHQPPPIFRRGLAPLARLFLLVSVCLAMLVADLRFRYLEVF
FT                   RQGLSVVTYPLQMAAATPADFVRNASRYFATLIEVQLENADLRRQQLGAAERLLRYEQL
FT                   EQEYKQLRGLMQMAERVQVKSVAAEILYNAPDPFARKVILDRGAQQGVEAGLAVVDSDG
FT                   VIGQVTRVYPIQSEVTLLTDRNQAIPVRVLRNGLRGVLFGTGQGRIELRFVIAGADIQV
FT                   GDMLVTSGLDGVFLPGLPVAEVLSVDREAEAFARIVCKPVAGVERSSQVLVLGRAEPPP
FT                   PIPVDPAPAPPAEGRRARRGDGGH"
FT   CDS_pept        192266..192787
FT                   /transl_table=11
FT                   /gene="mreD"
FT                   /locus_tag="azo0176"
FT                   /product="rod shape-determining protein"
FT                   /function="Cell shape-determining protein"
FT                   /note="Rod shape-determining protein mreD. Involved in
FT                   formation of the rod shape of the cell. May also contribute
FT                   to regulation of formation of penicillin-binding proteins."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0176"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92794"
FT                   /db_xref="GOA:A1K1T9"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1T9"
FT                   /protein_id="CAL92794.1"
FT                   /translation="MQPTNRSSRILLPVRLGFIYFSLMVALALAYVPTGRFPGVPDWVA
FT                   LVLAFWCIREPLRIGMGAGFLFGVLVDIGQGAAMGQHALAYVVLAYLATGLARRVMWFP
FT                   PLLQALHVLPMLLASQMLMVAVRLIAGAEFPGWAYFLSSFTAVALWVPLNYLLLLPQYQ
FT                   PVDRDDNRPI"
FT   CDS_pept        192797..194686
FT                   /transl_table=11
FT                   /gene="pbpA"
FT                   /locus_tag="azo0177"
FT                   /product="penicillin-binding protein"
FT                   /function="Cell division protein FtsI/penicillin-binding
FT                   protein 2"
FT                   /note="Penicillin-binding protein 2 (PBP-2). CELL WALL
FT                   FORMATION; PBP2 IS RESPONSIBLE FOR THE DETERMINATION OF THE
FT                   ROD SHAPE OF THE CELL. ITS SYNTHESIZE CROSS- LINKED
FT                   PEPTIDOGLYCAN FROM THE LIPID INTERMEDIATES. InterPro:
FT                   Penicillin binding protein transpeptidase domain"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0177"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92795"
FT                   /db_xref="GOA:A1K1U0"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1U0"
FT                   /protein_id="CAL92795.1"
FT                   /translation="MTEFRTPAQEKSRFRNRVVVAALFILACFALLAMRFYYLQVTRHA
FT                   YFHTRAEDNRIALLPVVPNRGTITDRNGVVLARNYAAYTLEITPSKAGDLEATIDGLAE
FT                   VVTIEPRDRRRFRKVLEESRNFESVPIRTRLTDEEVARFTAQRYRFPGVEVQARLFRDY
FT                   PEGEVASHVIGYIGRINDRDVERIEERGQTANYRGSEYIGKAGLEQSYEAELHGQTGFE
FT                   QVEVNAGGRAVRRLSRTAAMVGNNLELTLDIELQKIAENAFGNRRGALVAIEPGTGGVL
FT                   ALVSKPTFDPNLFVEGISAQDWKQLNDSPDHPLLNRAIFSAYPPGSTFKPFMALGALTT
FT                   GKRTPGYVMADPGYFVSGGHRFMDDKVGGHGMVDLHKSIVVSCNTFYYQLANDMGIDGI
FT                   ADFMRPLGFGSRTGIDVPGEAEGVLPSPAWKKKRFRRPEQQRWFGGETISVGIGQGYNA
FT                   YTPLQLANALATVVSDGKVFRPHIVRHVVDARDNRRVIEPEPLRQLNFKPEHLALVRRA
FT                   MVDVNKSGTGARAFAGAPYEVGGKTGTAQVFSLKGAKYVEGRVSERLRDHSWFIAYAPA
FT                   DNPKIALAVLVENGGFGAQSAAPIARQVIDYHLLGKRPNQPAGEDADAPESTE"
FT   CDS_pept        194683..195819
FT                   /transl_table=11
FT                   /gene="rodA"
FT                   /locus_tag="azo0178"
FT                   /product="rod shape-determining protein"
FT                   /function="Bacterial cell division membrane protein"
FT                   /note="Rod shape-determining protein rodA. THIS IS ONE OF
FT                   THE PROTEINS RESPONSIBLE FOR THE ROD SHAPE OF THE CELL. IT
FT                   IS REQUIRED FOR THE EXPRESSION OF THE ENZYMATIC ACTIVITY OF
FT                   PBP2 WHICH IS THOUGHT TO SYNTHESIZE PEPTIDOGLYCAN IN THE
FT                   STEP OF INITIATION OF CELL ELONGATION."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0178"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92796"
FT                   /db_xref="GOA:A1K1U1"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1U1"
FT                   /protein_id="CAL92796.1"
FT                   /translation="MSDHRFNPLLLLRAVLRPIDPVLMLVLMMLLGYAFVLMASASPDR
FT                   LDSQLVNTTVALLAMWVAAWLPSQRLLSFALPLYALGVVLLVAVELFGEVSKGAQRWLH
FT                   VGVTRIQPSELMKIAMPLMLAWYFQQREAKIGLREFIVAGLLLVVPVGLILIQPDLGTS
FT                   LLVTAAGFYVIFFAGLSWKLIVPVGLVGIIGIGSIVAFGDTLCQPDVDWFGLREYQKQR
FT                   VCTLLDPTRDPLGKGFHIIQSTIAIGSGGVVGKGWMDGTQTHLAFLPERHTDFIFAVLA
FT                   EEFGLVGTLVLLVTYLALLARSFQIATQAPTLATKLLGGAMAMIFFTYAFVNMGMVSGI
FT                   LPVVGVPLPFISYGGTALVTLCLGVGILMGIRRGRPAS"
FT   CDS_pept        195800..196840
FT                   /transl_table=11
FT                   /gene="rlpA"
FT                   /locus_tag="azo0179"
FT                   /product="lipoprotein"
FT                   /function="Members of this family are quite diverse, and if
FT                   catalytic this family may contain several different
FT                   functions"
FT                   /note="RlpA-like protein precursor."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0179"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92797"
FT                   /db_xref="GOA:A1K1U2"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1U2"
FT                   /protein_id="CAL92797.1"
FT                   /translation="MAVPRPDLPAVMMMKSVPAAFTLRARPLTLVVASCCAAWLAGCST
FT                   APVQESSAPGARPSPPPPVASPAPAPAKRGGAYYKDDGPGDNPPDNLDAVPDAQPRLEP
FT                   LHRFANRPYNVFGQDYVPATRLAPFRERGLASWYGRRFHGGNTSSGEPYDMYAMTAAHP
FT                   TLPIPSYARVTNVATGRSVVVRINDRGPFHKGRIMDLSYTAAYRLGYVNGGSAEVEVEQ
FT                   ILPDEVPMEAMSPPVPPLPGRRVPPALAAAAPDPAPATAAPASPSAGAVAFFLQLGAFA
FT                   SRDNAEGFRATVQRDLAAFAQRVDLLAEGGRFRLHAGPYASENEARVAAERIAATLKLK
FT                   PFVVAR"
FT   CDS_pept        196966..198096
FT                   /transl_table=11
FT                   /gene="dacC"
FT                   /locus_tag="azo0180"
FT                   /product="probable D-alanyl-D-alanine carboxypeptidase"
FT                   /function="D-alanyl-D-alanine carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="Probable D-alanyl-D-alanine carboxypeptidase.
FT                   Homology to dacD of E. coli of 41% (sprot|DACD_ECOLI)
FT                   Removes C-terminal D-alanyl residues from sugar-peptide
FT                   cell wall precursors. Pfam: D-alanyl-D-alanine
FT                   carboxypeptidase signal peptide no TMHs"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0180"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92798"
FT                   /db_xref="GOA:A1K1U3"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1U3"
FT                   /protein_id="CAL92798.1"
FT                   /translation="MRFVFALLLSLFSLLAAAQSIPAPALAAKAWVLVDHNTGQVLAAN
FT                   DPDARIEPASLTKLMTAYLTFSALKAGTIALDQPVPVSERAWRQEGSRMFIEPQKPVTV
FT                   QELIRGVIVQSGNDACVALAELIAGTEEAFAAMMNREAQRLGMSNTHFTNSTGLPDPQL
FT                   YTTAKDLALLASAIIRDFPDYYASLYSLKEYRYNNITQPNRNRLLWMDSTVDGMKTGHT
FT                   SSAGYCLISSALRGPRRLVSVVLGAESDTVRAQESLKLLNFGFQFFDTVKLYSADQALS
FT                   QFRVWKGQANEVAAGFTSDFVISLPKGQADKITATLESRQPVLAPLQKGQEIGTLKLSL
FT                   DGKPLGEYPVVALQDVPVAGFFGRLWDALVLWIKSL"
FT   CDS_pept        198136..198993
FT                   /transl_table=11
FT                   /gene="daaA"
FT                   /locus_tag="azo0181"
FT                   /product="D-alanine transaminase"
FT                   /function="Branched-chain amino acid
FT                   aminotransferase/4-amino-4-deoxychorismate lyase"
FT                   /EC_number="2.6.1.21"
FT                   /note="D-alanine aminotransferase (EC 2.6.1.21)
FT                   (D-aspartate aminotransferase) (D-amino acid
FT                   aminotransferase) (D-amino acid transaminase) (DAAT). Acts
FT                   on the D-isomers of alanine Leucine aspartate glutamate
FT                   aminobutyrate norvaline and asparagine (By similarity).
FT                   InterPro: Aminotransferases class-IV"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0181"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92799"
FT                   /db_xref="GOA:A1K1U4"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1U4"
FT                   /protein_id="CAL92799.1"
FT                   /translation="MNLCYLDGRYLPLDEARVSPMDRGFLFGDGAYEVVPVYSRRPFRL
FT                   AEHLGRLARTLAAMRLPNPHSDEEWADRVTTLVAGNPWEDQSIYLQVTRGADAVRNHAF
FT                   PKDVRPTVFMLSEPLLTPAPELLASGVAAVSAADFRWLRCDLKSVSLLANCLLRQYGFD
FT                   QGCAETVLFRDGFLTEGSASNIFVVRDGRLLAPPKSHLMLAGITYDVVLELAAAHGLPL
FT                   EVREILDAEVRSADELWMTSSTKEVLAITRLDGRPVGSGAPGPLGRQMYAWYQEFKNTV
FT                   MRSG"
FT   CDS_pept        198986..199267
FT                   /transl_table=11
FT                   /locus_tag="azo0182"
FT                   /product="conserved hypothetical protein"
FT                   /function="uncharacterized conserved protein"
FT                   /note="Conserved hypothetical protein. Homology to RSC0326
FT                   of Ralstonia solanacearum of 53% (tremble:Q8Y2K9) Has
FT                   PF04359;Protein of unknown function (DUF493);This family
FT                   includes several proteins of uncharacterised function.
FT                   InterPro;IPR007454 No Signal Peptdie or TMH present."
FT                   /db_xref="EnsemblGenomes-Gn:azo0182"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92800"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1U5"
FT                   /protein_id="CAL92800.1"
FT                   /translation="MADQTPQPRQTLLEFPCDFPIKIMGARVDGFAQAVIEVVLRHAPD
FT                   FDPAGAEMRPSSKGNYLAVTCTFRAISQQQVDALYMELTSHPMVKVVL"
FT   CDS_pept        199264..199947
FT                   /transl_table=11
FT                   /gene="lipB"
FT                   /locus_tag="azo0183"
FT                   /product="LipB protein"
FT                   /function="Lipoate-protein ligase B"
FT                   /note="Lipoate-protein ligase B (EC 6.-.-.-) (Lipoate
FT                   biosynthesis protein B). Involved in the attachment of
FT                   lipoyl groups to proteins by creating an amide linkage that
FT                   joins the free carboxyl group of lipoic acid to the
FT                   epsilon-amino group of a specific lysine residue in
FT                   lipoylated proteins (By similarity). InterPro:
FT                   Lipoate-protein ligase B lipB: lipoate-protein ligase B"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0183"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92801"
FT                   /db_xref="GOA:A1K1U6"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1K1U6"
FT                   /protein_id="CAL92801.1"
FT                   /translation="MTAAAVLAGHEGPAAAVSVPLLVKRLGRVDYAPAWEAMQHFTASR
FT                   GEDTADEIWLLEHPPVYTLGQAGRPEHLLRNDAGIPLVKIDRGGQITYHGPGQLVAYLL
FT                   LDLRRRHLKVRELVALMEQAVIDCLAEYGLHAERKDGAPGVYIDGAKIAALGLRVRNGC
FT                   SYHGLALNVDADLAPFGWINPCGYEGLQTIRLKDFGVGDDVAAVGERLLQHLLRLLPPG
FT                   VVPSR"
FT   CDS_pept        199989..200936
FT                   /transl_table=11
FT                   /gene="lipA"
FT                   /locus_tag="azo0184"
FT                   /product="lipoic acid synthetase"
FT                   /function="Lipoate synthase"
FT                   /note="Lipoic acid synthetase (Lip-syn) . Synthesis of
FT                   alpha-(+)-lipoic acid. It may be involved in the sulfur
FT                   insertion chemistry in lipoate biosynthesis (By
FT                   similarity). InterPro: Lipoate synthase lipA: lipoic acid
FT                   synthetase"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0184"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92802"
FT                   /db_xref="GOA:A1K1U7"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1K1U7"
FT                   /protein_id="CAL92802.1"
FT                   /translation="MDNPARKQRGAEKTARIPIKIVPAERLKKPDWIRIRLGAGAEAER
FT                   FNEIKQTLREHKLHTVCEEASCPNIHECFGKGTATFMIMGDICTRRCPFCDVGHGRPEP
FT                   LNPNEPTDLARTIAAMRLNYVVITSVDRDDLRDGGAQHFVDCIRETRAASPSTTIEVLV
FT                   PDFRGRMEIALEIFNQAPPDVMNHNMETVPRLYKQARPGADYAYSLRLLKEFKAGHPDV
FT                   LTKSGLMVGLGETDDEILDVMRDLRAHDVDMLTIGQYLQPSGGHLPVLRYVHPDTFKMF
FT                   ETEALRMGFRNAACGPMVRSSYWADQQAHGAGVV"
FT   CDS_pept        201005..201682
FT                   /transl_table=11
FT                   /locus_tag="azo0185"
FT                   /product="conserved hypothetical secreted protein"
FT                   /note="Conserved hypothetical secreted protein. Homology to
FT                   PP1518 of P. putida of 54% (trembl|Q88MQ2(SRS) No domains
FT                   predicted Signal P reporting signal peptide present. No TMH
FT                   reported present."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0185"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92803"
FT                   /db_xref="InterPro:IPR025245"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1U8"
FT                   /protein_id="CAL92803.1"
FT                   /translation="MKFLQKTLILFALCSSAWAASLVDLSDAEVGGGLKEALTQGAGHA
FT                   VEVLGRKDGFLSNPKVKIPLPGVLKQAEPLLRMSGRGEDLDQLVTSMNRAAEAAVPGAK
FT                   NLLVGAVKQMSVADAKKILTGGDDSVTRYFRDKTEAQLTRMFLPTVKQNTDKLALAGQY
FT                   NALVGQAAGLGLVKSEDAQIENYVTRKALDGLYLMIAEEERAIRKDPVGAVGGLAKKVF
FT                   GAL"
FT   CDS_pept        201756..203750
FT                   /transl_table=11
FT                   /gene="rep"
FT                   /locus_tag="azo0186"
FT                   /product="ATP-dependent DNA helicase"
FT                   /function="Superfamily I DNA and RNA helicases"
FT                   /EC_number="3.6.1.-"
FT                   /note="ATP-dependent DNA helicase rep (EC 3.6.1.-). REP
FT                   HELICASE IS A SINGLE-STRANDED DNA-DEPENDENT ATPASE INVOLVED
FT                   IN DNA REPLICATION; IT CAN INITIATE UNWINDING AT A NICK IN
FT                   THE DNA. IT BINDS TO THE SINGLE-STRANDED DNA AND ACTS IN A
FT                   PROGRESSIVE FASHION ALONG THE DNA IN THE 3 TO 5 DIRECTION
FT                   (BY SIMILARITY). InterPro: UvrD/REP helicase."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0186"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92804"
FT                   /db_xref="GOA:A1K1U9"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1U9"
FT                   /protein_id="CAL92804.1"
FT                   /translation="MSALLNPPQREAIHYLNGPCLVLAGAGSGKTRVITHKIAHLINEC
FT                   GLSPTNVGAITFTNKAAKEMQERVAHLMGGRAPGGLTVCTFHALGVRIIRQEALHCGLK
FT                   PQFSILDASDAVQIVADVAGDQDKGIAKQMQWQISSWKNAMISPAEAAQLADNELSAAA
FT                   AKAFADYERTLRAYQAVDFDDLISLPVRLFEENDEVRERWQNRLRYLLVDEYQDTNRAQ
FT                   YRLLRQLAGVRGAFTAVGDDDQAIYAWRGADVENLKLLQRDYPKLRVIKLEQNYRSSRR
FT                   ILEAANVLIANNEKLFDKRLWSEHGPGEQIAVTSCRDADHEAEWVAMKISAHKFENRTR
FT                   FKDYAILYRGNHQARIIEQQLRNQRIPYVMSGGQSFFEKPEIKDLIAYLRLLMNEDDDL
FT                   AFIRAITMPRRGIGPSTIEALGHYAGGRHISLFAASFEEGVALHLGARQLEAVQQFTAF
FT                   INRIQHRARREPAAQVLEDLLAAIRYEAWLFEHFDSREAESKWSNVRDFVGWLGRKGEE
FT                   DGKNLIELTQTIALISMLDKEDADFDGVQLATLHASKGLEFPHVFLVGVEEGLLPHQSS
FT                   IDEDKVEEERRLMYVGITRAQRSLNITWCERRKAGKEFRPCEISRFIAEMGGDLNIGDR
FT                   KRNAPVSREEGRARLANLKAMFERRDEGS"
FT   CDS_pept        complement(203837..204298)
FT                   /transl_table=11
FT                   /locus_tag="azo0187"
FT                   /product="conserved hypothetical cytochrome c5"
FT                   /function="Cytochrome c5"
FT                   /note="Conserved hypothetical cytochrome c5. Homology to
FT                   vc0168 of V. cloreae of 38% (tremble: Q9KVH8). This basic
FT                   c-type monoheme cytochrome has an unusally low redox
FT                   potential compaired with mitochaondrial cytochrome C. It is
FT                   reactive with cytochrome c oxidase but not with reductase.
FT                   Pfam: Cytrochrome C probable signal peptide no TMHs"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0187"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92805"
FT                   /db_xref="GOA:A1K1V0"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1V0"
FT                   /protein_id="CAL92805.1"
FT                   /translation="MSEHRASRRAQRPLRPALSLAMAAAIVLAGCGKDNGKVDPEVTAS
FT                   LIQPVAKVELKVVTVAPGSRTGEQIYKSICSSCHDAGMLGAPKTGDSGAWGPRLAQGFD
FT                   GLTKSAIAGKNAMPPRGGGSDLTDTEVKRAVAFLANKAGAGYTEPPVAQ"
FT   tRNA            204448..204524
FT                   /gene="tRNA-Arg"
FT                   /locus_tag="azo_tRNA_0001"
FT                   /product="transfer RNA-Arg"
FT                   /anticodon="(pos:204482..204484,aa:Arg)"
FT                   /inference="nucleotide motif:Simple tRNAscan Autoannotator"
FT   rRNA            204806..206339
FT                   /locus_tag="azo_rrn1"
FT   tRNA            206413..206489
FT                   /gene="tRNA-Ile"
FT                   /locus_tag="azo_tRNA_0002"
FT                   /product="transfer RNA-Ile"
FT                   /anticodon="(pos:206447..206449,aa:Ile)"
FT                   /inference="nucleotide motif:Simple tRNAscan Autoannotator"
FT   tRNA            206517..206592
FT                   /gene="tRNA-Ala"
FT                   /locus_tag="azo_tRNA_0003"
FT                   /product="transfer RNA-Ala"
FT                   /anticodon="(pos:206550..206552,aa:Ala)"
FT                   /inference="nucleotide motif:Simple tRNAscan Autoannotator"
FT   rRNA            206857..209743
FT                   /locus_tag="azo_rrn2"
FT   CDS_pept        complement(210014..210739)
FT                   /transl_table=11
FT                   /gene="yueD"
FT                   /locus_tag="azo0189"
FT                   /product="putative benzil reductase"
FT                   /note="Putative benzil reductase. Homology to yueD of B.
FT                   cereus of 32% (trembl|Q8RJ14). Belongs to the short-chain
FT                   dehydrogenases/reductases (SDR) family. Transform benzil to
FT                   (S)-benzion. Interpro: short-chain dehydrogenase/reductase
FT                   SDR (IPR002198) Pfam: short chain dehydrogenase (PF00106)
FT                   no signal peptide no TMHs"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0189"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92806"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1V1"
FT                   /protein_id="CAL92806.1"
FT                   /translation="MKAIVTGHSRGLGEALAIGLLERGLEVLGVSRHSHAEMAARFPRF
FT                   SESRVDLADVAAVCRFIESPVFQAFGNAREPVILINNAAMLQPVGRSGSLAAAEIQQAV
FT                   NVNVLGPLLLTNAVVQCADPDLSRRILHISSGAARTAYSGWSIYGATKAALDHHARCVS
FT                   EEGRAHVRICSVAPGVLDTRMQADVRQLETGQFPARERFISLKDSGQLVPPAEAAAKLL
FT                   AFLFAPAFGDTPTADVRTF"
FT   CDS_pept        210838..211857
FT                   /transl_table=11
FT                   /locus_tag="azo0190"
FT                   /product="conserved hypothetical protein"
FT                   /function="Nucleoid-associated protein"
FT                   /note="Conserved hypothetical protein. Homology to an orf
FT                   of R. oxalatica of 31% (trembl|Q84ES1). Pfam: 37-kD
FT                   nucleoid-associaed bacterial protein The Escherichia coli
FT                   nucleoid contains DNA in a condensed but functional form.
FT                   Analysis of proteins released from isolated spermidine
FT                   nucleoids after treatment with DNase I reveals significant
FT                   amounts of two proteins not previously detected in
FT                   wild-type Escherichia coli. Partial amino-terminal
FT                   sequencing has identified them as the products of rdgC and
FT                   yejK. no signal peptide no TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:azo0190"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92807"
FT                   /db_xref="GOA:A1K1V2"
FT                   /db_xref="InterPro:IPR007358"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1V2"
FT                   /protein_id="CAL92807.1"
FT                   /translation="MSTDQIITQLLIHRLVKAGDAAARIVQRDRLNSPDAAAIGLVTQL
FT                   ISTFTQRSGKCHGTFEDDEEEFPVARLLREFSGDDERGFIDLGAHLSDHLRNCADLVGL
FT                   DNGGAFLLARVREQAVDWLWIALVPETVTTAVDKDLNLHEHTHLDVHATQAVARIDLTG
FT                   WRRGDERCVAFLSGRGPAAQCFRRFLGCKDVVVALQETRKLVQALTDFADSERLDPPVR
FT                   DEMMERAHRYLDDLGEAGAPVELDALASELWPSAPARLGTTLQTPARALAPAFVPNRRA
FT                   LKPLVRLSASADQWRVEFERAGLRSGAVSYDVVSDTLVLSNLPPYLKQMLIDDGDASS"
FT   CDS_pept        211933..212409
FT                   /transl_table=11
FT                   /locus_tag="azo0191"
FT                   /product="conserved hypothetical protein"
FT                   /function="Acyl dehydratase"
FT                   /note="Entry name TREMBL:Q988L8 Prim. accession # Q988L8
FT                   InterPro IPR002539; MaoC_dehydratas. Identities = 63/131
FT                   (48%) Pfam PF01575; MaoC_dehydratas; 1. Number of predicted
FT                   TMHs: 0 Probable MaoC protein (Phenylacetic acid
FT                   degradation protein paaZ)."
FT                   /db_xref="EnsemblGenomes-Gn:azo0191"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92808"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1V3"
FT                   /protein_id="CAL92808.1"
FT                   /translation="MTETPPQRGAPLYLDDLQVGLRFGSGTHPIDAQQITAFADSFDPQ
FT                   PFHLDHEAAQDSLFGGLAASGWHTAAITMRLLVEGGLPIAGGIIGAGAEVTWPRPTRPG
FT                   DVLQVDSEVLEITPSRSKPDRGIVTLRSETRNQRGEILQVLTSRLVVPRRPLNG"
FT   CDS_pept        212402..213313
FT                   /transl_table=11
FT                   /gene="apbA1"
FT                   /locus_tag="azo0192"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /function="Ketopantoate reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="Catalyzes the NADPH-dependent reduction of
FT                   ketopantoate into pantoic acid (By similarity). apbA_panE:
FT                   2-dehydropantoate 2-reductase"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0192"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92809"
FT                   /db_xref="GOA:A1K1V4"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1V4"
FT                   /protein_id="CAL92809.1"
FT                   /translation="MDSSRQREAFSTDVLQAAPYPVAIIGAGALGLSLASRLIRSGPVA
FT                   LVASNADAAQRLRAGVRVGAVVERFDGFAAPRLPRADWVVVVVKAGGTRDALRSALAMR
FT                   PRGVLSLQNGLLDLEPAGTGTCVAQGVTTMGAFRTDEGVMPVSDGETLMPQGFEPLAAL
FT                   FQQAGLPARIEVAMQAARLAKLLVNVVLNPLTAVFRVRTGELLAAPYMNHVEALVAEAW
FT                   PVLRAAGLMLEFDEARAKVWSVVRSTADNRTSMLQDVLAGRRTEREAITGAFLRLADGN
FT                   GAAVPTHRALHTLLGQIDADRC"
FT   CDS_pept        complement(213319..213780)
FT                   /transl_table=11
FT                   /gene="trxC1"
FT                   /locus_tag="azo0193"
FT                   /product="probable protein-disulfide reductase"
FT                   /function="Thiol-disulfide isomerase and thioredoxins"
FT                   /EC_number="1.8.1.8"
FT                   /note="Probable protein-disulfide reductase. Homology with
FT                   trxC of E. coli of 45% (AAB88587). Participates in various
FT                   redox reactions through the reversible oxidation of the
FT                   active center dithiol to a disulfide. InterPro: Thioredoxin
FT                   Tigrfam: redox_disulf_1: redox-active disulfide Pfam:
FT                   Thioredoxin no TMHs no signal peptide"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0193"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92810"
FT                   /db_xref="GOA:A1K1V5"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1V5"
FT                   /protein_id="CAL92810.1"
FT                   /translation="MHAEEAHMNPSIHLVCPHCDAVNRLPAERMAEHPACGQCHRPLFI
FT                   GEPLALDGARFERHLTRNDLPVLIDFWAPWCGPCRMMAPAFAAAAAQLEPQLRLAKVNT
FT                   EAEPALAQRFGIRSVPTIALFQGGREVTRQAGAMNTEQLVRWVRGQLGR"
FT   CDS_pept        213935..214333
FT                   /transl_table=11
FT                   /gene="hvrA1"
FT                   /locus_tag="azo0194"
FT                   /product="putative trans-acting regulatory protein HvrA"
FT                   /note="Putative trans-acting regulatory protein. Homology
FT                   to hvrA of R. capsulatus of 27% (sprot|HVRA_RHOCA). The
FT                   histone-like nucleoid-structuring (H-NS) protein belongs to
FT                   a family of bacterial proteins that play a role in the
FT                   formation of nucleoid structure and affect gene expression
FT                   under certain conditions (e.g. light). Interpro: Histone
FT                   -like nucleotide-structuring protein H-Ns (IPR001801) Pfam:
FT                   H-NS histone family no signal peptide no TMHs"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0194"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92811"
FT                   /db_xref="GOA:A1K1V6"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1V6"
FT                   /protein_id="CAL92811.1"
FT                   /translation="MEIDLKSYTLPQLRALREQTARAIDRLQRSQRETLLRRLSALARA
FT                   EGLTLAELAEDAAAMKGAERPRKHPRTTPRQPLPVKYRHPSNRALAWSGRGRQPHWVAA
FT                   WLANGGSMDALATAAEKLAPRIPRGISG"
FT   CDS_pept        214378..214626
FT                   /transl_table=11
FT                   /locus_tag="azo0195"
FT                   /product="conserved hypothetical secreted protein"
FT                   /note="Conserved hypothetical secreted protein. Homology to
FT                   CV3728 of Chromobacterium violaceum of 57% (tremble:Q7NRQ2)
FT                   No domains predicted. No TMHs signal peptide present"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0195"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92812"
FT                   /db_xref="InterPro:IPR011690"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1V7"
FT                   /protein_id="CAL92812.1"
FT                   /translation="MNKIIVAALISTFALSAHAEGPTCNASAAEKKLVGAAKTSFLKKC
FT                   EKDAAASCEAAAAEKKLAGAAKGSFTKKCVKDAVGAP"
FT   CDS_pept        complement(214688..215722)
FT                   /transl_table=11
FT                   /locus_tag="azo0196"
FT                   /product="consrved hypothetical transcription factor"
FT                   /function="predicted transcriptional regulator"
FT                   /note="Conserved hypothetical transcription factor,"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0196"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92813"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1V8"
FT                   /protein_id="CAL92813.1"
FT                   /translation="MSQTERLYQIVRMLEDARQPVPLARFLETLEISRASFKRDLDYLR
FT                   DRLGAPIVWRRGSAGDPEGYVLEGERGEAGKRFGIHGMWFNPSEIHALLMMQQLATAME
FT                   PGLLAGQVDGLMTRIGLMLGSANDDPAEVGRRVRILHSANRRATPAAFDTVAQATMKRR
FT                   RLALRYYTRSRNAESDRVVSPQQLLHYRENWYLLGYCHQARALRLFALDAIRSASVRPG
FT                   SAREVGERRLKEATGAAFGIFAGAPRERAELRFSAEVAPWVASEIWHPAQTSAPQTDGS
FT                   LLLGVPYADSRELVMEILRYGADVEVLAPPALRAAVADRLRRAAAQYEGADATSGPDTT
FT                   QPRD"
FT   CDS_pept        215834..216118
FT                   /transl_table=11
FT                   /locus_tag="azo0197"
FT                   /product="hypothetical membrane protein"
FT                   /note="Hypothetical membrane protein. No homology to the
FT                   data bank. No domains predicted. Signal peptide. 1 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:azo0197"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92814"
FT                   /db_xref="GOA:A1K1V9"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1V9"
FT                   /protein_id="CAL92814.1"
FT                   /translation="MKSSRPVLPPPDDVLANRRRLVFSLALLSLPLAFQFAEAAIVPVP
FT                   EAMRIVLAFSVWATLVVLELSAGALVWALCRALRRLRQGGMPAWRAYPR"
FT   CDS_pept        complement(216106..217965)
FT                   /transl_table=11
FT                   /gene="pabB"
FT                   /locus_tag="azo0198"
FT                   /product="para-aminobenzoate synthase component I /
FT                   4-amino-4-deoxycho"
FT                   /function="Anthranilate/para-aminobenzoate synthases
FT                   component I"
FT                   /EC_number="4.1.3.-"
FT                   /note="Para-aminobenzoate synthase component I (EC 4.1.3.-)
FT                   (ADC synthase). CATALYZES THE BIOSYNTHESIS OF
FT                   4-AMINO-4-DEOXYCHORISMATE (ADC) FROM CHORISMATE AND
FT                   GLUTAMINE. InterPro: Anthranilate synthase component I and
FT                   chorismate binding enzyme pabB: para-aminobenzoate synthase
FT                   component I"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0198"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92815"
FT                   /db_xref="GOA:A1K1W0"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1W0"
FT                   /protein_id="CAL92815.1"
FT                   /translation="MESFALLDDSQAAVETPASRLYTGFCGEIRCTDPDRLEADWVRVE
FT                   TELAAGRHAVIVADYEWGVRLAGVTTAKPGGMLRVLLYATLQRLDGAGVAHWLAQQEGR
FT                   DEPDAAGVAEWQASLERPAFDAAIEAIHAAIRAGETYQINFSYRLGGRAYGSPLALYRR
FT                   LRAAQPVPFGALIRLPAPTGDGDGDGGYLLSCSPELFLRHRDGVLEARPMKGTAARRGD
FT                   PAADAQAAGDLAADPKNRAENLMIVDLLRNDLGRIAETGSVQVPALFAVEPYATVLQMT
FT                   STVSARLAARHAFPAVLRALFPCGSITGAPKHRSMRLIDTLEDRPRGTYTGAVGWMDAP
FT                   RAGHRCGDFCLSVAIRTLAVGAERDGRRTAELGVGAGIVIDSRAADEYAECQLKARFVT
FT                   ALDPGFQLIETMRAGPAGSGGAPGIPLLARHLARLAASAAALGFRYDDAQVRAALARHL
FT                   ATLADGMHRVRLLLHKDGRIDVSGGPLPALPPGPVRVLLADAPIDGRDYLLRHKTTRRA
FT                   SYDAAIRAAEAAGAFDTLFFNHAGALTEGGRSNVFVRMDGQWLTPPVEAGVLPGVMRAA
FT                   LLDDPAWQAHEAALTRADLARAEAVVLCNALRGVLHVRFDQRG"
FT   CDS_pept        218051..219196
FT                   /transl_table=11
FT                   /gene="sbcD"
FT                   /locus_tag="azo0199"
FT                   /product="exonuclease SbcD, putative"
FT                   /function="DNA repair exonuclease"
FT                   /EC_number="3.1.11.-"
FT                   /note="Exonuclease sbcD homolog. Probably involved in
FT                   genetic recombination. InterPro: DNA repair exonuclease.
FT                   sbcd: exonuclease SbcD."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0199"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92816"
FT                   /db_xref="GOA:A1K1W1"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1W1"
FT                   /protein_id="CAL92816.1"
FT                   /translation="MRFLHTADWHLGRVYHGVSLLEDQAHVLRDFVRLAGETRPDAILI
FT                   AGDVYDRSVPPADAVRLLDETLTELVVGLAIPVVLIAGNHDGPDRLAFGASLLGRAGLT
FT                   VRGPVDASVAPVRLRDAHGEVAIYPLPYAEPALVRSAFGEEALADHHAALGAQLRAIRA
FT                   AHAAGTRSVVVAHAFVLGGSESESERPLSVGGSGAVGAELFAGFDYVALGHLHRPQQAG
FT                   GEHIHYSGSLLKYSFAEAGHAKSVNLVEMDAAGRCTVERVALAPRRDLRIVEGTLADII
FT                   AGAAADPGRDDYLLARLSDSGALLDAMGKLRTAYPNALAIERPLHAGDGPGRAAADHRR
FT                   IRIEDLFASFYAETAGRPLEAEAIATVQRIVGAIEQEARHA"
FT   CDS_pept        219193..222264
FT                   /transl_table=11
FT                   /gene="sbcC"
FT                   /locus_tag="azo0200"
FT                   /product="exonuclease SbcC, putative"
FT                   /function="ATPase involved in DNA repair"
FT                   /EC_number="3.1.11.-"
FT                   /note="Nuclease sbcCD subunit C. SbcCD cleaves DNA hairpin
FT                   structures. These structures can inhibit DNA replication
FT                   and are intermediates in certain DNA recombination
FT                   reactions. The complex acts as a 3->5 double strand
FT                   exonuclease that can open hairpins. It also has a 5
FT                   single-strand endonuclease activity (By similarity). sbcc:
FT                   exonuclease SbcC."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0200"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92817"
FT                   /db_xref="GOA:A1K1W2"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1W2"
FT                   /protein_id="CAL92817.1"
FT                   /translation="MKPLKLSLQAFGPFAGREEIDFTLLPEGALFLISGPTGAGKTSIL
FT                   DGITYALYGDTSGGERSAREMRSHHADAALLTEVEFEFALGARRYRVRRVPEQERAAQR
FT                   ATKSGDGLVKVLARAELHRLDDDGVTWLPLAHKTTEVTSELTALLGCQAEQFRQVVLLP
FT                   QGQFRKLLTASSGEREKILETLFGTAAYKRLQDALKQEAQALQKAADETRLRRDTLLQQ
FT                   AAAESVEGLRGQAEALDAELTRLAGEESAARSADTAAQAALQQGRALAAQFAEQHAAGA
FT                   ALAAVEARAGEIAALRLREAAARRALQVVPADEACAGAGRQLALARQRAAEAGERVATA
FT                   AAAMQQARAGLEADKARAPQRDTAQRELLQLEALAAQVEQLAAAERELAARRSQAAAAE
FT                   QALAQARHAAAEAEQGRAALVVRVDQLAPRAAEAEALALRVAQAEQREADAQRLAARRK
FT                   ALAEATAAEAQARQAMDAARAALDAARDAQQALDGLWREAQAAILARHLHDGAPCPVCG
FT                   SAVHPGPATHAGELPSESALREAAARSREAEQGFEARRAAFDRAAQARTAVEAEVGALS
FT                   GALRTAGDDGVQADMLVETAADLRQRLAVARQAGAELTAARDRLQALEQAQRNALAAQE
FT                   QAATAAQSAASALHGAERVVEARREAVPAALRPAGALAAALKTARSALDTLLAASQQAQ
FT                   AAHAGAEAALAAAHAQRDTLAQAETEQAAALEQAQAVFARALAAAAFDDEAGYRAARLA
FT                   AADIDHLAASLRQHDEDAAAARERLARADQAVAGRTPPQLAELETSAQAARAAIDAVLA
FT                   RSADLRGALEKTRHTLALLDELAARNADIEARYRITGELAAVANGDNGRNLTFQRYVLA
FT                   ALLDDVLRAASLRLKAMSRGRYLLQRREEVADARRAAGLDLEVLDDYTGRARPVATLSG
FT                   GEGFMASLSLALGLSDVVQAYAGGVQLDTLFIDEGFGSLDPESLDMAMRTLIDLQRQGR
FT                   MVGVISHVEEMKQQIDVAIEVVQGVRGSRVRVRG"
FT   CDS_pept        complement(222387..223202)
FT                   /transl_table=11
FT                   /locus_tag="azo0201"
FT                   /product="probable aryl-ester hydrolase"
FT                   /function="predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily)"
FT                   /EC_number="3.1.1.2"
FT                   /note="Arylesterase (EC 3.1.1.2) (Aryl-ester hydrolase)
FT                   pir:C75401:39% identity, 52% similarity:hydrolase-related
FT                   protein - Deinococcus radiodurans . IS A BIFUNCTIONAL
FT                   ENZYME CAPABLE OF BOTH ESTER HYDROLYSIS AND HALOGENATION.
FT                   ACTS ON MANY PHENOLIC ESTERS. Pfam: PF00561: alpha/beta
FT                   hydrolase fold (74-271) InterPro: IPR000073: Alpha/beta
FT                   hydrolase fold IPR000379: Esterase/lipase/thioesterase
FT                   Pfam:Zn binding dehydrogenase mobB: molybdopterin-guanine
FT                   dinucleotid"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0201"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92818"
FT                   /db_xref="GOA:A1K1W3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1W3"
FT                   /protein_id="CAL92818.1"
FT                   /translation="MSDLNAPSILTHDHSVAHPEGRIFARSWTPAGGAASSEPPIVLLH
FT                   DSLGCVELWRDFPAELSAATGRRVIAYDRLGFGKSDAREGRPAALDFIGEEARRYFPAV
FT                   REQLGLDRFIVFGHSVGGCMAIHCAAEFGADCVALITESAQTFPEDLTLTNIAAAKAQF
FT                   ADEAQLQRLQKYHGDKARWVLEAWTDNWLDPAFAAWTLAPVLPRVSCPVLAIHGQQDEY
FT                   GTTRHPQMIGELSSGPARVEILADTHHVAHREQPAVVLELVAGFVRALV"
FT   CDS_pept        223457..224176
FT                   /transl_table=11
FT                   /locus_tag="azo0202"
FT                   /product="conserved hypothetical protein"
FT                   /function="Ferredoxin"
FT                   /note="Conserved hypothetical protein. Homology only to
FT                   r01975 of S. meliloti of 31% (trembl|Q92P21). no signal
FT                   peptide no TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:azo0202"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92819"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1W4"
FT                   /protein_id="CAL92819.1"
FT                   /translation="MPPTSDPAAPDFAALDDAGLNLHAVFDFASLPADVRAQLQRDVCT
FT                   PHACRQLILIGNAGRALWAALRASGFSAADPIDAFSVRAVAQWFARQLPGHRYTLLYPG
FT                   EAPVGLQALGRLAGWHHATPFKVGILPGWGSWFGYRVALLADTALPPTPPLQVESPCLS
FT                   CAARPCIAACPAEAMAGGDFALDRCAAHRLQPDSDCAYRCAARDACPVGQDHRYEADHL
FT                   RHTYGASLGALERYLRG"
FT   CDS_pept        224493..225563
FT                   /transl_table=11
FT                   /locus_tag="azo0203"
FT                   /product="conserved hypothetical membrane protein"
FT                   /function="predicted membrane-bound metal-dependent
FT                   hydrolases"
FT                   /note="TREMBL:Q82XH5: 33% identity, 44% similarity
FT                   InterPro:IPR007404; DUF457. Pfam: PF04307; DUF457 fnt:
FT                   formate/nitrite transporter Non-secretory protein with
FT                   signal peptide probability of 0.391 TMHMM predicted 4
FT                   transmembrane helices"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0203"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92820"
FT                   /db_xref="GOA:A1K1W5"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1W5"
FT                   /protein_id="CAL92820.1"
FT                   /translation="MDTVTHALSGALLGRLFSSGRGGLRPAAAIAAGATAAAFPDIDYL
FT                   LGYVSELTYLRGHRGVTHSVLLLPLWGALLAGLFARLARLRDRRGPDWPAFYGLACAGI
FT                   AIHIAGDLITQFGTMILAPLSDRRFGIGTTFIIDLVFTGIILAGLAASAVFRRSRVPAA
FT                   LALVALAGWVGVGWVGRGEAIEAARAYAVTKRIPVVAIDAAPRPASPFNWTAIVFDGER
FT                   YHYAHLNTRRQHALTVREGDNFIRRFSAPYLPVAQAQWAVKPMFGNGGEGELARAVWNA
FT                   GDFAFYRWFAMFPVLDQVDAATPAGPCASFRDLRFETPGRDGTPFRYGLCGTGNGQGWR
FT                   LFERRDDGGLRWVAGG"
FT   CDS_pept        complement(225594..226691)
FT                   /transl_table=11
FT                   /gene="bmpA"
FT                   /locus_tag="azo0204"
FT                   /product="probable lipoprotein"
FT                   /function="uncharacterized ABC-type transport system
FT                   periplasmic component/surface lipoprotein"
FT                   /note="Description:abc transporter periplasmic binding
FT                   protein.This is a family of basic membrane lipoproteins
FT                   from Borrelia and various putative lipoproteins from other
FT                   bacteria. All of these proteins are outer membrane proteins
FT                   and are thus antigenic in nature when possessed by the
FT                   pathogenic members of the family Probable CD4+ T
FT                   cell-stimulating antigen precursor. TREMBL: Q8XXD8: 64%
FT                   identity, 79% similarity InterPro:IPR003760; Bmp. Pfam:
FT                   PF02608; Bmp Secretory protein with high signal peptide
FT                   probablity (Signal P predicted). No. of transmembrane
FT                   helices: 1 (TMHMM predicted) prok_nadp_idh: isocitrate
FT                   dehydrogenas"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0204"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92821"
FT                   /db_xref="GOA:A1K1W6"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1W6"
FT                   /protein_id="CAL92821.1"
FT                   /translation="MSTRRTALKWTAALAAAAALPAPLAAFAADPVKVGFVYVGPVGEA
FT                   GWTYAHDLGRRALEAAFPGQVKTTFIERVPEGADAERVIRSLAQDGHQIIFTTSFGYMD
FT                   ATLKVARQFPKVVFQHATGFKTAANMGTYDVRTYEGAYLAGVLAGKMSKSGNLGVVGSH
FT                   PIPEVIRNINAYTIGARSVNPTATTRVIWVNSWFDPGKERQAALTLIAQGADVLMQNTD
FT                   SPAVLQAAQEKGVYAFGWDSDMTAFGPKAQLAASEIDWGVWYKKVVGEVMAGTFDAKRQ
FT                   VWYGLKEGAIDLGHLAASLPADAKKLVAERRQGILDGKRPVFAGPLRNQAGKEVVAAGQ
FT                   ELADKDKLAMNYYVEGVQGAVPGGK"
FT   CDS_pept        complement(226835..228079)
FT                   /transl_table=11
FT                   /gene="hipO1"
FT                   /locus_tag="azo0205"
FT                   /product="probable hippurate hydrolase"
FT                   /function="Metal-dependent
FT                   amidase/aminoacylase/carboxypeptidase"
FT                   /EC_number="3.5.1.32"
FT                   /note="Hippurate hydrolase (EC 3.5.1.32) (Benzoylglycine
FT                   amidohydrolase) (Hippuricase). TREMBL:Q7VUP2: 43% identity,
FT                   57% similarity InterPro; IPR002933; Peptidase_M20.
FT                   InterPro; IPR010168; Pept_M20D_amidh. Pfam; PF01546;
FT                   Peptidase_M20; 1. TIGRFAMs; TIGR01891; amidohydrolases
FT                   TIGR00003: copper-ion-binding protein No signal peptide
FT                   (Signal P predicted) No transmembrane helices present"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0205"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92822"
FT                   /db_xref="GOA:A1K1W7"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1W7"
FT                   /protein_id="CAL92822.1"
FT                   /translation="MSAAARPSAGGASSPGEDVAQRQEGSSENIADDALAGLLPALVRL
FT                   RHDLHAHPELGFAEHRTAAVVAAELRAIGLAVHEGIGGTGVVGVLRRGSSGASVGLRAD
FT                   MDALPMDECSGVAYASTHAGAHHGCGHDGHTSMLLGAARLLAARDFDGTVNFIFQPAEE
FT                   GLGGARAMVEDGLFERFPCDAVYALHNWPALPLGTAQTRPGPIMAAADRFDIVIRGRGG
FT                   HAAQPHTTPDAILAAGHLVSQLHAIVSRRIDPVESAVLSITRIESGHTHNVLPAEVKLT
FT                   GTVRSFDPAAQDTIEAALHQIADGVALASGTTIAIDYLRYYPATINHAAEAQVALEAAA
FT                   NAGLQVKTAPAPAFTSEDFAFMLQARPGAYLWLGQGRGGDDKPLHHPAYDFNDAALPHG
FT                   VRWLVAVAERQLQRR"
FT   CDS_pept        complement(228076..228660)
FT                   /transl_table=11
FT                   /locus_tag="azo0206"
FT                   /product="putative AraC-family transcriptional regulator"
FT                   /function="AraC-type DNA-binding domain-containing
FT                   proteins"
FT                   /note="Putative AraC-family transcriptional regulator,"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0206"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92823"
FT                   /db_xref="GOA:A1K1W8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1W8"
FT                   /protein_id="CAL92823.1"
FT                   /translation="MRRAPGLHVPAVARTAAVHAQGRAARPCKSTFAVAATGHCSAIVG
FT                   GIAPKLFPMETKPLPTCRGARRPPRGIDNALAYIHRHFDEQLSLEELAEIAGLSVCRFA
FT                   TVFRERMGIPPHRYICILRVRHAQALLRSGMPAANVASEAGFYDQSHLSRHFKNICGMT
FT                   PKQYLREAGPLPEGAYIGALRQPAAFAAHAA"
FT   CDS_pept        228700..229056
FT                   /transl_table=11
FT                   /locus_tag="azo0207"
FT                   /product="conserved hypothetical protein"
FT                   /note="Conserved hypothetical protein. Homology to bb1472
FT                   of B. bronchiseptica of 46% (trembl|Q7WMC0). Interpro:
FT                   Protein of unknown function DUF861 (IPR008579). Pfam:
FT                   Cupin_3 (former DUF861) (PFO5899). This family consists of
FT                   several proteins which seem to be specific to plants and
FT                   bacteria. The function of this family is unknown. No signal
FT                   peptide. No TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:azo0207"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92824"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1W9"
FT                   /protein_id="CAL92824.1"
FT                   /translation="MGIRIIKQSEDLQGLEAQGPVGRPLGEPVAQMCGVDVALAGAGSN
FT                   DCGIWECTPGRFRRQIDNAEVMHILSGACTFTPEGGEPLQIAAGDTLFFPSHTVGVWEI
FT                   SETLRKVYVVFALR"
FT   CDS_pept        complement(229064..229267)
FT                   /transl_table=11
FT                   /locus_tag="azo0208"
FT                   /product="Hypothetical protein"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /note="Hypothetical protein, 45% identity to TrEMBL;Q7U8P5.
FT                   Weak Homology with hits. No domains,repeats, motifs or
FT                   features predicted Present."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0208"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92825"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1X0"
FT                   /protein_id="CAL92825.1"
FT                   /translation="MLRRGLLDNGYLELPILREHAVSVESLPPIHKDPFDRILVAQATV
FT                   EGILLLTRDALVAQYPGPIQLV"
FT   CDS_pept        complement(229633..230862)
FT                   /transl_table=11
FT                   /gene="agaE"
FT                   /locus_tag="azo0209"
FT                   /product="probable sarcosine oxidase, beta subunit"
FT                   /function="Glycine/D-amino acid oxidases (deaminating)"
FT                   /EC_number="1.5.3.1"
FT                   /note="Sarcosine oxidase,subunit beta counts to the FAD
FT                   dependent oxidoreductases. Similar to trembl|Q88AX8 (49%)
FT                   and to trembl|Q987J9 (43%). Pfam (PF01266): FAD dependent
FT                   oxidoreductase Pfam (PF01494): FAD binding domain Pfam
FT                   (PF00070): Pyridine nucleotide-disulphide oxidoreductase"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0209"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92826"
FT                   /db_xref="GOA:A1K1X1"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1X1"
FT                   /protein_id="CAL92826.1"
FT                   /translation="MKPVTAPPIAATSETLRADVIVVGGGLVGASAAFFLRKRGLSVIL
FT                   LERGLVGQQASGTNFGNVRRQGRALAQLPLAARARDIWGQLPALLGEDAEFLDSGHLRV
FT                   CYSEEQAEDFARYAVDAKPYGLNLEVMGAAELRRRYGLFGPEVLAGSLSAVDGHANPRL
FT                   AGPAFGRGARRVGATVLEHTEVLRVEREGGDFLVHTQHPAGGEGPRCRAPQLLVATGAW
FT                   GNRIASAFGEPVPIVAHGPQMGVTEPLPYAIGPAIGVTTRNVTEGMYFRQVKRGNIVFG
FT                   GGPKGPAYADRLRAYVEPTNTLNQLQQLRRLAPALGGLQLIRTWSGIEGYLQDSKPVLG
FT                   PSAKVDGLYYAFGFCGEGFAIGPGIGDSIAELIATGQTATPYPDSHIGRFAVAEAAACA
FT                   RKTRQLDQPA"
FT   CDS_pept        complement(230859..232241)
FT                   /transl_table=11
FT                   /gene="ooxA"
FT                   /locus_tag="azo0210"
FT                   /product="putative opine oxidase subunit A"
FT                   /function="uncharacterized NAD(FAD)-dependent
FT                   dehydrogenases"
FT                   /note="Putative opine oxidase subunit A. Homology to ooxA
FT                   of A. tumefaciens of 37% (sprot|OOXA_AGRT4). OXIDATIVE
FT                   CLEAVAGE OF OCTOPINE INTO L-ARGININE AND PYRUVATE (BY
FT                   SIMILARITY). InterPro: FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase (IPR001327),
FT                   NAD-bining site (IPR000205) Pfam: Pyridine
FT                   nucleotide-disulphide oxidoreductase no signal peptide no
FT                   TMHs"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0210"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92827"
FT                   /db_xref="GOA:A1K1X2"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR017224"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1X2"
FT                   /protein_id="CAL92827.1"
FT                   /translation="MAAPRVIVVGAGPAGVRASEALVEAGLRPVVVDEGRRDGGQIYRR
FT                   QPPNFSRPYATLYGSEAAKAEALHRAFDALRPHIDYRAETLAWNIANGQLHTVCGKRAE
FT                   ALPFDALIVCSGATDRLLPLPGWNRAGCYSLGAAQIALKAQACAIGSRTVFCGTGPLLY
FT                   LVASQYLKAGARIEAVIDTSPQPALNAIGGLLARPALLLRGLGLIATLHRAGVPLLRGA
FT                   TPLAIDGDDESGVSGITVRDASGRERRFDCDAVALGYHLRAETQLADLARCEFRFDDAS
FT                   RQWLPAIDEDGRASSAGIYLAGDGVRLAGADGAETAGRLAALAALHDLGVAPGIARYIS
FT                   EHKILRATLATMERFRRGLAAAFPWPHAQAAALPDEAVVCRCETITAGELRRTAAELGG
FT                   CELNRAKAFSRVGMGRCQGRYCGHAAAEIVAAATGIPVQQVGRLRGQAPVKPLPLDVEV
FT                   VQ"
FT   CDS_pept        complement(232223..232552)
FT                   /transl_table=11
FT                   /locus_tag="azo0211"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0211"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92828"
FT                   /db_xref="GOA:A1K1X3"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR042204"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1X3"
FT                   /protein_id="CAL92828.1"
FT                   /translation="MPASTPPRSPRFVRLAETGRRPVGLRVDGRPATALEGDTLLVAVL
FT                   ANGGRLRQSEFGDGARAGFCLMGACQDCWVRGAQGERWRACSTPVEDGMDILTQPQEAT
FT                   WPRRG"
FT   CDS_pept        complement(232564..233067)
FT                   /transl_table=11
FT                   /gene="prp"
FT                   /locus_tag="azo0212"
FT                   /product="probable proline dehydrogenase transcriptional
FT                   activator"
FT                   /function="Transcriptional regulators"
FT                   /note="Probable proline dehydrogenase transcriptional
FT                   activator. Similar to sprot|PUTR_AGRTU (31% Agrobacterium
FT                   tumefaciens, proline dehydrogenase transcriptional
FT                   activator prp or putR) InterPro: IPR000485 HTH_AsnC_lrp.
FT                   Pfam: PF01037 AsnC family. HTH reporting nucleic acid
FT                   binding motif."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0212"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92829"
FT                   /db_xref="GOA:A1K1X4"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1X4"
FT                   /protein_id="CAL92829.1"
FT                   /translation="MTITTAMPKLDRLDLRILCQLQRNGRITNVDLADAVGLSPSPCLI
FT                   RVKRLEQAGYIAGYGAQVKLDKLGEMLTVFTEVTLADHRREDFMRFESAIRNIDEILEC
FT                   HLVSGGYDYLLKFMTQGVNHYQSIIEGLLERSIGIEKYFSYIVIKSPFIKNYYPIERVV
FT                   DTSK"
FT   CDS_pept        complement(233142..234524)
FT                   /transl_table=11
FT                   /locus_tag="azo0213"
FT                   /product="aminotransferase, class III"
FT                   /function="Adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /note="Adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase (EC 2.6.1.62) (78-diamino-pelargonic acid
FT                   aminotransferase) (DAPA aminotransferase). bioA:
FT                   adenosylmethionine--8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0213"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92830"
FT                   /db_xref="GOA:A1K1X5"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1X5"
FT                   /protein_id="CAL92830.1"
FT                   /translation="MTTDALLDLDRKHLIHPVAAWRGHEQRGTTVLASGHDGVWLRDIH
FT                   GKEVLDAFAGLWCVNIGYGHESVVQAAAEQMRKLPYATGYFGFGSEPAIRLAAKLAEIA
FT                   PKSLRHTYLTLGGSEAVDAAIRLITHYYNATGRPQKKHFIAIERGYHGSSSVGSGLTAL
FT                   PAFHRGFDVPLPNQHYIASPYPYRSPVGDDPQAVIAASVAALRAKVAELGADNVAAFFC
FT                   EPVQGSGGVIVPPKGWLKAMREASRELGILFVVDEVITGFGRTGPMFACLAEDVEPDLM
FT                   TMAKGLTSGYVPMGALMISDEVYNGIADGAAPNVLVGHGATYSGHPVSAAVALEVIRLY
FT                   EEGGILAHAQAMEPGFAAGLGEMLDHPLVGDVRHRGLLGAVELVADKASKRAFDPALGL
FT                   ADRLFRSGYQNGLIFRSFGDHILGFAPALCFTEDNFAQLFARLKRTLDEVLDAPDVRRA
FT                   LA"
FT   CDS_pept        complement(235059..235934)
FT                   /transl_table=11
FT                   /locus_tag="azo0214"
FT                   /product="conserved hypothetical acetyltransferase"
FT                   /function="Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /EC_number="2.3.1.-"
FT                   /note="Conserved hypothetical acetyltransferase. Homology
FT                   to putative acetaltransferase (GNAT family) of P. syringae
FT                   of 42% (trembl|Q88AY8). Pfam: Acetyltransferase (GNAT)
FT                   family no signal peptide no TMHs"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0214"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92831"
FT                   /db_xref="GOA:A1K1X6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR041496"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1X6"
FT                   /protein_id="CAL92831.1"
FT                   /translation="MIGEIALRETSADGVTLRPLEAADLDAAHGLSVAVRWPHRLEDWR
FT                   FVAALGQGLVAVRDGEVVGTALGWHWDNSQAIFGMVIVAPQVQGRRIGQRLMQGLLDSA
FT                   GQRAVMLHATAEGRGLYERLGFVRHGEIRQHQGQARQAPLLMPGAGERLRPLGRGDSDR
FT                   LVELDAQASGMPRGAAIRALLDTAETVVLDRDGEAVGFAVLRRFGRGHAIGPVVAPSLA
FT                   SAKALIAHWSNLCAGKFLRIDVEAGGGLIEWLEEIGLRRVGMVAIMSRGEIPRRGPETG
FT                   LYAILSQALG"
FT   CDS_pept        236153..237637
FT                   /transl_table=11
FT                   /gene="aldH"
FT                   /locus_tag="azo0215"
FT                   /product="putative aldehyde dehydrogenase (NAD+)"
FT                   /function="NAD-dependent aldehyde dehydrogenases"
FT                   /EC_number="1.2.1.3"
FT                   /note="Putative aldehyde dehydrogenase (NAD+) (EC 1.2.1.3).
FT                   Homology to adlH of E. coli of 35% (sprot|DHAL_ECOLI).
FT                   Aldehyde dehydrogenases (EC: 1.2.1.3 and EC: 1.2.1.5) are
FT                   enzymes which oxidize a wide variety of aliphatic and
FT                   aromatic aldehydes using NADP as a cofactor. InterPro:
FT                   Aldehyde dehydrogenase family (IPR002086) Pfam: Aldehyde
FT                   dehydrogenase family no signal peptide no TMHs"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0215"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92832"
FT                   /db_xref="GOA:A1K1X7"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1X7"
FT                   /protein_id="CAL92832.1"
FT                   /translation="MPIFDPDQIQVPVGHFIGGRLQTPAGAALEVQRPSDGKVYAALPV
FT                   ADEALVDIAAENAWTAWKESDWARCAPRDRARVLRRWADLVEAEAPRLGVLEALGSTRP
FT                   VRDAIAWDVPFTAEGLRFFAEYADKLGGEVAATRHDHLGMVIAEPYGLIGAITPWNFPL
FT                   VMVSWKVGAALAAGNAVLLKPSELTPFSALRLAELAIQAGVPAGIFNIVQGDGRTTGEA
FT                   ITRHPRVSKMTFTGSTRTGAAIMSACALHGPKPVTLELGGKSPQLVFDDVRDLDKLAAT
FT                   IAGAITGNAGQVCVAGSRLIVQRRVAGALVERIRAIFTGHRPGATWDEDATLPPIISAQ
FT                   QAARIAAIVERAQAAGGRVKCGGRIVDGGYGGAYYLPTLIDGVDTANPAVSEEIFGPVL
FT                   TVQTFDDEEEGFALASHDSYGLAAGVHTSDVGRAMRAVRRIEAGTVWVNRYGRSADFVI
FT                   PTGGYHQSGIGKDLGRQAVEANLRFKSVLMDIGSPQ"
FT   CDS_pept        237835..238500
FT                   /transl_table=11
FT                   /gene="hadL"
FT                   /locus_tag="azo0216"
FT                   /product="probable haloalkanoic acid dehalogenase"
FT                   /function="predicted hydrolase (HAD superfamily)"
FT                   /EC_number="3.8.1.2"
FT                   /note="Probable 2-haloalkanoic acid dehalogenase (EC
FT                   3.8.1.2) (L-2-haloacid dehalogenase) (Halocarboxylic acid
FT                   halidohydrolase). TREMBL:Q92Y68: 68% identity, 82%
FT                   similarity These proteins catalyze the hydrolytic
FT                   dehalogenation of small L-2-haloalkanoic acids to yield the
FT                   corresponding D-2-hydroxyalkanoic acids [1]. They belong to
FT                   the Haloacid Dehalogenase (HAD) superfamily of
FT                   aspartate-nucleophile hydrolases InterPro:IPR006328;
FT                   HAD_II. IPR006388; HAD_SF_IA_v2. IPR005834; Hydrolase. Pfam
FT                   PF00702; Hydrolase rpiB_lacA_lacB: sugar-phosphate isomer
FT                   No signal peptide No transmembrane helices"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0216"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92833"
FT                   /db_xref="GOA:A1K1X8"
FT                   /db_xref="InterPro:IPR006328"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1X8"
FT                   /protein_id="CAL92833.1"
FT                   /translation="MTFRPKYITFDCYGTLIRFRMGDTARAMYADRLPPEQLERFVHDF
FT                   NAYRLDEVMGDWKPYVDILKSALERTCKRHGVKYLEEEGQKYYDLVPTWGPNPDVPEPL
FT                   AVIAKEIPLVILSNAANEQIMTNVEKLGAPFHAVYTAEQARAYKPRLQAFEYMLDQLGC
FT                   GPEDILHVSSSLRYDLMSADDLGIKNKVFVNRGHDPACAAYNYTEIKDIGGLPALVGL"
FT   CDS_pept        238541..239833
FT                   /transl_table=11
FT                   /gene="ordL"
FT                   /locus_tag="azo0217"
FT                   /product="FAD dependent oxidoreductase family protein"
FT                   /function="Glycine/D-amino acid oxidases (deaminating)"
FT                   /note="This family includes various FAD dependent
FT                   oxidoreductases: Glycerol-3-phosphate
FT                   dehydrogenase,Sarcosine oxidase beta subunit, D-alanine
FT                   oxidase, D-aspartate oxidase. Similar to trembl|Q88AY5
FT                   (61%) and to sprot|ORDL_ECOLI (32%). Pfam (PF01266):
FT                   D-amino acid oxidase ProSite (PS50205): NAD binding site"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0217"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92834"
FT                   /db_xref="GOA:A1K1X9"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1X9"
FT                   /protein_id="CAL92834.1"
FT                   /translation="MKLESYWTDSAPAFAGADTPLPKRADVAIVGGGFTGLSAALACAK
FT                   RGASVVVLEAGALAGEASGRNGGHVNNGLAVDYAALADKVGRDQARAWYHAYDAAVDSV
FT                   ARVVEEEGIACDFARNGKLKLAARPAHFEALARGFEQLKNEVDPDVELVDAAAVRDELA
FT                   SERYCGGILIKKSAQMHMGRFAVGLAEAAQRHGARIHTNTTVTRLERRRSEGVYAHRVH
FT                   TSAGSFDAAQVLVASGATRHGGFGSFGWLRRRIVPVGSFIVVTAPLGAERAAALLPRRR
FT                   TYTTTENIHNYFRLTPDNRLVFGGRARFAISSPQSDLKSGHILQAALVRTFPQLADVGI
FT                   DYCWGGLVDMSRDRLPRAGERDGLFYSLGYSGHGTQMSVHMGGIMAEVMAGNAAANPWR
FT                   DLPWPAIPGHFGPPWFLPAVGLYYRLKDTLV"
FT   CDS_pept        239850..241457
FT                   /transl_table=11
FT                   /gene="dppA"
FT                   /locus_tag="azo0218"
FT                   /product="putative dipeptide transport system,
FT                   periplasmic-binding protein"
FT                   /function="ABC-type dipeptide transport system periplasmic
FT                   component"
FT                   /note="Part of the ABC transporter complex dppABCD involved
FT                   in dipeptide import. Similar to the dipeptide
FT                   periplasmic-binding protein dppA in E.coli.
FT                   DIPEPTIDE-BINDING PROTEIN OF AN OSMOTIC-SHOCKABLE TRANSPORT
FT                   SYSTEM. DPPA IS ALSO REQUIRED FOR PEPTIDE CHEMOTAXIS.
FT                   InterPro: Bacterial extracellular solute-binding protein
FT                   family 5 Signal peptide"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0218"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92835"
FT                   /db_xref="GOA:A1K1Y0"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1Y0"
FT                   /protein_id="CAL92835.1"
FT                   /translation="MSSSTLTSSLPGVAPATPGLSRRAALGRLLAGGCALPGLGLPGPA
FT                   FASLAAMTAPPPRQGGYLRVAAAAAAITDTLDPARQSNQTDYIRGKMFYNGLTELDAHL
FT                   NPLPALAESFASEDAQEWTFRLRRGVVFHDGKPLTPADVVYSLMRHKDPAVGSKANAIA
FT                   AQIDSVAADGPQAVKVRLKAPNADLPVLMGTFHFHIVADGTTDFRLANGTGPYRCQEFR
FT                   PGVRSIAVRNPNYWKPGRPYVDTIECVGIVDEVARVNALLSGDIDLVSAVNPRSALRIA
FT                   ATPGFTFMTTQSGQYSDLVMRQDRGPGANADFVLALKYLMDRELMMKVIAQGHAMVGND
FT                   QPIDPTHTFYAPGLPQRAYDPERARFHLRKAGMEGARLPIVASPAATYSVEIALVLQHA
FT                   AARAGLNLEVKRMPVDGYWSNHWMKHPLSFGNINPRASADAVFTQFYQSSSAWNATGWK
FT                   NPRFDQLLVAARSELDEHRRRALYADMQALVHDECGSGIPLFIASIDGLSSRVKGLSQI
FT                   PLGGLMGYSFAENVWLEG"
FT   CDS_pept        241462..242418
FT                   /transl_table=11
FT                   /gene="dppB"
FT                   /locus_tag="azo0219"
FT                   /product="putative dipeptide transport system, permease
FT                   protein"
FT                   /function="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems permease components"
FT                   /note="Part of the ABC transporter complex dppABCD involved
FT                   in dipeptide import. Probably responsible for the
FT                   translocation of the substrate across the membrane. Similar
FT                   to the dipeptide permease protein, DppB in E.coli."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0219"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92836"
FT                   /db_xref="GOA:A1K1Y1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1Y1"
FT                   /protein_id="CAL92836.1"
FT                   /translation="MNALVLRLIAARIGLALVSLLLVSAVVFAITALLPGDAAEEKLGL
FT                   EATAETLAALRHEMGLDRPALVRYGDWLAGMAGGDPGRSVVSGAPVGQLIASRLPNSLL
FT                   LAGLTAAISVPLALALGIAAAMWRGSRFDRAVSMGAVAVVSVPEFLIATLAVLLFAVQL
FT                   RWLPALAYTGPDADLAELARAYALPVFSLCCVIISQMLRMTRAAVVDQLRAPYIEMVRL
FT                   KGASPLRMVLRHALPNALGPIANAVALSLSYLLGGVIIVETIFNYPGVAKLMVDGVTQR
FT                   DMPLVQTCAMLFCAAYLLLVTVADVLGIVSNPKLRHR"
FT   CDS_pept        242415..243290
FT                   /transl_table=11
FT                   /gene="dppC"
FT                   /locus_tag="azo0220"
FT                   /product="ABC transporter, permease protein"
FT                   /function="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems permease components"
FT                   /note="Part of the ABC transporter complex dppABCD involved
FT                   in dipeptide import. Probably responsible for the
FT                   translocation of the substrate across the membrane. Similar
FT                   to the dipeptide permease protein, DppC in E.coli."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0220"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92837"
FT                   /db_xref="GOA:A1K1Y2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1Y2"
FT                   /protein_id="CAL92837.1"
FT                   /translation="MSDQPMPASSAPAPALPAEPPRRRLPRLPLPGLLGLAVILFWLAT
FT                   ALFGPWLLAPEANEPGVDVVFGRLSAAHPLGTDYLGRDMLARLVLGAGYTVGVAIVATL
FT                   LASAGGTALALLAAVRGGWTDGALSRLMDTLISIPSKLFALIMVAAFGSSVTLLALTAA
FT                   LIYVPGVFRIARSLAVNINAMDYVAVARSRGEGDLYIMRHEILPNMLGPMLADLGLRFV
FT                   YVVLLLAGLSFLGLGVQPPEADWGSLVRENLGGLPEGAPAVIVPALAIASLTIAVNLFI
FT                   DNLPGRANRE"
FT   CDS_pept        243283..245109
FT                   /transl_table=11
FT                   /gene="dppD"
FT                   /locus_tag="azo0221"
FT                   /product="putative dipeptide transport system, ATP-binding
FT                   protein"
FT                   /function="ATPase components of various ABC-type transport
FT                   systems contain duplicated ATPase"
FT                   /note="Part of the ABC transporter complex dppABCD involved
FT                   in dipeptide import. Similar to the dipeptide transport
FT                   membrane protein, DppD in E.coli Probably responsible for
FT                   energy coupling to the transport system."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0221"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92838"
FT                   /db_xref="GOA:A1K1Y3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1Y3"
FT                   /protein_id="CAL92838.1"
FT                   /translation="MNDRADKEIAMRADKPGAAVAVRGLRIAAGGKPIVHGLDFDIAPG
FT                   EVLALIGESGSGKTTTALALMGYARQGCEIVGGTVRVGDDIEVLGLDAAGRRKLRGRTV
FT                   AYIAQSAAASFNPSRTIMDQVVEPALIHGLMPRAEAERRAVALFRELALPKPETIGARY
FT                   PHQVSGGQLQRLMAAMALITDPALVILDEPTTALDVTTQIEVLRAFRRVVRERGTSAVY
FT                   VTHDLAVVAQMADRILVLRHGAARELGDTRQVIEAPADDYTRSLLAAAHPAAREGGAVA
FT                   AAGSTPLLEVRNLAAGYGARGADGMPAVPILADIDLTLHRGQAIGVIGESGSGKTTLAR
FT                   VVAGLVGPARGEVLLDGAPLPATLAGRSREQLRRIQIVFQIADTALNPAHTVERILARP
FT                   LQLYHGLSGAALQARIARLLDLVQLPAAVAGRLPGGLSGGQKQRINLARALAAEPDIIL
FT                   ADEVTSALDTVVGAAVLDLMAELRRELGLSYLFISHDLNTVRAVCDEVVVLYAGRKVEA
FT                   VPRERFGTSVRHPYFDLLARSVPEMRIGWLDDIARNEVAPVARTPGGCVFIDRCPLRVD
FT                   GLCDSMPPPRQRLAGGSEILCHRSEAELAAAV"
FT   CDS_pept        245317..246789
FT                   /transl_table=11
FT                   /gene="gabD1"
FT                   /locus_tag="azo0222"
FT                   /product="probable succinate-semialdehyde dehydrogenase
FT                   [NAD(P)+]"
FT                   /function="NAD-dependent aldehyde dehydrogenases"
FT                   /EC_number="1.2.1.16"
FT                   /note="Probable succinate-semialdehyde dehydrogenase
FT                   [NAD(P)+]. Homology to gabD of R. eutropha of 68%
FT                   (AAF19796). Catalysis of the reaction: succinate
FT                   semialdehyde + NAD(P)+ + H2O = succinate + NAD(P)H + H+.
FT                   Pfam: Aldehyde dehydrogenase family no signal peptide no
FT                   TMHs"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0222"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92839"
FT                   /db_xref="GOA:A1K1Y4"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1Y4"
FT                   /protein_id="CAL92839.1"
FT                   /translation="MPLTLTRPDLQRQHNFIANAWHDATDGRLLPVSDPATDTVFAHVP
FT                   DSAAADARAAVDAAHAAFPAWRALTGRERAQYLKRWHALILAYQDDLGRLISREQGKPL
FT                   AEGRGEVLYAASYVEWFAEEAARSHGEVIPEPVRGRKMLMVKEPVGVVAAITPWNFPAA
FT                   MIARKIAPALAAGCTVVAKPAEDTPLTSLALVRLAEEAGLPAGVLNMVTASRERAAEVV
FT                   DVWLADSRVRKITFTGSTPVGKHLVRESAATLKRVSMELGGNAPFIVFEDADLDAAVAG
FT                   LMAAKFRNGGQTCVCPNRVFVHDAVHYDFVARLSARVAALKVGPASAPDSQIGPMINAR
FT                   AVDKIAAHVADAVERGACVVTGGERLAALGANYFAPTILVGVDAGMRCTQEETFGPVVP
FT                   VTRFEHEDEVVAAANDTPFGLAAYFYTRDMARAWRVADRLESGIVGINEGALAAEVAPF
FT                   GGIKESGYGREGSRHGLDDYTQMKYLCQGGLG"
FT   CDS_pept        247001..247369
FT                   /transl_table=11
FT                   /locus_tag="azo0223"
FT                   /product="conserved hypothetical secreted protein"
FT                   /note="Conserved hypothetical secreted protein. Homology to
FT                   an orf of Polaromonas sp. JS666 of 34% (ZP_00360285) . No
FT                   domains predicted. No TMHs. Signal peptide present."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0223"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92840"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1Y5"
FT                   /protein_id="CAL92840.1"
FT                   /translation="MFRMVHRVIHFLLMLAVLFHAVVAQGGWAAAGSSPKASHAALHWQ
FT                   GAAHHHRGVDGTHIHHDTSPESLKHVNFDCAVHAVALLSAGLADLPRLPDATLFVATVL
FT                   EPPVPFLERLKRPPRSAA"
FT   CDS_pept        247500..248717
FT                   /transl_table=11
FT                   /locus_tag="azo0224"
FT                   /product="hypothetical outer membrane efflux protein"
FT                   /function="Outer membrane protein"
FT                   /note="Hypotethical outer membrane efflux protein. Homology
FT                   to PA2525 of P. aeruginosa of 25%. signal peptide. no TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:azo0224"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92841"
FT                   /db_xref="GOA:A1K1Y6"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1Y6"
FT                   /protein_id="CAL92841.1"
FT                   /translation="MAACAIAGSMICCAALAQTTAPRVGLARALDAAWQRTQAGTEAQV
FT                   ALARAEAEQAAADSLLPEPPALELSHRSDRWHDNKGARENEVGLALPLWLPGQRSARQA
FT                   AAEAGQALARSGEDADRLRLAGEVREAAWALAGLDAEAAVAEAQLRYLRELAADVERRV
FT                   QAGELARTDAIAARAEALAAQAALSEARERRHAAMTRWQTLTGLDAPADPREADTVPDA
FT                   AGDDGLPATHPGLRLAAQAVEHARRGVEVARTDRAAPPELTLSYRREVGESGAAAERSI
FT                   NVGLRVPFGTDARNRPLAAAAQGELAQAQVAELRLRQQLAGDLLVARGALQAAQAQAEA
FT                   ARERAGLLRERAQLIDKAFRAGEAALPELLLAASAATQGEAGRARQDAALGLARARLQQ
FT                   VSGILP"
FT   CDS_pept        248714..249310
FT                   /transl_table=11
FT                   /locus_tag="azo0225"
FT                   /product="hypothetical secreted protein"
FT                   /note="Hypothetical secreted protein. No homology to the
FT                   data bank no domains predicted signal peptide no TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:azo0225"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92842"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1Y7"
FT                   /protein_id="CAL92842.1"
FT                   /translation="MTPISSFPLRRGFAALALAAAGAVFASPGAHGPNGEHLDTPSGAV
FT                   AVSATPRVEAHSEAFELVGKLDHGQFSFFIGRYETNEAVLGATVELEADGLKSIATFRA
FT                   ESGDYLVSDAAMVAALAKPGAHALLFTVETADDSDLLDASLTVADDHAVAHEGGKRGLP
FT                   LAWTAAGVLGLAAVGTVALRRRKSAPNPSARGGRA"
FT   CDS_pept        249307..250452
FT                   /transl_table=11
FT                   /locus_tag="azo0226"
FT                   /product="conserved hypothetical secreted protein"
FT                   /function="Membrane-fusion protein"
FT                   /note="Conserved hypothetical secreted protein. Homology to
FT                   cc1787 of C. crescentus of 30% (trembl|Q9A7D6) no domains
FT                   predicted signal peptide no TMHs"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0226"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92843"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1Y8"
FT                   /protein_id="CAL92843.1"
FT                   /translation="MNRKSFSLSTLALALAVLGSPLASASPGAHGPNGEHLDAPGAAVI
FT                   ASGLARLPDGSVNVPMAAQRRMGVLTRFSVESEAAATVELAGRVVMDPNAGGRVQPMYA
FT                   GRVEAGPKGLPVAGQAVKRGEVLAYLRYQAEPYAQAEQQAQLAEVRNNRKLAEQRVERL
FT                   QGLEGSIPRKEMDAARAELDTLKAREQRIGAALGAREALLAPVDGVIARADAVAGQVVE
FT                   ARDVLYEIIDPARVLVEATVADPALATGIAEARVVEAPQVAFKLVGAARSLRDGVLPLT
FT                   FRAVPDPKAKVAALPLAVGQPVTVVAALAERTRGFVLPAEAVVRNSANEPIVWIKSGAE
FT                   RYIPQPVQYRALDATRVVVTHGLGADNRVVVQGAPLIAQIR"
FT   CDS_pept        250466..253597
FT                   /transl_table=11
FT                   /gene="czcA1"
FT                   /locus_tag="azo0227"
FT                   /product="putative cation efflux system protein"
FT                   /function="Putative silver efflux pump"
FT                   /note="Cobalt-zinc-cadmium resistance protein CzcA (cation
FT                   efflux system protein CzcA). In A.eutrophus has a low
FT                   cation transport activity for cobalt, it is essential for
FT                   the expression of cobalt, zinc, and cadmium resistance.Czca
FT                   and Czcb together would act in zinc efflux nearly as
FT                   effectively as the complete czc efflux system
FT                   (czcABC).Belongs to the acrb/acrd/acrf family. 41%
FT                   similarity to the A.eutrophus CzcA protein.
FT                   SWISSPROT:CZCA_ALCEU:P13511 InterPro: Heavy metal efflux
FT                   pump CzcA. InterPro:IPR001036; Acrflvin_res.IPR004763:
FT                   CzcA. Pfam:PF00873; ACR_tran; 1. InterPro:TIGR00914:Heavy
FT                   metal efflux pump CzcA InterPro:PF00873:Acriflavin
FT                   resistance protein Signal peptide: present."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0227"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92844"
FT                   /db_xref="GOA:A1K1Y9"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1Y9"
FT                   /protein_id="CAL92844.1"
FT                   /translation="MFNWIVRYSLANRLFVLALALLMMAYGAYTAWKTPVDVFPDLNKP
FT                   VVTVLTEAGGMAPEEVEQLVTFPLETALGGMPGVTRVRSVSGVGLSIVYAEFDWGTDIY
FT                   RNRQLVSERLSLVREQLPTGITPMMGPVSSIMGEVMLIGLPLAADGKVSAMQAREYADF
FT                   VLRPRLLSIAGVSQVIPIGGEVRQLRVEPDTARMAQVGVSLTQVEEALRGFASNAGGGF
FT                   IDLNRREYLIRHLGRGNNVEDLAGLAVAWKDGRPVLLEQVATVRFAPSLKRGDAGYNGG
FT                   PAVIVSVQKQPDADTVKLTGQIEVALAELDHGRPAGLAAPKVLFRQANFIEASIGNVSE
FT                   ALRDGAIMVAIVLFAFLLSARTTLISLVAIPLSLAVTALVFQLLGQSINVMTLGGLAIA
FT                   IGELVDDAVVDVENILRRLKQNRALPNPAPVLEVVAAASVEVRSGIVYATIIVCLVFVP
FT                   LFALPGIEGRLFSPLGIAYIVSILASMLVSMTVTPALSSFLLPRMKRLDHGDSPLVAKL
FT                   KVWDAKLLTWSFPRAKLLIGIAALAVAAAAASVPFFPRAFLPAFNEGSLVLGMVLNPGT
FT                   SLEEANRLGALAETLIREVPEVTQVGRRTGRAELDEHAEGVHAAEIDVDLHPSERGREA
FT                   VMADIRDKLSVLPAQVAIGQPISHRLDHLLSGVRAQVAVKIFGDDIDTLRGLAEQMRQG
FT                   LASVPGLVDLTVEKQVLIPQITVRLDHRKAAQAGLTPGEAVRLLQALTDGAHSAEIVDG
FT                   PRRYDLVLRLADARRSPQDLARTLIDTPAGRLPVSAIATVQETDGPNQVGRENGRRRIV
FT                   VYANTDGSDMGRVIADVRAVIARTPMPAGNFVTLEGQFQAQEQATRLIAGLSLVSLAMI
FT                   FLVLYSRYKSAVLAGVIMANIPLALIGSVVAMWLAGVTLSVASMVGFITLAGIATRNGI
FT                   LKVSHYINLCRFEGETFGDAMIVRGSLERLTPVLMTALVAAFALTPLLLAADAPGKEIL
FT                   HPVAVVIFGGLVSSTLLDTLLTPVIFRLVGEKPTRRLLEGGEEGAVQGLPQEAY"
FT   CDS_pept        253594..254088
FT                   /transl_table=11
FT                   /locus_tag="azo0228"
FT                   /product="Hypothetical protein"
FT                   /note="Hypothetical protein, 32% identity to TrEMBL;Q82T66
FT                   No Signal Peptide/Features/Domains/TMH detected."
FT                   /db_xref="EnsemblGenomes-Gn:azo0228"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92845"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1Z0"
FT                   /protein_id="CAL92845.1"
FT                   /translation="MTATATIPPVRAPARNEIRGPRGAACKVRRTFDGDIPMTALKTLL
FT                   VAVAFGAASLAAAPVLAHGDSAPKHGGIVKSANDLSFELVAEGGDAALYIDDHGSAFDT
FT                   AGASGKLTVLAGSDKTAVELKPAGGNKLLAAGARLPAGAKVVAVITTAQNKTASVRFNL
FT                   P"
FT   CDS_pept        254346..256517
FT                   /transl_table=11
FT                   /gene="fhuA1"
FT                   /locus_tag="azo0229"
FT                   /product="probable ferrichrome-iron TonB-dependent
FT                   receptor"
FT                   /function="Outer membrane receptor proteins mostly Fe
FT                   transport"
FT                   /note="In E.coli this receptor binds the ferrichrome-iron
FT                   ligand. It interacts with the tonB protein, which is
FT                   responsible for energy coupling of the ferrichrome-promoted
FT                   iron transport system. Acts as a receptor for bacteriophage
FT                   T5 as well as T1, phi80 and colicin M. Binding of T5
FT                   triggers the opening of a high conductance ion channel. Can
FT                   also transport the antibiotic albomycin. Signal peptide."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0229"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92846"
FT                   /db_xref="GOA:A1K1Z1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1Z1"
FT                   /protein_id="CAL92846.1"
FT                   /translation="MTTRTKRRLRRVLVPAAAALSCASVFAAEPADTQDAADTTPAAAT
FT                   ASASTLDTVSVTGKKQPYRKLTATGATKTDTLLKDLPQSVRVLTEDLLEDAGVTNLAGA
FT                   LDLSSGVSRQSNLGGLWDSYAMRGFTGDPSFGSDYLVNGFNYSRGYNGVRDAANTGSVE
FT                   VLKGPSAALYGRGEPGGTVNITTKKPLFQREGQVDISYGSFDAFRTAIDLTGPISDRMA
FT                   YRLNGAYEKAGSYRDHVSSERSLISPSFLWMLSDDTTLSYELEVSRQKATFDRGVMAIN
FT                   GKLGVLSRKRFLGEPGDGDHDTETVGHQVFLQHYLNDDWQLQGGFSFRESSIKGTSTEV
FT                   RFLRADGENAARQRRTRDNEASDLSARAELLGSFRTGPLKHNVLFGVDAYKFVDERLQY
FT                   RIANAGDINIFEPVYGNVVWGFTPANRNTDTKEEQDSRSLYAQDQIDLTEQWKLLLGVR
FT                   FDDYDQKLTNNRNGIVVKKSLAATSPRVGLVYQPTKQVSLYAQAGKSFRPNGGVSRDFT
FT                   AFDPEEGRSYELGAKWDSADQRITSTVALFHITKENVLSPDPVDPNNFYVTAGEVESKG
FT                   LEFDLSGEIMPTVRLSFAYAYTKTEVTKDNNKLLEGRELANVPLHSANLMLVKSLSLND
FT                   KPATVGVGLNYVGEREGAVAPLVAADDFKLPGYTTVKLTGSYNFDKQTKLMLEVDNLFD
FT                   KEYYTSSYSQAWVYPGSPRAFKATLQHRF"
FT   CDS_pept        256540..257289
FT                   /transl_table=11
FT                   /locus_tag="azo0230"
FT                   /product="conserved hypothetical secreted protein"
FT                   /note="Conserved hypothetical secreted protein. Homology to
FT                   RPA1846 of R.palustris of 39% (trembl:Q6N8Q7). No domains
FT                   predicted. No TMHs. Signal peptide present."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0230"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92847"
FT                   /db_xref="InterPro:IPR019613"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1Z2"
FT                   /protein_id="CAL92847.1"
FT                   /translation="MNLKPVFRSLAAGLALAAVAGAAHAHQIWFEQAGNSITFRYGELD
FT                   ENLHEVSPGGLDRFRALEARWVKAEGTAPLAMQKLQDGYAVPARTAAGESLLAIDNNYP
FT                   MFDTRRDGKLLRTWWVPATRWVGDFSARKAELPLDFVPTGAKRGDAVEFQLVYKGEPLA
FT                   GEKVKLATPSGWVKYATTDADGKVAFALPWKGNYVLGVYYTDEIEGVRGDEKYQLEGYN
FT                   TSVSFNLAKGLAPLATAERTLPATGKH"
FT   CDS_pept        257937..259160
FT                   /transl_table=11
FT                   /locus_tag="azo0231"
FT                   /product="conserved hypothetical membrane protein"
FT                   /function="predicted membrane protein"
FT                   /note="Conserved hypothetical membrane protein. Homology to
FT                   SO1157 of Shewanella oneidensis of 50%
FT                   (trembl|Q8EHR0(SRS)). No domains predicted. Signal peptide.
FT                   7 TMHs"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0231"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92848"
FT                   /db_xref="GOA:A1K1Z3"
FT                   /db_xref="InterPro:IPR012429"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1Z3"
FT                   /protein_id="CAL92848.1"
FT                   /translation="MSSTASLSSTVGFGPAAAAGSMPLAAVRAPRIVSIDILRGLVMLV
FT                   MLLDHVRETLYLHLQVTDPMTIATTPAALFFSRFAAHFCAPAFVFLTGLSAWLYANPPA
FT                   GTPRPVKSFLMKRGFLLLFLEATVITFAWSGDLPPRVIYLQVIWAIGLAMIVLALMSGL
FT                   PRKLLAAIGFVIVFGHNALAGLSFAPDSPLYLPWTLLLHRGPVIAEGALQIKLTYPVLP
FT                   WIGVILLGWVAGPLYAHTVGAARRIKLLLALGLACLGLLLVLRGFNIYGENAPWEYGAT
FT                   TVHTVMSFLNFTKYPPSLDFLLTTLGTAFLLLAAFERADNRVGRFLATFGGAPMFYYIG
FT                   HLLLLLVLYKILLAVFGPNQGTRFGVNPDQFWVVWVSTVALIPVLYFPCRAFARYKRTS
FT                   KRAWVRYF"
FT   CDS_pept        259217..260059
FT                   /transl_table=11
FT                   /gene="exbB1"
FT                   /locus_tag="azo0232"
FT                   /product="putative biopolymer transport protein ExbB"
FT                   /function="Biopolymer transport proteins"
FT                   /note="Putative biopolymer transport protein ExbB. Homology
FT                   to exbB of B. pertussis of 35%. ExbB is part of the
FT                   TonB-dependent transduction complex. The TonB complex uses
FT                   the proton gradient across the inner bacterial membrane to
FT                   transport large molecules across the outer bacterial
FT                   membrane. PFam: MotA/TolQ/ExbB proton channel family
FT                   signals peptide most probable 4 TMHs"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0232"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92849"
FT                   /db_xref="GOA:A1K1Z4"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1Z4"
FT                   /protein_id="CAL92849.1"
FT                   /translation="MKLRRFFSSLSLAFAIACGAVSAPAFAQSDPATTASADSASAVAG
FT                   TIDAAPTAKPAAGAAAKVENPYGLEALWAGSDAVAKVVLVLMIIMSAGSWYIIIVKLIE
FT                   QTRMYRQAKAVEGVWKSATIKHGAENLENGSPFRFIAEAGLEATNRHDSLLEHVDLNDW
FT                   VTLSIHRAIEKVQSRMQNGLAFLATVGSTAPFVGLFGTVWGIYHALTAIGIAGQASIDK
FT                   VAGPVGEALIMTAIGLAVAVPAVLGYNWLVRRNKGVMDQVRGFGNELHTVILSSAKRA"
FT   CDS_pept        260085..260513
FT                   /transl_table=11
FT                   /gene="exbD1"
FT                   /locus_tag="azo0233"
FT                   /product="putative biopolymer transport protein ExbD"
FT                   /function="Biopolymer transport protein"
FT                   /note="putative biopolymer transport protein ExbD. ExbD is
FT                   part of the TonB-dependent transduction complex. The TonB
FT                   complex uses the proton grandient across the inner
FT                   bacterial membrane to transport large molecules across the
FT                   outer bacterial membrane. InterPro: Biopolymer transport
FT                   protein ExbD/TolR Pfam: Biopolymer transport protein
FT                   ExbD/TolR no signal peptide probable 1 TMH"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0233"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92850"
FT                   /db_xref="GOA:A1K1Z5"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1Z5"
FT                   /protein_id="CAL92850.1"
FT                   /translation="MAMNVGSADEDDGVMSAINTTPLVDVMLVLLIIFLLTIPVATVSV
FT                   PVELPKETIEARETKPENVILSVDKGGALFWHDVRVANVDALVERLKKVSVQQPQPEVQ
FT                   IRGDLDAAYDGVGRILYACQRAGITKVAFITEPPARGG"
FT   CDS_pept        260535..260960
FT                   /transl_table=11
FT                   /gene="exbD2"
FT                   /locus_tag="azo0234"
FT                   /product="putative biopolymer transport protein ExbD"
FT                   /function="Biopolymer transport protein"
FT                   /note="Putative biopolymer transport protein ExbD. Homology
FT                   to exbD2 of X. campestris of 36% ExbD is part of the
FT                   TonB-dependent transduction complex. The TonB complex uses
FT                   the proton gradient across the inner bacterial membrane to
FT                   transport large molecules across the outer bacterial
FT                   membrane. InterPro: Biopolymer transport protein ExbD/TolR
FT                   Pfam: Biopolymer transport protein ExbD/TolR no signal
FT                   peptide probable 1 TMH"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0234"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92851"
FT                   /db_xref="GOA:A1K1Z6"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1Z6"
FT                   /protein_id="CAL92851.1"
FT                   /translation="MNVGSAGASSEPEVMVDINTTPLIDVMLVLLIMLIITIPIQLHSV
FT                   NLDLPVGTPPASDIKPEIVKIDIDDKSTVYWQGVALADMGELETRLREIAARPVAPDLH
FT                   LRPDKAARYAVVARVLADTKRLGLTKIGVIGSEQFVQ"
FT   CDS_pept        260989..261636
FT                   /transl_table=11
FT                   /locus_tag="azo0235"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="Conserved hypothetical membrane protein. Homology to
FT                   an orf of Rubrivivax gelatinosus of 55%
FT                   (gi|47575633|ref|ZP_00245668.1|(NBCI ENTREZ)). No domains
FT                   predicted. No signal peptide. 1 TMHs"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0235"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92852"
FT                   /db_xref="GOA:A1K1Z7"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1Z7"
FT                   /protein_id="CAL92852.1"
FT                   /translation="MDYSFQPKQTSGRYVGIGIVVGLHVVIGWALASGMARKAVEVIKK
FT                   PLEAVVIQEVTLPPPPPPPPPPKIVQPPKQVVAPKVQAPPPPPFVPPPEVAVAPSAAPA
FT                   IEAVHTPPPAPPVIAPPAPPAPPAPVAAKSDIGVACPVQAKPEMPEKAINSGIAGVVRA
FT                   EAVIRGGVVQEVRILSGPRVFHAAVKTAMQQYRCTAPDGTVASQDFDFKVEG"
FT   CDS_pept        complement(261880..262902)
FT                   /transl_table=11
FT                   /gene="add"
FT                   /locus_tag="azo0236"
FT                   /product="adenosine deaminase"
FT                   /EC_number="3.5.4.4"
FT                   /note="Adenosine deaminase (Adenosine aminohydrolase).
FT                   InterPro: Adenosine and AMP deaminase"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0236"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92853"
FT                   /db_xref="GOA:A1K1Z8"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR028892"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1Z8"
FT                   /protein_id="CAL92853.1"
FT                   /translation="MDPSRLTDLHAYIRALPKAELHLHIEGTLEPELMFALAARNGVAL
FT                   PWDSVEATRAAYAFSDLQSFLDLYYAGAAALIHEQDFHDLALAYFERAHEDGVVHAELF
FT                   FDPQTHTARGVAFDTVLDGLERACIEAQERWGISSRLILCFLRHLSEEDGFATLEQALP
FT                   HLARIHGVGLDSSEKGHPPAKFARLFARCRELGLHIVAHAGEEGPPAYIEEALDILQVE
FT                   RIDHGVRAAESAALMERLAREQVPLTVCPLSNVKLCVFERLQDHNLKQLLDAGLKVTIN
FT                   SDDPAYFGGYVGQNYQQTAEALGLSRTELKQLAKNSLEASFVPQAVLDPWLLRLAAVPD
FT                   "
FT   CDS_pept        complement(262974..263831)
FT                   /transl_table=11
FT                   /gene="npd1"
FT                   /locus_tag="azo0237"
FT                   /product="putative NAD-dependent deacetylase"
FT                   /function="NAD-dependent protein deacetylases SIR2 family"
FT                   /note="Putative NAD-dependent deacetylase (EC 3.5.1.-)
FT                   (Regulatory protein SIR2 homolog). Modulates the activities
FT                   of several enzymes which are inactive in their acetylated
FT                   form. Similar to SWISSPROT: sprot|NPD_AERPE (27% Aeropyrum
FT                   pernix, NpdA or aq_2170) Pfam: PF02146 Sir2 family."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0237"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92854"
FT                   /db_xref="GOA:A1K1Z9"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:A1K1Z9"
FT                   /protein_id="CAL92854.1"
FT                   /translation="MTAPPPSTLHAAAQDAAAALAGADALLVTAGAGMGVDSGLPDFRG
FT                   AEGFWRAYPALRQTGLRFEEIADPVHFERDPALAWGFYGHRLALYRRTVPHAGFGLLRE
FT                   LGRALAQGVFVFTSNVDGQFQRAGFDADRIVEVHGSIHHLQCIHGCRDAIWPADAFAPD
FT                   VNEATCRLSNPPPRCPHCGAVARPNILMFGDWGWLEERSAAQQARLADWLDRVQRPLVV
FT                   EIGAGTAIPTVRRVGERAGATLVRINPQADRDPPPGSIALHCGGLAGIRALHAAAAAAG
FT                   LVGA"
FT   CDS_pept        complement(263828..264958)
FT                   /transl_table=11
FT                   /locus_tag="azo0238"
FT                   /product="hypothetical membrane protein"
FT                   /note="Hypothetical membrane protein no homology to the
FT                   data bank no domains predicted no signal predicted 7 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:azo0238"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92855"
FT                   /db_xref="GOA:A1K200"
FT                   /db_xref="UniProtKB/TrEMBL:A1K200"
FT                   /protein_id="CAL92855.1"
FT                   /translation="MEHALRPALLPTLPQLVLRGVDARHNMPAVIMLAAAGGLFVLSWA
FT                   AASVGSGDQFPLFLIGNLIGLALLLTGYSAAGVMLMDQARGRPPRSVGDTLRAGAVCAL
FT                   RHAVLAFFAAVGLALFALCVAMALLLARIPGLGVLFYLLLFPLASLGSAALFGLGGYAF
FT                   LLLGPALWCGAGVRQAALHVWAVFQHKPRQVLIACTLLTVLTAVLVLAGGAVAAAGTVF
FT                   VGGLSVPMLGEVDDFSGLFATPAQHLASGVTALSWAGVVGAGLVYAAIGAFVAAVMILG
FT                   TSHAWLHLTRDLDLEQAGRAFDDPAFDDAGEERGSLLAAPSAAHALVAAGSILAHAAHT
FT                   AAGLPPPAEGSCHRCGAGPEPGDRFCTACGCLLTRP"
FT   CDS_pept        complement(264970..266250)
FT                   /transl_table=11
FT                   /locus_tag="azo0239"
FT                   /product="hypothetical membrane protein"
FT                   /note="Hypothetical protein, showing only very low
FT                   similarity to known proteins (SWISSPROT: sprot|FRAH_ANASP;
FT                   >10% Anabaena sp., FraH). Important Domains are: Pfam:
FT                   PF00034 Cytochrome c. SMART: SM00438 ZnF_NFX TMHMM
FT                   reporting 1 transmembrane helices."
FT                   /db_xref="EnsemblGenomes-Gn:azo0239"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92856"
FT                   /db_xref="GOA:A1K201"
FT                   /db_xref="InterPro:IPR025874"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A1K201"
FT                   /protein_id="CAL92856.1"
FT                   /translation="MDCPACGHPNRTSAHFCSACGQHLDGPVPPALQVCPSCGRSCRGD
FT                   AHFCPACGFHLAGPLPDMSDIDFSQLDPARAEPGPAAQPFPPMGEPDATVILPPGWTAT
FT                   RPPAPDPAPAPASEARPGADAPAAAGGDEPAAGPTPVPPPPPADSAGRRPLALALGFVL
FT                   VVVAGLAAWWTTTAPHDEPPPPPPVAVDDAAARAERALALAERALAERAQLDTAPAAGS
FT                   AATPDTAAPPPVAEVDTAAANASTQPVAAVAPAAAPRPVRTLYARGCAACHERGANGAP
FT                   RTADPEQWQDLLQGSPHDQSQRVLAGHGGAPAGAGLGLTPVESERLVAHVGELVGQART
FT                   REAAAERSRAAERSARATTAAAERPAAPAAPRQDDWQRSLKSELARCGQLGFFERVACT
FT                   EKARWTYCNNRWNSVPECAVRNHQSAP"
FT   CDS_pept        266442..267473
FT                   /transl_table=11
FT                   /gene="dctP1"
FT                   /locus_tag="azo0240"
FT                   /product="putative C4-dicarboxylate-binding periplasmic
FT                   protein"
FT                   /function="TRAP-type C4-dicarboxylate transport system
FT                   periplasmic component"
FT                   /note="Putative ABC transporter periplasmic binding
FT                   protein, DctP: TRAP dicarboxylate transporter.Binds
FT                   C4-dicarboxylates; part of the binding-protein- dependent
FT                   transport system for uptake of c4-dicarboxylates. 28%
FT                   TRAP_transptDctP. Pfam:PF03480; SBP_bac_7; 1.
FT                   TIGRFAMs:TIGR00787; dctP; 1. Signal peptide:present.
FT                   TMhelix:1"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0240"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92857"
FT                   /db_xref="GOA:A1K202"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A1K202"
FT                   /protein_id="CAL92857.1"
FT                   /translation="MKKRQFSALLAGLCASFALGLPLPAAAAPYKDEYKLSTVLGEAFP
FT                   WGWGAKRWADLVAEKTQGRIKIKVYPGTSLVSGDQTKEFTALRQGIIDIAVGSTINWSP
FT                   QVKELNLFALPFLMPDHKAIDALTHGRVGKKMFELLAERDVVPLAWGENGFREVSNSKK
FT                   PIRTPDDLKGLKMRVVGSPLFLATFSALGANPTQMSWADAQPAMATGAVDGQENPLGVF
FT                   SAAKLHTVGQKHLTLWGYVADPLIFVVNKNVWNSWTPEDQKAVAEAAQQAAREEIARAR
FT                   AGISAGDDALLKEIAANGVTVTTLTEAEREGFRKATAGVYKEWAGKVGAELVKQAEEDI
FT                   AKR"
FT   CDS_pept        267570..268058
FT                   /transl_table=11
FT                   /gene="dctQ1"
FT                   /locus_tag="azo0241"
FT                   /product="DctQ1 protein"
FT                   /function="TRAP-type C4-dicarboxylate transport system
FT                   small permease component"
FT                   /note="C4-dicarboxylate transport system,permease small
FT                   protein,DctQ. The Dct locus encodes a high-affinity
FT                   transport system for the C4-dicarboxylates
FT                   malate,succinate, and fumarate. 22% DctQ. Pfam:PF04290;
FT                   DctQ; 1. TMHelix:4."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0241"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92858"
FT                   /db_xref="GOA:A1K203"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:A1K203"
FT                   /protein_id="CAL92858.1"
FT                   /translation="MNPDPSADTAAEAPAPLSPEQILCGIAMALIVLISLGNVVARYLT
FT                   SQSFAATEEFSIALLLILSFLGSSTAFAFDRHIRVTFFIERLPSRWRQGAEWLSFVVTA
FT                   ALFGFIAFYAGRLTWDQYRFEETSPALGLPQWWYTVWMPALAVVIVLRLVVTRLGARS"
FT   CDS_pept        268055..269338
FT                   /transl_table=11
FT                   /gene="dctM1"
FT                   /locus_tag="azo0242"
FT                   /product="probable TRAP-type C4-dicarboxylate transport
FT                   system, large permease component"
FT                   /function="TRAP-type C4-dicarboxylate transport system
FT                   large permease component"
FT                   /note="TRAP-type C4-dicarboxylate transport system, large
FT                   permease component, DctM.The Dct locus encodes a
FT                   high-affinity transport system for the C4-dicarboxylates
FT                   malate,succinate, and fumarate. 34% DctM.IPR000252;
FT                   DedA.IPR004681; TRAP_transptDctM. Pfam:PF06808; DctM;
FT                   1.PF00597; DedA; 1. TIGRFAMs:TIGR00786; dctM; 1. Signal
FT                   peptide: present. TMhelix:11."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0242"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92859"
FT                   /db_xref="GOA:A1K204"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A1K204"
FT                   /protein_id="CAL92859.1"
FT                   /translation="MTGVVLIGLFLLALVAGLPLAVGLGVASIAVLALAGFDQLAVPTN
FT                   IYAGIAKYPLLAIPMFILAGMIFERSGVALRLVRFVTAMVGEWTGSLAVVAVLVSMLLG
FT                   GISGSGPADAAAVAAVMLPSMVARGYPKGFSAGLIAAAGSTAIVIPPSVAFIVYSVMVP
FT                   AATVPALFAAGLFPGMIAALCLLIPAVLISRKYGFGRDYRAERPPLGKSFVDAIWGLLA
FT                   PVIILGGLRAGIFTPTEAAVVAVAYGIFVGMVVYRTITPKTLFRLLVDAGELSAVVMMI
FT                   IGVASVFAWAGNTLGIFDAAAKALVEMHPGHWGMLLSVNLLLLVAGMFLDAVSIFLILL
FT                   PLLVPIALAMGWDLVWFGVMMTINLAIGQFTPPMALSLMITSRIAGIGIEQTFRWVIWF
FT                   VLAMGAGLAAMVVFPELALWLPRRLGYV"
FT   CDS_pept        complement(269367..270011)
FT                   /transl_table=11
FT                   /gene="uidR"
FT                   /locus_tag="azo0243"
FT                   /product="putative TetR family transcriptional regulator"
FT                   /function="Transcriptional regulator"
FT                   /note="Putative TetR family transcriptional regulator,"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0243"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92860"
FT                   /db_xref="GOA:A1K205"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:A1K205"
FT                   /protein_id="CAL92860.1"
FT                   /translation="MTADRSPVDAPRAEARRAQILDAAVACFRAHGFHGASIAQISKAA
FT                   GMSAGHIYHYFDNKEAIIAAIVEQDLERLLTLTAEMRSARDVLEAMIERAAEGVRDNLD
FT                   PASVGLKLEIVAEASRNPRVAEIVRQADATCRDSLAETLRAMRANCGHRDDEAAIAGLT
FT                   EVLAAMFGGLMIRSVRNPDLEQDTVIRMFQRVIRFIITDALAAPAPGEAPH"
FT   CDS_pept        270224..271426
FT                   /transl_table=11
FT                   /locus_tag="azo0244"
FT                   /product="membrane fusion protein"
FT                   /function="Membrane-fusion protein"
FT                   /note="HlyD family secretion protein. The secretion of a
FT                   number of proteins/molecules require the help of members
FT                   belonging to the ABC transporter family and a membrane
FT                   fusion protein belonging to the HlyD family, TREMBL:Q8XRL2
FT                   (55% identity); SWISSPROT:P31223 (53% identity). Pfam
FT                   (PF00529): HlyD family secretion protein. SignalP
FT                   predicting signal peptide. TC (8.A.1): The Membrane Fusion
FT                   Protein (MFP) Family."
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0244"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92861"
FT                   /db_xref="GOA:A1K206"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A1K206"
FT                   /protein_id="CAL92861.1"
FT                   /translation="MQTPPSLLLKPLAVLVAAALLLTACGGQQAPAGAPPGGGAPTVGV
FT                   VKVQSEAVALTTELPGRTAPYQIAEVRPQVTGIVKKRAFREGSEVKGGELLYQIDPATY
FT                   QAAYDSAKASLARAEANLYTAKLKGERYADLSQINAISKQANDDAVAALKQAEADVAAA
FT                   RAAVDKARIDLEFTRVSAPIPGRIGRSSVTAGALVTANQADPLATVQQLDPIYVDVTQS
FT                   SAELLALRRSLAEGKLQRAGDNAARVQLVMEDGSLYPAEGKLEFSEVSVDTGTGSVVLR
FT                   AVFPNPKNDLLPGMYVRARFAQGVRQDAVLVPHAGVTRDARGNAVVMVVNGDNKVEARQ
FT                   VRAEQALADKWVVSEGLAAGDRVIVEGLQKVRPGADVQVQEVGAAAPQAAAAAPTAAAA
FT                   K"
FT   CDS_pept        271438..274596
FT                   /transl_table=11
FT                   /locus_tag="azo0245"
FT                   /product="RND efflux transporter, permease protein"
FT                   /function="Cation/multidrug efflux pump"
FT                   /note="Members of this family are integral membrane
FT                   proteins. Some are involved in drug resistance. AcrB
FT                   cooperates with a membrane fusion protein, AcrA, and an
FT                   outer membrane channel TolC. The structure shows the AcrB
FT                   forms a homotrimer, TREMBL:Q8E8H2 (65% identity);
FT                   SWISSPROT:P31224 (63% identity). InterPro (IPR001036):
FT                   Acriflavin resistance protein. InterPro (IPR004764):
FT                   Hydrophobe/amphiphile efflux-1 HAE1. TIGRFAM (TIGR00915):
FT                   Hydrophobe/Amphiphile Efflux-1 (HAE1) Family protein.
FT                   TIGRFAM (TIGR00914): Heavy metal efflux pump, CzcA family.
FT                   Pfam (PF00873): AcrB/AcrD/AcrF family. TMHMM reporting 12
FT                   transmembrane helices. TC (2.A.6.2): The (Largely
FT                   Gram-negative Bacterial) Hydrophobe/Amphiphile Efflux-1
FT                   (HAE1) Family."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0245"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92862"
FT                   /db_xref="GOA:A1K207"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A1K207"
FT                   /protein_id="CAL92862.1"
FT                   /translation="MARFFIDRPIFAWVVAIVIMLAGALSILSLPVSQYPAIAPPQIAI
FT                   NATYPGATAKAVEDSVTQVIEQKMTGLDNLLYMNSTSDSYGRVTVTLTFNAGTNPDIAQ
FT                   VQVQNKLQTALPLLPQAVQQQGVQVAKSTRNFLMVLGFVSRDGSQSANDLSDFLASTVQ
FT                   DPLSRVTGVGEVQVFGSQYAMRVWLDPAKLNNYKLMPSDVRSALEAQNTQVSAGQLGGT
FT                   PALPGQGFTASITAQSRLQTAEQFENILLKSSAQGGEVRLRDVARVEVGAQDYGFTARY
FT                   NGKPAAGIGIKLAAGSNALDTAKAVRKAIDGMSRYFPAGVEVVTPYDTTPFVRLSIEEV
FT                   VKTLVEAIVLVFLVMFLFLQNLRATLIPTIAVPVVLLGTFGLMAAFGFSINTLTMFGVV
FT                   LAIGLLVDDAIVVVENVERIMTEEGLSPREATRKSMGQITGALIGIGLVLSAVFVPMAF
FT                   FGGSTGVIYRQFSITIVSAMALSVLVAIVFTPALCATMLKPVEKGHDHSEGGWFSGFFR
FT                   WFNRMFARNTTRYESAVGGILRRSGRFLLIYALIVGVLAFLFLRMPTSFLPEEDQGVMF
FT                   TQVMLPAGATQERTIEVLKKVENHFLEGEKDYAKSIFTVAGFSFAGSGQNMAIGFVHLR
FT                   DWDERKGPAGNVKAVAGRAMAAFSQIREAMVFAFVPPAVLELGTSNGFDVQLQDRSGLG
FT                   HDALIAARNQFLGMAAQDKRLVAVRPNGQEDMQEYVLDIDHAKAGALGVSVSDINATLS
FT                   TAWGGVYVNDFLDRGRIKKVYLQSQAEGRMRPEDLTKWYVRNKAGEMVPLSAFASGHWA
FT                   FGSPRLERYNGQSSVEVLGQGAPGVSSGDAMAAVEEIIAKLPPGIGYEWTGTSYEERRS
FT                   GSQAPALYALSLIVVFLCLAALYESWSVPFAVMLVVPLGVLGAIVAATGRGLSNDVYFQ
FT                   VGLLATIGLSAKNAILIVEFAKEQMEKEGKALIDATLEAVRMRLRPILMTSLAFGLGVL
FT                   PLAVATGAGSGSQNAIGTGVLGGTIFATVLGIFFIPLFYVAIKRIFKDKPAADAAPLAV
FT                   QEAR"
FT   CDS_pept        274611..276014
FT                   /transl_table=11
FT                   /gene="oprM1"
FT                   /locus_tag="azo0246"
FT                   /product="probable outer membrane efflux protein"
FT                   /function="Outer membrane protein"
FT                   /note="Probable outer membrane efflux protein. Homology to
FT                   oprM of P. aeruginosa of 57%. Component of an efflux system
FT                   that confers multidrug or multible antibiotic resistence.
FT                   Pfam: Outer membrane efflux protein signal peptide no TMHS"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0246"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92863"
FT                   /db_xref="GOA:A1K208"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A1K208"
FT                   /protein_id="CAL92863.1"
FT                   /translation="MPLKTLAVALAAASLGACSTLAPDYERPAAPVAAAWPAEPAQPAA
FT                   GTPSADAVAWRSFFADERLRQVVDLALANNRDLRVSALNIERARALYQIQRAELVPWIG
FT                   VGGGQSAQRLPADLTQRGEPTISRQYSATVGFSSYELDFFGRIRSLRDAALEQYLATED
FT                   ARRSAQISLVAEAANAWLTLAADRERLDLARRTYETQQQSYELTKKSFDFGAVSAIDLR
FT                   QAQTARESARADLAAYTTQVARDINALNLVAGAAVPDELLPTALTDKVSAVGDLPAGLP
FT                   SEVLVSRPDILAAERQLRAAYANIGAARAAFFPSITLTAAAGTASASLEGLFKAGSGTW
FT                   SFAPQINLPIFQGGRLLANLQVAKVDREIAVADYEKAIQSAFREVADALAERANVGEEL
FT                   DARRALVEATAETYRLSEARYRSGVDSYLGLLDAQRTLYSAEQGLISVRLADAANRVAL
FT                   YRVLGGGAQ"
FT   CDS_pept        276172..276657
FT                   /transl_table=11
FT                   /gene="bfr1"
FT                   /locus_tag="azo0247"
FT                   /product="putative bacterioferritin"
FT                   /function="Bacterioferritin (cytochrome b1)"
FT                   /note="Bacterioferritin (BFR) (Cytochrome B-1) (Cytochrome
FT                   B-557). In E. coli is an iron-storage protein consisting of
FT                   24 identical subunits that pack together to form a highly
FT                   symmetrical, nearly spherical shell surrounding a central
FT                   cavity of about 8 nm diameter.X-ray crystallographic
FT                   studies have revealed a close structural similarity between
FT                   BFR and the ferritins, a family of iron-storage proteins
FT                   found in both eukaryota and prokaryota. Key role in iron
FT                   homeostasis. InterPro: Bacterioferritin. Non-secretory
FT                   protein"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0247"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92864"
FT                   /db_xref="GOA:A1K209"
FT                   /db_xref="InterPro:IPR002024"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A1K209"
FT                   /protein_id="CAL92864.1"
FT                   /translation="MKGKTPVISALNALLVDELAARDQYFIHSRMLAEWGLHHAAERIA
FT                   HEMEDETQHASDLICRILFLEGIPAMTPAAITVGADLPDIFAKDLAVEYKVVDNLRAAM
FT                   ALCEAEQDYVTRDILLKMLADTEEDHAHWLEQQLRLISLVGLQNYLQSQMKTGTPGS"
FT   CDS_pept        276847..277365
FT                   /transl_table=11
FT                   /gene="dksA1"
FT                   /locus_tag="azo0248"
FT                   /product="probable dnaK suppressor protein"
FT                   /function="DnaK suppressor protein"
FT                   /note="Probable dnaK suppressor protein,"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0248"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92865"
FT                   /db_xref="GOA:A1K210"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:A1K210"
FT                   /protein_id="CAL92865.1"
FT                   /translation="MNARAALPAVFGNFIPAWFHQPAGSKREDFSMNDVLTPLMTEAEL
FT                   RAAPEDDYMSPRQLAFFRALLEKEMKTLLEAAHETTTHLQENAATPDPADRASVEEEHT
FT                   LELRVRDRERKLLKKIEEAIARIDDGSYGWCEETGEPIGIGRLLARPTATLSLEAQERR
FT                   EKLKKMHGG"
FT   CDS_pept        277409..277567
FT                   /transl_table=11
FT                   /locus_tag="azo0249"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical protein. No homology to the data bank.
FT                   No domains predicted. No signal peptide. No TMHS"
FT                   /db_xref="EnsemblGenomes-Gn:azo0249"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92866"
FT                   /db_xref="UniProtKB/TrEMBL:A1K211"
FT                   /protein_id="CAL92866.1"
FT                   /translation="MRCAPARLLPQRLLPGRRIVLNIPARDRRALSLLPSSALSRAVPR
FT                   EPVRRPY"
FT   CDS_pept        complement(277561..278289)
FT                   /transl_table=11
FT                   /locus_tag="azo0250"
FT                   /product="hypothetical flavodoxin reductase"
FT                   /function="Flavodoxin reductases (ferredoxin-NADPH
FT                   reductases) family 1"
FT                   /note="Hypothetical flavodoxin reductase. Homology to the
FT                   N-terminal part of bb4317 of B. bronchisptica of 40%
FT                   (trembl|Q7WFF6). InterPro: Oxidoreductase FAD and
FT                   NAD(P)-binding domain ((IPR001433); NADH: cytochrome b5
FT                   reductase (CBR) (IPR001834) Pfam: Oxidorectase FAD-binding
FT                   domain; Oxidoreductase NAD-binding domain no signal peptide
FT                   no TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:azo0250"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92867"
FT                   /db_xref="GOA:A1K212"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A1K212"
FT                   /protein_id="CAL92867.1"
FT                   /translation="MSASMPSRPPPSDRIPVRVRSVRDEARDIRSLEFEAVRGGDLPPW
FT                   PPGAHVLVYPPACPPRAYALCSLPGEAATYRIAVRRDAGTGNTPAQLHALHPGDQLAVS
FT                   APHSSFALDEGAERHLLVAGGIGIAPLLSMFRALERGGAEAELHYFARSEDDAAFLAEL
FT                   EGARARGTLHCHFGLSGGATAARLQDLFATAAQRPGAGAGLAIYTCGPAGLMRAVDVAA
FT                   AANLHAAQLRQQHFGPTLDQ"
FT   CDS_pept        278417..279895
FT                   /transl_table=11
FT                   /locus_tag="azo0251"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="Conserved hypothetical membrane protein, 38%
FT                   similarity to trEMBL;Q7WDT1,Putative membrane protein
FT                   [BB4906] [Bordetella bronchiseptica (Alcaligenes
FT                   bronchisepticus)]. TMHMM2 predicts 6 TMH's present. No
FT                   signal peptide present."
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0251"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92868"
FT                   /db_xref="GOA:A1K213"
FT                   /db_xref="InterPro:IPR021296"
FT                   /db_xref="UniProtKB/TrEMBL:A1K213"
FT                   /protein_id="CAL92868.1"
FT                   /translation="MSVRPPSLSQSPAAPDAVDAAARASFHARWLAEVVRRHEEAHGAL
FT                   PDEAELTAARRAPPRFEDRLLARARLLAAREGWDADLARLARRLRVGAAAALVAAFVVG
FT                   WAAGAAVLGDGGRAVNVVWALGGVLGAHLVGLLVWLGAVAFGLRRGQGGGAWLARAGRA
FT                   AANLLDHGARAGPAAAALFGLLGRGGGLPWAAGLLNHLLWAAALGGAAGSMLLLFATRR
FT                   YGFVWETTILPVGLFVELGSALGRLPAALGFPVPDSTALAAAGVPASAVGDGAAGRGWA
FT                   GWLIGCVLLYGVLPRLLLAGLCAALLRRAVAAVRLDEDQPGHAALRARLLPDSERLGIH
FT                   DADHSGAPPRAPAAPAGGEGALALALELGDDLDWPPPFGAGDIASAADPRCAPRRLDSR
FT                   EQRQAWLAAVRARPPQRLLVAVDARQTPDRGSLGTLVELAACAGCLRVWTLPGSAAGRL
FT                   AQWRTALAERDLATADRAVLTDADAARRWLETGA"
FT   CDS_pept        279963..281318
FT                   /transl_table=11
FT                   /locus_tag="azo0252"
FT                   /product="conserved hypothetical protein"
FT                   /note="conserved hypothetical protein, 54% identity to
FT                   TrEMBL;Q9JYD1 Hypothetical protein NMB1644 [NMB1644]
FT                   [Neisseria meningitidis(serogroup B)]. Has
FT                   PF00009:Elongation factor Tu GTP binding domain:IPR000795
FT                   ProtSyn_GTPbind: This domain contains a P-loop motif, also
FT                   found in several other families such as Ras, Arf and
FT                   Myosin_head. Elongation factor Tu consists of three
FT                   structural domains, this plus two C-terminal beta barrel
FT                   domains. Elongation factors belong to a family of proteins
FT                   that promote the GTP-dependent binding of aminoacyl tRNA to
FT                   the A site of ribosomes during protein biosynthesis,and
FT                   catalyse the translocation of the synthesised protein chain
FT                   from the A to the P site. The proteins are all relatively
FT                   similar in the vicinity of their C-termini, and are also
FT                   highly"
FT                   /db_xref="EnsemblGenomes-Gn:azo0252"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92869"
FT                   /db_xref="GOA:A1K214"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR021871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1K214"
FT                   /protein_id="CAL92869.1"
FT                   /translation="MSLLRIAVVGHTNTGKTSLLRTLARDAGFGEVSDRAGSTRHVEGL
FT                   RLFADGEAVIELFDTPGMEDAIALLEHLEGLAGPGERIDGPERVARFLAGAEAAGRYEQ
FT                   EAKVLRQLLASDAGLYVVDARDPVLPKHRDELAILAGCARPLLPVLNFVRAADARPQAW
FT                   REALARLGLHAVVSFDTVAPARDGERLLFEALATLLHGGRGPLARLLAARAREALARQH
FT                   AAQRLGAALLVQLAALRVTVAAEPTAIAAATETLQAAVRAREQACVEALLALYRFRADD
FT                   LSAPALPLVAGRWASDLFNPESLRQLGVRVGGGAAAGAAAGVGVDLLAGGLTLGAAAAL
FT                   GALAGSVLQVAGGYRERLLARVRGQRELTVDDAVLRLLALRLHALVEALEGRGHAALDP
FT                   IRLADPGARRWREAALPAELRRARSHPEWARGEGPGYEAAVQALADAEAAPG"
FT   CDS_pept        complement(281341..282051)
FT                   /transl_table=11
FT                   /locus_tag="azo0253"
FT                   /product="conserved hypothetical protein"
FT                   /note="Conserved hypothetical protein. Homology to MCA0921
FT                   of Methylococcus capsulatus of 54% (trembl:Q60AE3). N
FT                   domains predicted. No TMHs. NO signal peptide."
FT                   /db_xref="EnsemblGenomes-Gn:azo0253"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92870"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1K215"
FT                   /protein_id="CAL92870.1"
FT                   /translation="MSSAFRKRLLDAATAPYRPAGHFAWHFARGKLGRDPIFFSLLRHG
FT                   LIPDPATVLDLGCGQGLLSNWITAAARLHDEGRWPADWPPPPRLQGYRGIELMQNDVDR
FT                   ALPALPPGAVVEQGDMRHADYGEANVVFILDCLHYVDIAAQDAVLARVRDTLAPRGRLI
FT                   MRVGDAGAGLPFHLCSWVDRVVTFVRGHRLGTLHCRPVTAWQATLEGLGFRVQTMPMDA
FT                   GTPFANTMLVGSLD"
FT   CDS_pept        complement(282048..282746)
FT                   /transl_table=11
FT                   /locus_tag="azo0254"
FT                   /product="conserved hypothetical polysaccharide
FT                   deacetylase"
FT                   /note="Conserved polysaccharide deacetylase. Homology to
FT                   rs03397 of R. solanacearum of 62% (trembl|Q8Y2A8).
FT                   Interpro: Polysaccharide deacetylase (IPR002509). Pfam:
FT                   Polysaccharide deacetylase (PF01522). The family of
FT                   polysaccharide deacetylases includes NodB (nodulation
FT                   protein B from Rhizobium) which is a chitooligosaccharide
FT                   deacetylase. It also includes chitin deacetylase from
FT                   yeast, and endoxylanases which hydrolyses glucosidic bonds
FT                   in xylan. No signal peptide. No TMHs"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0254"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92871"
FT                   /db_xref="GOA:A1K216"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A1K216"
FT                   /protein_id="CAL92871.1"
FT                   /translation="MLAALALNHAALTAAGLWPRSRLLGPNWTRLPAAAAARGEIALTI
FT                   DDGPDPEVTPQVLAQLAAAGARATFFLIGENAARHPQLVADILRAGHEVQNHSQWHRKT
FT                   FSLFGPRRMERDVAAAQHTLTGLGAPLPRFFRAPAGLRNPFLEPVLARHGLTLASWTRR
FT                   AFDTREGEPAAVLARLTRGLGPGDILLLHDGHAARSPGGRAVILEVLPRLLDAVRTAGL
FT                   HPVTLTAALR"
FT   CDS_pept        complement(282948..283649)
FT                   /transl_table=11
FT                   /locus_tag="azo0255"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical protein. No good homology to the data
FT                   bank. No domains predicted. No TMHs. No signal peptide."
FT                   /db_xref="EnsemblGenomes-Gn:azo0255"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92872"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1K217"
FT                   /protein_id="CAL92872.1"
FT                   /translation="MSTLQPPPPPPPRARLDQHIVRAGAEPAADVLVLLAGAYDGPADF
FT                   IAAGFADARAARGLALDLVLVESDLAAVCDGSLAHRLQHEVIAPARAAGATRVHTGGIS
FT                   IGALTALMHADACPDEAASLVLLAPYPGNRAISGEIAGAGGLAQWTPAADYPPNDERRG
FT                   WRALQRIAAAGAPPVWLGYGSEDRFARGHALMGAMLPAGAHCRHPGGHDWPTWTALWDH
FT                   ALTWLAPRLHR"
FT   CDS_pept        complement(283646..286057)
FT                   /transl_table=11
FT                   /locus_tag="azo0256"
FT                   /product="conserved hypothetical membrane protein"
FT                   /function="predicted exporter"
FT                   /note="Conserved hypothetical membrane protein. Homology to
FT                   rsc0429 of R. solanacearum of 52% (trembl|Q8Y2A7). Tigrfam:
FT                   2A0604s01: protein-export membrane protein signal peptide
FT                   10 TMHs"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0256"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92873"
FT                   /db_xref="GOA:A1K218"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A1K218"
FT                   /protein_id="CAL92873.1"
FT                   /translation="MSRRPRLAALTIWLAVMAVLALIIARSQFTADMSVFLPRNPTPEQ
FT                   RLLVDQLRDGMVSRLILVGISGGNAETRGRVSQAMAAALHGDARFVSVNNGESGALQEE
FT                   QRWLFDNRYLLSPAVTPARFSTDGLRAALTDTLNLLASPAGMLVKPLVTRDPTGELMQL
FT                   LQRLDPGTQPARDPAHGVWITRDGETALMLALTRAAGSDIDAQEAAMGALQREFETARG
FT                   SAAAATPLRLEMTGPGVFAVESRATIKREVERIAVLGAVLTVGFLLAVYRSLTVLLLGM
FT                   LPVVTGTLAGVAAVSLGFGVVHGLTLGFGTTLIGEAVDYAIYLFVRAGRGPGTAAEDDD
FT                   PDEGRDGFWATIRLGLLTSVAGFAALFASGFPGLAQLGLYSIAGLIAAVLVTRYLLPTL
FT                   LPADFRLRDVRPLGLRLAALANAAGRLPWLVVALAAGAAAVLALRHDGLWNSELLALSP
FT                   VPMRQQELDMRLRTEMGAPDVRYLVVVDGADTETTLRAVEALAPRLDALQADGVIAGWD
FT                   APTRYLPSLATQAARRAALPAREELAARLHAATAGLPLRAERLTPFLDEIDAARQRPPL
FT                   TPESMAGSSLGLAVQAMLIHTEGGVRALLPLRAPEDGTDLIDAGRVRAALAGAGDGSAP
FT                   LFLDLKQESDALYANYLREAIRLALGGVAAVVVLLLVFLRSPRQVLRVVTPLAAAVLVV
FT                   TAGLALAGKQLILLHLVGMLLIVAVGSNYTLFFNRADGRMAAPRTLASLFFANCTTVCA
FT                   FGLLAFSEVPVLQAIGITVGPGAVLALVFSAMLGSRGDARAALPAPACGR"
FT   CDS_pept        complement(286054..286632)
FT                   /transl_table=11
FT                   /locus_tag="azo0257"
FT                   /product="conserved hypothetical secreted protein"
FT                   /note="Conserved hypothetical secreted protein. Homology to
FT                   RS03399 of R. solanacearum of 47% (trembl|Q8Y2A6(SRS)) No
FT                   domains predicted. Signal Peptide present. No TMH
FT                   reported."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0257"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92874"
FT                   /db_xref="GOA:A1K219"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:A1K219"
FT                   /protein_id="CAL92874.1"
FT                   /translation="MSRFLSAALLALAFAFTPPPVAAAAWDVPQLMTLLAANGGGRVRF
FT                   TETRHLAMLDAPLVATGELVYVPPARLERHTETPVRETMVLDGDTLSLTREGRNHSLKL
FT                   RDYPEAAALIESIRATLAGDRKALERTYALSLSGSAAQWALDLLPSDPAVTKVVLRIRV
FT                   SGSRGEVRGVEIQQADGDRSVMHIEPPAR"
FT   CDS_pept        complement(286629..287561)
FT                   /transl_table=11
FT                   /locus_tag="azo0258"
FT                   /product="conserved hypothetical acetyltransferase"
FT                   /function="predicted acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="Conserved hypothetical acetyltransferase. Homology
FT                   to rsc0431 of R. solanacearum of 61% (trembl|Q8Y2A5) Pfam:
FT                   Bacterial lipid A biosynthesis acetyltransferase no signal
FT                   peptide no TMHs"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0258"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92875"
FT                   /db_xref="GOA:A1K220"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR014548"
FT                   /db_xref="UniProtKB/TrEMBL:A1K220"
FT                   /protein_id="CAL92875.1"
FT                   /translation="MSVHSTPGQGSTGTEWAQRPERSNMLLLRVMAWISLRLGRPAGRL
FT                   VLHLITTYFVLFTPSARRASRAYLGRALGRPARLADGYRHVHCFASTIHDRLYLLKDRF
FT                   DLFDIRIEGEALIEEVVASGRGALLFGAHLGSFEVIRAVGRHQPDLRIALAMYEDNARR
FT                   INTLLAAINPAARPEVIALGRLDAMLKVRARLAQGALVGVLADRSLESEDRVSLPLLGS
FT                   PAALPAGPFRMAAMLEARVVFMAGLYHGGNRYTIRFLPIADFAGVARDGREAAIAAAMR
FT                   RYADALETCCREAPSNWFNFFDFWGDADR"
FT   CDS_pept        complement(287558..287869)
FT                   /transl_table=11
FT                   /locus_tag="azo0259"
FT                   /product="conserved hypothetical protein"
FT                   /note="Conserved hypothetical protein. Homology to xac 4098
FT                   of X. axonapodis of 36% (trembl|Q8PF87). No domains
FT                   predicted. No signal peptide. No TMHs."
FT                   /db_xref="EnsemblGenomes-Gn:azo0259"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92876"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR016962"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A1K221"
FT                   /protein_id="CAL92876.1"
FT                   /translation="MSGSRTLAIAADHPAFAGHFPGRPIVPGVVLLDEAVQALEAEFAL
FT                   PPTCWKLASAKFLSPVGPGDVVTLSWQAPAASGAIAFRLACGERAVASGTLAPPDAAR"
FT   CDS_pept        complement(287866..289215)
FT                   /transl_table=11
FT                   /locus_tag="azo0260"
FT                   /product="conserved hypothetical protein"
FT                   /function="Acyl-coenzyme A synthetases/AMP-(fatty) acid
FT                   ligases"
FT                   /note="Entry name:- TREMBL:Q87EI7 InterPro:- IPR000873;
FT                   AMP-bind. Pfam:- PF00501; AMP-binding; 2. Identity :- 45%
FT                   Prediction: Non-secretory protein Signal peptide
FT                   probability: 0.000 Number of predicted TMHs: 0"
FT                   /db_xref="EnsemblGenomes-Gn:azo0260"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92877"
FT                   /db_xref="GOA:A1K222"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1K222"
FT                   /protein_id="CAL92877.1"
FT                   /translation="MLPLVTHTSPDAVVARRHGEAITVRHFLADVRKVAAALPAGRHVL
FT                   NACTDRYRFAVGFAAGMVAGKISLLPSTYTPDTLRHLAAFAPDTTVLTDGDVADLPLPA
FT                   MPFPALLDAAAVPAGACDIPCIASEQLVAWVFTSGSTGSPVPHPKTWGRLVVNVQAEGV
FT                   ALGLDPAHPATLVGTVPPQHMYGFESTVLVALQSGAAFDAGRPFYPADIVAALQRAPAP
FT                   AALVTTPFHLRTLLDEGIPVPPAALVVSATAPLPVELAVAAEAAFGAPLLEIYGSTETG
FT                   QIATRRSAQGEAWTLFPGIELAPRDDGHTWASGGHIERAVPMSDVIEQVGARRFLLRGR
FT                   NADLVNIAGKRTSLGYLNQQLLSIPGVRDGAFYLPDDSGGAHIVRLAAFVVAPTLDAAT
FT                   LQAALRERIDAVFLPRPVVWLDALPRNATGKLPRETCAALLAAHAERRAR"
FT   CDS_pept        complement(289232..289885)
FT                   /transl_table=11
FT                   /locus_tag="azo0261"
FT                   /product="conserved hypothetical membrane protein"
FT                   /function="predicted membrane protein"
FT                   /note="Conserved hypothetical membrane protein. Homology to
FT                   rsc3402 of R. solanacearum of 46% (trembl|Q8Y2A3(SRS)) no
FT                   domains predicted signal peptide 5 TMHs"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0261"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92878"
FT                   /db_xref="GOA:A1K223"
FT                   /db_xref="UniProtKB/TrEMBL:A1K223"
FT                   /protein_id="CAL92878.1"
FT                   /translation="MTTPLRFGRAALAAVAFAAYLLLAHHTTASGQHPTLGALLAVVPY
FT                   MAAALAMAARARHRGFALALWALGAALLWRQWPVVEARFEWVYLIQHVGTFGLLAIGFG
FT                   RSLGGEPMITRFARLVHGAELALPLVRYTRGATAAWALFFAAMTTASLLLFFGGPLPLW
FT                   SLLVNILTPLLVALMFAAEFLVRRLLLPPGLRTGLVESVRACMHAGRRASPPAA"
FT   CDS_pept        complement(289885..290169)
FT                   /transl_table=11
FT                   /locus_tag="azo0262"
FT                   /product="hypothetical protein"
FT                   /function="Acyl carrier protein"
FT                   /note="Similar to TREMBL:Q9PFA7 (61% identity);
FT                   TREMBL:Q87AD9 (61% identity); SWISSPROT:Q7VKH6 (34%
FT                   identity)."
FT                   /note="Function unclear"
FT                   /note="ORF1"
FT                   /db_xref="EnsemblGenomes-Gn:azo0262"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92879"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A1K224"
FT                   /protein_id="CAL92879.1"
FT                   /translation="MTHTAPASADAALLAEVAALIVTALNLEVRAEDIEPDAPLYGEGL
FT                   GLDSIDILEVALVVSKRYGFSLRADNEDNLKIFASLRSLGDYIATHRVQ"
FT   CDS_pept        complement(290292..291683)
FT                   /transl_table=11
FT                   /locus_tag="azo0263"
FT                   /product="probable two-component system histidine kinase"
FT                   /function="Signal transduction histidine kinase"
FT                   /EC_number="2.7.13.1"
FT                   /note="Probable sensor protein,"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0263"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92880"
FT                   /db_xref="GOA:A1K225"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1K225"
FT                   /protein_id="CAL92880.1"
FT                   /translation="MSADALPLPGWSLKRRLLGLLLLVAGGVSALTIVLAYRAAHTEAE
FT                   HAFDAQLVVVAETLMAIAADAGVDYAEHELSEHAYPDTLPVAYQVWGRQDGRVSLLLRS
FT                   ASAPATAMTVHEGLSDGERDGRRWRHYLLRRGDFAVIAGQDHAGRDALARELTLRILLP
FT                   FLLALPLLAAAIWLTVGRALQPVAALAAEVEAMKPDGLNPVGLADPPPQEIAPLLQALN
FT                   RLIGRMAAALAGEQRFTADAAHELRTPLAALRIQAQVAARAGEDSAARERALDQVIAGV
FT                   DRMTHLVDQLLTLARLEPAAAQPAFAPVDLAAVAEAAVAALAPRSAARKQHVECALAPA
FT                   TVSGNAVWLGILARNLIDNALRYAPPGSHIRVRTAREGMRCVLEVSDDGPGLEPGARDS
FT                   LRARFARGVAADGEGCGLGLSIVGRIVELHGGEFRLGDGLPRSAPAGVGLAATVVLAAA
FT                   SPSPR"
FT   CDS_pept        complement(291680..292336)
FT                   /transl_table=11
FT                   /gene="qseB1"
FT                   /locus_tag="azo0264"
FT                   /product="transcriptional regulatory protein"
FT                   /function="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /note="Transcriptional regulatory protein,"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0264"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92881"
FT                   /db_xref="GOA:A1K226"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A1K226"
FT                   /protein_id="CAL92881.1"
FT                   /translation="MRILLVEDDALLGDGLQAGLRLAGFNADWVRSAEAAETALALEHF
FT                   SAVVLDLGLPGRDGNSLLAALRQRHDDIPVLILTARDAVADKVRGLDLGADDYMVKPVD
FT                   LDELAARLRAALRRAGGRASGVIRHGEVELDPAARRVRRAGAEVALTSREFDLLYVLLS
FT                   RAGTVLTRRMLDEQLYAWDEGAESNTLEVHIHHLRRKLGADLIHTVRGVGYTVPA"
FT   CDS_pept        292491..292763
FT                   /transl_table=11
FT                   /locus_tag="azo0265"
FT                   /product="conserved hypothetical secreted protein"
FT                   /note="Conserved hypothetical secreted protein. Homology to
FT                   bd0091 of B. bacteriovorus of 52%
FT                   (tremblnew|CAE77770(SRS)). no domains predicted. signal
FT                   peptide. no TMHs."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0265"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92882"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:A1K227"
FT                   /protein_id="CAL92882.1"
FT                   /translation="MKTRSAFVVLAACTLSTVALAGPQCTEAPKSQWLPEEAMKQKISA
FT                   AGYTVDKFKVTSGNCYEIYGKDKDGKKVEIYYNPVDGSVAREKRG"
FT   CDS_pept        292777..293298
FT                   /transl_table=11
FT                   /locus_tag="azo0266"
FT                   /product="conserved hypothetical cytochrome b561 family
FT                   protein"
FT                   /function="Cytochrome b"
FT                   /note="Conserved hypothetical cytochrome b561 family
FT                   protein. Homology to rsc2354 of R. solanacearum of 43%
FT                   (trembl|Q8XWW6). Involved in electron transfer from
FT                   hydrogen to oxygene. Pfam: Nickel-dependen hydrogenase
FT                   b-type cytochrome no signal peptide probable 4 TMHs"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0266"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92883"
FT                   /db_xref="GOA:A1K228"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A1K228"
FT                   /protein_id="CAL92883.1"
FT                   /translation="MGIERVKVWDLPVRLFHWSLVAAFLTAWLSADDAETLHQGAGYCA
FT                   LGLVAFRVLWGFVGCRHARFVDFVPSPQGLFGYLRAALRGQEPRFRGHNPAAAVMILFL
FT                   LAMIGVIGATGWAMTTDWGWGADWLEEIHEAAAHLTLAAVAVHVAAAIYGSWHHRENLV
FT                   RAMVDGYKRL"
FT   CDS_pept        293415..294473
FT                   /transl_table=11
FT                   /gene="czcB"
FT                   /locus_tag="azo0267"
FT                   /product="putative membrane fusion protein"
FT                   /note="Putative membrane fusion protein. Homology to cnrb
FT                   of A. eutrophus of 30% (pir|F47056). Proteins of the MFP
FT                   family function as auxiliary proteins or
FT                   'adaptors',connecting a primary porter in the cytoplasmic
FT                   membrane of a Gram-negative bacterium with an outer
FT                   membrane factor protein that serves a porin or channel
FT                   function in the outer membrane. In A. eutrophus is this
FT                   protein involved in cobalt and nickel resistance. No
FT                   domains predicted. No signal peptide No TMHs"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0267"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92884"
FT                   /db_xref="GOA:A1K229"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A1K229"
FT                   /protein_id="CAL92884.1"
FT                   /translation="MSFSVAAPVAAAEAVVLDAARLTAAGIELAPVQAAGAASLAHLPA
FT                   RVVVPSAQQRFVAAPVAGLVAAVLVGSGETVRAGQPLARIASPELLALRRDLTQAGAEQ
FT                   ERARLALQRDQQLHAEGLIPAARLEATRAAAAQAGAALAERRALLGLSGGASEGGGELT
FT                   IVAPIAGVVLAQPAQPGMRVEAAAPLFHIARLDPLALEVDLPPALAAQLKPGLRVRVPA
FT                   GGAEGRVVAVGRAVSGAQTVTVRALLDRGLGALGPGQNVEVEIERGGDAAAGAAPVWAV
FT                   PASALVRLGEDGGGSAVFVRRGDAFVPVPVSVLGEQGGNAVLRGELHADERVAVRGASL
FT                   LKAAAMGIGKGE"
FT   CDS_pept        294470..297574
FT                   /transl_table=11
FT                   /gene="czcA2"
FT                   /locus_tag="azo0268"
FT                   /product="putative cation efflux system protein"
FT                   /function="Putative silver efflux pump"
FT                   /note="Cobalt-zinc-cadmium resistance protein CzcA (cation
FT                   efflux system protein CzcA). In A.eutrophus has a low
FT                   cation transport activity for cobalt, it is essential for
FT                   the expression of cobalt, zinc, and cadmium resistance.Czca
FT                   and Czcb together would act in zinc efflux nearly as
FT                   effectively as the complete czc efflux system
FT                   (czcABC).Belongs to the acrb/acrd/acrf family. 41%
FT                   similarity to the A.eutrophus CzcA protein.
FT                   SWISSPROT:CZCA_ALCEU:P13511 InterPro: Heavy metal efflux
FT                   pump CzcA. InterPro:IPR001036; Acrflvin_res.IPR004763:
FT                   CzcA. Pfam:PF00873; ACR_tran; 1. InterPro:TIGR00914:Heavy
FT                   metal efflux pump CzcA InterPro:PF00873:Acriflavin
FT                   resistance protein Signal peptide: present."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0268"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92885"
FT                   /db_xref="GOA:A1K230"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A1K230"
FT                   /protein_id="CAL92885.1"
FT                   /translation="MSVLARLVEFSLTQRLLVLVLTALLVGAGAMALRSLPIDAFPDVS
FT                   TTQVKIIVKAPGMTPEEVEARITVPIEQELLGIPAQRMLRAVSKYGITDITVDFDDGTD
FT                   IYWARQQVSERLDAAMSGLPAQASGGLAPITTPLGEMFMFTIEGPLSLEEKRTLLDRVI
FT                   RPQLRTIRGVADVNSLGGHVRSYEVVPNPQLLAARGLGLNLLREAIERNNRNDGAGRLG
FT                   DGEETLIVRAEGAVNEPADLAAVVVATRDGVPVRLGDVAEVRIGSLTRYGAVTRDGAGE
FT                   TVQGLVLGLRGANAQAVIAGVKARLAELAPSLPPGVSIVPFYDRSALVDRAVGTVSKAL
FT                   FEAIALVVVLLLAFLGNLRAALVVALTLPLAALGTFILMRYTGVSANLMSLGGLAIAIG
FT                   MLVDAAVVVVENVETQLAADGVQARLPLLHVVYRAVREVALPVASGIAIIIIVFVPLLT
FT                   LQGLEGKLFVPVALSIVYALASSLVLALTVIPVLASLLLKRGEAHTPWLVRRLDAAYAP
FT                   ALDWALANARTVIAVALLSLALAAAGYAFVGKTFMPTMDEGDLIMQLEKLPSIGLEQTI
FT                   AVDSRVQRTILEQVPEVKSVVARSGSDELGLDPMGLNQTDSFLVLKPVAEWRQPDKAWL
FT                   TDELRRVVAEFPGIDVTFTQPIDMRVSEMLTGVRGDIAIKVFGTDLAALGRAAGEIEAL
FT                   LAAMDGAEDVFTAKNEGVQYLRVEIDHLAAGRLGLSVDDVQSALRSLVEGEQAGAVIEA
FT                   GRRVPILIRADEGVRASASRFADLRLALPGGGAVPLSAVARLERVAGPVKVDRENGSRY
FT                   VTVQSNVRGRDLVGFVEEAQARVAATVKLPAGYRLEWSGQFENQQRAAARLAVVVPVAL
FT                   LLIFLLLFSTFGSVRQAALVLANVPFALVGGVFALLLAGEYLSVPASVGFIALLGIAVL
FT                   NGVVMVTYFNQLIEQGMPLARVVVEGARRRLRPVLMTASIAAFGLVPLLFATGPGSEIQ
FT                   RPLAIVVIGGLISSTLLTLLLLPILFRRFGMDRAPALSAPEALLP"
FT   CDS_pept        297571..297885
FT                   /transl_table=11
FT                   /locus_tag="azo0269"
FT                   /product="conserved hypothetical protein"
FT                   /note="Conserved hypothetical protein.30% identical to
FT                   TrEMBL; Q89MS9. Signal Peptide present."
FT                   /db_xref="EnsemblGenomes-Gn:azo0269"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92886"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR021634"
FT                   /db_xref="UniProtKB/TrEMBL:A1K231"
FT                   /protein_id="CAL92886.1"
FT                   /translation="MTATPDTLLTLVAPAALEDKLVDLLLALPGMASGFTTHPASGHGR
FT                   EIALVGANENVRGRGARVCVRLALQSAALQPLLGEVRAALPDANIFYWVTPLLDCGRVS
FT                   "
FT   CDS_pept        297885..299159
FT                   /transl_table=11
FT                   /locus_tag="azo0270"
FT                   /product="hypothetical secreted protein"
FT                   /note="Hypothetical secreted protein. Homology to cnfc of
FT                   Ralstonia sp CH34 of 28% (tremblnew|CAB82451(SRS). Pfam:
FT                   outer membrane protein. Interpro: Type I antifreeze protein
FT                   (IPR000104). singal peptide. no TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:azo0270"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92887"
FT                   /db_xref="GOA:A1K232"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A1K232"
FT                   /protein_id="CAL92887.1"
FT                   /translation="MAAFLSRRGAVLAPLAALMLALPARAADYPAELPPLPMLQAAIEA
FT                   APEVRAAEALREGGEAERRQLAAGPYEWTLNADYGRRRTREAGVTARTGEWEVALERPL
FT                   RLPGKAGLDERLGDLKVKAAELGLADARHETARALLAAWYDWLREQAGAGVLRAQAEAA
FT                   AREAAAVTRRAELGDASRLDAMQAEAAAAQAAAAARLGEGRAAAAAAGLRQRYPQLALP
FT                   ARPPLPDPAPPGADLQELVELALEHDHGLLLARSAAARAEAESQRAAAQRRPDPTFGVR
FT                   YGRERDSAEHMVGAYVAIPLGGSYRNATADMARASAAAAAEQANAAERRLAGELRARHE
FT                   MVIATHDHWRLAEDSAARLAAAAERLALAQRLGEAPLAEVLLARRQALEAALQASGARV
FT                   DALAEQASLRLAAHRLWADGEDHGE"
FT   CDS_pept        complement(299301..300887)
FT                   /transl_table=11
FT                   /locus_tag="azo0271"
FT                   /product="conserved hypothetical protein"
FT                   /function="Fe-S oxidoreductase"
FT                   /note="Conserved hypothetical protein. Homology to
FT                   Daro03000974 of Dechloromonas aromatica of 68%
FT                   (gi|46140980|ref|ZP_00152750.2|(NBCI ENTREZ)). Pfam:
FT                   Elongator protein 3, MiaB family, Radical SAM. This
FT                   superfamily contains MoaA, NifB, PqqE, coproporphyrinogen
FT                   III oxidase, biotin synthase and MiaB families, and
FT                   includes a representative in the eukaryotic elongator
FT                   subunit, Elp-3. Some members of the family are
FT                   methyltransferases; Pfam: B12 binding domain. This domain
FT                   binds to B12 (adenosylcobamide), it is found in several
FT                   enzymes, such as glutamate mutase Q05488, methionine
FT                   synthase Q99707 and methylmalonyl-CoA mutase. no signal
FT                   peptide. no TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:azo0271"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92888"
FT                   /db_xref="GOA:A1K233"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="UniProtKB/TrEMBL:A1K233"
FT                   /protein_id="CAL92888.1"
FT                   /translation="MPGQPDFTLLANRMAPIGILQLASWLEKHGHPTQLHDCMGPYAPA
FT                   SLEANVAQIIATKPELVGFSATTSGFMDAVDMAEQIKQKLPHVKTFFGNVHTSSIGAPL
FT                   LEHFPEIDYLCIGEGEGAILDVANGMAPKDIANIIYRDDAGRAVINERRTRILDLDELP
FT                   FPAYEKLAGFPHGYHLPLFSYEKRWGATMITSRGCPYTCSFCDRTVYERLYKYNSAQYV
FT                   HDHIRHLRDTFGVHHINIYDDLFTAHKKRIHELCELLIAKPLGVDFNCAIRTGHTSDEM
FT                   LALLKRAGALMVSMGIESADPGMMERHKTGVTLEAVKKTVEQIHTAGLRAKGLFIFGLP
FT                   GETPETLKKTSDFILELDLDEMNMTKFSPMYGAPIWDECVSGKEGDFNEDWRLMNCLNF
FT                   VFKPNGFESREQMDALYNWHVRRYYDSKAYRRRFSKRIWQHRWSLWHLLKNAPRVIQAA
FT                   RYFSANKAQIEAAARDFAPHPRQPRGLQPFLSPELQADALAAMSPVKISRKPKPKVEDA
FT                   TAIAAPRIQAA"
FT   CDS_pept        complement(301090..301368)
FT                   /transl_table=11
FT                   /locus_tag="azo0272"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical protein. No homology to protein of
FT                   similar size in the data bank. No domains predicted. No
FT                   signal peptide. No TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:azo0272"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92889"
FT                   /db_xref="UniProtKB/TrEMBL:A1K234"
FT                   /protein_id="CAL92889.1"
FT                   /translation="MNTPSPADPLRKRLRALPPPAAGTALRARLLADADARLPHPAAWW
FT                   QPLWRTGLAAMAVVAVCAFGVNEYLAWQEIQELAELDTLSTATMLLL"
FT   CDS_pept        complement(301346..301972)
FT                   /transl_table=11
FT                   /gene="sigW"
FT                   /locus_tag="azo0273"
FT                   /product="putative ECF-family RNA polymerase sigma factor"
FT                   /function="DNA-directed RNA polymerase specialized sigma
FT                   subunit sigma24 homolog"
FT                   /note="Putative RNA polymerase sigma factor, Myxococcus
FT                   xanthus carQ; Alcaligenes eutrophus plasmid pMOL28-encoded
FT                   cnrH; Escherichia coli fecI; Pseudomonas syringae hrpL;
FT                   rpoE from Escherichia coli, Salmonella typhimurium and
FT                   Haemophilus influenzae; Streptomyces coelicolor sigE; and
FT                   Bacillus subtilis sigma factors sigV, sigX, sigY and sigZ."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0273"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92890"
FT                   /db_xref="GOA:A1K235"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A1K235"
FT                   /protein_id="CAL92890.1"
FT                   /translation="MSLAALLPASWRADATLLAAALDGDRRAVAALVDRLAPQGHALAW
FT                   RLTGSRAEAEDAVQEAFLRLWRDGGRLEARGQISTWFLTVVRNLCFDRLRRRDDPLDDE
FT                   TRDTLVDDGPTPEDRLLLTAAASELHAALERLPPRQRHALMLWAWQDHDVGQIADALDI
FT                   APNAAHQLLFRARRSLRQAVEAIRAASTHPVSAVKDIGHEYPQPR"
FT   CDS_pept        complement(301969..302409)
FT                   /transl_table=11
FT                   /locus_tag="azo0274"
FT                   /product="conserved hypothetical secreted protein"
FT                   /note="Conserved hypothetical secreted protein. Homology to
FT                   XCC0845 of X. campestris of 30% (trembl|Q8PC89). No domains
FT                   predicted. Signal peptide. No TMHs"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0274"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92891"
FT                   /db_xref="InterPro:IPR021455"
FT                   /db_xref="UniProtKB/TrEMBL:A1K236"
FT                   /protein_id="CAL92891.1"
FT                   /translation="MTSPLHRLLFAACLLAAWPPAHAAAPAVPELGQWFTLEPAVRRER
FT                   AHQIREQLADASPAERQAFRAALRERLAALPPERRRSVADQLQQEWRELSPQERDAMRA
FT                   ERRAYLRSLSREERRQLLEDRRAMLQRLSPEERQRWQQGLER"
FT   CDS_pept        302583..302924
FT                   /transl_table=11
FT                   /locus_tag="azo0275"
FT                   /product="conserved hypothetical secreted protein"
FT                   /note="Conserved hypothetical secreted protein. Homology to
FT                   CC3220 of Caulobacter crescentus of 34%
FT                   (trembl|Q9A3I4(SRS)) No domains predicted. Signal Peptide
FT                   present. NO TMH present."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0275"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92892"
FT                   /db_xref="UniProtKB/TrEMBL:A1K237"
FT                   /protein_id="CAL92892.1"
FT                   /translation="MYAFRSSLFALIAALVVAPSLVHAETPAERMAQRIDNRQARQEQR
FT                   IDKGVASGALTAREAARMERQQGHVDRVEDRALADGTLSRREAVHMERLQDRTSRHIAV
FT                   QKHDRQVSR"
FT   CDS_pept        303050..303640
FT                   /transl_table=11
FT                   /locus_tag="azo0276"
FT                   /product="Hypothetical protein"
FT                   /note="Putative Hypothetical protein. No Good homologous
FT                   hits in the DB. No domains/features/signal peptide or
FT                   motifs present."
FT                   /db_xref="EnsemblGenomes-Gn:azo0276"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92893"
FT                   /db_xref="UniProtKB/TrEMBL:A1K238"
FT                   /protein_id="CAL92893.1"
FT                   /translation="MASVPPGFKPGIANLEKAWGSSPELVGHAQWSGMDAIDLETLQEF
FT                   CRAERKLLIFRAPGGLGRQVRGLGVEILPKPAAMKQKTHGRWIVQDGRLYTSDWDLLSA
FT                   WQRTGNGYSRFELGADSRQTAEFLKRINRQLLFPLQHGANDDYLDEAGNARNRAIGERF
FT                   IAIDETGGIDRCETQVLMKAYYATRGLAPWLYG"
FT   CDS_pept        303727..304134
FT                   /transl_table=11
FT                   /locus_tag="azo0277"
FT                   /product="Hypothetical protein"
FT                   /note="Hypothetical protein. Weak Homology. 39% identity to
FT                   TrEMBL;Q8EWG7. No domains, repeats, motifs or features
FT                   present."
FT                   /db_xref="EnsemblGenomes-Gn:azo0277"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92894"
FT                   /db_xref="UniProtKB/TrEMBL:A1K239"
FT                   /protein_id="CAL92894.1"
FT                   /translation="MKAAQLQVSYDLIGPANWKGKYTSNNPYNSPNWTWYKDGNNRLTN
FT                   YPHITLAFNEVWEVAKNGEWVGFHVSYPLSRSGKNARFNYTIRNGVVTFNNMTRKGFTD
FT                   MALAEAEEISRDNWQDIDAFAEAFYRAATNT"
FT   CDS_pept        complement(304110..304865)
FT                   /transl_table=11
FT                   /locus_tag="azo0278"
FT                   /product="hypothetical membrane protein"
FT                   /note="Hypothetical membrane protein. No homology to the
FT                   data bank. No domains predicted. Signal peptide. 1 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:azo0278"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92895"
FT                   /db_xref="GOA:A1K240"
FT                   /db_xref="UniProtKB/TrEMBL:A1K240"
FT                   /protein_id="CAL92895.1"
FT                   /translation="MSLPVLTSARCLRPALMAAALTCTALPAHALVVPGALEAVEGNIN
FT                   NAFPFIPDPLRAQQVYDASAFAGVGGPLLLTGLAFRPDAVDGAPQAWVVPDVRIHLSTT
FT                   SAGPDRLSTTFADNVGSDDTEVLRGALSLSTADLPGPGGTRLFDIVIRFTTPFRYDPAR
FT                   GNLLLDIFSAGGSPVVSYDAHNLAGDAISRVIGDLDTARGIADSSGLVTAFDFVALAVP
FT                   APGTLALLLAAALALPAARRRPQVLVAAR"
FT   CDS_pept        305070..305825
FT                   /transl_table=11
FT                   /locus_tag="azo0279"
FT                   /product="conserved hypothetical protein"
FT                   /note="Conserved hypothetical protein. Homology to BB1132
FT                   of B.bronchiseptica of 42% (tremble:Q7WNA8). No domains
FT                   predicted. No Signal peptide or TMH present."
FT                   /db_xref="EnsemblGenomes-Gn:azo0279"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92896"
FT                   /db_xref="InterPro:IPR021783"
FT                   /db_xref="UniProtKB/TrEMBL:A1K241"
FT                   /protein_id="CAL92896.1"
FT                   /translation="MAQGLPRTRFNTSALQRALAGLVVEEPGESRQPFAERLGQWLDFK
FT                   DALALFSVLDARPGEAATAAAAASPLGAELARVRSTLAQAIGADGASAPGVGRIAAPLP
FT                   PLDGGPEALADFAPYQRYCLARQRDMQAAIATLRGDARAALARHSAALARLAALDAVLE
FT                   QGLAVRERALLATIPALLAQRFEQLLAAHRAAQPAGTADDPAGWSRPGGWLATFRADLR
FT                   TVLLAELALRLQPVSGLVEALEGAPAAGA"
FT   CDS_pept        305877..308081
FT                   /transl_table=11
FT                   /locus_tag="azo0280"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="Conserved hypothetical membrane protein. Homology to
FT                   rs03062 of R. solanacearum of 48% (tremble:Q8XQ05) no
FT                   domains predicted signal peptide 2 TMHs"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0280"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92897"
FT                   /db_xref="GOA:A1K242"
FT                   /db_xref="InterPro:IPR008520"
FT                   /db_xref="UniProtKB/TrEMBL:A1K242"
FT                   /protein_id="CAL92897.1"
FT                   /translation="MNRTACAAAFVVGLVVVGWVGYGYLGGSPLALTMTALIAAVYVAG
FT                   ATEMLRFQRATAALQRALADIPPQLADPAAWIATLPPTLRNAVRLRLEGERVALPGPTV
FT                   TPYLIGLLVLLGMLGTFLGMVVTLNGAVVALESTTDLQTIRAALAAPVKGLGVAFGTSV
FT                   AGVAASAMLGLITTLCRRARQQAAHLLDARIATALRPFSRAHQRDEGFKAMQQQARLLP
FT                   ELVDALGTLMAQLERRSGEAEQRLAAEQARFHREAREAYSELAAAVGRSLQASLSESAR
FT                   LAGETIKPVVDTTMAGIARETAALQARVADAVQAQLDGAGARFDSAVTRVTASWTAALE
FT                   QHQRANAAVGAQIEAALGAHAERVDQHSAALLASVAQAHDALRGELATTAARLTDDTAA
FT                   LHARLAAGTERHLDGLATRFDAAVSAVSETWTRALAEHERSGSVLIERLDGALGAFAGR
FT                   FDDRAGALLAEVAERSASLQAALASQEEARLAAQRAALAELAGSLQQRWAEAGADSEAR
FT                   QQRICQTLDDTARALVAETKAQASGTLAEVGALMERAAEAPRAAAEVIGELRKELSASV
FT                   ARDNELLAERSRIMETLRALLDAINHASTEQRSAIDALVASSAAALEQAGTRFGDTVAT
FT                   ESSRMADAAGLLAGGAAEVASLGEAFQLALRLFGESNTQLMESLQRIEGALDKSMARSD
FT                   EQLAYYVAQAREIIDLSIGSQQQIVDDLRRLSAPALAGGV"
FT   CDS_pept        308084..308728
FT                   /transl_table=11
FT                   /locus_tag="azo0281"
FT                   /product="conserved hypothetical outer membrane protein"
FT                   /note="Outer membrane protein A precursor. Homology with
FT                   hypothetical transmembrane protein and probable outer
FT                   membrane protein of 56% as well as with motB (flagellar
FT                   motor protein B) from amino acid 84 of 34%. Pfam: OmpA no
FT                   signal peptide probable 1 TMH"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0281"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92898"
FT                   /db_xref="GOA:A1K243"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A1K243"
FT                   /protein_id="CAL92898.1"
FT                   /translation="MDEIDGGIEHAAPVWAVFADLMSGLLGAFVLILVGVLGVQMELAS
FT                   SLEAEVQKRRVEEQRREALEKALAVPLASGRVTLANGRIGISGSVLFALNSDELQPDGR
FT                   QLLKSLAPPLAAYLASHDEMLMVSGFTDDRPVRDSNRQFADNWELSAQRALTVTRVLVE
FT                   EGVPSAAVFAAAFGQEQPVASNADADGRARNRRVEMAPVPRSAKAAGADRG"
FT   CDS_pept        308721..309476
FT                   /transl_table=11
FT                   /locus_tag="azo0282"
FT                   /product="conserved hypothetical protein"
FT                   /note="Conserved hypothetical protein. Homology to RS03060
FT                   of R.solanacearum of 35% (tremble:Q8XQ03) No domains
FT                   predicted. No signal peptide or TMH present."
FT                   /db_xref="EnsemblGenomes-Gn:azo0282"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92899"
FT                   /db_xref="InterPro:IPR021549"
FT                   /db_xref="UniProtKB/TrEMBL:A1K244"
FT                   /protein_id="CAL92899.1"
FT                   /translation="MAEAEATTVAADGASAQTLIEALRARGAARFDAVGFRFLDALAAR
FT                   LAALDGAAKQRLESRLAEAAAALGERMDAAAREAEACCAAAAARFPAAAAALAKDLAAG
FT                   DFTALRRRIAALEAGLAPGPLGELVARLQRPAADAPEAAAEPGGAPAELRSLRRFRRTW
FT                   SRLSTEQQLAEAFAQAPENAGPLNAHFLVLRALTRMRDLAPAYLEQFVSYANTLLWLEQ
FT                   VEAGRAAAQKPGARAERGRKRKPAAGGAS"
FT   CDS_pept        complement(309473..310132)
FT                   /transl_table=11
FT                   /locus_tag="azo0283"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="Hypothetical protein predicted by Glimmer/Critica.
FT                   no homology to the data bank. no domains predicted. no
FT                   TMHs. no signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:azo0283"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92900"
FT                   /db_xref="UniProtKB/TrEMBL:A1K245"
FT                   /protein_id="CAL92900.1"
FT                   /translation="MIALAAFYRQHYDAAALSAAARTCCAVPLRRAGAMTELVLTGVHA
FT                   CLDSQPPRPTALIWGSRTGIRHATARVVGDLCISGEAPMPFDFLATQPALAAVPVQQTF
FT                   PCVVNAVYQPWQAEADAHWARMLHLAIAWLQSGRHERVLCAQVEPATEHPQGDWLVLQR
FT                   GDGAAWPEVQVGLADGTHGAGSAALFDWLEAGIGKGFVLRGADALPALRFYRAGAR"
FT   CDS_pept        complement(310129..311193)
FT                   /transl_table=11
FT                   /locus_tag="azo0284"
FT                   /product="putative Beta-ketoacyl synthase family protein"
FT                   /function="3-oxoacyl-(acyl-carrier-protein) synthase"
FT                   /note="Pfam (PF02801): Beta-ketoacyl synthase, C-terminal
FT                   domain. Pfam (PF00109): Beta-ketoacyl synthase, N-terminal
FT                   domain."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0284"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92901"
FT                   /db_xref="GOA:A1K246"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:A1K246"
FT                   /protein_id="CAL92901.1"
FT                   /translation="MNPAAPPRRAVHVARLGHCSARGHDAPSAAEALLAGADDTATREL
FT                   LDARHPWFELPLAENGWTARARAAVTAVGAQLTAGMDPARVAALPLFIGSSSLQAGAIE
FT                   AAARAGGCVEMPPDAAAFAADVAAWLGIGSVPWTFSTSCTSGLAALDAAATLIAAGLID
FT                   EALVLGFEFANDTTLAGFAGLGILAATPEADGLVLGEAVGGVLLSATPGAAGWRVAACR
FT                   LGVDGYSPTAPAPDGGVIAKVIAAALADAGLHSADIALLKPHRGQLASTDAAEAAALQR
FT                   VFGAAPPPAVALKRQLGHTLGASGLVELGALLAMLDAPAGRARHGSPRHLLLNLIGFGG
FT                   SIAALVLSRSGGQP"
FT   CDS_pept        complement(311190..311462)
FT                   /transl_table=11
FT                   /locus_tag="azo0285"
FT                   /product="conserved hypothetical acyl carrier protein"
FT                   /note="Conserved hypothetical acyl carrier protein.
FT                   Homology to psptO5093 of P. syringae of 44%
FT                   (trembl|Q87V48). Interpro: Phosphopanteteine-binding
FT                   (IPR00613). Pfam: Phosphopantetheine attachment site
FT                   (PF00550) Phosphopantetheine (or pantetheine 4' phosphate)
FT                   is the prosthetic group of acyl carrier proteins (ACP) in
FT                   some multienzyme complexes where it serves as a 'swinging
FT                   arm' for the attachment of activated fatty acid and
FT                   amino-acid groups. Tigrfam: acyl_carrier: acyl carrier
FT                   protein. no signal peptide. no TMHs"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0285"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92902"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A1K247"
FT                   /protein_id="CAL92902.1"
FT                   /translation="MTALTHELKVLIVDACDKACDPATISDDEILFGPEAPLALDSLDA
FT                   LQVSMALQKKYGVRLTDSKETRRILASVANLAAFLQAHGKTGTSA"
FT   CDS_pept        complement(311480..312718)
FT                   /transl_table=11
FT                   /locus_tag="azo0286"
FT                   /product="putative ABC transporter permease"
FT                   /function="ABC-type multidrug transport system permease
FT                   component"
FT                   /note="Similar to TREMBL:Q7NFQ1 (27% identity);
FT                   TREMBL:Q97E48 (20% identity); TREMBL:Q8FWI9 (21% identity).
FT                   TMHMM predicting six transmembrane helices. TC (2.A.6.2):
FT                   The (Largely Gram-negative Bacterial) Hydrophobe/Amphiphile
FT                   Efflux-1 (HAE1) Family."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0286"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92903"
FT                   /db_xref="GOA:A1K248"
FT                   /db_xref="UniProtKB/TrEMBL:A1K248"
FT                   /protein_id="CAL92903.1"
FT                   /translation="MAGAPLPLTRLRALWRKETLTLLRDRHALAALFLMPAIFILVMSL
FT                   ALRDAFVPGVQSELAYAVVDLDRSPASQELVERLDRIAVLRAQGVLDNEAAGRGAVADG
FT                   RLAFALVVPAGFGERLAARQGDEGAPPLRVLADPTVPRAVQSGFEQQVAAEAARLRVLT
FT                   LLDGLGRKLMVPELRRQVGIDASPRVISEAVRSDAGAAAPPAVVPSSVQQSVPAWLIFS
FT                   MFFVVVPLSAVFIAERQQGTLQRLATQQVPFGLVLAGKLLPYFVVNQVQAVVMVMVGRW
FT                   LVPLAGGEALTLPAGAASLVALWLMAAAVSVAAVAWALLIASLTRSSEQATIVGGVGNI
FT                   LMGALGGIMVPKFLMPPEMQTLTQLSPMAWALDGFHRVMLLGDGVAGILPQAATLLCFG
FT                   LAALAAAILRTGR"
FT   CDS_pept        complement(312733..313155)
FT                   /transl_table=11
FT                   /locus_tag="azo0287"
FT                   /product="conserved hypothetical protein"
FT                   /function="predicted nucleic acid-binding protein contains
FT                   PIN domain"
FT                   /note="Probable DNA mismatch repair protein mutS.
FT                   TREMBL:Q92SQ4:42% identity, 55% similarity.
FT                   InterPro:IPR002716; PIN. Pfam: PF01850; PIN Absence of
FT                   signal peptide Absence of transmembrane helices L17:
FT                   ribosomal protein L17"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0287"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92904"
FT                   /db_xref="GOA:A1K249"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A1K249"
FT                   /protein_id="CAL92904.1"
FT                   /translation="MIYLDTSVLGAIFFREPGAAALVEQLERVRADGLLISAWTLTEMA
FT                   SVGGIKQRTGSIDAALRQQALSNFQRFASAELRTVEVEPADFRTAAVFIDCPVALRAGD
FT                   AVHLAVTRRSGARIASLDRRLGDAADALGIPRFQLA"
FT   CDS_pept        complement(313152..313379)
FT                   /transl_table=11
FT                   /locus_tag="azo0288"
FT                   /product="hypothetical protein"
FT                   /note="no significant homologies"
FT                   /db_xref="EnsemblGenomes-Gn:azo0288"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92905"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:A1K250"
FT                   /protein_id="CAL92905.1"
FT                   /translation="MKTATIADAKTHLSSLIADIEAGEDVVITRRGRAVARLVAEPAAE
FT                   EFGWAALKSWVAEEATTGLSVADMRERDLL"
FT   CDS_pept        complement(313482..314405)
FT                   /transl_table=11
FT                   /locus_tag="azo0289"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /function="ABC-type multidrug transport system ATPase
FT                   component"
FT                   /note="ATP-binding cassette (ABC) transporters form a large
FT                   family of proteins responsible for translocation of a
FT                   variety of compounds across biological membranes. They are
FT                   composed of two transmembrane domains responsible for
FT                   binding and transport and two nucleotide-binding domains
FT                   responsible for coupling the energy of ATP hydrolysis to
FT                   conformational changes in the TMDs, TREMBL:Q8R788 (35%
FT                   identity); TREMBL:Q81S77 (37% identity). InterPro
FT                   (IPR003439): ABC transporter. InterPro (IPR003593): AAA
FT                   ATPase. InterPro (IPR001687): ATP/GTP-binding site motif A
FT                   (P-loop). Pfam (PF00005): ABC transporter. TC (3.A.1): The
FT                   ATP-binding Cassette (ABC) Superfamily."
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0289"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92906"
FT                   /db_xref="GOA:A1K251"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1K251"
FT                   /protein_id="CAL92906.1"
FT                   /translation="MLRARDLTYRYRPEQPPALDGVSLDVPAGSLFGLLGPNGAGKTTL
FT                   ISLVAGLLAPQGGSLEYDGRPLARARRAQPNAIALVPQDHAFYPTLTVAENLDFFAGVQ
FT                   GLGGALARQRVGAALAFGQLDSYAKRRAGELSGGLKRRLNLAIGLLADPQLLLLDEPTV
FT                   GVDPQSRHFLLDAIRELRTAGKTVIYTSHYMDEVEALCEQVAIVDHGRVLVQGTLAEVL
FT                   RDTEPVLTLQLDRPPPAALAAAWTARHPGLEIDATAVRVPGATAAELPALLAELAAAGC
FT                   TPHSLGYGEQNLEQVFMRLTQRSLRD"
FT   CDS_pept        complement(314413..315417)
FT                   /transl_table=11
FT                   /locus_tag="azo0290"
FT                   /product="conserved hypothetical protein"
FT                   /note="Conserved hypothetical protein. Homology to
FT                   Daro03001929 of Dechloromonas aromatica of 68%
FT                   (gi|53730629|ref|ZP_00348881.1|(NBCI ENTREZ)). No domains
FT                   predicted. No TMHs. No signal peptide."
FT                   /db_xref="EnsemblGenomes-Gn:azo0290"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92907"
FT                   /db_xref="InterPro:IPR026935"
FT                   /db_xref="InterPro:IPR032369"
FT                   /db_xref="UniProtKB/TrEMBL:A1K252"
FT                   /protein_id="CAL92907.1"
FT                   /translation="MADFQHQHASHCESGVMSAIVRHYGLPFSEPMAFGLASALSFAWL
FT                   PFVKLGGLPLVAYRMPPKAIIRGLRKPLALDMRFETFRDPARGMARLDELLAQGKVVGL
FT                   QTSVFWLPYMPEDLRFHFNAHNVLVYGRDAASGDYLLSDPVFEHPVRCAAEDLSRARFA
FT                   RGVLAPKGLLYYPANRPSAPDWGKAIPAAIRKTERIMLKAPLPLIGARGIERAARAVGR
FT                   LPAQDKDGDVRHSKLFIGHLVRMQEEIGTGGAGFRYLYASFLEEGAELAQRPALKEFSG
FT                   RLVEIGDRWREFALAAARMIRDRDPLDPPRLAAMLSERAAEERAFFTDLGRAL"
FT   CDS_pept        complement(315418..315813)
FT                   /transl_table=11
FT                   /locus_tag="azo0291"
FT                   /product="conserved hypothetical protein"
FT                   /note="Conserved hypothetical protein. Homology to
FT                   Daro03001928 of Dechloromonas aromatica of 59%
FT                   (gi|41724574|ref|ZP_00151411.1|(NBCI ENTREZ)). No domains
FT                   predicted. No TMHs. No signal peptide."
FT                   /db_xref="EnsemblGenomes-Gn:azo0291"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92908"
FT                   /db_xref="UniProtKB/TrEMBL:A1K253"
FT                   /protein_id="CAL92908.1"
FT                   /translation="MDIDDVPQEGNRSLGGHRKALYARGADGQLALVPSRGWEAEEIVT
FT                   RQAVEELDRLAAEAQERARAGTGSALEYHMYKARMDSLMLAQVTGLWHWRVRRHLRPEV
FT                   FRRLRPALLARYAEALGLDLATLTRIP"
FT   CDS_pept        complement(315826..316980)
FT                   /transl_table=11
FT                   /gene="darB"
FT                   /locus_tag="azo0292"
FT                   /product="probable 3-oxoacyl-[acyl-carrier-protein]
FT                   synthase"
FT                   /function="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="3-oxoacyl-[acyl-carrier-protein] synthase (EC
FT                   2.3.1.41) (Beta- ketoacyl-ACP synthase III) (KAS III).
FT                   Catalyzes the condensation reaction of fatty acid synthesis
FT                   by the addition to an acyl acceptor of two carbons from
FT                   malonyl-ACP. Catalyzes the first condensation reaction
FT                   which initiates fatty acid synthesis and may therefore play
FT                   a role in governing the total rate of fatty acid
FT                   production. Possesses both acetoacetyl-ACP synthase and
FT                   acetyl transacylase activities. Its substrate specificity
FT                   determines the biosynthesis of branched- chain and/or
FT                   straight-chain of fatty acids (By similarity). Entry name
FT                   trembl|Q84H29(SRS) Identities = 238/384 (61%) Prediction:
FT                   Non-secretory protein Signal peptide probability: 0.0
FT                   Number of predicted TMHs: 0 Pfam:- Beta-ketoacyl synthase,
FT                   N-terminal do Accession number:-Pf00109"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0292"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92909"
FT                   /db_xref="GOA:A1K254"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:A1K254"
FT                   /protein_id="CAL92909.1"
FT                   /translation="MAEARAVYITATAAFLPNAPVGNDDIEAVLGRIGGRPSRARRLVL
FT                   RNNGIESRHYAIDPASGAATHTNAQLTAAAVRALEAPGFALDTLECLVTGTSLPDQLMP
FT                   NHGVMVHGELGTPACEVVSTAGICLAGMTALKYAWLSVLAGNSRNAVASGSELASAVMR
FT                   AAHFEAENEARVDALETHPEIAFEKDFLRWMLSDGAGAFLLQDAPRPDAPSLRIDWFEL
FT                   SSQAHAQPACMYAGADKDADGSLRGWARFSAAEWGRRSIFAVKQDVRQLNEQVVRQTLE
FT                   IPLASLIARRGLKADAIDWFLPHMSSAYFRQPVADCLARLGCAIPPERWFTNLAQRGNT
FT                   GSASIFIMLDELVRSGRLRRGQRLLCFVPESGRFSSGFLHLTVV"
FT   CDS_pept        complement(316973..317914)
FT                   /transl_table=11
FT                   /gene="darA"
FT                   /locus_tag="azo0293"
FT                   /product="probable dialkylrecorsinol condensing enzyme"
FT                   /note="Probable dialkylrecorsinol condensing enzyme.
FT                   Homology to darA of P. aurantiaca of 56%
FT                   (trembl|Q84H30(SRS)) no domains predicted no signal peptide
FT                   1 TMHs"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0293"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92910"
FT                   /db_xref="GOA:A1K255"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A1K255"
FT                   /protein_id="CAL92910.1"
FT                   /translation="MKKVLVVHYSQTGQLADIVGTLLQPLRAAGVAIHEEVLRPAQPHP
FT                   FPWPFFEFLDVFPESVRLDAAPNLPLTVPADADFDLVILAWQVWYLSPSLPVTAFLKSA
FT                   EGRRLLAGKPVVSVVACRNMWMTAHEKLAALLADAGARLVDHVALTDGAHPLATFITTP
FT                   RWMFTGRRDRFLGLPRAGVAGEDVAGAARFGSALAAALAADRERSGEPMLAGLRAAVVN
FT                   PRLVISERAGQRAFKVWSALVRACGRPGQRRRRPALALFALYLVTLIITVVPASLALQT
FT                   LFAPLLRARLERLRAQYEQPSGSADFRLTRNG"
FT   CDS_pept        complement(317928..319742)
FT                   /transl_table=11
FT                   /locus_tag="azo0294"
FT                   /product="putative penicillin-binding protein"
FT                   /function="Beta-lactamase class C and other penicillin
FT                   binding proteins"
FT                   /note="INVOLVED IN CELL WALL BIOSYNTHESIS AND MAY ALSO ACT
FT                   AS A SENSOR OF EXTERNAL PENICILLINS, TREMBL:Q7UMP8 (30%
FT                   identity); TREMBL:Q988N4 (27% identity)."
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0294"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92911"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A1K256"
FT                   /protein_id="CAL92911.1"
FT                   /translation="MPASPRPAARIAHPVAALARRLLAPAAILLLGACAAIQPPPRPAH
FT                   VGSGDYAYTRDYLRWLIGQEMEENRITGLSIALVDDQRVVWAEGFGKEDAERDVAAGPH
FT                   TRYRMGSIAKVLTATAAMQMAERGEIDIDRPLADYLPGFSVRSRFDDRTPITPRNIMHH
FT                   HSGLPANYLKGMMGGDPPPFTTLVEAVREEYVAYPPEFIFGYSNLAVTLLGAALEQRAG
FT                   LPFADHMAKSLIEPLGMTETRFESNPALRVYDARGQIEALPLRDLPSGGLVSSVADMSR
FT                   FMRMVFAGGRSGNTQLLRPETLHEMLRAQNEHIALDLGFRVGLGWLLSGIEIRNAGLVA
FT                   SHGGTLFDSHSMMVVLPEHKLGVIVASNSGTSQGTVKKIATEALIHALEAKAGIRQPEA
FT                   AAIAQPEVRLAPEQLASYSAWYDSMVGLIRVKPRAGALDADVMGHTLQLRAQPGGQFGL
FT                   RYKLFGLIPVQVGAFDGVRISAAAIGGHEVLVGHFGDDTMLVGEKLAPRPIPRTMLDYV
FT                   GEYEIVGKPPGLAPDRLALRVEDGMLIGECSFSELPGFMLRIALNPISPTEAVISGLGT
FT                   GKGETIRILPGEGRRLLFSGLELRQKTN"
FT   CDS_pept        320022..320456
FT                   /transl_table=11
FT                   /locus_tag="azo0295"
FT                   /product="conserved hypothetical protein"
FT                   /note="Conserved hypothetical protein. Homology to CV2374
FT                   of C.violaceum of 31% (tremble:Q7NVG9). No domains
FT                   predicted. No signal peptide or TMH present."
FT                   /db_xref="EnsemblGenomes-Gn:azo0295"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92912"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:A1K257"
FT                   /protein_id="CAL92912.1"
FT                   /translation="MTDATPDAAPAAPDPQRLTIARLIALTLIADGDLASRELEALDRH
FT                   RIAELVGVPRDLLIQTVIDHCRTLRAGEAPGTLRVLDLERTERMLDSITDPALRALACR
FT                   AMLVLSKADGRITLPEQTLLRHALTRWGLSLEAIAADAAS"
FT   CDS_pept        complement(320512..321492)
FT                   /transl_table=11
FT                   /locus_tag="azo0296"
FT                   /product="probable metallo-beta-lactamase superfamily
FT                   protein"
FT                   /function="Zn-dependent hydrolases including glyoxylases"
FT                   /EC_number="3.5.-.-"
FT                   /note="InterPro:IPR001279- Metallo-beta-lactamase
FT                   superfamily,glyoxalase II family, that catalyse the
FT                   hydrolysis of S-D-lactoyl-glutathione to form glutathione
FT                   and D-lactic acid. TREMBL:Q7WEK1-55% Identity.
FT                   Pfam-Presence of phosphoribosyltransferase, tissue factor,
FT                   and GMP reductaseC like domains Signal P predicting signal
FT                   peptide and TMHMM predicting transmembrane helices. ccoP:
FT                   cytochrome c oxidase cbb3-type s"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0296"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92913"
FT                   /db_xref="GOA:A1K258"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A1K258"
FT                   /protein_id="CAL92913.1"
FT                   /translation="MHLPRARHWILAAAIATAAPLLSLSAAHAEAPQVKTQAPGFYRMA
FT                   LGQFEITALYDGYVDLDPKLLKNASQRDIQRLLAHRFQDGPKMQTAVNAYVINTGSKLV
FT                   LVDAGAAKVFGPSLGYITDNLKAAGYDPAQIDAVLLTHLHGDHANGVVGADGKAVFPKA
FT                   VVYAAQNDADFWLAEGALEKAPESGKPFFQMAQAAVAPYRADNRFKTLQDGDEIVPGIK
FT                   AVAAYGHTPGHSGFLVESGDKRLLIWGDIVHNAAVQFAKPEVAIEFDVDSKQAVRTREA
FT                   VFKRVAREKLLVAGMHLPFPGIGHVRRAEKGSYEWVPVDYSPVRE"
FT   CDS_pept        complement(321614..321958)
FT                   /transl_table=11
FT                   /locus_tag="azo0297"
FT                   /product="conserved hypothetical protein"
FT                   /note="Conserved hypothetical protein, 66% similarity to
FT                   TrEMBL; Q6NA86. Signal peptide present. No TMH reported
FT                   present."
FT                   /db_xref="EnsemblGenomes-Gn:azo0297"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92914"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A1K259"
FT                   /protein_id="CAL92914.1"
FT                   /translation="MALPPHGTLLGTLPPAGAEERFERLLQTDAACIERIVSNGQASPP
FT                   GFWYDQPDDEWVMLVAGQAELLFDDAGAHTRLALRAGDWVTIPARLRHRVESTSADAVW
FT                   LAVHLRTAPR"
FT   CDS_pept        complement(321964..322572)
FT                   /transl_table=11
FT                   /gene="paaY"
FT                   /locus_tag="azo0298"
FT                   /product="probable phenyl acetic acid degradation protein"
FT                   /function="Carbonic anhydrases/acetyltransferases
FT                   isoleucine patch superfamily"
FT                   /note="pathway:carnitine metabolism (conversion of
FT                   carnitine to gamma-butyrobetaine). TREMBL:Q9F9V3: 71%
FT                   identity, 83% similarity similarity:belongs to the
FT                   transferase hexapeptide repeat family Carnitine operon
FT                   protein caiE. InterPro:IPR001451; Hexapep_transf.
FT                   Pfam:PF00132; Hexapep InterPro: Bacterial transferase
FT                   hexapeptide repeat TIGR00094: conserved hypothetical
FT                   protein"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0298"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92915"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011974"
FT                   /db_xref="UniProtKB/TrEMBL:A1K260"
FT                   /protein_id="CAL92915.1"
FT                   /translation="MPCYEIDGLKPVIHPTAYVHPDAVLIGDVIIGPRCYVAPLASLRG
FT                   DFGRIVMEEGSNIQDSCVMHGFPGTDTVVGVDGHIGHGAILHGCQVGRNALIGMNAVVM
FT                   DNAVIGDSAIVAASAFVKAGMEVPPRTLVAGMPAKVVRELSDQEVSWKMDGTRTYQDLT
FT                   VRSLATLKPCEPLAEMEPGRKRFEMPGVVPLVDAKKNGG"
FT   CDS_pept        complement(322766..324430)
FT                   /transl_table=11
FT                   /gene="paaZ"
FT                   /locus_tag="azo0299"
FT                   /product="conserved hypothetical dehydrogenase"
FT                   /function="NAD-dependent aldehyde dehydrogenases"
FT                   /EC_number="1.2.1.-"
FT                   /note="Conserved hypothetical dehydrogenase. Homology to
FT                   paaZ of A. evansii of 83% (trembl|Q9F9V2). Pfam: Aldehyde
FT                   dehydrogenase family no signal peptide no TMHs"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0299"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92916"
FT                   /db_xref="GOA:A1K261"
FT                   /db_xref="InterPro:IPR011975"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A1K261"
FT                   /protein_id="CAL92916.1"
FT                   /translation="MTHPLYAKHQATLEAALAAIHTRGYWTPYAEMPSPKVYGETAADD
FT                   GKRAFEACLGKDFELDQPGRSGWAASERSPYGIALDVRYPVCEPSALIAAAEAAMPGWR
FT                   KIGAEGRVGVCLEILDRLNKRSFEIAHAVMMTTGQGWMMAFQAGGPHAQDRGLEAVAYA
FT                   WDAMRGVPATTVWEKPQGKNPPLKMQKHYEIVGRGVALVVGCGTFPTWNTYPGLFAALA
FT                   TGNPVIVKPHSNAILPAAMTVKIAREVLAEAGLDPSVVSLAVVEKRSDTQALATHPAVK
FT                   SIDFTGSNVFGQWLIDNARQAQVYAELAGVNNVVIESTDNYKAMLRNLAFTLCLYSGQM
FT                   CTTTQAILVPAGGIDTDQGHKRYDEVAADLGAAIDKFLSDPAVATAVLGAIQSDATLAR
FT                   INEAGQYGDIVLASKKIEHPEFPQAEVRTPVLLACDAAAEKSYMEERFGPIAFVVKVAD
FT                   GAAAVALSERIVREHGALTVGLYSTKAEVIDAMTEATLRAGVALSINLTGGVFVNQSAA
FT                   FSDYHGVGMNPAANASYSDAAFVANRFRVVQRRYHVE"
FT   CDS_pept        324719..325522
FT                   /transl_table=11
FT                   /gene="paaG1"
FT                   /locus_tag="azo0300"
FT                   /product="probable enoyl-CoA hydratase"
FT                   /function="Enoyl-CoA hydratase/carnithine racemase"
FT                   /EC_number="4.2.1.17"
FT                   /note="Probable enoyl-CoA hydratase. Homology to paaG of E.
FT                   coli of 60% (sprot|PAAG_ECOLI(SRS) COULD POSSIBLY OXIDIZES
FT                   FATTY ACIDS USING SPECIFIC COMPONENTS (BY SIMILARITY).
FT                   Activity:- (3S)-3-hydroxyacyl-CoA = trans-2(or 3)-enoyl-CoA
FT                   + H2O. Interpro: Enoyl-CoA hydratase/isomerase (IPR001753)
FT                   Pfam: Enoyl-CoA hydratase/isomerase no signal peptide no
FT                   TMHs"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0300"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92917"
FT                   /db_xref="GOA:A1K262"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR011968"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A1K262"
FT                   /protein_id="CAL92917.1"
FT                   /translation="MSSFETIRYEVAAGVATLTLNRPDRLNSFNDQMHREVREALAQVQ
FT                   AGRADGSVRVLVIAAAGRGFCAGQDLSDRNVSAGAEAPDLGASIEKNYKPLVTTLRNLD
FT                   LPVIAAVNGVAAGAGANLALACDLVFAARSASFIQSFAKLGLVPDTGGSWILPRLLGPA
FT                   RALGLALLGDKLPAEQAEQWGLIWKCVDDDALQATVQQVAATLANGPTFGYAQTKKAIW
FT                   ASTTNDFDTQLDLERDAMRACGRSHDYREGVAAFMEKRAPQFKGN"
FT   CDS_pept        325526..327073
FT                   /transl_table=11
FT                   /gene="paaH1"
FT                   /locus_tag="azo0301"
FT                   /product="probable 3-hydroxybutyryl-CoA dehydrogenase"
FT                   /function="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.157"
FT                   /note="Activity:-3-acetoacetyl-CoA + NADPH =
FT                   (S)-3-hydroxybutanoyl-CoA + NADP+ Entry name TREMBL:Q9F9V1
FT                   InterPro IPR006108; 3HCDH_C. IPR006176; 3HCDH_N. IPR008927;
FT                   6DGDH_C_like. IPR002110; ANK. IPR000205; NAD_BS. Pfam
FT                   PF00725; 3HCDH; 2. PF02737; 3HCDH_N; 1. Identities =
FT                   344/510 (67%) Prediction: Signal peptide Signal peptide
FT                   probability: 0.660 Number of predicted TMHs: 1"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0301"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92918"
FT                   /db_xref="GOA:A1K263"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011967"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041040"
FT                   /db_xref="UniProtKB/TrEMBL:A1K263"
FT                   /protein_id="CAL92918.1"
FT                   /translation="MTAADKALDKQVKVLVIGAGAMGSGIAHVAALAGHPVYLYDTRAE
FT                   AIDKGIGGIAKDLAFLVEKGKLAGAERDAVLARISGITQLADAKDAGLAIEAIVENLDI
FT                   KQKLFRELEALLAEDAVLASNTSSLSITAMGAALARPERLVGLHFFNPAPRMKLVEIVS
FT                   GLATPRELAERMHATAKAWGKVPVHAKSTPGFIVNRVARPYYAEAQRVLAECAAEPATL
FT                   DAAMREGCGFPMGPFELMDLIGHDVNFAVTNSVFDAYFGDKRFTPSLLQQELVAAGRLG
FT                   RKSGHGFYSYAAGAARPAPQTEEPHEAEAAITVVGGLGVAAALIGRFEAAGIEVRRTAG
FT                   AGGSDAQGWLEIGGARVALSDGRTATRRAVEEGVPNLVLFDLCLDYATTPRLTLARADQ
FT                   CGHGAWGAAVGTLQRAGLAVSRIDDVAGLVGLRTVAMLANEAADAVLQGIGTAADIDTA
FT                   MRFGTNYPKGPLAWADQLGVAFVARVLANLREHYGEERYRVSPLIQRKTFSGAAFHE"
FT   CDS_pept        327066..327536
FT                   /transl_table=11
FT                   /gene="paaI"
FT                   /locus_tag="azo0302"
FT                   /product="phenylacetic acid degradation protein PaaI"
FT                   /function="uncharacterized protein possibly involved in
FT                   aromatic compounds catabolism"
FT                   /note="Phenylacetic acid aerobic catabolism. Similar to
FT                   TREMBL:Q9F9V0 (74% identity); SWISSPROT:P76084 (48%
FT                   identity). InterPro (IPR003736): Phenylacetic acid
FT                   degradation-related protein. Pfam (DUF157): Uncharacterized
FT                   protein PaaI, COG2050"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0302"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92919"
FT                   /db_xref="GOA:A1K264"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR011973"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A1K264"
FT                   /protein_id="CAL92919.1"
FT                   /translation="MSEAAYRDVTAGLDPQALAEKVRDGMFERDQAARSLAMEITAVGP
FT                   GRATIAMKVREDMLNGFRICHGGFITTLADTAFAYACNSGNEQTVASGISVDFMAPGKP
FT                   GDVLTAEAQQVFEAGRTGVYDITVTNQQGELIAVMRGKSYRLKGRPVVEIQA"
FT   CDS_pept        327612..328934
FT                   /transl_table=11
FT                   /gene="paaK"
FT                   /locus_tag="azo0303"
FT                   /product="Phenylacetate--CoA ligase."
FT                   /function="Coenzyme F390 synthetase"
FT                   /EC_number="6.2.1.30"
FT                   /note="Phenylacetate-coenzyme A ligase (EC 6.2.1.30)
FT                   (Phenylacetyl-CoA ligase) (PA-CoA ligase). catalyzes the
FT                   activation of phenylacetic acid to phenylacetyl-coA"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0303"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92920"
FT                   /db_xref="GOA:A1K265"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011880"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1K265"
FT                   /protein_id="CAL92920.1"
FT                   /translation="MPINSYAPPQLEPIETASIDELRALQLERLKWSVRHAYENVPHYR
FT                   KKFDEKGVHPDDLKSLADLAKFPFTSKYDLRDNYPFGMFAVPMDRIARVHASSGTTGKP
FT                   TVVGYTLKDIDTWATVVARSIRAAGGRPGDMVHVSYGYGLFTGGLGAHYGAEKLGCTVV
FT                   PMSGGQTEKQIQIIQDFKPKIIMVTPSYMLTILDEMERMGIDPKSTSLRIGIFGAEPWT
FT                   PAMRVAMEQRAGIDAVDIYGLSEVMGPGVANECVETKDGPTIWEDHFYPEIIDPNTGEV
FT                   LPDGSEGELVFTSLSKEAMPVIRYRTRDLTRLLPPSARSMRRMAKITGRSDDMLIIRGV
FT                   NVFPTQIEELICKIPKLAPHYLLEVDKQGHMDTLTVKVEINAEAEVGRHPEHKEALARE
FT                   LTHSIKSLIGVSAKVLVGEPFSIERVTVGKAKRVIDRRPKD"
FT   CDS_pept        328992..329987
FT                   /transl_table=11
FT                   /gene="paaA"
FT                   /locus_tag="azo0304"
FT                   /product="phenylacetic acid degradation protein [paaA]"
FT                   /function="uncharacterized conserved protein"
FT                   /note="Phenylacetic acid degradation protein [paaA],86%
FT                   identity(91% similarity) to TrEMBL;Q9F9U9. 72% identity to
FT                   TrEMBL;Q7WGX6, Q8XS77 Has PF05138, Phenylacetic acid
FT                   catabolic protein;IPR007814, PaaA_PaaC; This family
FT                   includes proteins such as PaaA and PaaC that are part of a
FT                   catabolic pathway of phenylacetic acid. These proteins may
FT                   form part of a dioxygenase complex. No Signal Peptide or
FT                   TMH present."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0304"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92921"
FT                   /db_xref="GOA:A1K266"
FT                   /db_xref="InterPro:IPR007814"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011881"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A1K266"
FT                   /protein_id="CAL92921.1"
FT                   /translation="MYTQALDIPQADAAPLRAVENPAYQAEFDARIDAGDFIEPKDWMP
FT                   EAYRKTLVRQISQHAHSEIVGMLPEGNWITRAPSLKRKAILLAKVQDEGGHGLYLYAAA
FT                   ETLGVSRDELYEALLAGRAKYSSIFNYPTLNWADIGVIGWLVDGAAIMNQIPLCKCSYG
FT                   PYARAMIRVCKEESFHQRQGYDLLLTMMRGTPEQQEMVQDAVNRWWWPSIMMFGPHDSD
FT                   SVHTETTRWGIKRISNDDLRQKFVDATVKQAEVLGVTLPDPALKWNEARGHYDFGAIDW
FT                   DEFRAVVGGHGQCNVDRIAARRKAWEDGAWVREAAVAHAEKQAVRDKAAA"
FT   CDS_pept        330089..330376
FT                   /transl_table=11
FT                   /gene="paaB"
FT                   /locus_tag="azo0305"
FT                   /product="phenylacetic acid degradation protein PaaB"
FT                   /function="uncharacterized enzyme of phenylacetate
FT                   metabolism"
FT                   /note="May be part of a multicomponent oxygenase involved
FT                   in phenylacetyl-coa hydroxylation. Phenylacetic acid
FT                   aerobic catabolism pathway, TREMBL:Q8XS76 (75% identity);
FT                   SWISSPROT:P76078 (61% identity)."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0305"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92922"
FT                   /db_xref="InterPro:IPR009359"
FT                   /db_xref="InterPro:IPR038693"
FT                   /db_xref="UniProtKB/TrEMBL:A1K267"
FT                   /protein_id="CAL92922.1"
FT                   /translation="MERKEWPLWEVFIRSRNGLDHKHCGSVHAPDARLALQTARDVYTR
FT                   RLEGVSIWVVKASDIVASDPDAKPELFDPAEDKIYRHPTFYQLPEEVNHM"
FT   CDS_pept        330388..331158
FT                   /transl_table=11
FT                   /gene="paaC"
FT                   /locus_tag="azo0306"
FT                   /product="probable phenylacetic acid degradation protein
FT                   PaaC"
FT                   /note="Probable phenylacetic acid degradation protein PaaC.
FT                   Homology to paaI of P. putida of 46% (trembl|O84983). Part
FT                   of a catabolic pathway of phenylacetic acid. These proteins
FT                   forms part of a dioxygenase complex. Interpro: Phenylacetic
FT                   acid catabolic (IPR007814) Pfam: Phenylacetic acid
FT                   catabolic protein (PF05138) no signal peptide no TMHs"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0306"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92923"
FT                   /db_xref="GOA:A1K268"
FT                   /db_xref="InterPro:IPR007814"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011882"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A1K268"
FT                   /protein_id="CAL92923.1"
FT                   /translation="MTQANSANPAHLEYVLRLADNVLILGQRISEWCGHAPVIEEDLAL
FT                   SNMALDLIGQARLLLTHAGRLEGRGRDEDQLAFLRVERDYRNLTLVEVPNQDFGRTVVR
FT                   NMLFGAFQVVLWERLTASADSELAAIAAKSLKEARYHFSHAAEWVVRLGDGTALSHDKV
FT                   QAALDELWPYTNEFFASDETDAAAAAAGIGPASNTLEADWENAVLPVLAQATLVAPART
FT                   PFKTFGKFGRHSEHMGHLLATMQYMQRTYPGAQW"
FT   CDS_pept        331218..331709
FT                   /transl_table=11
FT                   /gene="paaD"
FT                   /locus_tag="azo0307"
FT                   /product="probable phenylacetic acid degradation protein
FT                   PaaD"
FT                   /note="Probable pheylacetic acid degradation protein PaaD.
FT                   Homology to phaH of P. putida of 54% (trembl|Q88HS8)
FT                   Interpro: Protein of unknown function DUF59 (IPR002744)
FT                   Pfam: Domain of unknoen function DUF59 (PF01883). Domain of
FT                   unknown function DUF59;IPR002744; This family includes
FT                   prokaryotic proteins of unknown function. The family also
FT                   includes PhaH O84984 from Pseudomonas putida. PhaH forms a
FT                   complex with PhaF O84982, PhaG O84983 and PhaI O84985,which
FT                   hydroxylates phenylacetic acid to 2-hydroxyphenylacetic
FT                   acid. So members of this family may all be components of
FT                   ring hydroxylating complexes. no signal peptide no TMHs"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0307"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92924"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR011883"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:A1K269"
FT                   /protein_id="CAL92924.1"
FT                   /translation="MLTETEAWQALDAVPDPEIPVVSVTELGIIREVRCNDGAVTVVVT
FT                   PTYSGCPATEVIGLAVRDALLAAGAREVAMETQLHPAWTSDWIGEAAREKLRAYGIVPP
FT                   EGRAAPAAVQPIRFMRRTLACPRCGSTDTERLTEFGSTACKATWRCRACLEPFEYFKPI
FT                   "
FT   CDS_pept        331742..332809
FT                   /transl_table=11
FT                   /gene="paaE"
FT                   /locus_tag="azo0308"
FT                   /product="probable phenylacetic acid degradation NADH
FT                   oxidoreductase PaaE"
FT                   /function="Flavodoxin reductases (ferredoxin-NADPH
FT                   reductases) family 1"
FT                   /note="Probable phenylacetic acid degradation NADH
FT                   oxidoreductase paaE. Homology to paaE of E. coli of 50%
FT                   (sprot|PAAE_ECOLI). Probable PART OF A MULTICOMPONENT
FT                   OXYGENASE involved in aerobic degradation of phenylacetic
FT                   acid. InterPro: Oxidoreductase FAD and NAD(P)-binding
FT                   domain(IPR001433); 2Fe-2S Ferredoxin (IPR006057);
FT                   Ferredoxin (IPR001041); NADH: cytochrome b5 reductase (CBR)
FT                   (IPR001834) Pfam: Oxidoreductase FAD-binding domain;
FT                   Oxidoreductase NAD-binding domain; 2Fe-2S iorn-sulfur
FT                   cluster binding domain no signal peptide no TMHs"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0308"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92925"
FT                   /db_xref="GOA:A1K270"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR011884"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A1K270"
FT                   /protein_id="CAL92925.1"
FT                   /translation="MTPRFHPLKVAEVRRETADSVSLRFEVPADLAADYRFVQGQHLNL
FT                   KAVVNGEEVRRSYSICSGVDDGELRVAIRKVDGGRFSSWAVDAVRVGDVFEVMTPEGRF
FT                   STQLDPANAHHYVAFAAGSGITPILSLIKTTLRAEPKSRFTLVYGNRNQNSAMFAEALE
FT                   DLKDRYLTRFALYNVFSREEQEVPLFNGRLDQARVAAFLDTLIPAADIDAAFICGPGGM
FT                   IDEVEAALKGAGVPADRIHLERFGVPASAPRHHVEAGDAPQARITVIVDGLKREMEFRA
FT                   QDPSILDVALRAGLDLPYSCKGGVCCTCRAKVLEGKVRMDKNYTLEQPDIDAGYVLTCQ
FT                   AHPLTERVVISYDDR"
FT   CDS_pept        332869..333513
FT                   /transl_table=11
FT                   /gene="paaR"
FT                   /locus_tag="azo0309"
FT                   /product="putative TetR family transcriptional regulator"
FT                   /function="Transcriptional regulator"
FT                   /note="Putative TetR family transcriptional regulator,"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0309"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92926"
FT                   /db_xref="GOA:A1K271"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:A1K271"
FT                   /protein_id="CAL92926.1"
FT                   /translation="MARGKSPTFELQREAILQEAARLFADKGFHNASMAELAAACGVSK
FT                   PLLYHYYRDKEHILFDIADSYMDRLLAIVAGVEAQDLEPQPQLAELVMRFMAEYAHSQS
FT                   QHMVLVQDVKFLQAEQSEQVVGKQRKVVAAFAAAIEAVEPGLKKRKLDKPVAMILFGMI
FT                   NWTFTWLRADGRLTYADMAPVVTAILLNGVKGLLAQLPARGRKPPAEADAA"
FT   CDS_pept        333560..334762
FT                   /transl_table=11
FT                   /gene="paaJ1"
FT                   /locus_tag="azo0310"
FT                   /product="probable beta-ketoadipyl CoA thiolase"
FT                   /function="Acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="THIOLYTIC CLEAVAGE OF BETA-KETOADIPYL-COA TO
FT                   SUCCINATE AND ACETYL-COA. Entry name:- TREMBL:Q84HH5
FT                   InterPro:- IPR002155; Thiolase. Pfam:- PF02803; Thiolase_C;
FT                   1. PF00108; Thiolase_N; 1. Identities = 298/398 (74%)
FT                   Number of predicted TMHs: 0"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0310"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92927"
FT                   /db_xref="GOA:A1K272"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012793"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A1K272"
FT                   /protein_id="CAL92927.1"
FT                   /translation="MTEVFICDGIRTPIGRYGGALSGVRTDDLAALPIKALIARNSGVD
FT                   WAAVDDIYYGCANQAGEDNRDVARMAGLLAGLPIDVPGSTINRLCGSGMDAVGTAARAI
FT                   RTGETQLMIAGGVESMSRAPFVMGKADTAFSRSAKIEDTTIGWRFVNPLMKAKYGIDSM
FT                   PETAENVATDFNINRADQDAFALRSQLRYAAAAERGFYEGELVPVEIAQKKGDPLRVTA
FT                   DEHPRVTTLEALAKLKGVVRPDGTVTAGNASGVNDGSVALLLASEAAAAKHGLKPRARI
FT                   VAMATAGVEPRIMGIGPAPASRKLLALTGLSLDQMDVIELNEAFAAQALAVTRQLGLAD
FT                   DDARVNPNGGAISLGHPLGASGARLVLTALRQLEATGGRYGLCTMCIGVGQGIAMIIER
FT                   V"
FT   CDS_pept        334888..336033
FT                   /transl_table=11
FT                   /locus_tag="azo0311"
FT                   /product="probable ABC transporter substrate binding
FT                   protein"
FT                   /function="ABC-type branched-chain amino acid transport
FT                   systems periplasmic component"
FT                   /note="ABC transporter substrate binding proteins count to
FT                   the family of extracellular ligand binding proteins. It is
FT                   a component of the high affinity amino acid transport
FT                   system. Similar to trembl|Q8XU64 (71%) and to
FT                   sprot|LIVJ_ECOLI (16%). Pfam (PF01094): Receptor family
FT                   ligand binding region SignalP reporting Signal peptide."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0311"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92928"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1K273"
FT                   /protein_id="CAL92928.1"
FT                   /translation="MKLKHTLLAAIGLAFAAAAHADLNVGVVVSATGPAASLGIPEKNT
FT                   IALMPATIGGEKVNYIVLDDASDTTTAVKNIRKLLSEDKVDVVVGSTITPNSLAMIDVT
FT                   AEAATPMISMAASARIVEPIDDKKRWVFKTPQNDAQMSTAIIEHMTSNGVKTVAFIGFA
FT                   DAYGEGWYEQFKSVAEARKLQIVANERFNRTDTSVTGQVLKVMAAKPDAVLIAGSGTPS
FT                   ALPQKTLKERGYAGKYYQTHGVANNDFLRVCGKDCEGTFLPAGPVLVAAQLPDSNPVKK
FT                   AALEYINKYEAAHGKGSVSTFGAHAWDAGVLLQAAVPVALKKAKPGTKEFRAALRDALE
FT                   GVKETAGAHGIFNMSATDHLGFDQRARVMVQIQNGGWKLVQ"
FT   CDS_pept        336157..337194
FT                   /transl_table=11
FT                   /locus_tag="azo0312"
FT                   /product="ABC transporter permease protein"
FT                   /function="Branched-chain amino acid ABC-type transport
FT                   system permease components"
FT                   /note="Branched-chain amino acid transport system typically
FT                   composed of a periplasmic substrate-binding protein, one or
FT                   two reciprocally homologous integral inner-membrane
FT                   proteins and one or two peripheral membrane ATP-binding
FT                   proteins that couple energy to the active transport
FT                   system.The integral inner-membrane proteins translocate the
FT                   substrate across the membrane. Similar to trembl|Q7W5E8
FT                   (62%), to sprot|BRAD_PSEAE (25%) and to sprot|LIVH_ECOLI
FT                   (26%). Pfam (PF02653): Branched-chain amino acid transport
FT                   system / permease component TMHMM reporting nine Tmhelix."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0312"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92929"
FT                   /db_xref="GOA:A1K274"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1K274"
FT                   /protein_id="CAL92929.1"
FT                   /translation="MDFQIALLLGQDGITNGAIYALLALALVLVFAVTRVIFIPQGEFV
FT                   AYGALTLAMLQAGAVPATVWLLAGLGAVAAVLDGRGALQSGNAKKLPGIVGWNLAYPLA
FT                   LAGVLMALPVKELPLAVQVLLALAVVVPMGPYLYRVVYQPIAAAPVLILLIVSVAVHVG
FT                   MVGLGLLFFGAEGQRTPAFSDARFEVGPLLVSGQTIWVIVASIALIAALYQFFERTLYG
FT                   KALRATAINRVGAQLMGISPALAGKLTFVLAAFIGALSGVLIAPITTIYYDTGFLIGLK
FT                   GFVAAIIGGLGSYPIAAIGAVLVGLLEAFSSFWASAYKEVIVFTLIIPVLLWRSLTSHH
FT                   LEEEE"
FT   CDS_pept        337260..339053
FT                   /transl_table=11
FT                   /locus_tag="azo0313"
FT                   /product="ABC transporter ATP-binding/permease protein"
FT                   /function="ABC-type branched-chain amino acid transport
FT                   systems ATPase component"
FT                   /note="ATP-binding cassette (ABC) transporters are
FT                   multidomain membrane proteins, responsible for the
FT                   controlled efflux and influx of substances (allocrites)
FT                   across cellular membranes. The integral inner-membrane
FT                   proteins translocate the substrate across the membrane.
FT                   ATP-binding protein is for coupling the energy of ATP
FT                   hydrolysis to conformational changes in the transmembrane
FT                   domains. Similar to trembl|Q8XRX5 (54%) and to
FT                   trembl|Q8UFI6 (47%). Pfam: ABC transporter Pfam (PF02653):
FT                   Branched-chain amino acid transport system / permease
FT                   component Smart : AAA ATPase SignalP reporting Signal
FT                   peptide. TMHMM reporting nine Tmhelix."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0313"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92930"
FT                   /db_xref="GOA:A1K275"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A1K275"
FT                   /protein_id="CAL92930.1"
FT                   /translation="MLSPRLVLGVFLALLAVAPLVLPPFYVTLLNYIGLYAMVALGLVL
FT                   LTGVGGLTSFGQAAFVGLGAYTTALLCTATELPGWLAWAGGSPWLALVVGLAFTAVVAV
FT                   VLGSLTLKLSGHYLPLGTIAWGISLYFLFGTMESLGGHTGLTGIPPISIFGWVLDQGEE
FT                   IYYLIWVFLLAAVFTTQNLLDSREGRAIRALKGGMVMAEAMGVDTSRSRMIIFVIAALH
FT                   ACASGWLYAHMQRFVNPTPFGLHIGIEYLFMAVVGGAGHVWGALVGAGVITVLKQWLQD
FT                   LLPRLFGQSGNFEVIVFGLMMVIVLQRARDGLWPILTKLVPVKAKRKTLDAAAKELPRR
FT                   ELPGKGELILEAKNVTRKFGGLVANNNMSLEVKAGEILALIGPNGAGKSTMFNQISGVD
FT                   TPTSGEVLFRGKPVAGHDSREIARMGMSRSFQHVKLLPTMSVLENVAIGGHLRGDKGVL
FT                   SAAWRMDREEEARLLAEAARQIERVGLAEHMFDEAGSLALGQQRILEIARALCSDPCLL
FT                   LLDEPAAGLRFKEKEALGELLKKLKAEGMAILLVEHDMDFVMGLVDRVVVMEFGEKIAE
FT                   GLPEDVQKDPKVLEAYLGGVE"
FT   CDS_pept        339053..339814
FT                   /transl_table=11
FT                   /locus_tag="azo0314"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /function="ABC-type branched-chain amino acid transport
FT                   systems ATPase component"
FT                   /note="ATP-binding cassette (ABC) transporters are
FT                   multidomain membrane proteins, responsible for the
FT                   controlled efflux and influx of substances (allocrites)
FT                   across cellular membranes. ATP-binding protein is for
FT                   coupling the energy of ATP hydrolysis to conformational
FT                   changes in the transmembrane domains. Similar to
FT                   trembl|Q8XRX4 (68%) and to trembl|Q7WCY5 (63%). Smart: AAA
FT                   ATPases"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0314"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92931"
FT                   /db_xref="GOA:A1K276"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A1K276"
FT                   /protein_id="CAL92931.1"
FT                   /translation="MANETKNKVLEIQDLCVAYGKVEALTNANLTVGEGQIVTVIGPNG
FT                   AGKTTMLSAIMGVLNSKGKVAFDGSIEAVPEVERMVARGMNLVPEKRELFGEMTVEDNL
FT                   TLGAFQRYRMGKRDHGQTMEEVYHLFPRLKERRSQLAGTLSGGERQMLAVGRALMAKPK
FT                   LLMLDEPSLGLAPLIVREIFRIIAELRKRGVSILLVEQNARAALQVADYAYVLETGQIA
FT                   MEGPAAQLKDDPRVIEAYLGLGGKHQEMLAT"
FT   CDS_pept        340402..340677
FT                   /transl_table=11
FT                   /gene="hupB"
FT                   /locus_tag="azo0315"
FT                   /product="DNA-binding protein HU (DNA-binding protein II)"
FT                   /function="Bacterial nucleoid DNA-binding protein"
FT                   /note="DNA-binding protein HU (DNA-binding protein II)
FT                   (HB). Histone-like DNA-binding protein which is capable of
FT                   wrapping DNA to stabilize it and thus to prevent its
FT                   denaturation under extreme environmental conditions.
FT                   InterPro: Bacterial histone-like DNA-binding protein"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0315"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92932"
FT                   /db_xref="GOA:A1K277"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:A1K277"
FT                   /protein_id="CAL92932.1"
FT                   /translation="MNKGEFVEALADRLDVSRAQADRALSAVLDIISEQLGKGEKVAFT
FT                   GFGSFEVSERAARTGRNPQTGATIDIAASSVPKFTAGATLKAAVNK"
FT   CDS_pept        341121..342464
FT                   /transl_table=11
FT                   /gene="rhlE1"
FT                   /locus_tag="azo0316"
FT                   /product="putative ATP-dependent RNA helicase"
FT                   /function="Superfamily II DNA and RNA helicases"
FT                   /note="ATP-dependent RNA helicase"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0316"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92933"
FT                   /db_xref="GOA:A1K278"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1K278"
FT                   /protein_id="CAL92933.1"
FT                   /translation="MTFHALGLAEELIAAVEQSGYTTPTPVQEQAIPAAIAGGDLLVSS
FT                   HTGSGKTAAFTLPSLHRLVGRRPAPNSGPRVLVLTPTRELAQQVEEAVKTYGRALRWLN
FT                   TACLVGGAPFFAQVKQLSRPVDVVVATPGRLLDHLNRRKLKLSDVETLVLDEADRMLDM
FT                   GFAEDIEAIVGAIPASRQTLLFSATLDGVVGALANKLTRNPQRIEIASTEAKRGNIEQR
FT                   LMFADDMGHKSRLLEALLGTDGLQQAVVFTATKKSADELSLSLQEKGFSAAALHGDMHQ
FT                   TVRNRTLQRLRQGRIGVLVATDVAARGIDVAGISHVINFDPPRQVEDYVHRIGRTGRAG
FT                   RDGIAITLSGPRETGLIRAIERFTGDRLAVHTIPGLEPAPRRPSAPRPGGPGRRFGSGG
FT                   KPGGGFGGRSEGGYGGRGEGGRGAYGRDGHATRNERSHGDRRDRGPRG"
FT   CDS_pept        complement(342549..343016)
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="azo0317"
FT                   /product="putative N utilization substance protein B"
FT                   /function="Transcription termination factor"
FT                   /note="NusB protein (N utilization substance protein B
FT                   homolog) Involved in the transcription termination process
FT                   (By similarity).Belongs to the nusB family 46% 1 TIGR01951
FT                   nusB; 1"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0317"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92934"
FT                   /db_xref="GOA:A1K279"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1K279"
FT                   /protein_id="CAL92934.1"
FT                   /translation="MSSRMARRRARELALQGVYQWLLSGNSPQVVEAHVEAEAADFDKV
FT                   DRELFVMLLRGTLDNVGALQDEFSPFIHRPIEELSPIERAILLLGTHELKHNIETPYRV
FT                   VINEAIELAKAYGGTDGHRFVNGVLDKLAARLRSIEVEAARAKKDAGDGQA"
FT   CDS_pept        complement(343013..343483)
FT                   /transl_table=11
FT                   /gene="ribH"
FT                   /locus_tag="azo0318"
FT                   /product="riboflavin synthase"
FT                   /function="Riboflavin synthase beta-chain"
FT                   /EC_number="2.5.1.9"
FT                   /note="67-dimethyl-8-ribityllumazine synthase (EC 2.5.1.9)
FT                   (DMRL synthase) (Lumazine synthase) (Riboflavin synthase
FT                   beta chain). Riboflavin synthase is a bifunctional enzyme
FT                   complex catalyzing the formation of riboflavin from
FT                   5-amino-6-(1-D)- ribityl-amino-24(1H3H)-pyrimidinedione and
FT                   L-34-dihydrohy-2- butanone-4-phosphate via
FT                   67-dimethyl-8-lumazine. The beta subunit catalyzes the
FT                   condensation of 5-amino-6-(1-D)-ribityl-amino-
FT                   24(1H3H)-pyrimidinedione with L-34-dihydrohy-2-butanone-4-
FT                   phosphate yielding 67-dimethyl-8-lumazine (By similarity).
FT                   ribH: riboflavin synthase beta subunit"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0318"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92935"
FT                   /db_xref="GOA:A1K280"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1K280"
FT                   /protein_id="CAL92935.1"
FT                   /translation="MARYDNIAEFESDLNGKGLRVGIVMSRFNQDVCEGLLSACTEELQ
FT                   KLGVSPELIRIATVPGALEIPLVLQKMGQSGKFDALIALGAVIRGETYHFELVSNEMGA
FT                   GITRIGLDTGIPIANGVLTTEDDDQALARMQEKGSDCARAAVEMANLLKVLQ"
FT   CDS_pept        complement(343535..344626)
FT                   /transl_table=11
FT                   /gene="ribAB"
FT                   /locus_tag="azo0319"
FT                   /product="GTP cyclohydrolase II"
FT                   /function="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /EC_number="3.5.4.25"
FT                   /note="RibAB; riboflavin biosynthesis bifunctional protein:
FT                   GTP cyclohydrolase II and
FT                   3,4-dihydroxy-2-butanone-4-phosphate synthase InterPro:
FT                   3,4-Dihydroxy-2-butanone 4-phosphate synthase ribB:
FT                   3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0319"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92936"
FT                   /db_xref="GOA:A1K281"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:A1K281"
FT                   /protein_id="CAL92936.1"
FT                   /translation="MSALSPISEIIADIRAGKMVILVDEEDRENEGDVVLAAEFVTPEA
FT                   INFMVTHCRGLVCLTLTDERCRQLGLEQMVRNNRTPHGTAFTASIEAATGVTTGISAHD
FT                   RSRTVQVAVARHAKPDDIVMPGHIFPLTAQKGGVLIRAGHTEAGCDLAQLAGLEPAAVI
FT                   CEILKDDGTMARLPDLIEFAAQHGLKIGAIRDLIEYRAATEHLVEKVTEKDVDTPHGRF
FT                   RLSAFEDRTSGDIHFALTRGEISPDRETLVRVHEPISVVDFLDPASGKHSFPVNDALAA
FT                   IAKAEAGAIVLLYRPQSGTDLLASLTGTTVERPVKWDPRLFGVGAQILRALGVGRMRLL
FT                   ANPRKIPSMAGFGLEITGFVEKP"
FT   CDS_pept        complement(344623..345237)
FT                   /transl_table=11
FT                   /gene="ribE"
FT                   /locus_tag="azo0320"
FT                   /product="riboflavin synthase"
FT                   /function="Riboflavin synthase alpha chain"
FT                   /EC_number="2.5.1.9"
FT                   /note="Riboflavin synthase alpha chain (EC 2.5.1.9).
FT                   Riboflavin synthase is a bifunctional enzyme complex
FT                   catalyzing the formation of riboflavin from
FT                   5-amino-6-(1-D)- ribityl-amino-24(1H3H)-pyrimidinedione and
FT                   L-34-dihydrohy-2- butanone-4-phosphate via
FT                   67-dimethyl-8-lumazine. The alpha subunit catalyzes the
FT                   dismutation of 67-dimethyl-8-lumazine to riboflavin and
FT                   5-amino-6-(1-D)-ribityl-amino-24(1H3H)- pyrimidinedione.
FT                   ribE: riboflavin synthase alpha subunit"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0320"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92937"
FT                   /db_xref="GOA:A1K282"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:A1K282"
FT                   /protein_id="CAL92937.1"
FT                   /translation="MFSGIVAACGRIERIEPLADGLRLTVDTAGLDLADVQIGDSIANS
FT                   GVCLTVIERDGPRVRFDVSRETLNCTVGLDVEGGEVNLEKALQLSDRLGGHLVTGHVDG
FT                   VGEVLKFAPIGESHELVIRAPGAIAGYIAKKGSVTVNGVSLTVNRVEGPDFSINLIPHT
FT                   VAVTNLKHLKAGSRVNLEIDLIARYVERMLAWREEESKDKP"
FT   CDS_pept        complement(345296..347116)
FT                   /transl_table=11
FT                   /gene="cutA2"
FT                   /locus_tag="azo0321"
FT                   /product="putative protein disulfide-isomerase"
FT                   /function="Thiol:disulfide interchange protein"
FT                   /EC_number="5.3.4.1"
FT                   /note="Putative Protein disulfide-isomerase (EC 5.3.4.1).
FT                   Homology to dsbD of E. coli of 37% (sprot|DSBD_ECOLI).
FT                   Required to facilitate the formation of correct disulfide
FT                   bonds in some periplasmic proteins and for the assembly of
FT                   the periplasmic c-type cytochromes. Acts by transferring
FT                   electrons from cytoplasmic thioredoxin to the periplasm.
FT                   This transfer involves a cascade of disulfide bond
FT                   formation and reduction steps (By similarity). Pfam:
FT                   Cytochrom C biogenesis protein transporter signal peptide
FT                   probable 8 TMHs"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0321"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92938"
FT                   /db_xref="GOA:A1K283"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR022910"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036929"
FT                   /db_xref="UniProtKB/TrEMBL:A1K283"
FT                   /protein_id="CAL92938.1"
FT                   /translation="MIHRLFALLAILACLLAHPARASEPIEPEKAFAMQARALDAQTVE
FT                   VVFEIAKDYYLYGSKFRFSAQPAGVTLGEVQRPPGKLKHDEFFGEVETYRGTLRMLVPV
FT                   AAPAGVDAIELTVSSQGCWDGGVCYPPLPQQARVALVAASPAAGASLLDGALARGDVLA
FT                   SDAVAPPAAVSLDESGRIAGLLRDASVPLVLASFFGFGLLLAFTPCHFPMIPILSGIIV
FT                   GGGGQHLSRTRTFALSLAYVLGMAVTYALAGVGAGLSGTLLVAALQNVWVLSAFALVFV
FT                   ALALSMFGFYELQLPSALQSRIADTASHNKGGHLGGVAAMGALSALIVGPCLAAPLAGA
FT                   LLYIARSGDAALGGGALFAMGLGLGAPLLAVGMATRSVLPKVGPWMDGVKKAFGVILLG
FT                   VAIWLLMPVLPPLAGMLAWAALLLFSGIFLHALDPLPPHAHGWQRFWKGVGVVLAIGGA
FT                   AMLVGALAGSRDPLQPLAVLRAEASPAAETVRFERVGSLAELESRLAAAERPVMLDFYA
FT                   DWCVSCKEMERYTFPDPQVAQRLAQMTLLKADVTANSEEHKALLKRFGLFGPPGIIFFD
FT                   GAGRERTDLRVVGFQKPEAFAGVLDSALRR"
FT   CDS_pept        complement(347169..347492)
FT                   /transl_table=11
FT                   /gene="cutA1"
FT                   /locus_tag="azo0322"
FT                   /product="periplasmic divalent cation tolerance protein"
FT                   /function="uncharacterized protein involved in tolerance to
FT                   divalent cations"
FT                   /note="Periplasmic divalent cation tolerance protein .36%
FT                   similarity to E.coli CutA1 protein involved in copper
FT                   tolerance. InterPro:IPR004323; CutA1. Pfam:PF03091; CutA1;
FT                   1."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0322"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92939"
FT                   /db_xref="GOA:A1K284"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:A1K284"
FT                   /protein_id="CAL92939.1"
FT                   /translation="MSEILLVLTTLPDADSAAALGARLVEERLAACVNILAPCASVYRW
FT                   QGRVETATEVPLLIKTSAARYAALETAILAEHPYELPEIVAVPVQRGLPGYLDWVSTET
FT                   APG"
FT   CDS_pept        complement(347536..348780)
FT                   /transl_table=11
FT                   /gene="naoA"
FT                   /locus_tag="azo0323"
FT                   /product="2-nitropropane dioxygenase."
FT                   /function="Dioxygenases related to 2-nitropropane
FT                   dioxygenase"
FT                   /EC_number="1.13.11.32"
FT                   /note="TREMBL:Q7MBF3: 80% identity, 89% similarity
FT                   InterPro:IPR004136; 2nprop_dioxygen. IPR003009; FMN_enzyme.
FT                   Pfam: PF03060; NPD tim: triosephosphate isomerase
FT                   Non-secretory protein with no signal peptide. TMHMM
FT                   predicted no transmembrane helices."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0323"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92940"
FT                   /db_xref="GOA:A1K285"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="UniProtKB/TrEMBL:A1K285"
FT                   /protein_id="CAL92940.1"
FT                   /translation="MKRVDDFRLRLGSKELVPIMVGGMGVDISTAELSLEAARLGGIGH
FT                   ISDAMVPTVSDRRFNTKYVKNKLQQYKFNVANPDKSVVQFDLGLLAEATALHVGKTMEA
FT                   KRGDGLVFINCMEKLTMNGPKETLRVRLQAAMDAGIDGITLAAGLHLGSFALIQDHPRF
FT                   NDVKLGIIVSSLRALQLFLKKNGRTGRLPDYVVVEGPLAGGHLGFGMDWAKYDLATIVA
FT                   EIRDWLHAEQLDIPLIPAGGIFTGSDAVRFLEMGAGAVQVATRFTVTQECGLPEDVQQE
FT                   YFKAGEDDIEVNQISPTGYPMRMLKNSPAIGDGIRPNCEAYGYLLDASGNCQYIDAYNR
FT                   EVAAHPEARKVKVWDKTCLCTHMRNFECWTCGQYTYRLKDTTRRNEDGTYRVLSAEHVF
FT                   HDYQFSTDDRIALPD"
FT   CDS_pept        348990..349301
FT                   /transl_table=11
FT                   /locus_tag="azo0324"
FT                   /product="conserved hypothetical protein"
FT                   /note="Conserved hypothetical protein. Homology to GSU0176
FT                   of G.sulfurreducens of 42% (tremble:Q74GR9) No domains
FT                   predicted. No signal peptide or TMH reported present."
FT                   /db_xref="EnsemblGenomes-Gn:azo0324"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92941"
FT                   /db_xref="InterPro:IPR018961"
FT                   /db_xref="UniProtKB/TrEMBL:A1K286"
FT                   /protein_id="CAL92941.1"
FT                   /translation="MSLSVFDILAEQRIADALRRGEFDHLPGAGRPLVFDDEPLLSPEQ
FT                   RMANHILKNAGVTPPEIGLRREIAALRARLETLDGEARARARRELGQLVLRLAELQRR"
FT   CDS_pept        349421..350749
FT                   /transl_table=11
FT                   /locus_tag="azo0325"
FT                   /product="putative flavocytochrome protein"
FT                   /function="predicted ferric reductase"
FT                   /EC_number="1.14.-.-"
FT                   /note="Putative flavocytochrome protein. 48%
FT                   FAD_binding_6.IPR001433; Oxred_FAD/NAD(P). Pfam:PF00970;
FT                   FAD_binding_6; 1.PF00175; NAD_binding_1; 1. TMhelix: 6.
FT                   Siganl peptide: present."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0325"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92942"
FT                   /db_xref="GOA:A1K287"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A1K287"
FT                   /protein_id="CAL92942.1"
FT                   /translation="MKNIKLAFLVPPVVLTLLWLAADPVLWGEIRFFPLRAALMNYTGI
FT                   LGIAAMSVGVMLAARPAWADARLGGLDKGYRLHKWLGIAGLVIATLHWALAKLPKWMVG
FT                   WGWLERPLRGPRAEQSVAIFRFFQEQRGLAETVGEWAFHAALVLIALALIKRFPYRRFV
FT                   RTHHLLAVVYLALVFHAVVLMKFSYWSEPLGPLMALLMAGGTLAALASLFRRVGRSRQV
FT                   SGEIEELVRHPDNGVLRVGVRLRGRWPGHQAGQFAFVSFDATEGPHPFTICSAWTGDGR
FT                   LVFMIKGLGDYTARLPDTLKVGDPVRVEGPYGRFDFAGARPRQVWVAGGIGITPFVARL
FT                   QALAGQHDGRPVDLFYSTAAPDEGFIARLRQHAERAGVALHVQVTPIQGRLDAGRIRAE
FT                   VPAWKEADFWFCGPAAFGNTLRAELTAGGLGAGDFHQELFEMR"
FT   CDS_pept        350997..351800
FT                   /transl_table=11
FT                   /locus_tag="azo0326"
FT                   /product="conserved hypothetical protein"
FT                   /note="conserved hypothetical protein. Homology to cv0811
FT                   of C. violaceum of 43% (trembl|Q7NPT0(SRS) no domains
FT                   predicted no signal peptide no TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:azo0326"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92943"
FT                   /db_xref="InterPro:IPR021390"
FT                   /db_xref="UniProtKB/TrEMBL:A1K288"
FT                   /protein_id="CAL92943.1"
FT                   /translation="MSSAAESPATYADRPLFEPVATLLAAFPAGLPDHAGLQHLFEQAA
FT                   PEAVSGGGRPIRFVLPDDSRPAYEVRIHASGEVPTRAGDWHDFFNALAWCVWPRTKAAC
FT                   NALHLQEIAAREVSGAQGRGPRRDALTQFDECGVVVVSADADIPALLADHQWEAVFWQR
FT                   RARLQASTRFLVFGHGSWDQLRRPFFGLCAKAIHRVVEPDWLQLPPAAQQAEVDAWLAA
FT                   HLASLPTLTPRAFSPLPLLGIPGVTPDSEHAGYYRDTRQFRPRRR"
FT   CDS_pept        complement(351835..352428)
FT                   /transl_table=11
FT                   /locus_tag="azo0327"
FT                   /product="putative TetR family transcriptional regulator"
FT                   /function="Transcriptional regulator"
FT                   /note="Putative TetR family transcriptional regulator,"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0327"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92944"
FT                   /db_xref="GOA:A1K289"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A1K289"
FT                   /protein_id="CAL92944.1"
FT                   /translation="MRVSREQAAENRERVVQEASRLFREHGFDGIGVAELMKQAGLTHG
FT                   AFYGQFGSKDALMAEASARALADSLSYWKRRVAAAGEDGLTSIVNKYLSPAHRDHPGRG
FT                   CAFAALGAEAHRRNPAVRQAMSAGLLPLVDELARLLPDSPGADRRQQALAAFSAMVGAL
FT                   VLARAVDDAALSEEILRATAASITAGATPAQPER"
FT   CDS_pept        352603..353745
FT                   /transl_table=11
FT                   /gene="livK1"
FT                   /locus_tag="azo0328"
FT                   /product="putative leucine-specific binding protein"
FT                   /function="ABC-type branched-chain amino acid transport
FT                   systems periplasmic component"
FT                   /note="In enteric bacteria such as E. coli and Salmonella
FT                   typhimurium, periplasmic binding proteins are found to
FT                   participate in the transport of amino acids, sugars and
FT                   ions. Leucine-specific binding protein are coded by livK
FT                   and livJ. Similar to sprot|LIVK_SALTY (23%) and to
FT                   trembl|Q8XUX2 (46%). Pfam (PF01094): Receptor family ligand
FT                   binding region SignalP reporting Signal peptide."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0328"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92945"
FT                   /db_xref="GOA:A1K290"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1K290"
FT                   /protein_id="CAL92945.1"
FT                   /translation="MPSLLRPFRLAAGLLALLVPLAPSGAAAQTRELVIGQVAPFSGPQ
FT                   AVTGKAIHAGIRLYFDQVNAQGGVKGARLRLVTRDDAQKPEQTVALARELIQQEAPVAL
FT                   IGTVGTTNVDALIADGVLVRAGLPLVGAVSGASSAIGGRNVFVTKASYHDEVNRLFTSL
FT                   SGLGMKRVGLVYQDDALGQDVIAGADAAAPRAGISLIARAGYERNTVKVEQAVEAMLKA
FT                   NPQVVFLGATTAAAIEFVRQYRARGGDATLYGLSIIDTRQLVAQLGPAGARGFAFSVVL
FT                   PLEGQQTIEVNREYLRLRAASTDPDLSGRSIEGFIAAKALVHALRSAEGAPGGGAVLKS
FT                   LQAMRKVDLGGYMLDFGQPGRPGSSYVDFAMLGDGGRVVH"
FT   CDS_pept        complement(353800..354273)
FT                   /transl_table=11
FT                   /locus_tag="azo0329"
FT                   /product="conserved hypothetical protein"
FT                   /note="Conserved hypothetical protein. Homology to SCO5300
FT                   of Streptomyces coelicolor of 46% (tremble:Q9XAE9). No
FT                   domains predicted. No TMHs. No signal peptide."
FT                   /db_xref="EnsemblGenomes-Gn:azo0329"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92946"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR021708"
FT                   /db_xref="UniProtKB/TrEMBL:A1K291"
FT                   /protein_id="CAL92946.1"
FT                   /translation="MQLAELNVARLLAPIDSPQLAGFVNQLDEINALAEASPGFVWRFD
FT                   GDARLGTTSVPDDPLLLINLSVWQDVDALFAFTYQSLHKRPLGGRRDWFERPTEAHLVM
FT                   WWVEDGHRPGVDEALARLALLRRDGPGPRAFDFRCRFAADGRECAAKPGTVTA"
FT   CDS_pept        complement(354344..355339)
FT                   /transl_table=11
FT                   /gene="blaA"
FT                   /locus_tag="azo0330"
FT                   /product="probable transcriptional regulator, LysR family"
FT                   /function="Transcriptional regulator"
FT                   /note="HTH-type transcriptional regulator blaA
FT                   (Beta-lactamase regulatory protein blaA). Positive
FT                   regulator of the expression of the gene (blab) for
FT                   beta-lactamase. Similar to SWISSPROT: sprot|BLAA_PROVU (32%
FT                   Proteus vulgaris, HTH-type transcriptional regulator BlaA)
FT                   InterPro: IPR000847 HTH_LysR. IPR009058 Winged helix
FT                   DNA-binding. Pfam: PF00126 Bacterial regulatory
FT                   helix-turn-helix protein, lysR family. HTH reporting
FT                   nucleic acid binding motif."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0330"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92947"
FT                   /db_xref="GOA:A1K292"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1K292"
FT                   /protein_id="CAL92947.1"
FT                   /translation="MEAPGKLPPLPALRSFEAAARLLSFSRAADELHVTHGAVSHQIRA
FT                   LEAQLGLALFARDTRGLRLTPAGEALLQATNGALRGIADAVAGLRRHLRPDRLSVSVMP
FT                   SFAGRWLAPRLAAFLDANPGCELNVLSSDAITDFARDGTDLAIRWGFGGYSGVHSELLM
FT                   DDVMFPVVSPHFAGGVPRTPAGLAGLPLLRSVGEDWLPWFRAAGLDWPEPSRGLVLSDS
FT                   GLLVQAAIDGQGVALARRSLAMRAVREGRLLKPFDIEVPLLYGPGQGKPPSLGLAPDGT
FT                   PKRWRFWLVWPLTPAPTPLLQRFVAWLHAEVAAELDAAAATPASSALTGL"
FT   CDS_pept        355556..356023
FT                   /transl_table=11
FT                   /locus_tag="azo0331"
FT                   /product="conserved hypothetical protein"
FT                   /note="Conserved hypothetical protein, 41% similarity to
FT                   TrEMBL;Q88JC7. Has IPR005544 DUF_HHE:PF03794;Domain of
FT                   Unknown function:This domain normally occurs as tandem
FT                   repeats and is found in bacteria, yeast and plants. It
FT                   contains two fully conserved histidines and one glutamate
FT                   residue. Members of the family include DnrN, NorA and ScdA,
FT                   which have been implicated in NO response and cell wall
FT                   physiology. Has no Signal peptide or TMH reported present."
FT                   /db_xref="EnsemblGenomes-Gn:azo0331"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92948"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:A1K293"
FT                   /protein_id="CAL92948.1"
FT                   /translation="MNKSSLPTGLKDVLGALLEDHREAKKLFKDFEKAKSSEEKEEIAR
FT                   TVCEALTLHTQLEEEFFYPAVRELESDSIKALLDEAEVEHASAKELIQQIEGIGADDAL
FT                   FEAKVTVLGEYVSHHIREEEEELFPKLVEEKVDLREVGAAMEEKRNELVAH"
FT   CDS_pept        complement(356048..357376)
FT                   /transl_table=11
FT                   /locus_tag="azo0332"
FT                   /product="putative esterase"
FT                   /function="predicted esterase of the alpha-beta hydrolase
FT                   superfamily"
FT                   /note="Hypothetical protein yqhO. This family consists of
FT                   various patatin glycoproteins from the total soluble
FT                   protein in potato tubers.Patatin is a storage protein but
FT                   it also has the enzymatic activity of lipid acyl hydrolase,
FT                   catalysing the cleavage of fatty acids from membrane lipids
FT                   SPROT:P54513: 23% identity, 33% similarity SubtiList:
FT                   BG11703; yqhO. InterPro:IPR002641; Patatin. Pfam:PF01734;
FT                   Patatin No signal peptide TMHMM predicted 2 transmembrane
FT                   helices mobB: molybdopterin-guanine dinucleot"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0332"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92949"
FT                   /db_xref="GOA:A1K294"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:A1K294"
FT                   /protein_id="CAL92949.1"
FT                   /translation="MNAADFHRAADAALAAMTAEGLDRRRYSDTLDGEGYQYVDLVMEG
FT                   GGVLGVALLGYIHVLEKAGLRFVGLGGASAGSITALALAALDVPAAAKSDRLIEIVANM
FT                   PMADFIDGKDDDDEDAADFIDTLLKRPGLAKLAWKGMQILDNLDEMIGLNRGDRFHRWL
FT                   TEDVLRAHGIHTTAQLRARMATTPAGWHLREDSPQRESQLRGEARLAPLDPAADYLCVV
FT                   AADVATETKVEFPCMAALYWDEPDQVNPADYVRCSMSIPVFFKPVTRPIRIRDAAHEAL
FT                   WRDLAGMGDDDLKPTRFPPPRAVFVDGGVLSNFPIDVFHRPNKVPARPTFGVKLQWDER
FT                   SHDVNKLAKLITQTFNSARHCLDYEFIRRNPDFKQLVACIDTADHDWLKFEMPDEAKLD
FT                   LFRRGAEAAVGFLRRFDWARYKETRAHLAAAYTTAQQPQIVHL"
FT   CDS_pept        357462..358568
FT                   /transl_table=11
FT                   /locus_tag="azo0333"
FT                   /product="putative esterase"
FT                   /function="predicted esterase of the alpha-beta hydrolase
FT                   superfamily"
FT                   /note="Hypothetical protein Rv1063c/MT1093/Mb1092c.
FT                   TREMBL:Q89EP5: 29% identity, 42% similarity
FT                   InterPro:IPR002641; Patatin. Pfam:PF01734; Patatin 2A0108:
FT                   nitrate transporter Absence of signal peptide No. of TMH's:
FT                   2 (TMHMM predicted)."
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0333"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92950"
FT                   /db_xref="GOA:A1K295"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR021095"
FT                   /db_xref="UniProtKB/TrEMBL:A1K295"
FT                   /protein_id="CAL92950.1"
FT                   /translation="MEVMNHTEPLPVALILGGGLALGAYQAGVLAALETSREVRIVAVT
FT                   GASIGAINGALLAGNRPAERVNRLRGFWDRVTTDLAPGWLEPAGRTGPFRHARNWVNTL
FT                   GTHLAGARGLYRPRIFFDSGPSAVPSFYDSSLAAATLAQLVDFDVLNGGAVRYCAVATD
FT                   VETAAAVPFDTAAGVRIGIPHLLASSALMPSFAPVAIDGRLYADGGLAANAPLELFLSS
FT                   ARVGPLPPLCILIDLFAPQSPPPRTLEAAMARGSDLKFAAQTRLRLEAIERERSLEAAL
FT                   ALPAADAADEGPAGAAPGTELIYLSYRPLAHDAGSEKQYDFSRPTLADRWQRGEDDAAE
FT                   VLRMVAAVAPAAGAQPGLRIHRCGAWVR"
FT   CDS_pept        complement(358579..359157)
FT                   /transl_table=11
FT                   /locus_tag="azo0334"
FT                   /product="conserved hypothetical secreted protein"
FT                   /function="predicted outer membrane protein"
FT                   /note="Conserved hypothetical secreted protein. Homology to
FT                   BPP2140 of Bordetella parapertussis 0f 44%
FT                   (trembl|Q7W8J3(SRS)) No domains predicted. Signal peptide
FT                   present. No TMH present. 6PTHBS: 6-pyruvoyl
FT                   tetrahydrobiopterin"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0334"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92951"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR025419"
FT                   /db_xref="UniProtKB/TrEMBL:A1K296"
FT                   /protein_id="CAL92951.1"
FT                   /translation="MSATRLTRHALVACAALFATGALAQSSYPPAPTGDKSSERRMENR
FT                   LASEDRDFLENASQAGQVEIEGSRLAEEKATSAEVKTFAKQMIEDHTKAHRELVTLATR
FT                   KGFTLPDEGSIMQRTELTALKAVSGETFDKMYASRIGVNAHEKTLELFREAASKAKDPE
FT                   IKAYAAKYVPALEKHLGMARTLRDRVGKE"
FT   CDS_pept        359461..360240
FT                   /transl_table=11
FT                   /locus_tag="azo0335"
FT                   /product="EAL-domain containing protein"
FT                   /function="FOG: EAL domain"
FT                   /note="EAL-domain containing protein, ):This domain is
FT                   found in diverse bacterial signaling proteins. It is called
FT                   EAL after its conserved residues. The EAL domain is a good
FT                   candidate for a diguanylate phosphodiesterase function [1].
FT                   The domain contains many conserved acidic residues that
FT                   could participate in metal binding and might form the
FT                   phosphodiesterase active site."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0335"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92952"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A1K297"
FT                   /protein_id="CAL92952.1"
FT                   /translation="MSDHPPCAGCSGQPLAFGFSYAYQPIVDLAARQIFAHEALVRGPA
FT                   GEGAGTVLAQVNADNRYRFDQACRVRAIETAARLGMQSRLSINFLPNAIQRPDLCIRST
FT                   LEAARLHGFPLERIIFESVEGERIADARWLAEVFREWQHHGFLTAIDDFGAGYAGLNLL
FT                   ADFQPDLVKLDMGLVRAVHRHPARQAIVRGVARICEELDIPVVAEGVEELDEARCLSDA
FT                   GIRLMQGFLFCRPLFEGVGEAATLAWPALAPQAGGRQ"
FT   CDS_pept        360237..361499
FT                   /transl_table=11
FT                   /locus_tag="azo0336"
FT                   /product="PAS/PAC/GGDEF-domain containing protein"
FT                   /function="FOG: PAS/PAC domain"
FT                   /note="PAS/PAC/GGDEF-domain containing protein, suggesting
FT                   involvement into signalling processes. Similarity to
FT                   SWISSPROT: sprot|YDAM_ECOLI (24% Escherichia coli, hyp.
FT                   protein) / TREMBL: trembl|Q887F0 (59% Pseudomonas syringae,
FT                   hyp. protein) Pfam: PF00990 GGDEF domain. This domain is
FT                   found linked to a wide range of non-homologous domains in a
FT                   variety of bacteria. The function of this domain is
FT                   unknown, however it has been shown to be homologous to the
FT                   adenylyl cyclase catalytic domain. This prediction
FT                   correlates with the functional information available on two
FT                   GGDEF-containing proteins, namely diguanylate cyclase and
FT                   phosphodiesterase A of Acetobacter xylinum, both of which
FT                   regulate the turnover of cyclic diguanosine monophosphate.
FT                   TIGRFAM:TIGR00254 putative diguanylate cyclase (GGDEF)
FT                   domain. TIGR00229 PAS domain S-box."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0336"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92953"
FT                   /db_xref="GOA:A1K298"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A1K298"
FT                   /protein_id="CAL92953.1"
FT                   /translation="MSSQREKLLEAAVAQSFNAVVITDARLDGGGPHIVYVNRAFCEMT
FT                   GYAAEDLIGQSPRILQGPDTDPEVIDRLRTALRSGSFFEGATVNYRRDGSAYDVEWNIS
FT                   PVRDDGGELSHFVSVQHNISDKMWMRRERDLLAQALNVASDPIIVTDRGGAIVFVNQAF
FT                   ERLTGYPADEMLGRTPAVLRSGAHDAAFYSGLYAALARGRPFRATFTNRRKDGSLFHAE
FT                   QSIAPLCDGEGEVTHFVSVSKDLTERIERERALQEIASRDPLTGLYNRRAGEQALELQV
FT                   QAAHAEGTALSLIIGDIDHFKSINDRHGHPAGDRVLAGVGEALRGAVRSRDLAVRWGGE
FT                   EFVVLVPECGAARALELAERLRSSVAGLQFPAVGRVTMSLGLATLVAGETAAGLVMRAD
FT                   RALYRAKHGGRDRVETAAALD"
FT   CDS_pept        complement(361535..362107)
FT                   /transl_table=11
FT                   /locus_tag="azo0337"
FT                   /product="Hypothetical protein"
FT                   /note="Probable hypothetical Protein. Extremely weak
FT                   homology with hits in the PDB. No Motif/Features/TMH/ or
FT                   Signal peptide present."
FT                   /db_xref="EnsemblGenomes-Gn:azo0337"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92954"
FT                   /db_xref="UniProtKB/TrEMBL:A1K299"
FT                   /protein_id="CAL92954.1"
FT                   /translation="MRATSNPPGLEHQGYEFFPPYDETGATVISWEIQVQTAQDFHEAC
FT                   PRDDEACQWRDPLEASGDFRPTMQTVVRINTLNVALRERLLRLTNDMSNLAIAEMGMRK
FT                   STDAGGAEMAAGPEPLSEDSAQRLMALTRAWFDIIGMAQASMGTLTGYMPRTADRTAAS
FT                   ADYADRPLVERRQNVRHIDFADRRRAG"
FT   CDS_pept        362400..363443
FT                   /transl_table=11
FT                   /gene="pstS1"
FT                   /locus_tag="azo0338"
FT                   /product="putative phosphate-binding periplasmic protein"
FT                   /function="ABC-type phosphate transport system periplasmic
FT                   component"
FT                   /note="38% Peri-phosph.IPR006059; SBP_bac_1. Pfam:PF01547;
FT                   SBP_bac_1; 1. TIGRFAMs:TIGR00975; 3a0107s03; 1. Signal
FT                   peptide present."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0338"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92955"
FT                   /db_xref="GOA:A1K2A0"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2A0"
FT                   /protein_id="CAL92955.1"
FT                   /translation="MAIRFLLLLSLAWSACVAAAPDVLRGAGSSAAQPVYAAWAAAYAA
FT                   THGTVLEYDPAGSGAGIKKLLAAEVDFGASDLVPDAAALQGRDIVVVPTAVTGAVPVIN
FT                   LPGLRGALRLDGATLAEIFAGRIRRWDDAAIRRLNPGLTLPERAIERVVRSDSSGTTWN
FT                   FADYLAKLSPRWRAEFGVAARFDWGEGVIAAKGSGGVAEAVARTPGAIGYVDYNYVVRH
FT                   GLQAVTLQNRDGAFVQAGTDGFAAALSASPWPRSGDFTATLTDQPGARSWPITMGTFIL
FT                   VPRHGGGDGVRRALAFFTWAYLHGDELIRSSHFVRLPDRVQAKAFRSLAAVTDANGTPI
FT                   GFGGLAR"
FT   CDS_pept        complement(363495..363989)
FT                   /transl_table=11
FT                   /locus_tag="azo0339"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="Conserved hypothetical membrane protein. Homology to
FT                   an orf of Acinetobacter sp. (strain ADP1) of 43%
FT                   (tremble:Q6F6W4). no domains predicted. signal peptide. 1
FT                   TMHs"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0339"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92956"
FT                   /db_xref="GOA:A1K2A1"
FT                   /db_xref="InterPro:IPR013229"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2A1"
FT                   /protein_id="CAL92956.1"
FT                   /translation="MKKPFLAIAALSLAGCATIIGSTTQPVTIKTEPEGAQISVSNRAG
FT                   EKIHSGSTPVTVTLNRGAGYFKAETYTVRIAKEGYEPREVVLEGHVNGWYFGNIIFGGV
FT                   ILGMLIVDPLSGAMFTLSPDKVDEALQKTGVTGSKDDGSLTVVLIENVPEEVLRTARRV
FT                   N"
FT   CDS_pept        complement(364232..364546)
FT                   /transl_table=11
FT                   /locus_tag="azo0340"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="Conserved hypothetical membrane protein. No homology
FT                   to the data bank No domains predicted No signal peptide 2
FT                   TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:azo0340"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92957"
FT                   /db_xref="GOA:A1K2A2"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2A2"
FT                   /protein_id="CAL92957.1"
FT                   /translation="MLAGDPLLLRARDAGHGRDQDDCIESPYAVTFPFRPRMLEVLLIL
FT                   AQALLEFLFHTVLYGAGWLMLRALTLGRYPPPRPIEHNHDLVALLPLVTVLVTIAFAYA
FT                   "
FT   CDS_pept        364615..365061
FT                   /transl_table=11
FT                   /locus_tag="azo0341"
FT                   /product="putative cytochrome c'"
FT                   /function="Cytochrome c556"
FT                   /note="Putative cytochrome c'. Homology to cytochrome c of
FT                   R. gelatineosus (sprot|CYCP_RHOGE). CYTOCHROME C IS THE
FT                   MOST WIDELY OCCURRING BACTERIAL C-TYPE CYTOCHROME.
FT                   CYTOCHROMES C ARE HIGH-SPIN PROTEINS AND THE HEME HAS NO
FT                   SIXTH LIGAND. THEIR EXACT FUNCTION IS NOT KNOWN. InterPro:
FT                   Cytochrome c class II (IPR002321) Pfam: Cytochrome C
FT                   probable signal peptide no TMHs"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0341"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92958"
FT                   /db_xref="GOA:A1K2A3"
FT                   /db_xref="InterPro:IPR002321"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="InterPro:IPR012127"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2A3"
FT                   /protein_id="CAL92958.1"
FT                   /translation="MPRPLLPALLILLTLAGCGPVEDTRPGQPVKQRQEAFKSILRSFE
FT                   PMGVMLRDNKYQADKFASLAGELVAKRDAPWSHFGPDTNYPPTKAKAAVWSDGETFERE
FT                   RLAFVAATDALFAAAQTRDQAQAKAAYEKVYGSCKSCHDRFKEK"
FT   CDS_pept        complement(365077..365901)
FT                   /transl_table=11
FT                   /gene="nhoA"
FT                   /locus_tag="azo0342"
FT                   /product="N-hydroxyarylamine O-acetyltransferase"
FT                   /function="Arylamine N-acetyltransferase"
FT                   /EC_number="2.3.1.118"
FT                   /note="Belongs to the arylamine n-acetyltransferase family.
FT                   Arylamine N-acetyltransferase is a cytosolic enzyme of
FT                   approximately 30kDa. It facilitates the transfer of an
FT                   acetyl group from Acetyl Coenzyme A on to a wide range of
FT                   arylamine, N-hydroxyarylamines and hydrazines. Similar to
FT                   TREMBL:Q98D42 (47% identity); TREMBL:Q8FHI6 (39% identity);
FT                   SWISSPROT:P77567 (39% identity). InterPro (IPR001447):
FT                   N-acetyltransferase Pfam (PF00797): N-acetyltransferase."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0342"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92959"
FT                   /db_xref="GOA:A1K2A4"
FT                   /db_xref="InterPro:IPR001447"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2A4"
FT                   /protein_id="CAL92959.1"
FT                   /translation="MTPPLDLDAYLARIGGLAAAPDTTLTTLNALIAQHVAAIPFENLS
FT                   PLLGEPVDISPAAVQAKLVAGGRGGYCYEHNRLFADVLRHLGFTVHELGARVVWNQPPG
FT                   AITPRSHMLLEVDTADGPRLVDVGFGGLTLTSALRLQADIEQITPHEPFRLLRDGDDWT
FT                   LQARLGEAWKPLYRFDRVRHHACDYIAPNYFLATHPDSVFTANLMLARAGRNQRWTLFN
FT                   RDYAEYHGDGRIVRRTLADMAELTEVLQRAFGIPPALCATAQPRLARLFDAG"
FT   CDS_pept        366042..366704
FT                   /transl_table=11
FT                   /gene="parA2"
FT                   /locus_tag="azo0343"
FT                   /product="probable ParA family protein"
FT                   /function="ATPases involved in chromosome partitioning"
FT                   /note="Sporulation initiation inhibitor protein soj.
FT                   INHIBITS THE INITIATION OF SPORULATION SPO0J ANTAGONIZES
FT                   THIS INHIBITION. SOJ ULTIMATELY INHIBITS THE ACTIVATION
FT                   (PHOSPHORYLATION) OF SPO0A. IT IS NOT REQUIRED FOR
FT                   CHROMOSOME PARTITIONING. InterPro: ParA family ATPase"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0343"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92960"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2A5"
FT                   /protein_id="CAL92960.1"
FT                   /translation="MGGTRIVALLSQKGGSGKTTVAMQLAAGLALAGYRVVVADLDPQE
FT                   SASRWADAAAPEAPFPAPVMRLRGSAEDMRQALRAAANRADFVVFDCPPSIDHPHTGSA
FT                   LALCDLALVPVVPSPTDLWATRGMEKLILNQMATRAPLRAALLPNRVMRTALAADVLEV
FT                   LGDFSLPVLDAALTQRSAYAQSAVQGASVYELGRSAQPAQAEVDRLVAAVLNQFEES"
FT   CDS_pept        366705..367574
FT                   /transl_table=11
FT                   /locus_tag="azo0344"
FT                   /product="Hypothetical protein"
FT                   /note="Probable Hypothetical Protein. No
FT                   domains,features,motifs, or signal peptide present."
FT                   /db_xref="EnsemblGenomes-Gn:azo0344"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92961"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2A6"
FT                   /protein_id="CAL92961.1"
FT                   /translation="MASTKTQSALRAALKQEDAALTERLPAAGAPAKPKAAKAAAVKPV
FT                   VAEQGKLADALIVPPAEGDGAAKAKPAAAAGPAKPAATKKQAAPVAGKTKAKSTAAKGS
FT                   AASKAAAAPAPVAETAAGSPAGAAKAKAKAAPVKTRPAAAAAAPAVEPAVTPAPAAAKK
FT                   AKAIRNGGAAVSKAAAAPAAELAVAPEAAAKTKAKVEKAEKAEKAEKTDKADKVEKVVR
FT                   DSFSLPASEHRRIKSVREQLGKSGRLVSKSEVLRVALVALGERSADELAALFDALPPVV
FT                   KGKRSKKH"
FT   CDS_pept        complement(367763..369865)
FT                   /transl_table=11
FT                   /locus_tag="azo0345"
FT                   /product="ATP-dependent DNA helicase"
FT                   /function="Superfamily I DNA and RNA helicases"
FT                   /EC_number="3.6.1.-"
FT                   /note="ATP-dependent DNA helicase pcrA (EC 3.6.1.-).
FT                   InterPro: UvrD/REP helicase"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0345"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92962"
FT                   /db_xref="GOA:A1K2A7"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2A7"
FT                   /protein_id="CAL92962.1"
FT                   /translation="MNSPAPAACAPAPAYLDRLNAAQREAVEYGVRGNAGRDIPGPLLV
FT                   IAGAGSGKTNTLAHRVAHLIANGADPGRILLLTFSRRAADEMGRRVQRILAQVAVDTPW
FT                   LAQATLQWSGTFHGIGARLLREYAGRIGLDPAFTIHDREDSADLMNLARHEAGLSTRNK
FT                   RFPLKGTCLAIYSAAVNTRAPLAEVLQTTFPWCAEWEAELKTLFRAYVQAKQAQQVLDY
FT                   DDLLLYWAHMVAEPALGAEIGGLFQHVLVDEYQDTNHLQAEILLAMKPDGRGLTVVGDD
FT                   AQSIYAFRGATIRNILDFPARFEPPAHRVTLEQNYRSTRPILDAANAVIAQAAERYSKD
FT                   LWSLRESTARPQLVSVRDDADQSAFVVERVLARREQGIKLKQQAVLFRAASHSARLEME
FT                   LTRRNIPFVKFGGLKFLEAAHVKDMLAVLRWVENLRDRVSGFRVVQLLVGIGPKTAGKV
FT                   LDHVVAAPEGCELLAEQPVPEAARADWQAFSTLIEHLRRPDAPWPASFELACRWYEGQM
FT                   PRLYDDAVVRQGDIQQLGRIAATYPSRQRFLTELTLDPPSATSDEAGVPLLDEDYLILS
FT                   TMHSAKGQEWNSVSVLNVVDGCVPSDIATRSSAEIEEERRLLYVAMTRAKDHLELLVPQ
FT                   RFYVSQQQGMGDRHVYAGRTRFIPNRLLPQFEQVSWPEPPPEFRGTPQSRQAALDLAAK
FT                   MRGMWD"
FT   CDS_pept        369965..371605
FT                   /transl_table=11
FT                   /locus_tag="azo0346"
FT                   /product="putative Na+/H+ antiporter"
FT                   /function="NhaP-type Na+/H+ and K+/H+ antiporters"
FT                   /note="42% Na_H_porter.IPR004705; NaHantiport_bac.Bacterial
FT                   Na+/H+ antiporter Pfam:PF00999; Na_H_Exchanger; 1.
FT                   TIGRFAMs:TIGR00831; a_cpa1; 1. Signal peptide present
FT                   TMHelix: 12"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0346"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92963"
FT                   /db_xref="GOA:A1K2A8"
FT                   /db_xref="InterPro:IPR004705"
FT                   /db_xref="InterPro:IPR004709"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2A8"
FT                   /protein_id="CAL92963.1"
FT                   /translation="MQSIEVVLAMLLAVVASGYLVRVVPVSLPLPLVQIALGAGIAAIS
FT                   GHGVRLDPEIFFLLFLPPLLFLDGWRIPKVGLFRDKGTILELAFGLVVFTVLGAGLLIH
FT                   WMIPAMPLAVAFALAAIVSPTDPVAVSSIAARVPIPKRLMHILEGESLLNDASGLVCFR
FT                   FAVAAVMTGGFSLAAASLTFLWVAFAGLAVGVIVTWVISLAQRWLSRHLGEEAGSPILV
FT                   NLLIPFGAYLVAEHLDASGILAAVAAGVTMSYVELSGRALATTRVQRAAVWDTVQFSLN
FT                   GIMFVLLGEQLPGIVQRAAAAVEDSGHVSRWWLLVYALAISAILAALRFAWVWVSLRVT
FT                   LFKAREAGEPLQRPDWRIVAAVSLAGVRGAITLAGVLTLPLLLPDGRDFPARDLVIFLA
FT                   AAVILVSLLLASLGLPRLLRGLALPDEPAERREEDRARREAAAAAIAAIEKARHALSEP
FT                   GAADADLYTNAAVRVMANYQRRLADSAMPGSVAADRLRAADRAEMALWLAALQAEREAI
FT                   FRLARDYELSDETSRKLVRQIDLMEARYR"
FT   CDS_pept        371653..372096
FT                   /transl_table=11
FT                   /locus_tag="azo0347"
FT                   /product="hypothetical secreted protein"
FT                   /note="Hypothetical secreted protein. No homology to the
FT                   data bank. No domains predicted. Signal P reporting Signal
FT                   Peptide present. No TMH reported Present."
FT                   /db_xref="EnsemblGenomes-Gn:azo0347"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92964"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2A9"
FT                   /protein_id="CAL92964.1"
FT                   /translation="MSPSRSAVLLILLLAAPAASAEVYQWVDQQGRVHYGDRPAPGVPA
FT                   ARREELSVPEPTQADRDAAAERAERARARLQSLPPSPPPEPTGTEGDRSAPQAEAEDDS
FT                   CAAQHRRYRASQACFAPYVTVTGAVKPEAFQYCENLPQPQCEE"
FT   CDS_pept        372236..373684
FT                   /transl_table=11
FT                   /locus_tag="azo0348"
FT                   /product="4-hydroxybenzoate octaprenyltransferase"
FT                   /function="4-hydroxybenzoate polyprenyltransferase and
FT                   related prenyltransferases"
FT                   /EC_number="2.5.1.-"
FT                   /note="Prenyltransferase family protein. InterPro: UbiA
FT                   prenyltransferase"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0348"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92965"
FT                   /db_xref="GOA:A1K2B0"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2B0"
FT                   /protein_id="CAL92965.1"
FT                   /translation="MENNTLVPLVVDLDGTLTPTDTLVESGIRLIKQSPLRALGALAAL
FT                   TKGKAALKDAIAAEVDLPVERLPYREPLLDYLREQKAAGRKLVLATAAHCSIADKVAGH
FT                   LGLFEQVLATRPGRNLKGSAKLAAIRSEVGTDFVYAGDCRADLPIWKAARAAVLVAVPP
FT                   SVADEVRRTTPVERDFAPDAAGPKVWARAFRVHQWLKNLLLFVPLFTAFSFFDLTKVGV
FT                   LAAAFVAFSLAASATYVVNDLWDLDNDRVHPRKRARPFASARIPILQGLGAAAAALAVA
FT                   LGVAWAISPPFLLMLLAYLVLTSAYSWVLKEYVLIDVLMLSLLYTLRIIAGSVASGIVI
FT                   SSWLLAFSVFLFLSLALVKRCSELVSLEQSGGAATRGRDYRVTDLVVLWQLGVGAALSA
FT                   VVVFGLFITAPDTVARYGTPHLLWAVAMALTYWLARLWIKTSRGEMHDDPVVYAIKDRG
FT                   SRVTVSAMVGVMAAAHYFRLEWIE"
FT   CDS_pept        373681..374046
FT                   /transl_table=11
FT                   /locus_tag="azo0349"
FT                   /product="putative Small Multi-Drug resistant family
FT                   protein"
FT                   /note="Putative Small Multi-Drug resistant(SMR)family
FT                   protein, 30% identical to TrEMBL;Q8XZS2. Has PF00893,Small
FT                   Multidrug Resistance protein;IPR000390, Smr:This family is
FT                   the Small Multidrug Resistance (SMR) family. Several
FT                   members have been shown to export a range of toxins,
FT                   including ethidium bromide and quaternary ammonium
FT                   compounds, through coupling with proton influx."
FT                   /db_xref="EnsemblGenomes-Gn:azo0349"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92966"
FT                   /db_xref="GOA:A1K2B1"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2B1"
FT                   /protein_id="CAL92966.1"
FT                   /translation="MRTAIVALLSIALSVTAQFSLKAGMASEGVRRALAEPHSLQTLLT
FT                   VLTDKFVFGGFMLYGLGAVIWLDVLSRWDVSKAYPLVGLGFVLTLGVGLALGEQVNAQR
FT                   FAGVALICAGVFLVGRS"
FT   CDS_pept        complement(374102..375397)
FT                   /transl_table=11
FT                   /locus_tag="azo0350"
FT                   /product="conserved hypothetical secreted protein"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /note="Conserved hypothetical secreted protein. Homology to
FT                   gll2146 of G. violaceus of 44% (trembl|Q7NIN7(SRS)) no
FT                   domains predicted signal peptide no TMHs"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0350"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92967"
FT                   /db_xref="InterPro:IPR027372"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2B2"
FT                   /protein_id="CAL92967.1"
FT                   /translation="MPAAPTRIALALALAAAAAAAHADTSTLVGWARLPAATFSDGPTS
FT                   GQFAAANPYGSNLPPYVAQQPVQGFSGVLRGPGHSIRVIADNGFGAQTNSADTLLRAYA
FT                   LVPDFKTARGGSGTVSAADWKTGRPLAAFTEASRITLHDPDNLLGNRIQADYTHYYNNP
FT                   ANPEVAPAIRAGRLLTGADFDIESVREDQFGRLWFGDEFGPYLIQTDADGKVLRREVAL
FT                   PGVFAPQNPAVTSGAVTANLGSSGGFEGMAINKRGDRLYTLLEKTVTGDAAKTLRINEF
FT                   DIRKGAYTGVNYRYRLEADGTAIGDMTAIDDERFIVIERNGCTATSACAPFKKLFLADV
FT                   SGVANGGEVVKTELVNLMDVADPDDLNGDGQTRFSFPYTTIEDVLILDANSLLVINDNN
FT                   FPYGGGRELASDDTEFLKIRLPRPIRNPTTAK"
FT   CDS_pept        complement(375522..376307)
FT                   /transl_table=11
FT                   /gene="nodJ"
FT                   /locus_tag="azo0351"
FT                   /product="ABC transporter permease NodJ"
FT                   /function="ABC-type multidrug transport system permease
FT                   component"
FT                   /note="Forms with NodI a membrane transport complex
FT                   involved in the nodulation process. it probably exports a
FT                   modified beta-1,4-linked n-acetylglucosamine
FT                   oligosaccharide. Belongs to the ABC-2 integral membrane
FT                   protein family, TREMBL:Q7WHD1 (49% identity);
FT                   SWISSPROT:O52619 (49% identity). InterPro (IPR000412): ABC
FT                   transporter, family 2. Pfam (PF01061): ABC-2 type
FT                   transporter. TMHMM reporting six transmembrane helices. TC
FT                   (3.A.1.102): The Lipooligosaccharide Exporter (LOSE)
FT                   Family."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0351"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92968"
FT                   /db_xref="GOA:A1K2B3"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR005981"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2B3"
FT                   /protein_id="CAL92968.1"
FT                   /translation="MTPNPWRPPALSRRFIPVWQRNFLVWRKLALPSVLGNLADPVIYL
FT                   FGLGFGIGLLVPEVGGVSYISFLAAGMVCYSTMNSATFEVLYSSFSRMHVQRTWDAILN
FT                   APVALDDVVFAELVWAASKALLSGAAILLVTTLFGLVEVRYALWVLPLIFLVGLTFAAL
FT                   GLIMTALAPSYDFFMYYFTLFVTPMMLVSGVFFPADQLPPLLHAATRALPLTHAVEIAR
FT                   PLLLGRVPEGVGLHLAVLAGYAVVAFWVALALTRRRLQK"
FT   CDS_pept        complement(376345..376629)
FT                   /transl_table=11
FT                   /locus_tag="azo0352"
FT                   /product="conserved hypothetical protein"
FT                   /note="Conserved hypothetical protein. Homology to mvpT of
FT                   E. carotovora of 44% (trembl:Q6D393) No domains predicted.
FT                   No TMHs No signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:azo0352"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92969"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2B4"
FT                   /protein_id="CAL92969.1"
FT                   /translation="MERSFIFKSKHGQTVGLPPRVELPKSVKQVDIVALGQARLIVPSG
FT                   GAWDSWFESEGVSDDFMDTREQPSGQYRGSFRTHQPYARYQDDVLGLAP"
FT   CDS_pept        complement(376663..376758)
FT                   /transl_table=11
FT                   /locus_tag="azo0353"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="Hypothetical protein predicted by Glimmer/Critica.
FT                   No homology to the data bank. No domains predicted. No
FT                   signal peptide No TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:azo0353"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92970"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2B5"
FT                   /protein_id="CAL92970.1"
FT                   /translation="MRLMVRPTVLEAEQTSPDREQLDELENSLDP"
FT   CDS_pept        377176..378156
FT                   /transl_table=11
FT                   /locus_tag="azo0354"
FT                   /product="putative methylase"
FT                   /function="Site-specific DNA methylase"
FT                   /EC_number="2.1.1.37"
FT                   /note="Region start changed from 377491 to 377176 (315
FT                   bases)"
FT                   /db_xref="EnsemblGenomes-Gn:azo0354"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92971"
FT                   /db_xref="GOA:A1K2B6"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2B6"
FT                   /protein_id="CAL92971.1"
FT                   /translation="MPTFVDLFCGAGFGARGAVRGGGVPLLGLDAWNLATETYKANFPQ
FT                   ADTITEKIEDVVPKTLGRKYRPDVLLTSPECTSHSIARGAKPGLETSRETAIGIVPWVE
FT                   AMEPRWVIVENVNRMKKWDRHDELVQTIEGLGYAVSDLLLNSADFGSAQARKRMFLVCD
FT                   RKGTTVGREDLLGLVSTPRKTAYDIIDWEADYPATLLRKPGRAPATLERAERAIAELGV
FT                   GVPFLIVYYGSDYAGGWQTLDVPLRTVTTVDRFGLVTWKGDTPYLRMLQPAELLLAMGG
FT                   ATEHVLPHGNRRDKVKLCGNGVCSDVMTAIFQWISLNQAKQQDAA"
FT   CDS_pept        complement(378157..379323)
FT                   /transl_table=11
FT                   /locus_tag="azo0355"
FT                   /product="conserved hypothetical protein"
FT                   /note="Conserved hypothetical protein. Homology to lpg1234
FT                   of L.pneumophila of 42% (gnl|keqq|lpn:lpg1234(KEGG)). Has
FT                   PF04471, Restriction endonuclease;IPR007560, Mrr_cat;
FT                   Prokaryotic family found in type II restriction enzymes
FT                   containing the hallmark (D/E)-(D/E)XK active site. Presence
FT                   of catalytic residues implicates this region in the
FT                   enzymatic cleavage of DNA. No TMHs. No signal peptide."
FT                   /db_xref="EnsemblGenomes-Gn:azo0355"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92972"
FT                   /db_xref="GOA:A1K2B7"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR041409"
FT                   /db_xref="PDB:4OC8"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2B7"
FT                   /protein_id="CAL92972.1"
FT                   /translation="MTFFTGETLGQVDLIVDAVYAGYKTERGGMADPLVPLVGVSRQGG
FT                   FRYRGTRERPTLLVLTSNLAEPEWPDQLDETTGTFIYYGDNRHPGRLLHDTPRFGNQLL
FT                   RQIFDWAHLGQRHLVPPILVFTTEATGRTFRFRGLAVPGSPALAATEDLVALWKTTEGQ
FT                   RFQNYKAVFTILDEAVIPRAWVHAVGRGETSGLAPVAWNAWLSAGGIRPLMAPRSLLVR
FT                   SKAEQLPATPEDQALIEVIRQRYKENPFGFEACAGALTRLLLPDVARLDLTRPWRDGGR
FT                   DGIGRLRIGQSPAAIEVDFALEAKCYGANNAVGVKEVSRLISRIKHREFGVLVTTSYVD
FT                   RQAYQEVTDDGHPVILTTAQDIVGLLRSAGVRTPTQVDAWLDGITASV"
FT   CDS_pept        complement(379320..379709)
FT                   /transl_table=11
FT                   /gene="vsr"
FT                   /locus_tag="azo0356"
FT                   /product="putative hypothetical very short patch repair
FT                   endonuclease"
FT                   /EC_number="3.1.-.-"
FT                   /note="Putative hypothetical very short patch repair
FT                   endonuclease. Homology to vrs of E. coli of 29%
FT                   (sprot|VSR_ECOLI) All proteins in this family for which
FT                   functions are known are G:T mismatch endonucleases that
FT                   function in a specialized mismatch repair process used
FT                   usually to repair G:T mismatches in specific sections of
FT                   the genome. Interpro: DNA mismatch endonuclease vsr
FT                   (IPR004603) Pfam: DNA mismatch endonuclease Vsr Tigrfam:
FT                   vsr: DNA mismatch endonuclease no signal peptide no TMHs"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0356"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92973"
FT                   /db_xref="GOA:A1K2B8"
FT                   /db_xref="InterPro:IPR004603"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2B8"
FT                   /protein_id="CAL92973.1"
FT                   /translation="MMSRIKGRDTGPELSLRRNIWALGLRYRLQYRIGRTRPDMVFVRA
FT                   RLAVFVDGCFWHGCPQHSTMPKNNRDFWERKLRRNRERDAENTHSLEAEGWRVLRLWEH
FT                   EIQASPADCARRIAVMLGKAEESKA"
FT   CDS_pept        complement(379781..380920)
FT                   /transl_table=11
FT                   /locus_tag="azo0357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0357"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92974"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2B9"
FT                   /inference="nucleotide motif:Gismo"
FT                   /protein_id="CAL92974.1"
FT                   /translation="MDWRVLVVDDKAADDVAETIGGNKTVPKPDSISCEKCADFFQAVE
FT                   LLKNQRFDLVILDLKDDGAPEQETLAGERVFEEIKKCRFVPVVFHTGFPHKVGDQTSPY
FT                   VRVVTRADWENLRSTIKEVLDTKLPRLIRHIEEEQRRFMWESAERIWADDLHKDNPTDL
FT                   VYLLARRLANSLSGDVVRSFFGSDGTEGAPKSEMVHAVELYIFPPISQHFLFGDIFEKK
FT                   TSGKSEYFVSLTPSCDHAQRKAEFLLFARCADLSDSEEWKKVQGFLEAKTAPSKSAVND
FT                   LKELMKDNNPRPRLQDRYKYLPGTSFIPDLLVDLQNTLTIDREKLVSGEAGLERIASLD
FT                   SPFSEYLQAKMIRYFGRVGTPSLDTDLTFERFKSRTMKT"
FT   CDS_pept        complement(380934..383189)
FT                   /transl_table=11
FT                   /locus_tag="azo0358"
FT                   /product="putative two-component sensor kinase"
FT                   /function="Signal transduction histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="Region start changed from 382943 to 383189 (246
FT                   bases)"
FT                   /db_xref="EnsemblGenomes-Gn:azo0358"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92975"
FT                   /db_xref="GOA:A1K2C0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2C0"
FT                   /protein_id="CAL92975.1"
FT                   /translation="MSNGRNSYESALRPRARIMKTLGSELISNDAVAVIELVKNAYDAE
FT                   ASRVLIKFVGPLQPKQGCIEIFDDGAGMSLDVVRGAWMEPATPGKRQKTSSGSKGRRVL
FT                   GEKGIGRFAAMRLASELELITRARGADQEVYGIFDWTQFEDEQKYLDEVLILTEVRKPE
FT                   VIRSDVGLDAIWPKHEVPVECPPSEQGTLLRMNNLAQAWDAERFRLIQRGLSRLISPFK
FT                   ENKDFSVFLQAPEAFSEFSSEITPPVVLNYPHYTVSGMVDPQGKCDLMLEVKATGEVRS
FT                   VTGGFVREGKDGLQYLENEAYSKLKQTTENQLENDKTEWEKKLPTCGPLQIELRIWDRD
FT                   DLGNVIQQTRSNLQNIRADLDAFAGINIYRDGFRVLPYGEPNNDWLRLDIRRVQNPTKR
FT                   LSNNQIVGHISITADQNNGLKDQSNREGLDENQSYSDLREIMKSILSKIEDLRKRSKGT
FT                   GEGGNKDKQTLNLFAPLDLSPIRQHLESVSPKDEVAKELINNVERAFNTKVESLKAVVA
FT                   KYHALATLGQLIDVLLHDGRLPLAKIRKESLLAQEDIVEGLLTGEDLLNKLAGRLRIIH
FT                   GQSDVLATVFRRVEPFGGRKRGRPKQLYLEKIIEDAFGVCASQIADLQIATSLSTGQTL
FT                   VRVDEAEIQEVIVNLLQNSLYWLQFVDTAVRRIDVSVSRTAQDHVEIIFSDTGPGIPDE
FT                   NRARIFEPYFSTKKDGVGLGLAIVGEIIMDYYGGKLELLDSSGASGAVFRITLTKRV"
FT   CDS_pept        complement(383349..384059)
FT                   /transl_table=11
FT                   /locus_tag="azo0359"
FT                   /product="conserved hypothetical membrane protein."
FT                   /note="Conserved hypothetical membrane protein. Homology to
FT                   MS2110 of M.succiniciproducens of 40%
FT                   (gi|52426165|ref|YP_089302.1|(NBCI ENTREZ)). No domains
FT                   predicted. No signal peptide. 1 TMHs"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0359"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92976"
FT                   /db_xref="InterPro:IPR011528"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2C1"
FT                   /protein_id="CAL92976.1"
FT                   /translation="MTEILGAAYNGMLLLFLLAVVGALLRSPLVKGWFGEAQSALAQEL
FT                   LLDKAIYTAINDITLPTTNGTTQIDHVVVSRYGIFVIETKNMKGWIYGTEKGATWTQNL
FT                   YGRKYRFQNPLHQNYRHVRALAEFLKLDDSHFHSVVMFWGNATLKNPLPPNVMTHGYVS
FT                   YIKGKQRVLFSDEEVAAIITAIQTGRLPRTWATRTAHVESLKARHANTGSRNGYVRTYP
FT                   PTQSAAANQIVGNE"
FT   CDS_pept        complement(384192..385178)
FT                   /transl_table=11
FT                   /gene="nodI"
FT                   /locus_tag="azo0360"
FT                   /product="ABC transporter ATP-binding protein NodI"
FT                   /function="ABC-type multidrug transport system ATPase
FT                   component"
FT                   /note="Nod factor export ATP-binding protein. Part of the
FT                   ABC transporter complex nodIJ (TC 3.A.1.102.1) involved in
FT                   the export of LCO (lipo-chitin oligosaccharide) and a
FT                   modified beta-14-linked N- acetylglucosamine
FT                   oligosaccharide. Responsible for energy coupling to the
FT                   transport system, TREMBL:Q7W9D3 (58% identity);
FT                   SWISSPROT:O52618 (53% identity). InterPro (IPR003439): ABC
FT                   transporter. InterPro (IPR001687): ATP/GTP-binding site
FT                   motif A (P-loop). InterPro (IPR003593): AAA ATPase. Pfam
FT                   (PF00005): ABC transporter. TC (3.A.1.102) The
FT                   Lipooligosaccharide Exporter (LOSE) Family."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0360"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92977"
FT                   /db_xref="GOA:A1K2C2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015851"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2C2"
FT                   /protein_id="CAL92977.1"
FT                   /translation="MSAALPVGSDTSGEVRPSPLIIRGLVKRYGDNEVVRGIDLELAAG
FT                   ECFTLLGPNGAGKTTTLRCALGLTAPTAGDIRLCGEPVPARAREARMRVGIVPQIDNLD
FT                   PDFTCTENLLVYGRYFGIKDADIRARIPELLAFAGLENKADARIQSLSGGMKRRLTLAR
FT                   ALVNRPELLVLDEPTTGLDPQARHLIWDRLKQLIRNGTTVLLTTHFMDEAERLSDHLAI
FT                   LDAGRLLTAGSPRDVIAQHIEPQVVEVFGEWGNAGNGTAGAPAWAAQHAAALSDRFEIS
FT                   GETAFCYVRDPAPLLAHLAAQPGLRYLHRPANLEDVFLKLTGRELRD"
FT   CDS_pept        complement(385249..385866)
FT                   /transl_table=11
FT                   /locus_tag="azo0361"
FT                   /product="conserved hypothetical glutathione S-transferase"
FT                   /EC_number="2.5.1.18"
FT                   /note="Conserved hypothetical glutathione S-transferase
FT                   protein. Homology to cv3306 of C. violaceum of 50%
FT                   (trembl|Q7NSW3). Conjugation of reduced glutathione to a
FT                   variety of targets. Pfam: Glutathione S-transferase,
FT                   N-terminal domain; Glutathione S-transferase, C-terminal
FT                   domain. no signal peptide. no TMHs"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0361"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92978"
FT                   /db_xref="GOA:A1K2C3"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034343"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2C3"
FT                   /protein_id="CAL92978.1"
FT                   /translation="MTMKLLASLTSPYARKIRIALAEKNIPFELVVDSPWEAATRVPDV
FT                   NPLGKVPALVLDDGEVFFDSPVIAGYIETLGHAPALLPAGGIERVRVRQSEALVDGILD
FT                   AAVTAYLEGRRPEAQQSAPNLDRQYDKIQRSLDLLEERLAGRNWLDGDSMQLGDIALGV
FT                   ALGYLDLRLGYLEWRAGRPVLEAFAQRMFARPSFAATVPPAG"
FT   CDS_pept        complement(385891..386562)
FT                   /transl_table=11
FT                   /locus_tag="azo0362"
FT                   /product="conserved hypothetical protein"
FT                   /function="predicted hydrolase of the alpha/beta
FT                   superfamily"
FT                   /note="Conserved hypothetical protein. Homology to rsc0328
FT                   of R. solanacearum of 59% (trembl|Q8Y2K7). Pfam: Prolyl
FT                   oligopeptidas family no signal peptide no TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:azo0362"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92979"
FT                   /db_xref="GOA:A1K2C4"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2C4"
FT                   /protein_id="CAL92979.1"
FT                   /translation="MTNRPLATESALLRGGAGAIEVLIDAPEHVRGIALICHPHPLYGG
FT                   ANTNKVAHTLARTFRDLGYAAVRPNFRGVGKSEGTHDLGNGETEDMLSVIAWMQSRWGQ
FT                   LPLALGGFSFGGFVQTRVANRLAEGVAPPRQIVLVGMAAGTAADGARHYETPELAKNVP
FT                   ALIIHGEADDTVPLDNVFDWARPQELPVIVIPGADHFFHARLHLIRDLMLRNVPPAGQA
FT                   A"
FT   CDS_pept        complement(386572..386892)
FT                   /transl_table=11
FT                   /gene="fer21"
FT                   /locus_tag="azo0363"
FT                   /product="putative ferredoxin 2Fe-2S protein"
FT                   /function="Ferredoxin"
FT                   /note="Putative ferredoxin 2fe-2s protein. Homology to fer2
FT                   of C. pasteruianum of 35% (sprot|FER2_CLOPA). Ferredoxins
FT                   are iron-sulfur proteins that transfer electrons in a wide
FT                   variety of metabolic reactions. no signal peptide no TMHs"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0363"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92980"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2C5"
FT                   /protein_id="CAL92980.1"
FT                   /translation="MSYFKHHVFFCCNQRQGGETSCNDHGASAMQVYAKERTAELGLKG
FT                   KGSVRINKAGCLGRCDDGPVLVVYPDNVWYTYVDKDDIDEIINEHLAHGRIVERLRLAD
FT                   PA"
FT   CDS_pept        complement(386915..388000)
FT                   /transl_table=11
FT                   /locus_tag="azo0364"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="Conserved hypothtical membrane protein. Homology to
FT                   rc03284 of R. solanacearum of 35% (trembl|Q8Y2L8(SRS) Has a
FT                   weak hit to PF04892(IPR006976;vanZ)in Smart:This family
FT                   contains several examples of the VanZ protein, but also
FT                   contains examples of phosphotransbutyrylases. VanZ confers
FT                   low-level resistance to the glycopeptide antibiotic
FT                   teicoplanin (Te). Analysis of cytoplasmic peptidoglycan
FT                   precursors, accumulated in the presence of
FT                   ramoplanin,showed that VanZ-mediated Te resistance does not
FT                   involve incorporation of a substituent of D-alanine into
FT                   the peptidoglycan precursors . no signal peptide 10 TMHs"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0364"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92981"
FT                   /db_xref="GOA:A1K2C6"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2C6"
FT                   /protein_id="CAL92981.1"
FT                   /translation="MPPRPASSLPRNLALAYAVLVIYACLHPFAGWKASGLPLFDFLVA
FT                   PWPKYFQPIDAVLNMLGYLPLGFVTVAALPRGWPRWRWVVVAALLGAGLSFGLETVQNL
FT                   LPSRVSSNVDLGANAAGALAGALLGARWAHPLFDHRGGLHRWRAERIVGGHTGDAGLIL
FT                   LGLWLLAQLTPDGLLFGSGDLRGLLGLPAPLLFSPERFIGFETGLIAASVLALGLLARC
FT                   MMRVPRPWPVVVLFLLGLGAKSIATSTFFVPGEPLAWLTPGAARGLALGSVLLALALLL
FT                   PRVLQHALAGSALLAATALINLMPENPYLFLGRRLLNQGNFLNFHGLTQLVASLWPFAA
FT                   LAYLSALGLWRGEHLAGERRL"
FT   CDS_pept        388715..389227
FT                   /transl_table=11
FT                   /locus_tag="azo0365"
FT                   /product="Conserved Hypothetical protein"
FT                   /note="Conserved Hypothetical protein, Q82Y48,Rhodanese
FT                   type protein. Has SMART SM00450 Rhodanese Homology
FT                   Domain(RHOD)starting at position 47-153aa;Rhodanese, a
FT                   sulfurtransferase involved in cyanide detoxification (see
FT                   IPR001307) shares evolutionary relationship with a large
FT                   family of proteins. No Signal peptide or TMH reported
FT                   Present."
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0365"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92982"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2C7"
FT                   /protein_id="CAL92982.1"
FT                   /translation="MSEASIEAPDVASAPRSIADAVPTAPAVLEAARRRAREEGLPYAG
FT                   SLAPVDAWALVEAGAALLVDVRSAEERRFVGHVPDSLHVAWMTGLSLSRNPRFVRELEG
FT                   KAGKGRVVLLLCRSGKRSAAAAEAAAKAGFTHVFNVLEGFEGDLDDRQRRGAFNGWRHA
FT                   GLPWIQD"
FT   CDS_pept        389292..390254
FT                   /transl_table=11
FT                   /gene="srpH"
FT                   /locus_tag="azo0366"
FT                   /product="probable serine O-acetyltransferase"
FT                   /function="Serine acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="Probable serine O-acetyltransferase plasmid (EC
FT                   2.3.1.30) (SAT). Homology to srpH of Synechococcus of 55%
FT                   (sprot|SRPH_SYNP7) no signal peptide no TMHs"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0366"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92983"
FT                   /db_xref="GOA:A1K2C8"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2C8"
FT                   /protein_id="CAL92983.1"
FT                   /translation="MSASTGAVEAAYEDVGGWGVSQVVAELRAARERWRAAQQRNREFA
FT                   VREFPSRDALRQIAADLCGVLFPMRLGPPELHQEGEDYYVGHTLDSTLNALFHQVRLEL
FT                   GYLARHRGIEADIDADAARIVKRFAGGLPALRTLLDSDVEAAYTGDPAARSVDEVLLCY
FT                   PGTLAIIHHRLAHSLHALGARLVARIIAEIAHSATGIDIHPGAQIGSGFFIDHGTGVVI
FT                   GETTVIGNRVRLYQAVTLGARRFAVDENGALEKGAARHPVLEDDVVVYAGATILGRVTI
FT                   GRGSSIGGNVWLTRSVPPGSHVSQASLQHESAAQRVAAS"
FT   CDS_pept        390251..390484
FT                   /transl_table=11
FT                   /locus_tag="azo0367"
FT                   /product="SgrAlc control protein"
FT                   /function="predicted transcriptional regulators"
FT                   /note="SgrAlc control protein,"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0367"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92984"
FT                   /db_xref="GOA:A1K2C9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2C9"
FT                   /protein_id="CAL92984.1"
FT                   /translation="MSPASVIASFGAAVRQFRERHGWSQELLAERADLNRSYLGEVERG
FT                   TVVPSLATAVKLAAALDIPLSNLLSHCENGRS"
FT   CDS_pept        390602..391528
FT                   /transl_table=11
FT                   /gene="mmpI"
FT                   /locus_tag="azo0368"
FT                   /product="probable immunodominant 35kDa protein"
FT                   /note="Probable immunodominant 35 kDa protein. Homology to
FT                   mmpI of Mycobacterium avium of 69%
FT                   (gi|2498566|sp|Q48899|MMP1_MYCAV(SwissProt (ExPASy)). No
FT                   domains predicted. No signal peptide. No TMHs.,"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0368"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92985"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2D0"
FT                   /protein_id="CAL92985.1"
FT                   /translation="MSTLPEPTALGDAAARQLANATKTTAQLSTISPRWLTHLLQWLPV
FT                   EAGIYRLNTVKNPRDVRVACSQRDESELPQTFVDYDEAPREYFLNAVTTILDVHTRVSD
FT                   LYSSPHDQIKEQLRLTIETIKERQESELINNPDYGLLANVADEQIISTLTGAPTPDDLD
FT                   ELLTKVWKEPAFFLTHPLAIAAFGRECTRRGVPPPTVSLFGAQFLTWRGIPLIPSDKVP
FT                   VDGGKTKILLLRVGEKRQGVVGLFQPGLVGEQSPGLSVRFMGINRNAIASYLISLYCSL
FT                   AVLVPDALAVLDDVEVGKYHDYPDTYK"
FT   CDS_pept        391503..393335
FT                   /transl_table=11
FT                   /gene="csdB"
FT                   /locus_tag="azo0369"
FT                   /product="probable cysteine desulphurase"
FT                   /function="Selenocysteine lyase"
FT                   /EC_number="4.4.1.15"
FT                   /note="Cysteine desulphurases required for the mobilization
FT                   of sulphur from cysteine. They are present in all
FT                   organisms, where they are involved in iron-sulphur (Fe-S)
FT                   cluster biosynthesis. Similar to sprot|CSD1_MYCLE (54%), to
FT                   trembl|Q82WT8 (55%) and to tremblnew|BAB21542 (34%). Pfam
FT                   (PF00266): Aminotransferase class-V Pfam (PF01041):
FT                   DegT/DnrJ/EryC1/StrS aminotransferase family"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0369"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92986"
FT                   /db_xref="GOA:A1K2D1"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2D1"
FT                   /protein_id="CAL92986.1"
FT                   /translation="MTIPTPTSKGAEGLSGAPLPDLPDEATLGALASAFFRALPGAALP
FT                   PADPVRAQVASAPELSLAQGGSRLAPAPVASDPVDPVGGAGAFVVPQAYAAALPQVAPP
FT                   QVPAGVAEGLPLAVPGSPYYFIGEASPYLQSGAAPALPENRVVARSFGLPGEGELKALL
FT                   AEIAAGRPLADAPAADPGGRFYFIDAAKVPAAEPGARAPFDVNAVRRDFPILQERVNGK
FT                   PLVWFDNAATTHKPQAVIDRLAHFYAHENSNIHRGAHELAARATDAYEAARQKVQRFLG
FT                   AGSADEIIFVRGATEAINLVAKTWGVQNIGEGDEIVVSLLEHHANIVPWQQLAAQVGAK
FT                   IRVIPVDDNGQLKLDELQKLLNPRTRLVSVTQVSNALGTVTPIKQVIDMAHAAGARVLV
FT                   DGAQSVSHMRVNVQALDADFFVFSGHKIFGPTGIGVVYGKAALLEQMPPWQGGGNMIAD
FT                   VTFERTLFQPAPNKFEAGTGNIADAVGLGAALDYVERIGLENIARYEHDLLVYATRGLS
FT                   SIAGVRLIGTAADKASVASFVLAGYSTEEVGRALNEEGIAVRSGHHCAQPILRRFGVET
FT                   TVRPSLAFYNTCEEIDRMLAVVRRLARGKGRVGA"
FT   CDS_pept        393595..394170
FT                   /transl_table=11
FT                   /locus_tag="azo0370"
FT                   /product="conserved hypothetical membrane protein"
FT                   /function="predicted membrane protein"
FT                   /note="Conserved hypothetical membrane protein. Homology to
FT                   NE2493 of Nitrosomonas europaea of 67%
FT                   (trembl|Q82S65(SRS)). Has PF01169, Uncharacterized protein
FT                   family UPF0016;IPR001727; This family contains integral
FT                   membrane proteins of unknown function. Most members of the
FT                   family contain two copies of a region that contains an EXGD
FT                   motif. No signal peptide. 5 TMHs"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0370"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92987"
FT                   /db_xref="GOA:A1K2D2"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2D2"
FT                   /protein_id="CAL92987.1"
FT                   /translation="MEAFLVSTSIVALAEIGDKTQLLAFILAAKFRKPWPIVLGILVAT
FT                   LANHAGAGALGSFVTSLVSPEVMRWVLGLSFIGMAIWTLIPDKFEEDDATFARFGVFGT
FT                   TLIAFFLAEMGDKTQVATVALAAQYQALVAVVMGTTLGMMIANVPAVLLGDRIANRIPV
FT                   KLVHGIAAAIFAVLGLATLLGAGEGLGL"
FT   CDS_pept        394317..395381
FT                   /transl_table=11
FT                   /locus_tag="azo0371"
FT                   /product="hypothetical secreted protein"
FT                   /note="Hypothetical secreted protein. No homology to the
FT                   data bank. No domains predicted. No TMHs. Signal peptide
FT                   present."
FT                   /db_xref="EnsemblGenomes-Gn:azo0371"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92988"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2D3"
FT                   /protein_id="CAL92988.1"
FT                   /translation="MPFPLISWRTIVLRPLRHVLWAGLIGLIGEAAAAPCDPLVGEFLM
FT                   EFGKEEIQLRIERSDGRYFVRLDDGRGQWREQLEALQEVPLDELKGLVPDVECGLGGGG
FT                   GVFVKTAVGGARLADNPAEKGHEVGYALTGFLMVIPQGFSISVFDLFPLADHTGAAEPR
FT                   VEPSPERAVAGVMRCPGDRAPDLTQASYDALPKYMKDNIQEGQPLERRTERMCGQRLVR
FT                   SIDSRYAKGAYAKIHGESLQELRSLLEAGQVPRDDKGVSQWWELGKVLLTYHGDGKPSE
FT                   DPLAATSSAIFLNLIVPHLTQESLKARPVRLRALGQIVTTLAGRSDADAREALARMKAA
FT                   GLPVHAQAAAGERG"
FT   CDS_pept        complement(395413..395931)
FT                   /transl_table=11
FT                   /locus_tag="azo0372"
FT                   /product="conserved hypothetical protein"
FT                   /function="Putative lipid carrier protein"
FT                   /note="Entry name SWISSPROT:YHBT_ECOLI Prim. accession #
FT                   P45474 InterPro IPR003033; SCP2. Pfam PF02036; SCP2; 1.
FT                   Prediction: Non-secretory protein Signal peptide
FT                   probability: 0.001 Number of predicted TMHs: 0 Identities =
FT                   46/107 (42%)"
FT                   /db_xref="EnsemblGenomes-Gn:azo0372"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92989"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR039543"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2D4"
FT                   /protein_id="CAL92989.1"
FT                   /translation="MHFPALPALPLTELLPHSLRQRVAQQFEQRLAGLRIPAFTVPAPL
FT                   ARIAARLPQQIPTQALVTALNLALGRILPRDQLEALSGRGLRIRVTDAGLTLDFTLGDK
FT                   GFRRAAGSSTPDLIISASTRDFLALALREEDADTLFFSRRLLMEGDTELGLLVKNTLDA
FT                   VDWSALRPV"
FT   CDS_pept        complement(395946..396842)
FT                   /transl_table=11
FT                   /locus_tag="azo0373"
FT                   /product="conserved hypothetical peptidase"
FT                   /function="Collagenase and related proteases"
FT                   /EC_number="3.4.-.-"
FT                   /note="Conserved hypothetical peptidase. Homology to
FT                   Rsp0969 of R. solanacearum of 51% (trembl|Q8XR90). Pfam:
FT                   Peptidas family U32 no signal peptide no TMHs"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0373"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92990"
FT                   /db_xref="GOA:A1K2D5"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2D5"
FT                   /protein_id="CAL92990.1"
FT                   /translation="MKLSLGPLLYYWPRQSVLDFYAEIADSPVDIVHLGETVCSRRHEL
FT                   RLDDWIEVAAVLADAGKEAVLSSQSLIESESDLKTLRRVVGQQRFRVEANDMAAVRLLA
FT                   EAGRRDWIAGPTLNVFNPHTLGLLVEAGASRWVVAPEMSGAALAEVRSTLPAPIETEIF
FT                   AYGRLPLAHSARCFTARHYNLQKDGCEFRCLGIADGLVLRTREGEPFLTLNGVQTQSAK
FT                   VHTLLGDLPALAGRAEVLRISPQGAHTRGIIEHFRATLDGRQTPAEALAASSAHMPAAP
FT                   CNGFWHGRPGVEQFVPA"
FT   CDS_pept        complement(396857..397870)
FT                   /transl_table=11
FT                   /locus_tag="azo0374"
FT                   /product="conserved hypothetical peptidase"
FT                   /function="Collagenase and related proteases"
FT                   /EC_number="3.4.-.-"
FT                   /note="Conserved hypothetical peptidase. Homology to cv4084
FT                   of C. violaceum of 64% (trembl|Q7NQQ39. Pfam: Peptidas
FT                   family U32 no signal peptide no TMHs"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0374"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92991"
FT                   /db_xref="GOA:A1K2D6"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2D6"
FT                   /protein_id="CAL92991.1"
FT                   /translation="MTSSQRIELVCPAGSLPALKTAIDHGADCVYLGFKDATNARNFTG
FT                   LNFDPAQMREGIAYAHARRRKVLLALNTYPQTANWAGWTAAVDRAAEFGIDAVILADPG
FT                   LMAYAAKTHPQLRLHLSVQGSATSYEAINFYHERFGIQRAVLPRVLSMAQVEQVVGRTP
FT                   VEIEVFGFGGLCVMVEGRCALSAYATGESPNCNGACSPGKHVRWEQTPQGMETRLNGIL
FT                   IDRFGEHERAGYPTLCKGRFEVNDETYYAIEEPTSLNTLEMLPELARVGVAAIKIEGRQ
FT                   RSPAYVAQVTKVWRAALDRVVADPAGFHALPAWMAELNKVSEGQSHTLGAYYRPWK"
FT   CDS_pept        complement(398061..399524)
FT                   /transl_table=11
FT                   /locus_tag="azo0375"
FT                   /product="probABLE SODIUM/SOLUTE SYMPORTER TRANSMEMBRANE
FT                   protein"
FT                   /function="Na+/proline symporter"
FT                   /note="TREMBL:Q8Y273: 59% identity, 72% similarity
FT                   Osmoregulated proline transporter (Sodium/proline
FT                   symporter). CATALYZES THE SODIUM-DEPENDENT UPTAKE OF
FT                   EXTRACELLULAR PROLINE. InterPro: Sodium:solute symporter
FT                   family InterPro:IPR001734; Na/solut_symport. Pfam:PF00474;
FT                   SSF; TMHMM predicted transmembrane helices sss: SSS sodium
FT                   solute transporter sup"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0375"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92992"
FT                   /db_xref="GOA:A1K2D7"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2D7"
FT                   /protein_id="CAL92992.1"
FT                   /translation="MLIGFVTAYLVLSIAIGLYAATRVKNSTDYVAAGRNLPLYIVTAT
FT                   VFATWFGSETVLGISATFIDEGLRGLWSDPFGASLCLILAGLFFARPLYRMNLLTLGDY
FT                   YRTRYGRTVEVLCSLAIVVSYLGWVSAQISALGLVFNILSEGSISAETGMLVGAGIVLA
FT                   YTLFGGMWSVALTDFMQMAIIIVGLAYIAWLVGDMAGGVGAVVAHANEAGKLNFLPAFD
FT                   AKDIIAFTAGILTMGFGSIPQQDVFQRFNAARNERIAVQGTLLGGSGYFLFAFIPLFIA
FT                   YSATLIDPALVANYQESDSQQILPQLILEHTPLFAQVLFFGALLSAIMSTASGTLLAPS
FT                   VTFSENILRSTFRGMNDRQFLVMTRVVVVLFALLVTWYAIHTDESIHGMVENAYKVTLA
FT                   TAFVPLAFGLYWKRASTQGALVSIVAGLAVWVLLEIVAPEADVPPHFAGMLAGVVGMVV
FT                   GSLAPQTLVRQSHGHSAHLNIGAHPQSRN"
FT   CDS_pept        complement(399721..401841)
FT                   /transl_table=11
FT                   /locus_tag="azo0376"
FT                   /product="conserved hypothetical protein"
FT                   /function="Ornithine/acetylornithine aminotransferase"
FT                   /note="Conserved hypothetical protein. Homology to ebA3609
FT                   of Azoarcus sp. EbN1 of 62% (gnl|keqq|eba:ebA3609(KEGG)).
FT                   InterPro: Aminotransferase class-III (IPR005814), Arginase
FT                   family (IPR00594). Pfam: Aminotransferase
FT                   class-III,Arginase family. Tigrfam: argD: acetylornithine
FT                   and succinylornithine aminotransferase,
FT                   GABAtrnsam:4-aminobutyrate aminotransferase. no signal
FT                   peptide. no TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:azo0376"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92993"
FT                   /db_xref="GOA:A1K2D8"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR010164"
FT                   /db_xref="InterPro:IPR014033"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR034757"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2D8"
FT                   /protein_id="CAL92993.1"
FT                   /translation="MNVPTPLPSGPHDRVHIVGAAFALGAPHGGSADGPEALRHAMLPE
FT                   RLRTTGITGTWLEPLRPLRTPPPDAPMEERLAAVGEYCARLAEQIAGLPEDGFPLVLGG
FT                   DHAVAIGTWRGVARRQGGAPGLIWIDAHLDSHTDQSTWSGNIHGMPLAALLGEGAPALT
FT                   AIPGPRLDPARVCIIGARDWEPAERERLDRLGVRVFDIAEVRERGLPTVFCEALTIARS
FT                   GHGRDGGFGVTLDLDALDPLAVPAVTCPTPDGIDPQQLVDVFHTLRSCGDFVGLEIVEY
FT                   RPDLDPDGHSAALTARLVAAALGPATYWLREKERRFGATNYAPMPVVFHRGEGVWLWDV
FT                   EGTRYLDMMSAYSAVSFGHANPRLLRALQDQAQLLTLTSRSFSNDRLPLLLERLCSLLG
FT                   FERALPVNTGLEAVETALKAARKWAYIVKGVPPDRAEIIACEGNFHGRSITIVGLSSKE
FT                   QYRDGFGPFPPGLRRVPFGDPTALEAAITPHTAAFLVEPIQGEGGIIVPPPGYLAHCAE
FT                   ICRRHNVLLIADEVQTGLGRTGRLLACDHDGVRPDGLILGKALGGGLLPVSAFLADREV
FT                   MDVFRPGDHGSTFGGNPLGAAVALEVLDLLAETRPWEAAERLGRRLRAELEAAELPCVR
FT                   EVRGRGLLIGVALDPVKAPAQLVAELLLARGIATRDTNGNVIRLAPPLTIDEGTLDRAA
FT                   AIIIDTLNPLGR"
FT   CDS_pept        complement(401938..403467)
FT                   /transl_table=11
FT                   /locus_tag="azo0377"
FT                   /product="probable ubiquinone biosynthesis protein"
FT                   /function="predicted unusual protein kinase"
FT                   /note="Probable ubiquinone biosynthesis protein ubiB.
FT                   Required probably indirectly for the hydroxylation of
FT                   2-octaprenylphenol to 2-octaprenyl-6-hydroxy-phenol the
FT                   fourth step in ubiquinone biosynthesis (By similarity).
FT                   TREMBL:Q82TL7:65% identity InterPro:IPR004147; ABC1.
FT                   IPR010232; UbiB. Pfam:PF03109; met_pdase_II: methionine
FT                   aminopeptida"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0377"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92994"
FT                   /db_xref="GOA:A1K2D9"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2D9"
FT                   /protein_id="CAL92994.1"
FT                   /translation="MRLLRLAKIITVSLRFGLDRMILDADASGRLGRIWHRVFFWRRFS
FT                   EPRAVRLRKALESLGPIFVKFGQMLSTRRDLLPPDLADELALLQDRVPPFPTEQALAVL
FT                   EGFYGRPVDAVFRDFERTPVASASVAQVHFARLPDGTEVAVKILRPGIERVIAHDLALM
FT                   EVGAMLLDKAWPEGRRLKPREVVAEFSKYLRDELDLMREAANCSQLRRNFKDSPLLLVP
FT                   EVYWDWCGRSVMVMERMHGVPISQTAAVTAQGTDLKALSRAGVEIFFTQVFRDGFFHAD
FT                   MHPGNIFVHADGRYIALDFGIMGTLNEVDKNYLAQNFLAFFKRDYKRVAMAHIEAGWVP
FT                   AKTRVDEFEAAIRTVCEPIFDKPLKDISFGKTLLRLFQTARRFEMEVQPQLVLLQKTLL
FT                   NIEGLGRQLDPELDLWKTAKPFLERWMNEQMGWRALVRGIKEEAPAWAGTLPQLPRLVH
FT                   HNLVESSHHHVVHQAALASLAVTQRRQGRLLALLVIAAAALVALELHRLLG"
FT   CDS_pept        complement(403712..405787)
FT                   /transl_table=11
FT                   /locus_tag="azo0378"
FT                   /product="putative TonB-dependent receptor"
FT                   /note="Putative TonB-dependent receptor. Homology to
FT                   bpp0186 ao B. parapertussis of 54% (trembl|Q7W206) The TonB
FT                   protein interacts with outer membrane receptor proteins
FT                   that carry out high-affinity binding and energy-dependent
FT                   uptake of specific substrates into the periplasmic space.
FT                   These substrates are either poorly permeable through the
FT                   porin channels or are encountered at very low
FT                   concentrations. In the absence of TonB these receptors bind
FT                   their substrates but do not carry out active transport.
FT                   Interpro: TonB-dependent receptor (IPR000531) Pfam:
FT                   TonB-dependent receptor (PF00593) signal Peptide no TMHs"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0378"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92995"
FT                   /db_xref="GOA:A1K2E0"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2E0"
FT                   /protein_id="CAL92995.1"
FT                   /translation="MLPRLSPLSLALLCALGTAHAAAQSAAPNDPTAAPPVQLEAVTVS
FT                   ASGLDVDSGAMSTPATVLGGDELVRRRAATLGETLATEPGIHATEFGAGASRPVIRGMD
FT                   GARVRLLSDGAEIMDASTISPDHAVAAEPLLSERIEVLRGPSALAYGGGAVGGVVNVLD
FT                   RRIPTAIPERGVEGSVELRGNTAAREAAGAFEVTAGAGNIAIHAEGLKRDARDYRVGDG
FT                   WAGGRRVDGSYNETETGSLGLSWIGERGYLGVAWTRQRNEYGLPGHAHDLEDCHTHGNS
FT                   LHCGGHDGDDEDDHDHADEGGGVPYVKLDSERWDLRGEYREPFAGISRLRVRASHTRYR
FT                   HDEIEDGAVSTRFRNNASEGRVELQHAPLGGWRGVFGLQTTRRDFSAIGEEAYVPPTLT
FT                   RRHGAFLIEEYPTGDWRFEAGLRHEWQQVEVDADARDRSHRGNSLSLGAVWNFAPDYAL
FT                   GLSLARAQRLPTAEELYADGLHMATRTIERGNADLKAETSHNIDLSLKKLAGATTFNLS
FT                   VFHNRVNDFIYAHTLDALEGMQLIEYAQRDAIFTGVEGQVRQQLDRVFGLTLFGDYVRA
FT                   RLAGGDGDRDRDLPRIPAHRVGLRLDARQGAWQGELEVYRVGRQRQVAEFESSTPGYNM
FT                   VNLGASYAGRIASVPYLFYVKAANLTDELAYSHTSFIKDAAPLMGRNLTMGVKVTF"
FT   CDS_pept        complement(405969..406301)
FT                   /transl_table=11
FT                   /locus_tag="azo0379"
FT                   /product="hypothetical secreted protein"
FT                   /note="Hypothetical secreted protein. No homology to the
FT                   data bank. No domains predicted. signal peptide. No TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:azo0379"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92996"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2E1"
FT                   /protein_id="CAL92996.1"
FT                   /translation="MRTPLLRAVLALVLVLAQTGALTHLLGHAAEVPQARSASTRIASD
FT                   DRAPVDAFGVCLQCLALGGLDLPLGAGSAALDPGRPGVAHATHALPLPPSSAPALPRCR
FT                   APPALA"
FT   CDS_pept        406538..408301
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="azo0380"
FT                   /product="putative arginine-tRNA ligase"
FT                   /function="Arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="Putative arginine-tRNA ligase (EC 6.1.1.19).
FT                   Homology to argS of E. coli of 25% (sprot:SYR_ECOLI)
FT                   CATALYTIC ACTIVITY: ATP + L-arginine + tRNA(Arg) = AMP +
FT                   diphosphate + L-arginyl-tRNA(Arg). InterPro: Arginyl-tRNA
FT                   synthetase (IPR001278); Aminoacyl-transfer RNA synthetase
FT                   class-I (IPR001412) Tigrfam: argS: arginyl-tRNA synthetase
FT                   Pfam: tRNA synthetases class I no signal peptide no TMHs"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0380"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92997"
FT                   /db_xref="GOA:A1K2E2"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1K2E2"
FT                   /protein_id="CAL92997.1"
FT                   /translation="MSADPKVLLTDLIKTALKSVAPEHADTAILLERPKQASHGDFATN
FT                   VALQLAKPLKRNPRELAALLLAELPASNLVAKTEVAGAGFINFTLAAAAKTAVVGEVLA
FT                   KGADFGRGAKKNVKVQVEFVSANPTGPLHVGHGRGAAYGASLSDVLCFAGYDVTREYYV
FT                   NDAGRQMDILALSTWLRYLALFGIDVPFPPNAYQGDYVIDMARGLRDAHQGRYAGVTLA
FT                   QVLEGTPGLPVAERKDDEAKQQRELHLDGLIANAKRLLGEDYPFVHGFALNEQLGDGRD
FT                   DLQEFGVHFDKWFSEKSLFDTGLVERAVAELEKRGHIYVQDGAKWFRSTDFGDEKDRVV
FT                   QRENGLYTYFASDIAYHLNKYERGFDRIIDIWGADHHGYIPRVKGAIAALGLPPEKLEV
FT                   ALVQFAVLYRDGQKTSMSTRSGEFVTLRELRREVGNDACRFFYVLRKSDQHLDFDLDLA
FT                   KSQSNENPVYYIQYAHARVCSVLNQWGGEPAELQAADLGKLENERELALCARLAGFPEV
FT                   VQGAAADYAPHQIAFYLKDLAADFHSWYNAERMLVDDEAVKLARLALAAAVRSVLRGGL
FT                   AVLGVSAPESM"
FT   CDS_pept        408318..408902
FT                   /transl_table=11
FT                   /locus_tag="azo0381"
FT                   /product="conserved hypothetical secreted protein"
FT                   /note="Conserved hypothetical secreted protein. Homology to
FT                   CV3999 of C.violaceum of 34% (trembl|Q7NQY6(SRS)). Pfam:
FT                   Sporulation related repeat This 35 residue repeat is found
FT                   in proteins involved in sporulation and cell division such
FT                   as FtsN, DedD, and CwlM. This repeat might be involved in
FT                   binding peptidoglycan (Bateman A pers obs). No TMHs. Signal
FT                   peptide present"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0381"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92998"
FT                   /db_xref="GOA:A1K2E3"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2E3"
FT                   /protein_id="CAL92998.1"
FT                   /translation="MSRDRKPTRKPARSPARSGGGTLVGIFIGLVMGAVIAAGAAWYFT
FT                   RANPFQAAAPAPARAPVAVDQPPAALPGKPGDRPVVKQDFEFYKILPQGDGATHAAVEP
FT                   PKPVEKAPEKPAEKLWLQVGAFGAADEAENLKARLALSGIQASSQRAQLADGRVVQRVR
FT                   IGPFDKPEDMNSIRARLASAGFEASVTKSAP"
FT   CDS_pept        408982..409629
FT                   /transl_table=11
FT                   /gene="dsbA"
FT                   /locus_tag="azo0382"
FT                   /product="putative protein disulfide-isomerase"
FT                   /function="Thiol-disulfide isomerase and thioredoxins"
FT                   /EC_number="5.3.4.1"
FT                   /note="Putative protein disulfide-isomerase. Homology to
FT                   dsbA of P. flourescens of 34%. Involved in disulfide-bond
FT                   formation. Acts by transferring its disulfide bond to other
FT                   proteins. Tigrfam: redox_disulf_1: redox-active disulfid
FT                   Pfam: DSBA Oxidoreductase signal peptide no TMHS"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0382"
FT                   /db_xref="EnsemblGenomes-Tr:CAL92999"
FT                   /db_xref="GOA:A1K2E4"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2E4"
FT                   /protein_id="CAL92999.1"
FT                   /translation="MNRRIALKQLAGLAVLAGAAGPVVAQRAAAAPFVELDTVVATDSK
FT                   GKVEVIEFFHYGCPHCRAFDPLLESWLKRLPTDVAFLRVPAIWGNAQLGKLAQLYYAIE
FT                   LSGKVEPLHGKVFVAVQDDKVPLHTEEGVREWVAKQGVDTKAFMDAYKSFGMQALLKQA
FT                   DQRARDYKIQGVPTMAVDGRFLTSASMTGSHEATLKVVDDLIARARSQPRRG"
FT   CDS_pept        409658..410446
FT                   /transl_table=11
FT                   /locus_tag="azo0383"
FT                   /product="short chain dehydrogenase family protein"
FT                   /function="Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /note="The short-chain dehydrogenases/reductases family
FT                   (SDR) is a very large family of enzymes, most of which are
FT                   known to be NAD- or NADP-dependent
FT                   oxidoreductases,TREMBL:Q8Y2Q1 (42% identity);
FT                   SWISSPROT:P25970 (34% identity). InterPro (IPR002198):
FT                   Short-chain dehydrogenase/reductase (SDR). InterPro
FT                   (IPR002347): Glucose/ribitol dehydrogenase. Pfam (PF00106):
FT                   Short chain dehydrogenase."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0383"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93000"
FT                   /db_xref="GOA:A1K2E5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2E5"
FT                   /protein_id="CAL93000.1"
FT                   /translation="MLTAAAAGSPRVFLTGASSGLGAALARHYAARGASLGLVARRADA
FT                   LHELVASLPGRHLALVADVADPAALRSAATRFEAAFGVPDIVIANAGVSVGTLTEYAED
FT                   LDAFERVLRTNLLGMAATFQPFVEAMRARGRGRLAGIASVAGIRGLPGAGAYSASKAAA
FT                   ITYLESLRVELHGSGVTVTTIAPGYVATPMTAVNPYPMPFMLPAAEAAARIARHIDTGR
FT                   RYAVVPWQMALVAKLLRVLPDALFDRLFAHAGRKPRGLPL"
FT   CDS_pept        410530..410949
FT                   /transl_table=11
FT                   /locus_tag="azo0384"
FT                   /product="Hypothetical protein"
FT                   /note="Hypothetical protein. No Good homologs in the DB
FT                   matching the length of the protein. No Significant
FT                   domains,features,motifs present."
FT                   /db_xref="EnsemblGenomes-Gn:azo0384"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93001"
FT                   /db_xref="GOA:A1K2E6"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2E6"
FT                   /protein_id="CAL93001.1"
FT                   /translation="MDMKSGLPPESPERRTRQRFLALRRGEPCFWASVAGRRVALVDLS
FT                   IEGFAFVGPATTATEPFAVVLHRAGVPDEIHARASVVNVGGSGDDALLGCRFTSLGNAE
FT                   AALLQDWLVAHVIMNATVRITEKDAIAIVRGGSLI"
FT   CDS_pept        410991..412268
FT                   /transl_table=11
FT                   /locus_tag="azo0385"
FT                   /product="hypothetical membrane protein"
FT                   /note="Hypothetical membrane protein. Homology to vng2292h
FT                   of Halobacterium sp. of 25% (trembl|Q9HN16(SRS). no domains
FT                   predicted .no signal peptide. 10 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:azo0385"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93002"
FT                   /db_xref="GOA:A1K2E7"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2E7"
FT                   /protein_id="CAL93002.1"
FT                   /translation="MTETEHGPVGPPGGRWVRVGAGGAILFALVVFGLQTLSLQGYVGS
FT                   DYKIFHWAATRFLADPAALYDAGSAASLQGYLYPPPSIAFFLPLALGSVEAVFPVFSWL
FT                   AFLAAGLALAVWMRYLQRAALAPASPLLRTALLTMMLVTAPVFHARGGQVDSFVLLLCV
FT                   GAVVLLAAHPRLAGALAAVGAAVKIYPALLVVFAAARRDGRAAFLAGMVTMALVLGLAT
FT                   LVWMPISVTQDYLALLPQLSARTIINIYNQSAQAIGMRLTVPLEEARTQFSAYPVPGWA
FT                   RFATQFGLVAVIGFSIWLARRRADRAYLAGLVLATIPLAAPLGWGHAYVYVLPLFCLVL
FT                   GVAIERRQPVALVALALAYVALLVPGYHRFPYLGGAPDALLHVLFARNALAAAAIIGVA
FT                   WCQLARVPDARRAAVVPRTLAQEWAA"
FT   CDS_pept        412265..413521
FT                   /transl_table=11
FT                   /locus_tag="azo0386"
FT                   /product="hypothetical membrane protein"
FT                   /note="Hypothetical membrane protein. No good homology to a
FT                   protein of similar length in the data bank. no domains
FT                   predicted no singal peptide 9 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:azo0386"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93003"
FT                   /db_xref="GOA:A1K2E8"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2E8"
FT                   /protein_id="CAL93003.1"
FT                   /translation="MNPLRAFSGADERLLLAVVVAIGLALRVAAMLFVGHTPESDELAY
FT                   RAMAASLLAGEGIVDNMGNRAMYNVGYPLFVIAPVSWLFGDSVRAVQLANAVLGAVSVV
FT                   LCYCVAAAAGAGRGGRLIAAAAWALYLPASVYGVYLLKENLMVPLMLGVVWCALRLVSR
FT                   PALSTGVVCGVLFGALALSGNAALALALAVAYALMAAPVGWRRRLTVAAAIAALAIAVA
FT                   TPWMVRNLVVLGAPVLNTNGGFNLYLGNNPAATGMFVSIGDTPHGEDWQSLRALGEVEA
FT                   SAILRRDALAWIADHPGQFAALALKKALYFWTPPIHEGKGPPSRIESMVRAAWALQFFV
FT                   LAGAALACLAVRRLWGPRLTVLMLAVAAYTAVHMLFYVIFRYREPIMPVVCVLAALALE
FT                   ALVVRRVFPSEPVALASRG"
FT   CDS_pept        413530..414396
FT                   /transl_table=11
FT                   /locus_tag="azo0387"
FT                   /product="conserved hypothetical periplasmic binding
FT                   protein"
FT                   /note="Conserved hypothetical periplasmic binding proten.
FT                   Homology to rs03250 of R. solanacearum of 53%
FT                   (trembl|Q8Y2Q2). Interpro: Periplasmic binding protein
FT                   (IPR002491). Pfam: Periplasmic binding protein (PF01497).
FT                   This family includes bacterial periplasmic binding
FT                   proteins. Several of which are involved in iron transport.
FT                   no signal peptide. no TMHs."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0387"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93004"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2E9"
FT                   /protein_id="CAL93004.1"
FT                   /translation="MDVSRDVEEHMGGAGGGPPPDAAGWADAVGARHGRADAGARIVCL
FT                   VPSITELLFDLGVGDRLVGRTGFCIHPRDRVRALPKLGGTKDVKLDALRGLAPTHVIVN
FT                   IDENRRDTVEDISRFVPNVIVTHPCAPEDNLALYALLGGIFDCEAAATSLSVSLQTALA
FT                   EAAELRAALVPERVLYLIWREPWMTVSSATYIAAMLAAVGWESMPRAPEPRYPVVDWED
FT                   ASMADVARVFLSSEPYRFGPAHVGEVGALASRPAMLIDGEMCSWYGSRAIAGVRYLTAL
FT                   RRRLAKG"
FT   CDS_pept        complement(414428..414877)
FT                   /transl_table=11
FT                   /locus_tag="azo0388"
FT                   /product="conserved hypothetical protein"
FT                   /function="predicted nucleic acid-binding protein contains
FT                   PIN domain"
FT                   /note="Conserved hypothetical protein. Homology to ebA3626
FT                   of Azoarcus sp. EbN1 of 59% (gnl|keqq|eba:ebA3626(KEGG)).
FT                   InterPro: Protein of unknown function DUF132
FT                   InterPro:IPR002850; DUF132. IPR002716; PIN. IPR006596;
FT                   PINc. Pfam:PF01850; PIN; SMART:SM00670; PINc;
FT                   TIGRFAMs:TIGR00305; DUF132 TIGR00305: conserved
FT                   hypothetical protein T. Non-secretory protein with very low
FT                   signalpeptide probability (0.003) (Signal P predicted).
FT                   Absence of transmembrane helices"
FT                   /db_xref="EnsemblGenomes-Gn:azo0388"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93005"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002850"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2F0"
FT                   /protein_id="CAL93005.1"
FT                   /translation="MSFPRRLVLDTNTVMALWLFRDPRLAALDAAIAAARFQPCCRPDA
FT                   VEELRRVLAYTHFGIDADEQQRLIAGYSERVTLVDGLGDAADALPLPLCRDRDDQKFLE
FT                   ISRAAQAEFLLTRDKALLRLARHRLVRERFSILTPERFVSDGWCQ"
FT   CDS_pept        complement(414946..416775)
FT                   /transl_table=11
FT                   /gene="phbC1"
FT                   /locus_tag="azo0389"
FT                   /product="probable poly-beta-hydroxybutyrate synthase"
FT                   /function="Poly(3-hydroxyalkanoate) synthetase"
FT                   /EC_number="2.3.1.-"
FT                   /note="Function:-Polymerizes d(-)-3-hydroxybutyryl-CoA to
FT                   create PHB which consists of thousands of hydroxybutyrate
FT                   molecules linked end to end. PHB serves as an intracellular
FT                   energy reserve material when cells grow under conditions of
FT                   nutrient limitation. Entry name TREMBL:Q8KXD5 Prim.
FT                   accession # Q8KXD5 Identities = 354/607 (58%) InterPro
FT                   IPR000073; A/b_hydrolase. IPR010941; PhaC_N. Pfam PF00561;
FT                   Abhydrolase_1; 1. PF07167; PhaC_N; 1. Number of predicted
FT                   TMHs: 0"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0389"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93006"
FT                   /db_xref="GOA:A1K2F1"
FT                   /db_xref="InterPro:IPR010941"
FT                   /db_xref="InterPro:IPR010963"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2F1"
FT                   /protein_id="CAL93006.1"
FT                   /translation="MAAPETQHMHPELPDPKEVARTYAEVAQRASHLISEHVQRQLKKG
FT                   VSAPADELGIAQAFMDMMAKLLANPYKLAQAQMNLVWDYFSLWQHSMLRFMGVNAAPVA
FT                   APEKSDKRFKDEEWQEHFMFDFIKQSYLIAARHIHDTVCCVEGLEEQTQKKVNFYTRQY
FT                   IDALSPSNFAVTNPEVFRETVKSHGQNLLKGLNNLLRDVEEGGGNLRVKMTDTTAFELG
FT                   KNVATTPGKVVFQTDMMQLIQYSPSTENVLKRPLLIIPPWINKFYILDLREKNSYIKWC
FT                   VDQGHTVFVISWVNPDERQAEKTFESYVKEGVVAALDAIEKQTGEKEVNAAGYCLGGTL
FT                   LSTTLAYLAAKKDKRIASATFFTTMTDFSEPGELGVFIDEGQVSSLEKKMFERGYLEGS
FT                   EMAGTFNMMRANDLIWSFVVNNYLMGKDPFPFDLLYWNSDSTRMPAKMHSFYLRKMYME
FT                   NRLVQPGGVEIDGVPIDLGKIKVPCYFISAIEDHIAPWKSTYMGARNFGGPVRFVLGGS
FT                   GHIAGIVNPPAANKYGYWLNPVAKLPATADAWFEGAQQQPGSWWTDWQAWVSAHDTEQV
FT                   APRDPAKGKLKALEDAPGSFVKIRLDAHKALAS"
FT   CDS_pept        complement(416816..417844)
FT                   /transl_table=11
FT                   /locus_tag="azo0390"
FT                   /product="conserved hypothetical protein"
FT                   /function="Zn-dependent hydrolases including glyoxylases"
FT                   /note="conserved hypothetical protein. TREMBL:Q8Y2Q4-47%
FT                   identity, 61% similarity. Pfam:
FT                   Lactamase_B,aminotransferase III, AP2 domain. TMHMM
FT                   predicted transmembrane helices."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0390"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93007"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2F2"
FT                   /protein_id="CAL93007.1"
FT                   /translation="MSTEQQIEYPVADLPAPGTAVEIAPGIRWIRMPLPFALDHINLWL
FT                   LDDGDEVAVIDTGFGLEPIQANWEAVLAAEPRPLSRVFVTHHHPDHLGLASWLMQRNGA
FT                   TLHMSLGEFLGGQAVWHQLPGYSVADMVAQFRIHGLDDARLSALAERGNAYRRGIPEIP
FT                   QQYSRLFDGDQVEIGGQRWEVIVGYGHAPEHVSLYCERLGVLVSGDMLLPRISTNISVY
FT                   AATPDDDPLGWFLDSLRRISHLPDNTLVLPSHGRPFKGIRARVAQLIAHHRERCDALVA
FT                   ACTQPRSAADLLGTLFARALDTHQVMFAMGEAIAHLNYLVKRGELCRVGNPETGIRHTI
FT                   TR"
FT   CDS_pept        417987..418430
FT                   /transl_table=11
FT                   /locus_tag="azo0391"
FT                   /product="putative MerR-family transcriptional regulator"
FT                   /function="predicted transcriptional regulators"
FT                   /note="Putative MerR-family transcriptional
FT                   regulator,copper efflux regulator / copper export
FT                   regulator) InterPro: IPR000551 HTH_MerR. HTH reporting
FT                   nucleic acid binding motif."
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0391"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93008"
FT                   /db_xref="GOA:A1K2F3"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2F3"
FT                   /protein_id="CAL93008.1"
FT                   /translation="MAREQTYTITELAREFDITPRAIRFYEDQGLLTPARAGRARVYTR
FT                   SDRTRLKLTLRGKRLGFSLADIKELLDMYDGVRNSAPQLERFLTGLGARRAALEQQRLD
FT                   IEAVLQEIDVLEDQCRALLGHNAEGAAAARAELVRRLDNAGTA"
FT   CDS_pept        418560..419027
FT                   /transl_table=11
FT                   /locus_tag="azo0392"
FT                   /product="conserved hypothetical protein"
FT                   /function="uncharacterized protein possibly involved in
FT                   aromatic compounds catabolism"
FT                   /note="Similar to TREMBL:Q8YBL0 (47% identity);
FT                   TREMBL:Q987R7 (50% identity); TREMBL:Q7WA35 (55% identity).
FT                   InterPro (IPR003736): Phenylacetic acid degradation-related
FT                   protein. Pfam (DUF157): Uncharacterized protein PaaI,
FT                   COG2050."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0392"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93009"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2F4"
FT                   /protein_id="CAL93009.1"
FT                   /translation="MRHESPPFQPRDPDYAARVRASFAQQRAMALIGAELVAVEPGYTE
FT                   IHLPHRAEVTQQHGYIHGGVVGMIADSAAGYAANTLTPAETSVLTVEYKLNLVAPADGQ
FT                   RLVARGEVIKPGRTLLITRAEVFAVRDEKWTLCAVMQQTIMAMHGKKELAG"
FT   CDS_pept        419104..420315
FT                   /transl_table=11
FT                   /gene="fadAx"
FT                   /locus_tag="azo0393"
FT                   /product="probable acyl-CoA thiolase"
FT                   /function="Acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="Probable acyl-CoA thiolase. Homology to fadAx of P.
FT                   putida of 67% (gnl|keqq|ppu:PP2215(KEGG)). IPR002155;
FT                   Thiolase. Pfam PF02803; Thiolase_C; 1. PF00108; Thiolase_N;
FT                   1. Two different types of thiolase are found both in
FT                   eukaryotes and in prokaryotes: acetoacetyl-CoA thiolase
FT                   (EC:2.3.1.9) and 3-ketoacyl-CoA thiolase (EC:2.3.1.16).
FT                   3-ketoacyl-CoA thiolase (also called thiolase I) has a
FT                   broad chain-length specificity for its substrates and is
FT                   involved in degradative pathways such as fatty acid
FT                   -oxidation. Acetoacetyl-CoA thiolase (also called thiolase
FT                   II) is specific for the thiolysis of acetoacetyl-CoA and
FT                   involved in biosynthetic pathways such as poly
FT                   -hydroxybutyrate synthesis or steroid
FT                   biogenesis.Prediction: Non-secretory protein Signal peptide
FT                   probability: 0.002 Number of predicted TMHs: 0"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0393"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93010"
FT                   /db_xref="GOA:A1K2F5"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2F5"
FT                   /protein_id="CAL93010.1"
FT                   /translation="MSDPVVIVSVARTPMGGFQGDLSGLTGPQLGAIAIKSAVERARLA
FT                   PEQVQEVIMGCVLPAGVGQAPARQAALGAGLPLAAGCTTINKVCGSGMKATMLAHDLLL
FT                   AGTNEVMVAGGMESMSNAPYLLPKARGGYRLGHGQLLDHMFLDGLEDSYSKENKGRLMG
FT                   TFAEDCAGHFDFSRSAQDAFAVASTERAQAAITEGAFSWEVVPVTVAGRKGDVVVDKDE
FT                   QPLKAQLDKIGTLKPAFKKDGTVTAANSSSISDGAAALVLMRKSTADKLGLAPLATIVG
FT                   HATHAQEPQWFTTAPVGAMQKVLAKAGWGVGDVDLWEINEAFAVVTMAAMKELNLPHDK
FT                   VNVNGGACALGHPIGASGARILVTLIGALRRRGLKRGVASLCIGGGEATAMAIELNASV
FT                   ACGG"
FT   CDS_pept        420508..421641
FT                   /transl_table=11
FT                   /gene="fadfX"
FT                   /locus_tag="azo0394"
FT                   /product="probable acyl-CoA dehydrogenase"
FT                   /function="Acyl-CoA dehydrogenases"
FT                   /EC_number="1.3.99.-"
FT                   /note="Activity:- Catalysis of the reaction: acyl-CoA +
FT                   acceptor = 2,3-dehydroacyl-CoA + reduced acceptor. Entry
FT                   name TREMBL:Q9AHX9 Prim. accession # Q9AHX9 InterPro
FT                   IPR006089; Acyl-CoA_dh. IPR006090; Acyl-CoA_dh_C.
FT                   IPR006091; Acyl-CoA_dh_M. IPR006092; Acyl-CoA_dh_N.
FT                   IPR009075; AcylCoADH_C_like. IPR009100; AcylCoA_dehyd_NM.
FT                   Pfam PF00441; Acyl-CoA_dh; 1. PF02770; Acyl-CoA_dh_M; 1.
FT                   PF02771; Acyl-CoA_dh_N; 1. Identities = 244/375 (65%)
FT                   Number of predicted TMHs: 0"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0394"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93011"
FT                   /db_xref="GOA:A1K2F6"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2F6"
FT                   /protein_id="CAL93011.1"
FT                   /translation="MILTSEQELIRDSIRAFAQERLAPFAAEWDRNHTFPRQALKELAE
FT                   LGALGMVVPEEWGGAGMDYMSLVLALEEIAAGDGATSTIVSVQNSLACGIPAKYGTDAQ
FT                   KERWLKPLARGDMLGCFCLTEPHVGSDASALRTTAVRDGDDWVLNGVKQFITTGREADV
FT                   AIVFAVTDKAAGKKGISCFIVPTATPGYIVARIEEKMGQKASDTAQILFENCRVPADAL
FT                   LGAEGEGYKIALSNLEAGRIGIASQCLGMARAALEAAVKYAQERETFGKPIFEHQAVNF
FT                   RLADMATQLEAARQLVWHAASLKDAGRPCLKEASMAKLFASEMAEKVCSDAIQIHGGYG
FT                   YVSDFPVERIYRDVRVCQIYEGASDIQKLVIGRALAQ"
FT   CDS_pept        421777..422394
FT                   /transl_table=11
FT                   /locus_tag="azo0395"
FT                   /product="2-hydroxychromene-2-carboxylate isomerase family
FT                   protein"
FT                   /function="2-hydroxychromene-2-carboxylate isomerase"
FT                   /note="Similar to TREMBL:Q8Y2R2 (42% identity);
FT                   TREMBL:Q7WEK4 (30% identity); TREMBL:Q88IW7 (27% identity).
FT                   Pfam (HCCA_isomerase): 2-hydroxychromene-2-carboxylate
FT                   isomerase."
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0395"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93012"
FT                   /db_xref="GOA:A1K2F7"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR014440"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2F7"
FT                   /protein_id="CAL93012.1"
FT                   /translation="MTPPKTIDFWFDFSSPYGYFMSEKIDAVARRHGRDVRWRPFLLGV
FT                   VYKEIGSRPLTEVPLKGEYTRRDLLRTARFLDLPFALPSPFPVATQHAARCFYWLQADD
FT                   EALARRFAHAAYRAYFVEGRDISQQVEVVSIAAALEVDGAALSAALGDAPVKERLRAAS
FT                   AEAIAAGVFGSPYVIIDGEPFWGVDRLPQIEAWLAERSAAGR"
FT   CDS_pept        422445..422642
FT                   /transl_table=11
FT                   /locus_tag="azo0396"
FT                   /product="conserved hypothetical protein"
FT                   /function="predicted Fe-S protein"
FT                   /note="Conserved hypothetical protein. Homology to cc1308
FT                   of C. crescentus of 35% (trembl|Q9A8P5). Pfam:DUF1289 This
FT                   family consists of a number of hypothetical bacterial
FT                   proteins. The aligned region spans around 56 residues and
FT                   contains 4 highly conserved cysteine residues towards the
FT                   N-terminus. The function of this family is unknown. no
FT                   signal peptide no TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:azo0396"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93013"
FT                   /db_xref="InterPro:IPR010710"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2F8"
FT                   /protein_id="CAL93013.1"
FT                   /translation="MSPASPCINVCRMDAATGWCEGCLRTLDEIARWGRASDDDKRRIL
FT                   AAVAERRATAAVPHPREAAA"
FT   CDS_pept        422639..422824
FT                   /transl_table=11
FT                   /locus_tag="azo0397"
FT                   /product="Hypothetical protein"
FT                   /note="Hypothetical protein, 54% identity to TrEMBl;Q8YGQ7.
FT                   Has PF06945, Protein of unknown function
FT                   (DUF1289);IPR010710;This family consists of a number of
FT                   hypothetical bacterial proteins. The aligned region spans
FT                   around 56 residues and contains 4 highly conserved cysteine
FT                   residues towards the N-terminus. The function of this
FT                   family is unknown."
FT                   /db_xref="EnsemblGenomes-Gn:azo0397"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93014"
FT                   /db_xref="InterPro:IPR010710"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2F9"
FT                   /protein_id="CAL93014.1"
FT                   /translation="MSSDALCVGVCMIDWDAGICLGCGRTPEEIEGVPVPSPAETMPEA
FT                   VPLPPNVAAQVGEGSD"
FT   CDS_pept        422821..423738
FT                   /transl_table=11
FT                   /locus_tag="azo0398"
FT                   /product="putative beta lactamase"
FT                   /function="Zn-dependent hydrolases including glyoxylases"
FT                   /EC_number="3.5.2.6"
FT                   /note="Probable Hypothetical protein ycbL.
FT                   TREMBL:Q8Y2S7-43% identity,57% similarity.
FT                   TIGRFAM:2A0115-Benzoate transport proteins belong to this
FT                   group. Benzyl alcohol,benzaldehyde, benzoate, and
FT                   anthranilate are metabolized via catechol,
FT                   cis,cis-muconate, and the beta-ketoadipate pathway in some
FT                   bacteria InterPro: Metallo-beta-lactamase superfamily
FT                   Pfam:Metallo Beta lactamase superfamily, Phage lysozyme
FT                   TMHMM predicted transmembrane heleces ftsZ: cell division
FT                   protein FtsZ"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0398"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93015"
FT                   /db_xref="GOA:A1K2G0"
FT                   /db_xref="InterPro:IPR001018"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2G0"
FT                   /protein_id="CAL93015.1"
FT                   /translation="MSAPRLPASVQVFERGWLSANNVVLDDGGEVTLIDSGYVTHAAQT
FT                   LALVAGALGGRRLAQLINTHSHSDHIGGNAAVQRAFGGRIVVPAGMADAVERWDEDALL
FT                   LRTADQRGERFAHDAVLTAGDRFIAGGLEWQALPAAGHDMDALAFYNAERRILVSGDAL
FT                   WRDGFGILFADVLGRGDALGAARETLEAFGRLAVDVVIPGHGAPFADVDGALERAFARL
FT                   AAFEADGARMARNAIRACITFRLLEHRRLALDDLAAHLDATPLYRSANARFLGLEAQAL
FT                   ADWLVAELLRAGVARREGETLVPA"
FT   CDS_pept        423811..424689
FT                   /transl_table=11
FT                   /locus_tag="azo0399"
FT                   /product="conserved hypothetical protein"
FT                   /function="predicted P-loop-containing kinase"
FT                   /note="Hypothetical UPF0042 protein YPO3586/Y0158.
FT                   SWISPROT:Q82TN5: 6i% identity, 78% similarity This is a
FT                   family of putative P-loop ATPases. Many of the proteins in
FT                   this family are hypothetical and kinase activity has been
FT                   proposed for some family members InterPro:IPR005337;
FT                   UPF0042. Pfam: PF03668; ATP_bind_2 No Signal peptide
FT                   (Signal P predicted) No transmembrane helices (TMHMM
FT                   predicted) cmk: cytidylate kinase"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0399"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93016"
FT                   /db_xref="GOA:A1K2G1"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1K2G1"
FT                   /protein_id="CAL93016.1"
FT                   /translation="MQIVLISGLSGSGKSIALHVLEDAGYYVVDNLPSALLLQLVLHLR
FT                   GAGYQRVAVAVDMRSGSSIAALPEQVESLRGMVDDLRFIFLEARDDTLIARFSETRRRH
FT                   PLADENVSLDEAIQRERDALASVAELGHRMDTSDIHANTLRAWIKDFIGAAASEGLTLM
FT                   FQSFGFKYGIPLDADLVFDVRCLPNPYYDPLLRPLTGRDQGVIDYLEKVPEVGRMAEDI
FT                   RRFVADWLPAYMRDNRSYLTVAIGCTGGQHRSVYMAEWLARRFADRVRVIVRHRSAARR
FT                   VQDAPPAVSGK"
FT   CDS_pept        424686..425081
FT                   /transl_table=11
FT                   /locus_tag="azo0400"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="Conserved hypothetical membrane protein. Homology to
FT                   TP1032 of Treponema pallidum of 32%
FT                   (sprot|YA32_TREPA(SRS)). Has PF07009(IPR010739):Protein of
FT                   unknown function (DUF1312);This family consists of several
FT                   bacterial proteins of around 120 residues in length. The
FT                   function of this family is unknown. No singal peptide. 1
FT                   TMH"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0400"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93017"
FT                   /db_xref="InterPro:IPR024045"
FT                   /db_xref="InterPro:IPR038690"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2G2"
FT                   /protein_id="CAL93017.1"
FT                   /translation="MRLAGDARAWLALLRPGDVLVAALGLLACAGSVVALWRGGAPDGA
FT                   VIRAGGKVFAEVDLRQPRIIDVPGPIGTTRIEIAPGRARVAADPGPRQYCVRQGWLSRA
FT                   GAVAICAPNEVSLALTGRGADYDSLNY"
FT   CDS_pept        425062..425604
FT                   /transl_table=11
FT                   /locus_tag="azo0401"
FT                   /product="heptaprenyl diphosphate synthase component I"
FT                   /EC_number="2.5.1.30"
FT                   /note="Heptaprenyl diphosphate synthase component I, 23%
FT                   identity (45% similarity) to TrEMBL;Q896H9. Has
FT                   PF07456,Heptaprenyl diphosphate synthase component
FT                   I;IPR010898,Hpre_diP_synt_I: This family contains component
FT                   I of bacterial heptaprenyl diphosphate synthase
FT                   (approximately 170 residues long). This is one of the two
FT                   dissociable subunits that form the enzyme, both of which
FT                   are required for the catalysis of the biosynthesis of the
FT                   side chain of menaquinone-7."
FT                   /db_xref="EnsemblGenomes-Gn:azo0401"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93018"
FT                   /db_xref="GOA:A1K2G3"
FT                   /db_xref="InterPro:IPR010898"
FT                   /db_xref="InterPro:IPR014535"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2G3"
FT                   /protein_id="CAL93018.1"
FT                   /translation="MTPSTIELVPSAEDRRVARHAAAAIVLTVAEAAIPLPLPGVKPGL
FT                   ANIVTLIVLARWGWREAVWVALLRVGAGSLLLGQFLAPGFFLSLSGALASLLTLGVAMH
FT                   LPRRWFGPVSQSILAAFAHIGAQLVVARLWLVPHDGVFYLTPVFAAAAVVFGTINGLVA
FT                   ARLLTELNAADSTRSAA"
FT   CDS_pept        complement(425612..426709)
FT                   /transl_table=11
FT                   /gene="cheB1"
FT                   /locus_tag="azo0402"
FT                   /product="probable protein glutamate-methylesterase"
FT                   /function="Chemotaxis response regulator containing a
FT                   CheY-like receiver domain and a methylesterase domain"
FT                   /EC_number="3.1.1.61"
FT                   /note="Probable protein-glutamate
FT                   methylesterase,CheB_methylest. IPR001789; Response_reg.
FT                   IPR008248; RR_chemtxs_CheB. Pfam: PF01339; CheB_methylest.
FT                   PF00072; response_reg. SMART: SM00448; REC. Chemotaxis
FT                   response regulator protein-glutamate methylesterase (EC
FT                   3.1.1.61). Involved in the modulation of the chemotaxis
FT                   system; catalyzes the demethylation of specific
FT                   methylglutamate residues introduced into the chemoreceptors
FT                   (methyl-accepting chemotaxis proteins) by cheR (By
FT                   similarity)."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0402"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93019"
FT                   /db_xref="GOA:A1K2G4"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2G4"
FT                   /protein_id="CAL93019.1"
FT                   /translation="MSNKIKVMIVDDSALVRQVVSQAISRDPGIEVIGTAQDPVFALAK
FT                   LNSLAPDVLVVDIEMPRMDGLTFLKRIMAERPTPVIICSSLAEKGAQVTMEALSAGAVA
FT                   IITKPKMGLKNFLEDASNDIVQAIKAAARANVRALGRAVSPAAVAADVRPKLSADAVIA
FT                   PASAHQGAGMYGTTDRIVAIGTSTGGTQALEAVLTRLPAVSPGIVIVQHMPERFTAMFA
FT                   ERLNGLCKIEVREARHGDRVIPGRALIAPGGKHMMLARSGAQYTVEVVDGPLVNRHRPS
FT                   VDVLFRSCAKFAGRNALGVIMTGMGDDGARGLKEMREAGARTVAEDESTCVVFGMPKEA
FT                   IRLGGVDEILPLDRIPAAILQSARG"
FT   CDS_pept        complement(426736..427560)
FT                   /transl_table=11
FT                   /gene="cheR1"
FT                   /locus_tag="azo0403"
FT                   /product="probable chemotaxis protein methyltransferase"
FT                   /function="Methylase of chemotaxis methyl-accepting
FT                   proteins"
FT                   /EC_number="2.1.1.80"
FT                   /note="Probable chemotaxis protein
FT                   methyltransferase,CheR_Metranf. IPR001601; Methyltransf.
FT                   IPR000051; SAM_bind. Pfam: PF01739; CheR. PF03705; CheR_N.
FT                   SMART: SM00138; MeTrc. Chemotaxis protein methyltransferase
FT                   (EC 2.1.1.80). METHYLATION OF THE MEMBRANE-BOUND
FT                   METHYL-ACCEPTING CHEMOTAXIS PROTEINS (MCP) TO FORM
FT                   GAMMA-GLUTAMYL METHYL ESTER RESIDUES IN MCP.Annotation
FT                   derived from meta auto annotator."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0403"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93020"
FT                   /db_xref="GOA:A1K2G5"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2G5"
FT                   /protein_id="CAL93020.1"
FT                   /translation="MDNPGITDREFALFQRLIYRLAGISMSDAKKVLMVGRLGKRLRHY
FT                   DLASFGDYYRLLASGTHPDELQTMVDLLTTNETYFFREPAHFEFLREFAASRKGGAPFR
FT                   IWSGACSSGEEPYTMALVLAETLGLSTSWEIVASDISMTVLERARAGLYPLERAEGIPQ
FT                   PLLKKYCLKGVREQQGNFLICPELRERIDFRQLNLVALDAPNLGHFDVIFLRNVMIYFD
FT                   TETKARVIANMLPHLKQDGRFIVGHSETLHGVTDELAALRPTLYKRASVQSS"
FT   CDS_pept        complement(427566..428156)
FT                   /transl_table=11
FT                   /gene="cheD"
FT                   /locus_tag="azo0404"
FT                   /product="conserved hypothetical chemotaxis protein CheD"
FT                   /note="Conserved hypothetical chemotaxis protein CheD.
FT                   Homology to cheD of S. oneidensis of 41% (trembl|Q8EF62).
FT                   Interpro: CheD (IPR005659). Pfam: CheD (PF03975). This
FT                   chemotaxis protein stimulates methylation of MCP proteins.
FT                   no signal peptide. no TMHs"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0404"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93021"
FT                   /db_xref="GOA:A1K2G6"
FT                   /db_xref="InterPro:IPR005659"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038592"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2G6"
FT                   /protein_id="CAL93021.1"
FT                   /translation="MTDWDQLSPQEVERLARNIGPGEWAVDRQRPISTLLGSCVAVCMF
FT                   DPVSRVGGMNHFMLPNIRRNDHHADDDMLLSGDYAMEALLNGLLNQGAVRHRVQAKAFG
FT                   GGTIIHGMTSAGIGERNAAFAREWLTREGISLQAEDFLGPWSRKLLFIPATGTAWCKRM
FT                   PTTMTTVEQIAREEADYAASLQRKPPKGNIELF"
FT   CDS_pept        complement(428223..428765)
FT                   /transl_table=11
FT                   /gene="cheW1"
FT                   /locus_tag="azo0405"
FT                   /product="probable positive regulator of CheA protein
FT                   activity"
FT                   /function="Chemotaxis signal transduction protein"
FT                   /note="Probable positive regulator of CheA protein
FT                   activity, CheW. Pfam: PF01584; CheW. SMART: SM00260; CheW.
FT                   Chemotaxis protein cheW.Involved in the transmission of
FT                   sensory signals from the chemoreceptors to the flagellar
FT                   motors. It physically bridges chea to the mcps
FT                   (methyl-accepting chemotaxis proteins) to allow regulated
FT                   phosphotransfer to cheY and cheB."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0405"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93022"
FT                   /db_xref="GOA:A1K2G7"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2G7"
FT                   /protein_id="CAL93022.1"
FT                   /translation="MNQIVASGQRKSGSPQDDGPQQYLTFSLGGEVFALGILNVKEIIE
FT                   FGNVTEIPMMPSFIRGVINLRGAVVPVIDLSARFGGKNSTISRRTCIVIVEIDGEDGKQ
FT                   DLGVIVDAVNEVLEIPRADIEPPPAFGAKIRADFIQGMGKVDGRFVIILNVERVLSTEE
FT                   IAMLTRMGDEDGATSAA"
FT   CDS_pept        complement(428787..431225)
FT                   /transl_table=11
FT                   /locus_tag="azo0406"
FT                   /product="putative methyl-accepting chemotaxis protein"
FT                   /function="Methyl-accepting chemotaxis protein"
FT                   /note="Methyl-accepting chemotaxis protein, only very low
FT                   similarity to SWISSPROT: sprot|Y4FA_RHISN (14% Rhizobium
FT                   sp. (strain NGR234). InterPro: IPR004090; Me_chemotaxis.
FT                   IPR004089; Chmtaxis_transd. IPR003660; HAMP. Pfam: PF00672;
FT                   HAMP. PF00015; MCPsignal. SMART: SM00304; HAMP. SM00283;
FT                   MA. Signal P reporting signal peptide. TMHMM reporting 2
FT                   transmembrane helices."
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0406"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93023"
FT                   /db_xref="GOA:A1K2G8"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2G8"
FT                   /protein_id="CAL93023.1"
FT                   /translation="MKIATRTKLLVLVSVLGIAVSVIFALFSLRSSLLSDRQDKTKNLI
FT                   EVAHSVLAHYHAREVAGQMTRDQAQTAAKDVIRGMRYDGEEYFWINDLEHRMLMHPIKP
FT                   ELEGKDLSTLKDAAGKAFFVDMVAAVKQNDGGFVDYVWPRAGSDKPVPKLSYVKGFKPW
FT                   GWMLASGIYIEDVDAALWREFSNQLIIGIVIVIALLVLAVATIRDVTRAIRGTVDSARH
FT                   LADGDFDTVSDLQLKNELGAVLEANNAIRVSVQQMRAEAVSLSRAAVAGQLSSRADLSK
FT                   YHGGYREVVEGVNATLDAVIGPLNVAADYVDRIAKGTIPPKITDSYNGDFNTIKNNLNT
FT                   AIDAINALVADAAMLSRAAVEGKLATRADASRHQGDYQRIVQGVNDTLDAVIGPLNVAA
FT                   DYVDRIAKGAIPPKITDSYNGDFNTIKNNLNTAIDAVGALVADAAMLAQAAVEGRLETR
FT                   ADASRHQGDYRKIVEGVNHTLDAVIDPINEVKRVMIALSQGDLTQKIHAEYAGDFRVLQ
FT                   DAVNGSLDKLGEIIEQVRGAADALSNAAAQVSATAQSLSQASSEQAASVEEVSSTIEEA
FT                   AASINQNSENAKVTDGMATKSATEAAEGGEAVRNTVEAMKNIAGKIGIIDDIAYQTNLL
FT                   ALNAAIEAARAGEHGKGFAVVAAEVRKLAERSQVAAQEIGQLAGNSVTLAERAGALLGE
FT                   MVPSIRKTSDLVQEIASASQEQSAGVVQINHAMGQLNKATQQNASASEELAATAEELGG
FT                   QAGQLQQLMGFFSVGDGAGAAAVIATASARKAPARAAATPAPRASRKPVSFSEADFERF
FT                   "
FT   CDS_pept        complement(431253..433700)
FT                   /transl_table=11
FT                   /locus_tag="azo0407"
FT                   /product="putative methyl-accepting chemotaxis protein"
FT                   /function="Methyl-accepting chemotaxis protein"
FT                   /note="Methyl-accepting chemotaxis protein, only very low
FT                   similarity to SWISSPROT: sprot|Y4FA_RHISN (14% Rhizobium
FT                   sp. (strain NGR234). InterPro: IPR004090; Me_chemotaxis.
FT                   IPR004089; Chmtaxis_transd. IPR003660; HAMP. Pfam: PF00672;
FT                   HAMP. PF00015; MCPsignal. SMART: SM00304; HAMP. SM00283;
FT                   MA. Signal P reporting signal peptide. TMHMM reporting 1
FT                   transmembrane helices."
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0407"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93024"
FT                   /db_xref="GOA:A1K2G9"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2G9"
FT                   /protein_id="CAL93024.1"
FT                   /translation="MKNLKIGIRLGLGFGVTVLLLIVIAGIAMLRLGALDQAIRQVVDD
FT                   AYPKTVIANRIIDNVNISAIALRNAALVKNPEAVNAEFERIAEARRNTAADFATLDRII
FT                   VLPEGKRLLQKVLESRATTGAEQDKYMALLKAGQRDQAVDMLITSVRSTQAAYIANVNE
FT                   MIDFQAKRMTDLGQDAGALANSTETLIGALAVAAVLLALGFAVFVTRSITRPIDEVLGA
FT                   ARKMAAGDFKFVLESTARDEVGEVVRAVASVQASVRTMIDDAAVLATAAVEGRLATRAD
FT                   AARHQGDFRRIVEGVNGTLDAVIGPLNVAADYVDRIAKGAIPPKIADSYNGDFNAIKNN
FT                   LNTAIDAINALVADAAMLSRAAVEGKLATRADASRHQGDYQRIVQGVNDTLDAVIGPLN
FT                   VAADYVDRIAKGAIPPRITDSYNGDFNTIKNNLNTAIDAVGALVADAAMLAQAAVEGRL
FT                   ETRADASRHQGDYRKIVEGVNHTLDAVIDPINEVKRVMIALSQGDLTQKIHAEYAGDFR
FT                   VLQDAVNGSLDKLGEIIEQVRGAADALSNAAAQVSATAQSLSQASSEQAASVEEVSSTI
FT                   EEAAASINQNSENAKVTDGMATKSATEAAEGGEAVRNTVEAMKNIAGKIGIIDDIAYQT
FT                   NLLALNAAIEAARAGEHGKGFAVVAAEVRKLAERSQVAAQEIGQLAGNSVTLAERAGAL
FT                   LGEMVPSIRKTSDLVQEIASASQEQSAGVVQINHAMGQLNKATQQNASASEELAATAEE
FT                   LGGQAGQLQQLMGFFSVGDGTGLKAGLPLPKKSASNRSAPAPAPARASRKPVSFSEADF
FT                   ERF"
FT   CDS_pept        complement(433738..435933)
FT                   /transl_table=11
FT                   /gene="cheA1"
FT                   /locus_tag="azo0408"
FT                   /product="putative chemotaxis protein histidine kinase"
FT                   /function="Chemotaxis protein histidine kinase and related
FT                   kinases"
FT                   /EC_number="2.7.13.1"
FT                   /note="Putative chemotaxis histidine kinase
FT                   protein,ATPbind_ATPase. IPR004358; Bact_sens_pr_C.
FT                   IPR002545; CheW. IPR004105; H-kinase_dim. IPR005467;
FT                   His_kinase. IPR008207; Hpt. IPR008208; Hpt_N. Pfam:
FT                   PF01584; CheW. PF02895; H-kinase_dim. PF02518; HATPase_c.
FT                   PF01627; Hpt. SMART: SM00260; CheW. SM00387; HATPase_c.
FT                   SM00073; HPT. Chemotaxis protein cheA (EC 2.7.3.-).
FT                   INVOLVED IN THE TRANSMISSION OF SENSORY SIGNALS FROM THE
FT                   CHEMORECEPTORS TO THE FLAGELLAR MOTORS. CHEA IS
FT                   AUTOPHOSPHORYLATED; IT CAN TRANSFER ITS PHOSPHATE GROUP TO
FT                   EITHER CHEB OR CHEY."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0408"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93025"
FT                   /db_xref="GOA:A1K2H0"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2H0"
FT                   /protein_id="CAL93025.1"
FT                   /translation="MDEIISVFVTESREQLAALEAALLQLEDAPDDSDTLNAVFRSAHT
FT                   IKGGAGVVECDFIVAFTHVVENVLDKLRNGEIKLNGDLAALLLACGDHIGNLLGVLEAG
FT                   ASAPDADLAAEGDALLARLQRDWLDGGAHGASPHPAPAPAAAVEVSGGGVVDTDCWHIS
FT                   LRFGPDVLKNGMDPLSFLRYLATLGTIVRIETLADAMPPADEMDAENCYLGFEISFASS
FT                   ADKAAIERVFDFVRDDCTLHILPPHSRLHDYLEMIKALPEDNMRLGEILVRVGALTQAE
FT                   LDDGLRTQHPPHEDGAAEEITAPIGEILVEQHVVQPELVEAAVVKQKQVSDKKAAEARL
FT                   IRIQADKLDKLIDLVGELVIAGASVNLLAGKSGLSELVEATSLTGRLVESIRDAALQLR
FT                   MVQIGETFNRFNRVVRDVSKELGKDIELAISGGETELDKSMVEKIGDPLMHLVRNAMDH
FT                   GIEAPEVRVANGKPARGRLELNAYHDSGSIIIEVADDGGGLKRERIVAKAVERGLVQAG
FT                   QQLSDAEIYNLIFEAGFSTAAQVSNLSGRGVGMDVVRRNIQSLRGTVEVSSVEGQGSRF
FT                   AIRLPLTLAIIDGFLVGVGRAAYVIPLDTVVECIELNQDAGERDYINLRGEVLPFVRLR
FT                   EMFEVAGEAPPRQNVVVVQYAGVKAGIVVDQLMGEFQTVIKPLGAIFRHIKGIGGSTIL
FT                   GSGEVALILDVQALVQRCANREAHGMQPPRALAASLD"
FT   CDS_pept        complement(435947..436255)
FT                   /transl_table=11
FT                   /locus_tag="azo0409"
FT                   /product="putative STAS domain protein"
FT                   /function="Anti-anti-sigma regulatory factor (antagonist of
FT                   anti-sigma factor)"
FT                   /note="Putative anti-sigma factor antagonists (STAS domain
FT                   protein), STAS. Pfam: PF01740; STAS. The STAS (Sulphate
FT                   Transporter and AntiSigma factor antagonist) domain is
FT                   found in the C-terminal region of sulphate transporters and
FT                   bacterial anti-sigma factor antagonists. It has been
FT                   suggested that this domain may have a general NTP binding
FT                   function."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0409"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93026"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2H1"
FT                   /protein_id="CAL93026.1"
FT                   /translation="MSTPATAPLAIVEDMTIYHAAEQKQQLVAALAQADELQIDLSAVA
FT                   EIDTAGFQLLILVKREAQRLGKRARIVAHSAAVREVVDFFNMAAEFGDPMLMPAPEA"
FT   CDS_pept        complement(436258..437526)
FT                   /transl_table=11
FT                   /locus_tag="azo0410"
FT                   /product="putative methyl-accepting chemotaxis protein"
FT                   /function="Methyl-accepting chemotaxis protein"
FT                   /note="Putative methyl-accepting chemotaxis
FT                   protein,Chmtaxis_transd. Pfam: PF00015; MCPsignal. SMART:
FT                   SM00283; MA. Signal P reporting signal peptide. TMHMM
FT                   reporting 2 transmembrane helices."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0410"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93027"
FT                   /db_xref="GOA:A1K2H2"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2H2"
FT                   /protein_id="CAL93027.1"
FT                   /translation="MPFNTLLQRSLVVFATVAVLAGIAVFFLNDWFHGSFLPALGLAQP
FT                   VGDAVGSMLIVTVAYFGQRVVSLAFFRDHMYGLTSSQEQMRDASHNVAAVGDEVAHELR
FT                   AVPTYNDVLRRQLDSVVQQTEKAAYDITERLQSIDGVVSHLNTFVVESSSESDQMAHDS
FT                   EERIAGNQKLIAEMRQYIDYRIQEARQDQERVAQVVHEARSLESLTRLIKDIAAQTNLL
FT                   ALNAAIEAARAGEAGRGFAVVADEVRKLSAETEKAVLAINQGILGVANTIETQLQEKLS
FT                   SINLDREQAALGQFADQLGALGHSYESILDHQGKVMSTVRDSSQQLAEMFMAALASVQF
FT                   QDVTRQQLEHTADSLRRLDGHLGVLADRLEQSENADFRYTPLSEHLEEIYSRYVMDQQR
FT                   HTHHNALQQADDVGGGGPKIELF"
FT   CDS_pept        complement(437534..437899)
FT                   /transl_table=11
FT                   /gene="cheY1"
FT                   /locus_tag="azo0411"
FT                   /product="probable chemotaxis response regulator"
FT                   /function="FOG: CheY-like receiver"
FT                   /note="Probable chemotaxis response regulator,"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0411"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93028"
FT                   /db_xref="GOA:A1K2H3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2H3"
FT                   /protein_id="CAL93028.1"
FT                   /translation="MKTIFLVDDSATILLSISNILSKAGYGVEKAGNAAEALSKFQSGV
FT                   KVDLLITDLNMPGMNGIDFIKEVRKLPNYRFMPILFLTTESQQSKKAEAKAAGASGWIV
FT                   KPASADELLNTIKLVIR"
FT   tRNA            complement(438216..438288)
FT                   /gene="tRNA-Lys"
FT                   /locus_tag="azo_tRNA_0004"
FT                   /product="transfer RNA-Lys"
FT                   /anticodon="(pos:438253..438255,aa:Lys)"
FT                   /inference="nucleotide motif:Simple tRNAscan Autoannotator"
FT   CDS_pept        complement(438349..439440)
FT                   /transl_table=11
FT                   /locus_tag="azo0412"
FT                   /product="conserved hypothetical membrane protein"
FT                   /function="predicted transporter component"
FT                   /note="Conserved hypothetical membrane protein. Homology to
FT                   rsc0739 of R. solanacearum of 52% (trembl|Q8Y1F1). Pfam:
FT                   DUF395 This family includes YeeE and YedE from E. coli.
FT                   These proteins are integral membrane proteins of unknown
FT                   function. Many of these proteins contain two homologous
FT                   regions that are represented by this family. This region
FT                   contains several conserved glycines and an invariant
FT                   cysteine that is probably an important functional residue.
FT                   signal peptide 8 TMHs"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0412"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93029"
FT                   /db_xref="GOA:A1K2H4"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2H4"
FT                   /protein_id="CAL93029.1"
FT                   /translation="MEAALPAPAILALGFMLGGGFGALSSRTHFCTMGAVADIVAFGDW
FT                   SRMRMWLAAIATAMLGTALLQAAGLFDPAHSLYAGARVPWLSHAVGGLCFGAGMTLASG
FT                   CAGKTLVRLGGGSLKALVVATFLAIGASMTLRGLFAAWRSSWLDPHVLVLDHAQTLPAF
FT                   LAAADLPSGALVGLVAGLALLIASLAPAGARRADILWSGAGVGLLCVAAWYVTGHLGYV
FT                   AEDPQTLEEAFIATSSGRAESLSFVAPHAYTLDLLLLWTDRSRVLSFGVATLGGVIAGA
FT                   LLYRLATRSLRLESFADPADLLRHVAGGLLMGFGGVTALGCSIGQGVGGLSTLSLGALI
FT                   TTAAIIAGATATLRLQLWHLQRS"
FT   CDS_pept        complement(439455..440141)
FT                   /transl_table=11
FT                   /gene="exsB"
FT                   /locus_tag="azo0413"
FT                   /product="conserved hypothetical ExsB protein"
FT                   /note="Conserved hypothetical ExsB protein. Homology to
FT                   exsB of P. syringae of 70% (trembl|Q87Y44). This protein
FT                   family is represented by a single member in nearly every
FT                   completed large (> 1000 genes) prokaryotic genome. In
FT                   Rhizobium meliloti, a species in which the exo genes make
FT                   succinoglycan, a symbiotically important exopolysaccharide,
FT                   exsB is located nearby and affects succinoglycan levels,
FT                   probably through polar effects on exsA expression or the
FT                   same polycistronic mRNA. Interpro: ExsB (IPR004479). Pfam:
FT                   ExsB (PF06508). Tigrfam: TIGR00364: exsB protein. Has
FT                   signal peptide present. No TMHs"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0413"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93030"
FT                   /db_xref="GOA:A1K2H5"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1K2H5"
FT                   /protein_id="CAL93030.1"
FT                   /translation="MTDLPRAVVLLSGGLDSATCLAIARDMGLETYALSVAYGQRHAAE
FT                   LTASRRVAHALGAREHRVASVSLGEFGGSALTDPAIAVPEDAAPGGIPVTYVPARNTVM
FT                   LSMALAWAEVLGARHIFVGVNAVDYSGYPDCRPAFIQAFETMANLATKAGVEGHPTTIH
FT                   APLIDLSKADIIRRGVALGVDYGLTVSCYQADDDGRACGRCDACRLRREGFAAAGIADP
FT                   TRYQAR"
FT   CDS_pept        complement(440170..440832)
FT                   /transl_table=11
FT                   /locus_tag="azo0414"
FT                   /product="conserved hypothetical radical activating enzyme"
FT                   /function="Organic radical activating enzymes"
FT                   /note="Conserved hypothetical radical activating enzyme.
FT                   Homology to xac3139 of X. axonopodis of 60%
FT                   (trembl|Q8PHW0). InterPro: Radical activating enzymes
FT                   (IPR001989) Pfam: Radical activating enzyme no signal
FT                   peptide no TMHs"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0414"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93031"
FT                   /db_xref="GOA:A1K2H6"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="InterPro:IPR027621"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2H6"
FT                   /protein_id="CAL93031.1"
FT                   /translation="MTEVVRQPVKLRLTEIFASIQGESTRVGLPTTFVRLTGCPLRCSW
FT                   CDTAYAFTGGEARALSDVLDDVAALGLRHVCVTGGEPLAQKYCLALLTALCDAGYSVSL
FT                   ETSGALDIGGVDPRVSRVMDLKAPGSAEVTRNRLENIPLLRARDELKIVLADQADYDWA
FT                   RAMIADHDLAARCPVLLSPVAGTLDPAQLAEWIVRDRLPVRFQLQLHKILWNDARGR"
FT   CDS_pept        complement(440843..441562)
FT                   /transl_table=11
FT                   /locus_tag="azo0415"
FT                   /product="conserved hypothetical secreted protein"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /note="Conserved hypothetical secreted protein. Homology to
FT                   RS05116 of R.solanacearum of 38% (trembl|Q8Y1F3(SRS)) No
FT                   domains predicted. No TMHs Has signal peptide."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0415"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93032"
FT                   /db_xref="GOA:A1K2H7"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR014162"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR032519"
FT                   /db_xref="InterPro:IPR034706"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2H7"
FT                   /protein_id="CAL93032.1"
FT                   /translation="MKRLLPLAALLALSSAGPAHAGLFDDNEARRQIYEMRQDLENRIN
FT                   ASQGSQLDLANQNEQLRGEVARLRGQIEVLMNEVESLKQRQRDFYVDLDNRLRKLETAP
FT                   VAAESAAPAADPVAESTEYEAALNLLKGGKHRDALTAFEAFLARHPAGSFAPSAHFWAG
FT                   NAALQAKEVASATTHFNAVLGKWPNDSVAPDAMLGLANSQQAMGDAKTAQRTLQSLVER
FT                   YPSSNAAQAAKQRLGKR"
FT   CDS_pept        complement(441562..442080)
FT                   /transl_table=11
FT                   /gene="pal"
FT                   /locus_tag="azo0416"
FT                   /product="putative peptidoglycan-associated lipoprotein"
FT                   /function="Outer membrane protein and related
FT                   peptidoglycan-associated (lipo)proteins"
FT                   /note="Putative peptidoglycan-associated lipoprotein.
FT                   Homology to pal of E. coli of 36% (sprot|PAL_ECOLI).
FT                   Thought to play a role in bacterial envelope integrity.
FT                   Very strongly associated with the peptidoglycan. Pfam: ompA
FT                   family signal peptide no TMHs"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0416"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93033"
FT                   /db_xref="GOA:A1K2H8"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR014169"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039001"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2H8"
FT                   /protein_id="CAL93033.1"
FT                   /translation="MKKLVLPALLSAVLAACSSTGPEATSGAAVTDRSGAGVATVTANT
FT                   PSGSGIAALTDPNNILSKRNVFFDFDSYVIKADAKPLVEAHGRFLAQNPQMKMLVQGNA
FT                   DERGSREYNLALGQKRADAVKQALLLLGAKEAQIESVSLGEEKPRCTESSEACFAQNRR
FT                   GDMLYSGEF"
FT   CDS_pept        complement(442120..443403)
FT                   /transl_table=11
FT                   /gene="tolB"
FT                   /locus_tag="azo0417"
FT                   /product="putative translocation protein TolB"
FT                   /function="Periplasmic component of the Tol biopolymer
FT                   transport system"
FT                   /note="Putativ translocation protein tolB. Homology to tolB
FT                   of P. aeruginosa of 39% Involved in the tonB-independent
FT                   uptake of proteins. signal peptide probable 1 TMH (unusual
FT                   for TolB)"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0417"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93034"
FT                   /db_xref="GOA:A1K2H9"
FT                   /db_xref="InterPro:IPR007195"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR014167"
FT                   /db_xref="InterPro:IPR036752"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1K2H9"
FT                   /protein_id="CAL93034.1"
FT                   /translation="MKTFAQLRLLLAAAALALLSFSAQAQLSIEITGAGASRFPVIIPV
FT                   FENEASLPRSVSDIVRADLERSGLFSLVDIGPLPLPEGQIPDLGSLRSRGADAALAASV
FT                   FPQGDGRYEIRFRLFDTQKQTELGALALRMTAAQNRITAHRIADFVYEKLTGLPGYFAT
FT                   RIAYVVKTGPRYELQVADADGMNAQAALVSREPIISPAWSPDGGRLAYVSFEAKKPIIY
FT                   VHTLATGQRQVVANFKGSNSAPAWSPDGQQLSVVLTKDGLSQLYVLNADGSGVRRLASS
FT                   SGIDTEPAWSPDGQWIYFTSDRGGSPQIYRIPTAGGAAQRVTFDGTYNVTARPSADGRL
FT                   LAFITRNNGRFQVAVQDLTTRQTTILTDSARDESPSFAPNGRMILYATDAGGRGVLAAV
FT                   SSDGRVKQRLSVQAADVREPAWGPLQKQ"
FT   CDS_pept        complement(443450..444292)
FT                   /transl_table=11
FT                   /gene="tolA"
FT                   /locus_tag="azo0418"
FT                   /product="conserved hypothetical membrane protein"
FT                   /function="Function unkown"
FT                   /note="Conserved hypothetical membrane protein. Homology to
FT                   tolA of N. europaea of 39% (trembl|Q82XP0). no domains
FT                   predicted InterPro: Proline-rich region (IPR000694) no
FT                   signal peptide 1 TMHs"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0418"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93035"
FT                   /db_xref="GOA:A1K2I0"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2I0"
FT                   /protein_id="CAL93035.1"
FT                   /translation="MNERALPHEHPGKWASLALTFAVHIGLALFLFFGIRWQSEPPASL
FT                   EVELAAPPPSRAPEPVDVRPEPEPKPEPPKPTPPRPEPKPEPKPEPPKAAAKPEIATKA
FT                   PEKKPEPPKPEPKKPEPPKPEPKKPEPPKPEPKKPEPPKPEPKKPVEPPKDNYMDKLLE
FT                   RETERAELDKMMRADAARAASARNKAATEGYINAIRTKVRGNLLRPPGLSGNPEAVFEV
FT                   DQLPSGEVLNVRLKRSSGIPALDEAIERAIRRSSPLPLPDKGELFERTLELKFRPLEE"
FT   CDS_pept        complement(444289..444702)
FT                   /transl_table=11
FT                   /gene="tolR"
FT                   /locus_tag="azo0419"
FT                   /product="putative translocation protein TolR"
FT                   /function="Biopolymer transport protein"
FT                   /note="Putative translocation protein TolR. Holomology to
FT                   tolR of P. aeruginosa of 30% (sprot|TOLR_PSEAE) Involved in
FT                   eth TonB-independent uptake of proteins. no signal peptide
FT                   probable 1 TMH"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0419"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93036"
FT                   /db_xref="GOA:A1K2I1"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2I1"
FT                   /protein_id="CAL93036.1"
FT                   /translation="MRQRRLMNQINVVPYIDVMLVLLVIFMVTAPMVQPGNIDVPSAGP
FT                   ISAPPAEAIVIELEKRNAIAIRKTSNAASRPVSSIEFQRVVKEALAANPEQPFLVAANK
FT                   SLPYQDVIDILEAARQLGVKKISLQTQSGAAGR"
FT   CDS_pept        complement(444721..445395)
FT                   /transl_table=11
FT                   /gene="tolQ"
FT                   /locus_tag="azo0420"
FT                   /product="translocation protein TolQ"
FT                   /function="Biopolymer transport proteins"
FT                   /note="Translocation protein TolQ. Homology to tolQ of R.
FT                   solanacearum of 52%. Involved in the tonB-independent
FT                   uptake of proteins. InterPro: MotA/TolQ/ExbB proton channel
FT                   family Pfam: MotA/TolQ/ExbB proton channel family no signal
FT                   peptide probable 3 TMHs"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0420"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93037"
FT                   /db_xref="GOA:A1K2I2"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR014163"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2I2"
FT                   /protein_id="CAL93037.1"
FT                   /translation="MTVSHDLSIISLITQASVLVQLVMAMLAGLSVMSWYWIFRKWFQI
FT                   RAARSKTTEFERDFWSGGDLNALFQSASAARHHTGGMERIFESGYREYNKLRAKSHDHG
FT                   ATIDGARRAMRATFQREVDDLEAHLAFLASVGSVSPYIGLFGTVWGIMNAFRGLSNVGT
FT                   ATLTQVAPGIAEALVATAIGLFAAIPAVVAYNRFAHDIDRIGIRFESFMEEFSNILQRN
FT                   LR"
FT   CDS_pept        complement(445392..445859)
FT                   /transl_table=11
FT                   /locus_tag="azo0421"
FT                   /product="conserved hypothetical thioesterase"
FT                   /EC_number="3.1.2.-"
FT                   /note="Conserved hypothetical thioesterase. Homology to
FT                   bb4233 of B. bronchiseptica of 41% (trembl|Q7WFN8).
FT                   Tigrfam: TIGR00051: conserved hypothetical protein .Pfam:
FT                   4-hydroxybenzol-CoA thioesterase (PF0361). Interpro:
FT                   4-hydroxybenzol-CoA thioesterase (IPR006684); thioesterase
FT                   superfamily (IPR006683) This family contains a wide variety
FT                   of enzymes, principally thioesterases. This family includes
FT                   4HBT which catalyses the final step in the biosynthesis of
FT                   4-hydroxybenzoate from 4-chlorobenzoate in the soil
FT                   dwelling microbe Pseudomonas CBS-3. This family includes
FT                   various cytosolic long-chain acyl-CoA thioester hydrolases.
FT                   Long-chain acyl-CoA hydrolases hydrolyse palmitoyl-CoA to
FT                   CoA and palmitate, they also catalyse the hydrolysis of
FT                   other long chain fatty acyl-CoA thioesters. no signal
FT                   peptide. no TMHs"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0421"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93038"
FT                   /db_xref="GOA:A1K2I3"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR014166"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2I3"
FT                   /protein_id="CAL93038.1"
FT                   /translation="MQTRSRPEPAGDAFVLPLRVYYEDTDAAGIVYYANYLRYCERART
FT                   EWLRALGFEQQRLRAERGLVFVVKSVHAEYMSPALLDDALELRSVIETLGRASLAFRQQ
FT                   VLRNGVCLFDARVVIACVDLVRNRPVAMPAEIREQFEHVLPPPQPEPPQPA"
FT   CDS_pept        445887..447230
FT                   /transl_table=11
FT                   /locus_tag="azo0422"
FT                   /product="hypothetical protein"
FT                   /function="predicted Zn-dependent hydrolases of the
FT                   beta-lactamase fold"
FT                   /note="SPROT:P37718: 26% identity, 43% similarity Cellulose
FT                   synthase operon protein C precursor. Required for maximal
FT                   bacterial cellulose synthesis. InterPro: STAS domain. The
FT                   STAS (Sulphate Transporter and AntiSigma factor antagonist)
FT                   domain is found in the C-terminal region of sulphate
FT                   transporters and bacterial anti-sigma factor antagonists.
FT                   It has been suggested that this domain may have a general
FT                   NTP binding function. InterPro:IPR008410; BCSC_C.
FT                   IPR003921; Cell_synth_C. Pfam:PF05420; BCSC_C; 1.
FT                   ant_ant_sig: anti-anti-sigma factor No signal peptide
FT                   present SignalP predicted). No transmembrane helices
FT                   present (TMHMM predicted)"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0422"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93039"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2I4"
FT                   /protein_id="CAL93039.1"
FT                   /translation="MRQVGRSETRPKATIPYTPKWAQALCWRPLAHHRRAVEVLSLPIP
FT                   LFSAPLFRGAKNSVALPFFGKKTPPATPDRAAPGGGDVPKAPQPAPTELSSLDFSRGDA
FT                   NRALAQFAGMVEVQEVETGIGAVFEEAAVLYANGADAEAEKVLVAVLDEPGSVTGEGLW
FT                   MMLLDLYRLTGQRQKFESRVLDYATRFERSPPPWYDLSAGERRRSDSVPLVTLSGALNA
FT                   QSAAQFQQIGIIGRKSGAVRIDLARVRGADDAGCALLRQVFAQLAADRVKVSLLNGGGL
FT                   ADTLSAQIEAGRAEQRDTWLLVLELLQYTADCERFEQLAIDYAVTFEESPPSWEKKASA
FT                   AAAAPVAEPSAPLVGAKGEFVLDGELGGASNDILRKLAAHAAERKSVVVECSRLRRIDF
FT                   VCAGTLFNIIATLQAQGRVVELRGVNAMVGALLRVMSVDQVAQVTLRA"
FT   CDS_pept        447262..447798
FT                   /transl_table=11
FT                   /gene="hslV"
FT                   /locus_tag="azo0423"
FT                   /product="ATP-dependent protease HslV"
FT                   /function="ATP-dependent protease HslVU (ClpYQ) peptidase
FT                   subunit"
FT                   /EC_number="3.4.25.-"
FT                   /note="ATP-dependent protease HslV (EC 3.4.25.-) (Heat
FT                   shock protein HslV). Homology to hslV of E. coli of 69%.
FT                   Protease subunit of a proteasome-like degradation complex.
FT                   InterPro: Multispecific proteasome proteases (IPR004491) no
FT                   signal peptide no TMHs"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0423"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93040"
FT                   /db_xref="GOA:A1K2I5"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1K2I5"
FT                   /protein_id="CAL93040.1"
FT                   /translation="MEQYHGTTILSVRRGNSVALGGDGQVTLGNIVVKASARKVRTLYQ
FT                   GQILAGFAGGTADAFTLFERFEAKLDKHQGNLLRSAVELAKDWRTDRMLRRLEAMLAVA
FT                   DREHSLIITGNGDVLEPEQGIVAIGSGGAYAQSAARALIENTELSPRDVIAKSLAIAGD
FT                   LCIYTNQCHTIEVLD"
FT   CDS_pept        447833..449164
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /locus_tag="azo0424"
FT                   /product="ATP-dependent Hsl protease ATP-binding subunit"
FT                   /function="ATP-dependent protease HslVU (ClpYQ) ATPase
FT                   subunit"
FT                   /note="ATP-dependent hsl protease ATP-binding subunit hslU.
FT                   Homology to hslU of E. coli of 65% (sprot|HSLU_ECOLI).
FT                   Chaperone subunit of a proteasome-like degradation complex
FT                   (By similarity). InterPro: Heat shock protein HslVU ATPase
FT                   subunit HslU(IPR004491),AAA ATPase,central region
FT                   (IPR003959), AAA ATPase (IPR003593) Tigrfam: hslU: heat
FT                   shock protein HslVU ATPas Pfam: ATPase family associated
FT                   with varius cellular no signal peptide no TMHs"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0424"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93041"
FT                   /db_xref="GOA:A1K2I6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1K2I6"
FT                   /protein_id="CAL93041.1"
FT                   /translation="MTQMTPPEIVSELDKHIVGQARAKKAVAIALRNRWRRARIDEPLR
FT                   SEITPKNILMIGPTGVGKTEIARRLARLANAPFIKVEATKFTEVGYVGRDVDTIIRDLV
FT                   EIAIKDGRERAMRVVRDRALDAAEDRVLDVLLPPARPVGFSEPAQPQDSATRQKFRKKL
FT                   REGELDDKEVEIEVASAPMQAEIFAPPGMEELTQQIQGMFQNLGNSRKKLRKLPIREAL
FT                   KLLADEEAARLINDEEVKTEALRAVEQNGIVFLDEVDKIAARADAHGADVSRQGVQRDL
FT                   LPLVEGTTISTKYGMIKTDHILFIASGAFHLSKPSDLIPELQGRFPIRVELESLSVEDF
FT                   ERILTSTDACLTRQYEALLATDGVTLSFTPEGIRRLAEIAYQVNEKTENIGARRLYTVM
FT                   EKLLEEVSFEAGKVGVDKLTVDAAYVDARLEVLAQREDLARYVL"
FT   CDS_pept        449266..450138
FT                   /transl_table=11
FT                   /gene="mdcF1"
FT                   /locus_tag="azo0425"
FT                   /product="putative malonate transporter"
FT                   /function="predicted permeases"
FT                   /EC_number="2.7.7.-"
FT                   /note="Putative malonate transporter. subcellular
FT                   location:integral membrane protein (potential). similarity:
FT                   belongs to the auxin efflux carrier (tc 2.a.69) family.
FT                   SPROT:P56948:24% identity, 41% similarity. InterPro:
FT                   IPR004776; Auxin_eff. Pfam:PF03547; Auxin_eff 2a69: Auxin
FT                   Efflux Carrier"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0425"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93042"
FT                   /db_xref="GOA:A1K2I7"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2I7"
FT                   /protein_id="CAL93042.1"
FT                   /translation="MLTRIVAILFPLFAITAAGFFIGRRLKPDLSHANRLNMDVFVPAL
FT                   VFAALANREFRIGEYLPLLGLTLALVAGSGLVGWVAARALKVEPRTLVPPLMFNNCGNL
FT                   GLPLAVLAFGDAALMPAVVMFMVSNLLHFSFGAWLLDHRARLVNLWRVPSVAATFAGLA
FT                   VGIAGIEVWPPLMTAIKMVGDISIPLMLFALGVRLTDARLTSVGLGVFVALLRPLSGMA
FT                   LVWVLLQLVPLPPREAALLLVFGALPPAVLNYIFAERYRQEPEKVASMVLIGNLAAVLF
FT                   LPLALALAL"
FT   CDS_pept        complement(450142..452085)
FT                   /transl_table=11
FT                   /locus_tag="azo0426"
FT                   /product="GGDEF/PAS-domain containing protein"
FT                   /function="FOG: GGDEF domain"
FT                   /note="GGDEF/PAS-domain containing protein,"
FT                   /db_xref="EnsemblGenomes-Gn:azo0426"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93043"
FT                   /db_xref="GOA:A1K2I8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2I8"
FT                   /protein_id="CAL93043.1"
FT                   /translation="MSFPPRQPLIGRDASPAARGFLVTIAVVVLVVSIEWAAWRQYRAF
FT                   EQRQATAEFARIADQATLSLMQQTAHYRNALLALRATWLASERFDPDEFARYVRALSAP
FT                   QSLPGLRAFAFNRAVEERDRAAYVQRIRREYSAHDPIYNRFDIYPDGIRERYHVVEMIQ
FT                   PPSGNQRSLGYDLGTSDVRRVTVEHALQHGFAATPPIQLQQAPGVLAILILAPLRNVAD
FT                   TTASAADTRDTVAASFLVNEMVNAAISPSLRKQFHLRITDLGATEAAIDTATPLYADNT
FT                   PPGVDSDPRTVTREESFGGRRWQLRFQPTEPAARPLADTVLFGLLAAGALLAGLVSHLA
FT                   MQHARRVVRHQALVRLGSDCILELDAGGRVREADNAAQRITGLPPREWEGEPLWRKVAE
FT                   EDALDVERAVRQCIERREPVVIECRVPDDSGGPPRWISMRLGNHLDHPYLGCLFAQISN
FT                   IDARKEVEAEVARLAFYDPLTGLPNRRLLEARAELTLAAARRHNGHAAVMVLDLDGFKE
FT                   INDSAGHAVGDEVLAQLATRLRHVVRDSDTVARLGGDEFVILLGEPAGEAEVRTAAVRI
FT                   SHALTVPLTAAGHNWLVTASVGIALHPDHGDNFADLLGAADTAMYRSKRTGRGLTTVAS
FT                   GRSAGATPRSTY"
FT   CDS_pept        complement(452338..452742)
FT                   /transl_table=11
FT                   /gene="hslR"
FT                   /locus_tag="azo0427"
FT                   /product="heat shock protein"
FT                   /function="Ribosome-associated heat shock protein
FT                   implicated in the recycling of the 50S subunit (S4
FT                   paralog)"
FT                   /note="Heat shock protein 15 homolog (HSP15). INVOLVED IN
FT                   THE RECYCLING OF FREE 50S RIBOSOMAL SUBUNITS THAT STILL
FT                   CARRY A NASCENT CHAIN. BINDS RNA MORE SPECIFICALLY THAN
FT                   DNA. BINDS WITH VERY HIGH AFFINITY TO THE FREE 50S
FT                   RIBOSOMAL SUBUNIT. DOES NOT BIND IT WHEN IT IS PART OF THE
FT                   70S RIBOSOME"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0427"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93044"
FT                   /db_xref="GOA:A1K2I9"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2I9"
FT                   /protein_id="CAL93044.1"
FT                   /translation="MTTSPSGSDDARTRIDKWLWAARFFKHRTGATDAVDGGKVKLNGS
FT                   AVKPARDVKVGDRLDITIGEEQFTVVVRAIADKRGPASVAQTLYEETPDSVERRQASRE
FT                   QRKLAATPGADLHGRPTKRDRRQIRRFTDF"
FT   CDS_pept        complement(452792..454072)
FT                   /transl_table=11
FT                   /gene="cysN/C"
FT                   /locus_tag="azo0428"
FT                   /product="putative sulfate adenylyltransferase subunit 1 /
FT                   adenylylsulfate kinase"
FT                   /function="GTPases - Sulfate adenylate transferase subunit
FT                   1"
FT                   /note="55% Adenylylsulfate kinase (EC 2.7.1.25) (APS
FT                   kinase) (ATP adenosine-5-phosphosulfate
FT                   3-phosphotransferase)], from Pseudomonas aeruginosa.
FT                   FUNCTION:ATP sulfurylase may be the GTPase, regulating ATP
FT                   sulfurylase activity (By similarity). FUNCTION:APS kinase
FT                   catalyzes the synthesis of activated sulfate (By
FT                   similarity). CATALYTIC ACTIVITY:ATP + sulfate = diphosphate
FT                   + adenylylsulfate. CATALYTIC ACTIVITY:ATP +
FT                   adenylylsulfate=ADP +3'-phosphoadenylylsulfate. PATHWAY:
FT                   Sulfate activation; cysteine biosynthesis reductive branch;
FT                   first step. PATHWAY:Sulfate activation; cysteine
FT                   biosynthesis reductive branch; second step.
FT                   SUBUNIT:Heterodimer composed of cysD, the smaller
FT                   subunit,and cysN (By similarity). SIMILARITY:In the
FT                   N-terminal section; belongs to the GTP-binding elongation
FT                   factor family. CysN/nodQ subfamily. SIMILARITY:In the
FT                   C-terminal section; Belongs to the APS kinase family.
FT                   SWISSPROT:CYSN_PSEAE:O50274.
FT                   InterPro:IPR002891;APS_kinase.IPR004161;EFTU_D2.IPR009001;
FT                   Elong_init_C.IPR000795; ProtSyn_GTPbind.IPR005225;
FT                   Small_GTP.IPR009000; Translat_factor. Pfam:PF01583;
FT                   APS_kinase; 1.PF00009; GTP_EFTU; 1.PF03144; GTP_EFTU_D2;1.
FT                   TIGRFAMs:TIGR00455; apsK; 1.TIGR00231; small_GTP; 1."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0428"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93045"
FT                   /db_xref="GOA:A1K2J0"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR011779"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR041757"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2J0"
FT                   /protein_id="CAL93045.1"
FT                   /translation="MSAPEQLPEIDNGLLRFLTCGSVDDGKSTLIGRLLFDTKAILADT
FT                   MNAIEKTSAKRGMSAVDLSLLTDGLQAEREQGITIDVAYRYFSTGTRKYIIADAPGHEQ
FT                   YTRNMVTAASTANLAIILVDARRGVLTQTRRHSYLASLVGIPHLLVAVNKMDLVDYDQK
FT                   VFEQIRADYLAFADKLGIKDVRFIPISALAGDMIVDRGDRLGWYDGPTLLEILEAAPAA
FT                   HTETAENFRFPVQFVCRPQDSANPELHDYRGFMGRVESGEVAVGDAITVLPSGATSKVK
FT                   AIELGGEKLQRAIHEQSVTLLLEDEIDISRGDMIVKSAEAPEAVKQIDATVCWLSETPM
FT                   STARTYLVRHTTREAKAKVAKIDYRLDVNTLEQEPATSLAMNDIARLTLKLAQPIVADA
FT                   YADNRATGAFIIIDESTNNTVGAGMIG"
FT   CDS_pept        complement(454492..455406)
FT                   /transl_table=11
FT                   /gene="cysD"
FT                   /locus_tag="azo0429"
FT                   /product="putative sulfate adenylyltransferase subunit 2"
FT                   /function="3-phosphoadenosine 5-phosphosulfate
FT                   sulfotransferase (PAPS reductase)/FAD synthetase and
FT                   related enzymes"
FT                   /EC_number="2.7.7.4"
FT                   /note="84% PAPS_reduct. Pfam:PF01507; PAPS_reduct; 1."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0429"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93046"
FT                   /db_xref="GOA:A1K2J1"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR011784"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2J1"
FT                   /protein_id="CAL93046.1"
FT                   /translation="MSTLTKQTLSHLDWLEAEAIHILREVAGQCSNPALLFSGGKDSLC
FT                   LLRLAEKAFRPGRFPFPLLHVDTGHNYPEVIEFRDRRAAELGERLIVRSVEDSMARGTV
FT                   VLKSPDESRNKHQSVTLLEAIEEFGFDACIGGARRDEEKARAKERIMSFRDEFGQWDPK
FT                   NQRPELWNLYNARSHKGENIRAFPISNWTELDVWQYIEREKLELPSIYFAHVRPVVRKN
FT                   GLLQPVTALTPAKPGDVIEDVLVRFRTVGDITCTAPVESDADTVAKILAETATTTITER
FT                   GATRMDDQTSEASMEQRKKEGYF"
FT   CDS_pept        complement(455534..456304)
FT                   /transl_table=11
FT                   /gene="cysH"
FT                   /locus_tag="azo0430"
FT                   /product="probable phosphoadenylyl-sulfate reductase"
FT                   /EC_number="1.8.4.8"
FT                   /note="Probabel phosphoadenylyl-sulfate reductase. Homology
FT                   to csyH of V. sinosum of 55% (trembl|Q9L9V0).
FT                   Phosphoadenosine phosphosulphate reductase (EC: 1.8.4.8) is
FT                   involved in the assimilation of inorganic sulphate. In a
FT                   reaction requiring reduced thioredoxin and NADPH, it
FT                   converts 3'-phosphoadenylylsulphate (PAPS) to sulphite and
FT                   adenosine 3',5' diphosphate (PAP). Interpro:
FT                   Phosphoadenosine phosphosulfate reductase cysH-type
FT                   (IPR004511); Phosphoadenosine phophsulfate reductase
FT                   (IPR002500) Tigrfam: cysH: phosophoadenylyl-sulfate
FT                   reductase Pfam: Phsphadenosine phosphosulfate reductase no
FT                   signal peptide no TMHs"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0430"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93047"
FT                   /db_xref="GOA:A1K2J2"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004511"
FT                   /db_xref="InterPro:IPR011798"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2J2"
FT                   /protein_id="CAL93047.1"
FT                   /translation="MSGAVSMLRPAATNPATRPELTEALRASVSAKAAAARELLAAAVA
FT                   ELGANGEITFANSFGAEDMVLTDLILGGKLPIEIFSLDTGRLPAETYTLMGAVEQRYGT
FT                   KLKVFFPDATAVEQFVRSEGINAFYDSVELRKACCGIRKMEPLRRALAGKKAWVTGLRA
FT                   AQSVTRTGLALREFDTANGLEKFNPLSDWTEAEVWAYIRINEVPYNALHDQFYPSIGCA
FT                   PCTRAIALGEDIRAGRWWWEDPASKECGLHVKKT"
FT   CDS_pept        complement(456301..456831)
FT                   /transl_table=11
FT                   /locus_tag="azo0431"
FT                   /product="conserved hypothetical protein"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /note="Conserved hypothetical protein. Homology to PA1837
FT                   of P.aeruginosa of 50% (tremble:Q9I2Q8). Has
FT                   PF06073,Bacterial protein of unknown function
FT                   (DUF934);IPR008318 UCP030820: This family consists of
FT                   several bacterial proteins of unknown function. One of the
FT                   members of this family Q8YEW3 is thought to be an
FT                   oxidoreductase. No signal peptide. No TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:azo0431"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93048"
FT                   /db_xref="InterPro:IPR008318"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2J3"
FT                   /protein_id="CAL93048.1"
FT                   /translation="MPKVIRNRRVEDDARQIVRLAEGETAETVAIPAGPVLVPLAVWQA
FT                   RAEELAARGDVGVWLEAAEGAELIAADLPKLAAVAVNFPAFTDGRGYSTAALLRTRYGY
FT                   SGELRAIGDVLRDQFQAYVRCGFDTLQPNAGRYTDAQLEAALASLGDFSVPYQGAVDEP
FT                   RPLWARAQRGVAA"
FT   CDS_pept        complement(456824..458506)
FT                   /transl_table=11
FT                   /gene="cysI"
FT                   /locus_tag="azo0432"
FT                   /product="putative sulfite reductase"
FT                   /function="Sulfite reductase beta subunit (hemoprotein)"
FT                   /EC_number="1.8.1.2"
FT                   /note="49% Fd-NiR.IPR011255; NiR_SiRalpha_1/3.IPR006067;
FT                   Nir_Sir_4Fe4S.IPR005117; NiR_SiR_beta_fer. Pfam:PF01077;
FT                   NIR_SIR; 2.PF03460; NIR_SIR_ferr; 2."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0432"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93049"
FT                   /db_xref="GOA:A1K2J4"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2J4"
FT                   /protein_id="CAL93049.1"
FT                   /translation="MYRYDDYDQRLVDERVAQFRDQTRRYLAGELSEDEFRPLRLQNGL
FT                   YVQRHAPMLRIAVPYGLFSSAQLRTLADIARRYDRGYGHFTTRQNIQFNWPELAKVPEI
FT                   LAQLATVQMHAIQTSGNCIRNITSDAFAGVAADELIDPRPWCEILRQWSSFHPEFAHLP
FT                   RKFKFAVNGAKEDRAVIQAHDIGLDVVKNDAGEIGFRVLVGGGLGRTPIIGEEIAAFVP
FT                   WQHIVTYCESILRVYNLHGRRDNKYKARIKILVKALGIEEFRRQVEAEWAFHKNGPSTL
FT                   TEAEVARVAAHFVDPAYESLPATDAGYASLLDENKPFAAWVKRNVRAHKVPGYASVTIS
FT                   LKKTGVPPGDITESQMELVADLADAYSYGEVRATHQQNLVLADVRQSDLFKVWQSLRDA
FT                   GLATPNIGLLTDIISCPGGDYCALANAKSIPIANAIQERFDNLDYLYDIGEIELNISGC
FT                   MNACGHHHVGHIGVLGVDKNGEEWYQVTIGGDQGNKAAIGKVIGPSFAAAEMPDVVTHL
FT                   IETYIANRHEDERFVDTVRRIGIEPFKAHVYGNRQTEKKVAHA"
FT   CDS_pept        complement(458559..459338)
FT                   /transl_table=11
FT                   /locus_tag="azo0433"
FT                   /product="conserved hypothetical membrane protein"
FT                   /function="predicted permeases"
FT                   /note="Conserved hypothetical membrane protein. Homology to
FT                   bll1489 of B. japonicum of 58% (trembl|Q89UC8(SRS))
FT                   InterPro:IPR002781; DUF81. Pfam:PF01925; DUF81 Presence of
FT                   8 transmembrane helices (TMHMM predicted) probable
FT                   transmembrane protein of unknown function) no signal
FT                   peptide"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0433"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93050"
FT                   /db_xref="GOA:A1K2J5"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2J5"
FT                   /protein_id="CAL93050.1"
FT                   /translation="MDFAYTVAGFAVGAIVGLTGVGGGSLMTPLLVLLFGIHPSVAVGT
FT                   DLLYAAITKAGGTVAHGLKGTVDWTVTRRLASGSIPAAALTLVLVGTFAPGGMAGATGL
FT                   IKVALGVALLLTAVALIFRKQIQAYAASRFGDEPNPQRTAWLTVVVGAVLGVLVSISSV
FT                   GAGALGVTALFFLYPKMPALRIVGSDIAHAVPLTLVAGIGHWILGSVDWFLLGSLIVGS
FT                   LPGIWLGSHISTKVPDRVLRPILATMLVLVGAKLIGH"
FT   CDS_pept        459444..460385
FT                   /transl_table=11
FT                   /gene="cysB"
FT                   /locus_tag="azo0434"
FT                   /product="transcriptional regulator CysB"
FT                   /function="Transcriptional regulator"
FT                   /note="HTH-type transcriptional regulator cysB (Cys regulon
FT                   transcriptional activator). this protein is a positive
FT                   regulator of gene expression for the cysteine regulon, a
FT                   system of 10 or more loci involved in the biosynthesis of
FT                   l-cysteine from inorganic sulfate. the inducer for cysb is
FT                   n-acetylserine. cysb inhibits its own transcription."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0434"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93051"
FT                   /db_xref="GOA:A1K2J6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037423"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2J6"
FT                   /protein_id="CAL93051.1"
FT                   /translation="MNLQQLRYIQEVARRGLNVSDAADALYTSQPGVSKQIRLLEAELG
FT                   IEIFARHGKRLVAVTEPGRAVLAIAERMLRDMDNLLQVGDEFSNEAAGGLSIATTHTQA
FT                   RYALPPVVREFMRRYPQVKLSLHQGSPHQVCEMVLDGSADIAIATEAIAEYDELVMLPC
FT                   HQWNRCVVASPRHPILREQPLTLEAIARYPLITYDDAFTGRSQINKAFLGRGLKPNVVL
FT                   TALDSDVIKTYVAMDLGIGILARMAYDPEEDRKLGMIDAAHLFESSTTRIGLRRRAWLR
FT                   GYVYAFVELFAPHLTRRMVETALAGGGSDPGL"
FT   CDS_pept        460530..461414
FT                   /transl_table=11
FT                   /locus_tag="azo0435"
FT                   /product="hypothetical secreted protein"
FT                   /note="Hypothetical secreted protein. No homology to the
FT                   data bank. No domains predicted. Signal peptide present. No
FT                   TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:azo0435"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93052"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2J7"
FT                   /protein_id="CAL93052.1"
FT                   /translation="MEIRKVVLGCATACCAIASPSVSAALLPLPDTVIDGVVVSIQYGD
FT                   FYSYSTRVLDYLQPDAGWDKSAGTGTLDVIITTRSAGQSNSNGGLAPYNIPDPITNVNE
FT                   NPTSGSWGMGGTSATTMLVSDLYRYLQDTFDATIPVFTFDQNETGGNPSLFAMAKVEIF
FT                   DKDGNLLEDWILGDGVNPVEAPGTVCVDPDSLPLKCFSNNVGSGAFDYILFAPTMDLTN
FT                   YNAEGNIFKVSWTFSSVDDGGEEATLTGRFTGSICVENPSAPQCQVIPEPGALALIGGG
FT                   LLALFALRRRWGA"
FT   CDS_pept        complement(461424..462398)
FT                   /transl_table=11
FT                   /locus_tag="azo0436"
FT                   /product="L-asparaginase II precursor"
FT                   /function="L-asparaginase/archaeal Glu-tRNAGln
FT                   amidotransferase subunit D"
FT                   /EC_number="3.5.1.1"
FT                   /note="L-asparaginase precursor (EC 3.5.1.1) (L-asparagine
FT                   amidohydrolase) (L-ASNase)."
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0436"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93053"
FT                   /db_xref="GOA:A1K2J8"
FT                   /db_xref="InterPro:IPR004550"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2J8"
FT                   /protein_id="CAL93053.1"
FT                   /translation="MPRQPVIALVATGGTIAGTADTPGAVTGYTAGVLGAEALLAAFPG
FT                   LGEIAALRAETLFSLDSKDMAPAHWLALAQRVQALADDPAVDGVVITHGTDTLEESAFF
FT                   VHLTVATAKPVVFTAAMRPATALSADGPMNLLAAVRVAAAPAFHGLGTLVAINDRVYAA
FT                   RDVQKQRTHGLDAFGAGEGAAVGRSDPARPGLLVNRDGGSCAAALASAALPAVEVLYVA
FT                   AGASPALLDAVRGSGAAGAVLAFPGNGSVPEAWKPAIDAALHAGMVLVRASRVPAGPVG
FT                   HDTRLPASLLSAGDLPPSKARVALMLALACDRPQRFCTLAAPH"
FT   CDS_pept        complement(462427..463827)
FT                   /transl_table=11
FT                   /locus_tag="azo0437"
FT                   /product="probable aspartate ammonia-lyase"
FT                   /function="Fumarase"
FT                   /EC_number="4.3.1.1"
FT                   /note="Region start changed from 463959 to 463827 (-132
FT                   bases)"
FT                   /db_xref="EnsemblGenomes-Gn:azo0437"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93054"
FT                   /db_xref="GOA:A1K2J9"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004708"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2J9"
FT                   /protein_id="CAL93054.1"
FT                   /translation="MQTTRIEHDLLGEREIPADVYWGIHSLRALENYPITGKSIGAYPE
FT                   LVKALALVKQAAARTNHQLGQLDEGRFHAIDEACREIAEGRLHNQFVVDVIQGGAGTST
FT                   NMNANEVIANLALEKLGWPKGHYKELHPINHVNMSQSTNDVYPTALKLAVVFAIQGLLD
FT                   AMETLRLAYLAKAEEFKDILKIGRTQLQDAVPMTLGQEFSTYAVMMKEDVARLREAICL
FT                   IQEINLGATAIGTGINTDIRYAKMATEHLAELSGVKLVPAENLIEATQDTGAFVQLSGV
FT                   LKRIACKLSKVCNDLRLLSSGPQAGFNEINLPERAAGSSIMPGKVNPIIPEVVNQIAFE
FT                   VIGNDVTITLASEGGQLQLNAFEPIIGHSLFKSIEHLEAGCRTLTDNCVRGITANRELL
FT                   AERVRTSAGLATALNPHIGYENATWAAREALKTGRSVAELVLERGLMDKESLERTLRPE
FT                   VLTAPRAE"
FT   CDS_pept        complement(463964..465061)
FT                   /transl_table=11
FT                   /gene="ansB2"
FT                   /locus_tag="azo0438"
FT                   /product="periplasmic L-asparaginase II"
FT                   /function="L-asparaginase/archaeal Glu-tRNAGln
FT                   amidotransferase subunit D"
FT                   /EC_number="3.5.1.1"
FT                   /note="L-asparaginase precursor (EC 3.5.1.1) (L-asparagine
FT                   amidohydrolase) (L-ASNase)."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0438"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93055"
FT                   /db_xref="GOA:A1K2K0"
FT                   /db_xref="InterPro:IPR004550"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2K0"
FT                   /protein_id="CAL93055.1"
FT                   /translation="MPLSSQLRHLLLPALAAAALLLPPAAHAREAAAPARLAKVVILAT
FT                   GGTIAGAGADAASSATYQAAKVPVEKLVAGIPELKNLAEVRGEQVFQIASESFTNEHLL
FT                   QLGRRVAELSASADVDGIVITHGTDTLEETAFFLNLVIRSDKPVVVVGSMRPGTALSAD
FT                   GALNLYDAVAVAASSDARGKGVLVTMNDEIHSGRDVSKAVNIRPDAFRSPWGPLGMVVE
FT                   GKPYWFRLPAKRHTLNSEFDIARIQSLAPVEIAYGYGNVSDTAYKAFAAAGAKAIIHAG
FT                   TGNGSVSNRVVPGLQALRAQGVHIVRSSRVDGGGFVLRNAEQPDDKYDWVAAHDLNPQK
FT                   ARILAAVALTTTSDSRELQRIFWEY"
FT   CDS_pept        complement(465187..465915)
FT                   /transl_table=11
FT                   /gene="glnQ1"
FT                   /locus_tag="azo0439"
FT                   /product="probable glutamine transport ATP-binding protein"
FT                   /function="ABC-type polar amino acid transport system
FT                   ATPase component"
FT                   /note="Glutamine transport ATP-binding protein glnQ.
FT                   Homology with glnQ of B. stearothermophilus of 56%
FT                   (sprot|GLNQ_BACST). PART OF THE BINDING-PROTEIN-DEPENDENT
FT                   TRANSPORT SYSTEM FOR GLUTAMINE. PROBABLY RESPONSIBLE FOR
FT                   ENERGY COUPLING TO THE TRANSPORT SYSTEM. InterPro: AAA
FT                   ATPase superfamily (IPR003593), ABC_transporter
FT                   (IPR003439), ATP/GTP_binding site motif A (P-loop)
FT                   (IPR001687) Pfam: ABC transporter no signal peptide no
FT                   TMHs"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0439"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93056"
FT                   /db_xref="GOA:A1K2K1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2K1"
FT                   /protein_id="CAL93056.1"
FT                   /translation="MIEINNVSKWYGDFQVLTDCTTGVKKGEVVVVCGPSGSGKSTLIK
FT                   CVNALEPFQQGSIKVNGIAVEDPKTNLPKLRSHVGMVFQHFELFPHMTITDNLAIAQIK
FT                   VLGRKRDEAVEKGLKLLDRVGLKAHAHKFPGQLSGGQQQRVAIARALAMDPICMLFDEP
FT                   TSALDPEMINEVLDVMVELAREGMTMMCVTHEMGFARKVAHRVIFMDRGAIVEDAAKDE
FT                   FFGQPRSERAQSFLAKILQH"
FT   CDS_pept        complement(465947..466627)
FT                   /transl_table=11
FT                   /gene="glnM"
FT                   /locus_tag="azo0440"
FT                   /product="putative glutamine transport permease protein"
FT                   /function="ABC-type amino acid transport system permease
FT                   component"
FT                   /note="Putative glutamine transport permease protein.
FT                   Homology to glnM of B. subtilis of 30% (TREMBL:O34671)
FT                   Probably part of the binding-protein-dependent transport
FT                   system of amino acids. Probably responsible for the
FT                   translocation of the substrate across the membrane
FT                   InterPro: Binding-protein-dependent transport systems inner
FT                   membrane component (IPR000515) Pfam:
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component no signal peptide probable 5 TMHs"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0440"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93057"
FT                   /db_xref="GOA:A1K2K2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR030205"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2K2"
FT                   /protein_id="CAL93057.1"
FT                   /translation="MGDFEFGVIADNWRFLAEGLRYTVQVTLVATIGGIFLGTLLALMR
FT                   LSSVKPLQWFAVGYINFFRSVPLVQVILAFYLIIPMVLQMFTGKPMPIGAENSAYFTFT
FT                   VFEAAYFAEIMRSGIQSIPRGQIGAGYALGFTYGQTMRLVVLPQAFRNMLPVLLTQTIV
FT                   LFQDVSLVYAIGATDFFGAADKITQRDLRPVEMYTTVAAVYFVLCFSLSRLVKRLQTRI
FT                   AIIR"
FT   CDS_pept        complement(466629..467366)
FT                   /transl_table=11
FT                   /gene="glnP"
FT                   /locus_tag="azo0441"
FT                   /product="putative glutamine transport permease protein"
FT                   /function="ABC-type amino acid transport system permease
FT                   component"
FT                   /note="Glutamate/aspartate transport system permease
FT                   protein gltJ. Homology to glnP of B. subtilis of 23%
FT                   (CAA93320). PART OF THE BINDING-PROTEIN-DEPENDENT TRANSPORT
FT                   SYSTEM FOR AMINO ACID; PROBABLY RESPONSIBLE FOR THE
FT                   TRANSLOCATION OF THE SUBSTRATE ACROSS THE MEMBRANE.
FT                   InterPro: Binding-protein-dependent transport systems inner
FT                   membrane component (IPR000515) Pfam:
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component HTH-motif probable 4 TMHs no signal peptide"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0441"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93058"
FT                   /db_xref="GOA:A1K2K3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR030202"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2K3"
FT                   /protein_id="CAL93058.1"
FT                   /translation="MNYHWDWAFFFQETDDGLKYIDWVISGMGWTTAVSLSALAIALLV
FT                   GSVLGVMRTTPSKLLVAIGDTYVDIFRNVPLIVQLFMWFFVVPELVPESIGLWMKQDLP
FT                   YFVTAVIGLGLYTAARIAEQVKSGINALARGQRFAGLALGFTEWQTYRYVRLPMAYRIV
FT                   LPALTSEAMNIFKNSAVTYAVGILELYFQYKQIIEKTSQVLEITIVVTLTYFVLAFAMN
FT                   RLLGFIEKRTRVPGLITGGSGGH"
FT   CDS_pept        complement(467763..468662)
FT                   /transl_table=11
FT                   /gene="glnH"
FT                   /locus_tag="azo0442"
FT                   /product="putative glutamine-binding protein"
FT                   /function="ABC-type amino acid transport/signal
FT                   transduction systems periplasmic component/domain"
FT                   /note="Putative glutamine-binding protein. Homology to glnH
FT                   of B. stearothermophilus of 28% (sprot|GLNH_BACST).
FT                   Involved in glutamine-transport system. Interacts with the
FT                   glutamine-transport system glnPQM. Pfam: Bacterial
FT                   extracellular solute binding protein no TMHs signal
FT                   peptide"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0442"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93059"
FT                   /db_xref="GOA:A1K2K4"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2K4"
FT                   /protein_id="CAL93059.1"
FT                   /translation="MRTSLSVLALCFAAAGLAAPAHAAEPTGTLKKIKDSGTITVGHRE
FT                   SSVPFSYLDADQKPVGYAMDLCAKVVDAVKDELKLPKLEVKYQAVTSQNRIPLMQNGTI
FT                   DIECGSTTNSVQRQQQVGFSVNYFVTSVRMAVRKDSGIKDIGDLNGKPVATTTGTTSDA
FT                   LIKQNEKGKSIDVRNIYGKDHADSFLMVESGRAAAFVMDDILLAGLIASSKNPAAYEIV
FT                   GPSLRDEPYGVMLRKDDTEFKAVVDKALTGLMKSGEAEKMYTKWFTQPIPPRNVNLNFP
FT                   MSAATKAALTNPTDKGVE"
FT   CDS_pept        468959..470002
FT                   /transl_table=11
FT                   /locus_tag="azo0443"
FT                   /product="beta-lactamase"
FT                   /function="predicted exonuclease of the beta-lactamase fold
FT                   involved in RNA processing"
FT                   /EC_number="3.5.2.6"
FT                   /note="Conserved Hypothetical
FT                   protein(Metallo-beta-lactamase superfamily). Has PF00753,
FT                   Metallo-beta-lactamase superfamily; IPR001279,
FT                   Blactmase-like;These proteins include thiolesterases,
FT                   members of the glyoxalase II family, that catalyse the
FT                   hydrolysis of S-D-lactoyl-glutathione to form glutathione
FT                   and D-lactic acid and a competence protein that is
FT                   essential for natural transformation in Neisseria
FT                   gonorrhoeae and could be a transporter involved in DNA
FT                   uptake. Except for the competence protein these proteins
FT                   bind two zinc ions per molecule as cofactor."
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0443"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93060"
FT                   /db_xref="GOA:A1K2K5"
FT                   /db_xref="InterPro:IPR026360"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2K5"
FT                   /protein_id="CAL93060.1"
FT                   /translation="MDLIVARPEGLYCPPGDFYIDPWRPVDRAVITHGHGDHARPGHRH
FT                   YLAAAPGEGVLRARLGEIPLQTLGYGEEVRHHGVGIRFHPAGHVLGSAQVRIEYRGEVW
FT                   VASGDYKLEADGTCDAFEPVRCDTFITESTFGLPIYRWPPQAELGAAINAWWQANAAAG
FT                   RASVLFCYAFGKAQRILHLLDPAIGPIVVHGAVEPLNAVYRAAGVALPATRKVGEVAAE
FT                   ELRRALVLAPPSAQGSPWLRRFGDYADAFASGWMRIRGTRRRRGVDRGFVLSDHADWPG
FT                   LLRAIEATGAQRVFVTHGSVAVLVRWLGEQGLAAQAFATEYGEEDDAGQGGAGDSARPD
FT                   DAAEPPQ"
FT   CDS_pept        469999..471642
FT                   /transl_table=11
FT                   /gene="lig2"
FT                   /locus_tag="azo0444"
FT                   /product="DNA ligase"
FT                   /function="ATP-dependent DNA ligase"
FT                   /EC_number="6.5.1.1"
FT                   /note="DNA ligase (EC 6.5.1.1) (Polydeoxyribonucleotide
FT                   synthase [ATP]). This protein seals during DNA replication
FT                   DNA recombination and DNA repair nicks in double-stranded
FT                   DNA (By similarity)."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0444"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93061"
FT                   /db_xref="GOA:A1K2K6"
FT                   /db_xref="InterPro:IPR012308"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="InterPro:IPR026333"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2K6"
FT                   /protein_id="CAL93061.1"
FT                   /translation="MKAFAALYAELDATTSSNAKLAAMVAYFRAAPAADAAWAAYFLAG
FT                   GKPRQLVPVRQLREFAMRIAGVPEWLFEESYQAVGDLAETLALLLPEGVAGDDAPLAEW
FT                   VEARLLPLRGLPPDVLQPRLEMLFGALSTLQRFVCAKLITGSFRVGVSRLLVTRALGEA
FT                   GGVDTRRVAERLIGYTDIGARPDAASYRALLAPPAPAEGAREDGLPYPFFLAHPLQAPV
FT                   EALEDRLGPPENWLIEWKWDGIRAQLVRRGGRSWLWSRGEDLVTERFPELAALGAELPE
FT                   GTVIDGEILVWKAGRVQPFAALQKRLGRKTVGTRLLAEAPVVLCAYDLLEWQGEDLRAQ
FT                   PQHARRAALERLAQHHPQRALQLSPLLHGEDWAALARLREEARERGVEGMMLKGRDAPY
FT                   GVGRSKEGGVWWKWKIDPYSIDAVLIYAQRGHGRRASLYTDYTFAVWDAPPDAPQRRLV
FT                   PFAKAYSGLTDAEIRQVDAIVRKTTQEKFGPVRSVTPEQVFELGFEGIARSARHKSGIA
FT                   VRFPRILRWRHDKPAAEADTLQTLAELLPP"
FT   CDS_pept        471695..474442
FT                   /transl_table=11
FT                   /locus_tag="azo0445"
FT                   /product="probable ATP-dependent helicase"
FT                   /function="Lhr-like helicases"
FT                   /EC_number="3.6.1.-"
FT                   /note="Putative ATP-dependent helicase MTH1802.
FT                   TREMBL:Q88NV1: 57% identity, 66% similarity
FT                   InterPro:IPR001410; DEAD/DEAH box helicase IPR001650;
FT                   Helicase_C. Pfam: PF00270; DEAD; 1. PF00271; Helicase_C; 1.
FT                   SMART: SM00487; DEXDc; 1. SM00490: HELICc livcs:
FT                   branched-chain amino acid trans Non secretory protein with
FT                   low probablity of cleavage site (0.167): Signal P
FT                   predicted. No transmembrane helices (TMHMM predicted)"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0445"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93062"
FT                   /db_xref="GOA:A1K2K7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013701"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR017170"
FT                   /db_xref="InterPro:IPR026362"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2K7"
FT                   /protein_id="CAL93062.1"
FT                   /translation="MSPPRKPPSRRATPRPPGSLPRLAPRRGAAAAARARAAAIEAVDA
FT                   ARAAAAGAGVAEPTVECAPLPGCEPGSSLPMAARIERWYAARGWAPFDFQRALATAVAA
FT                   GESGLLHATTGAGKTYAAWFAALARWAAAGAPSPSGTRRGPPAPPLTLLWLTPMRALAA
FT                   DTGRALQAPLAELGCDWRVGVRSGDTAASERAAQDRRLPTALVTTPESLSLLLSRAEAA
FT                   QTLGAVAIVVVDEWHELLGNKRGVQVQLALARLRRWNPALVVWGLSATLGNLDHARAAL
FT                   LGPAHAAQGRLLRGEVPKQLQIDTLLPSAPARFPWAGHLGMQMLPQVVAEIDASATALV
FT                   FVNTRSQAELWYQALLDARPDWAGLLALHHGSLDADSRAWVEAGLKAGTLKAVVCTSSL
FT                   DLGVDFLPVERVLQIGSPKGVARLLQRAGRSGHAPGRPSRVTLVPTQSLELVEAAAARA
FT                   AAEAGHVEARRSPEQPMDVLVQHLVTVALGGGFRPDALLAEVRGCHAYRALDEAAWQWA
FT                   LDFVGRGGAALVAYPDYRRVAPDEGGVWRVPDARLARRHRMGIGTIVSDAGISVRYWGG
FT                   RGAAGGRLGTVEESFVARLRPGDCFLFAGRLLELVRVHEMTAWVRRASGARPAVPRWNG
FT                   GRMPLSSELAAAVVAALDDAADGRFDAPELERARPLLELQARWSALPRRGALLAETLKT
FT                   REGHHLFLYPFAGRAVHLGLASLFAWRLARTRPLSFSIAVNDYGLTLLCAEDPDWDAAL
FT                   GAGLFEAGDLLGDVLASLNAGELARRRFREIARVSGLVFTGYPGEARSTRQLQASAGLF
FT                   YEVFRNHDPANLLLDQAEQEVLRQELELGRLEAALAAMRAARLLRAPLRRPSPFAFPLL
FT                   VERMREKLSTEKLADRIRRMLDELERAADAPAVSRAAPSAAREG"
FT   CDS_pept        474445..475113
FT                   /transl_table=11
FT                   /locus_tag="azo0446"
FT                   /product="conserved hypothetical protein"
FT                   /function="predicted ICC-like phosphoesterases"
FT                   /note="Probable Hypothetical protein MJ0037. Members of
FT                   this uncharacterized family share a motif approximating
FT                   DXH(X25)GDXXD(X25)GNHD as found in several
FT                   phosphoesterases, including the nucleases SbcD and Mre11.
FT                   SbcD is a subunit of the SbcCD nuclease of Escherichia coli
FT                   that can cleave DNA hairpins to unblock stalled DNA
FT                   replication. All members of this family are archaeal
FT                   TREMBL:Q88NV2: 46% identity, 59% similarity
FT                   InterPro:IPR004843; M-ppestrase. Pfam: PF00149;
FT                   Metallophos; No transmembrane helices TIGR00024: conserved
FT                   hypothetical prot"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0446"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93063"
FT                   /db_xref="InterPro:IPR024173"
FT                   /db_xref="InterPro:IPR026336"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2K8"
FT                   /protein_id="CAL93063.1"
FT                   /translation="MPAHVDLERAGLRLRLLPERAVWWADEATLFIADPHFGKAAAYRA
FT                   LGQPVPRGTTGETLARLDRLLAQWPARRLVVLGDFLHAPEAHAPATLAAMQRWRERHPR
FT                   LDCVLVRGNHDDRAGDPPPALGIAVVDEPLALGPLRLWHAPPPPERVPPGCFALGGHLH
FT                   PAYVLRTRHERLRLPCYLFGPAVGVLPAFGAFTGSAEVWPGPLDTVCVVGDGEVFRVAG
FT                   "
FT   CDS_pept        complement(475122..476456)
FT                   /transl_table=11
FT                   /gene="dctD1"
FT                   /locus_tag="azo0447"
FT                   /product="transcriptional regulatory protein"
FT                   /function="Response regulator containing CheY-like receiver
FT                   AAA-type ATPase and DNA-binding domains"
FT                   /note="C4-dicarboxylate transport transcriptional
FT                   regulatory protein,"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0447"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93064"
FT                   /db_xref="GOA:A1K2K9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2K9"
FT                   /protein_id="CAL93064.1"
FT                   /translation="MTAPLHVLVIEDDPNVRLGCEQALQLAGIAVDAVGSAEAGLAKLG
FT                   AGFPGIVVTDMRLPGADGLAVVRRARELDPDLPVIMITGHGDVTLAVEAMRSGAYDFIQ
FT                   KPFAPDLLVEVVRRALDKRALALEVVELRRRLEQRDGLDAALIGRSPQMERLRRLILDV
FT                   AGQTVDVLIHGETGTGKELVARCLHDRGPRRKANFVALNCGGLPDNLLDSELFGHEAGA
FT                   FTGAQKRRVGKIEHASGGTLFLDELESMPMAVQIKLLRVLQERVIERLGSNQLLPVDTR
FT                   VVAATKDDLLELANQGKFRADLYYRLNVVTIELPPLRERREDIPLLLEHFLLQAAQRFE
FT                   RPLPAVSPEHMSRLMAHGWPGNVRELRNVADCLVLGVANAVLGTAGSVATLSLAEQVEH
FT                   FERSLIDAELRRQAGNLSRAAEALHVAKTTLHDKIRKYGLGARDA"
FT   CDS_pept        complement(476453..478414)
FT                   /transl_table=11
FT                   /gene="dctB1"
FT                   /locus_tag="azo0448"
FT                   /product="sensor histidine kinase"
FT                   /function="Signal transduction histidine kinase regulating
FT                   C4-dicarboxylate transport system"
FT                   /EC_number="2.7.13.1"
FT                   /note="C4-dicarboxylate transport sensor protein,"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0448"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93065"
FT                   /db_xref="GOA:A1K2L0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017055"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2L0"
FT                   /protein_id="CAL93065.1"
FT                   /translation="MTAASSPSAKADSAAEAVPRPAPERPRPGHGPLLAALAVLLVSLA
FT                   GFGGYRLGEGLGMRALQVEASHRLDLGAAAIDGVVNRYAHIPATIELSPEVLALLRAPD
FT                   SEARAAAANRYLERLNGHIGSIALFVLDRRGEVRAASNWAHGDSFIGEDLSFRPYFQRA
FT                   IAGQAGRHFAIGTTRGDPGYFVSHPIRDGSEIIGVAVIKIPLGGLEETWLSLGTPALIS
FT                   DENGVVILTAVPGWLYRSLAPLSAATVAEIEANRLYNGRPIQPLTIGPEPVAAQLPMAD
FT                   EDGVELRLDRRIALPPELPRNSGYYLAQGRTLPDTGWRLLVFSDLTPVRHQAASQAALA
FT                   LVAAAFVVLLAIFIAQRRRILRQRLEAQRLLERSNAELENKVARRTRALTESIARLRKE
FT                   IAERQHAEQTLHAAQDELVQAGKLAVLGQLATSVTHELTQPLGAMRTLAGNAVEFMRRG
FT                   DQDTAAKNLDIVGRLADQMASIITPLKTFARKSPAVPAAVDVTHAVGNALFLLEQRLKS
FT                   ADITVDNACVAGEAIAWCDQNRLEQVLINLIGNAIDAMRGQPRRELSIHAVRHADGRIL
FT                   LRIGDTGCGVPEALRGRLFEPFFTTKPAGEGLGLGLAISRDIVREFGGDLDADNRASGG
FT                   TYFTVFLNPAPATESAAP"
FT   CDS_pept        complement(478380..480146)
FT                   /transl_table=11
FT                   /gene="kefB"
FT                   /locus_tag="azo0449"
FT                   /product="putative glutathione-regulated potassium-efflux
FT                   system protein"
FT                   /function="Kef-type K+ transport systems membrane
FT                   components"
FT                   /note="Glutathione-regulated potassium-efflux system
FT                   protein kefB,(K+/H+ antiporter).Transport system that
FT                   facilitates potassium-efflux possibly by potassium-proton
FT                   antiport. 32% K_eff.IPR006153;
FT                   Na_H_porter.IPR006036;TrkA_Kuptake. IPR003148; TrkA_N.
FT                   Pfam:PF00999; Na_H_Exchanger; 1.PF02254; TrkA-N; 1.
FT                   TIGRFAMs:TIGR00932; 2a37; 1. TMHelix:12. Belongs to the
FT                   monovalent cation:proton antiporter 2 (cpa2) transporter
FT                   (TC 2.A.37) family. KefB subfamily."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0449"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93066"
FT                   /db_xref="GOA:A1K2L1"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2L1"
FT                   /protein_id="CAL93066.1"
FT                   /translation="MHHFSASRYRMDHEAFPFLKETILFLALSGVLIPLLARLRINPVL
FT                   GFLAVGTALGPYGLASFVPAHPWLAYVTFPRQEEVETLAELGVIFLMFMIGLELSVDRL
FT                   WSLRRQVFGLGTLQVALTAALIGGIAHLFGNTTEASVILGLVLSFSSTAIVMQLLIQRG
FT                   ELGGPLGQAAFAILLLQDLAVVPLLVLLSILGAGNSEGSFALLLGTAAAKGLVTVGLIY
FT                   LIGRRLVRPVFHQITVSRQPDTFMALTLLTTLGVAAMTWAAGLSMALGALLAGLIIAET
FT                   EFRHEVEVTIEPFKGLLMGLFFLSVGMGIDLRALLAEPLWIPLAVAGLMIIKGAVVFAL
FT                   LRLFGLSWGRAVEGGFLLGQGGEFAFIVIGLALSFKLLPRDVGQFMLLAVGLSMLATPV
FT                   VARLGRELGAAMDRRQPPAAQEDAEFGTLRGHVLIAGYGRVGQMVGQMLAEQGVPHVAV
FT                   ETDAKLVAGQRKTGAAVIYGDASRPELLRKLHLDRALAVVLTMDHTAAAVHAVKGIRQS
FT                   NPHVRIIARARDEKHALTLREAGASVVVPETLESGLKLTGSVLETLGVPADAASRLLEQ
FT                   ERDRRIVAFRES"
FT   CDS_pept        480291..482036
FT                   /transl_table=11
FT                   /locus_tag="azo0450"
FT                   /product="PAS/PAC/GGDEF-domain containing protein"
FT                   /function="predicted periplasmic ligand-binding sensor
FT                   domain"
FT                   /note="PAS/PAC/GGDEF-domain containing protein,implicating
FT                   involvement into signalling processes. Similarity to
FT                   TREMBL: trembl|Q98JA6 (30% Rhizobium loti,hypothetical
FT                   protein mlr2027) InterPro: IPR000160 GGDEF. IPR001610 PAC.
FT                   IPR000700 PAS-assoc_C. IPR000014 PAS_domain. Pfam: PF00990
FT                   GGDEF. SMART: SM00086 PAC. SM00091 PAS. TIGRFAM: TIGR00254
FT                   GGDEF. TIGR00229 sensory_box."
FT                   /db_xref="EnsemblGenomes-Gn:azo0450"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93067"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2L2"
FT                   /protein_id="CAL93067.1"
FT                   /translation="MLATLGVAAAGLVLFTGDLLEGRLHERWRAERLSELSGLRAQLEG
FT                   RLNGAINLTAGLVAHVAVHGGIGEEEFERLAAELMVERSLLRNITLAPGNVIGMVYPLR
FT                   GNERAIGLDLLNHPVQGAATRRMLALNRPVLAGPVDLVQGGRALIHRVPIFLSPPDGPP
FT                   RSGSYWGLMSTPIDFDGLLAQAGLTDPRLRFRIALRGVDGMGADGAVFWGDAALFDDRD
FT                   AIALDIQVLNGSWRMAALPLDEPAVGNTVWAARAAAVLLVLVTLAMVLRLRSMDLRLTE
FT                   SEALHRELAEQIRDVLFRTDAAGRVIYLNPAWTQITGREVSTCLGYHWTELVEVEPGDG
FT                   VRLRTAKLLSDARHDGGNTPALQNERVHLTDCDGTRRTLVVRAGVHRNPAGAVEGVVGI
FT                   MVDISEQERLEARVRHLALHDSLTGLANRVLLASRFQQAAEFARRMGHRMAVLYLDLDG
FT                   FKPINDGYGHETGDRVLCGIGERLQLSVRESDTVARVGGDEFVILLGQVLSVDDARAVA
FT                   LKVQDVLAPALVVGEQRFSVRASIGISVFPDHGGSLDELLRAADRAMYRVKSAAAGGHI
FT                   GVIDA"
FT   CDS_pept        complement(482053..482613)
FT                   /transl_table=11
FT                   /locus_tag="azo0451"
FT                   /product="hypothetical secreted protein"
FT                   /note="Hypothetical secreted protein. No homology with hits
FT                   in the Database. No domains predicted. Signal peptide
FT                   present. No TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:azo0451"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93068"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2L3"
FT                   /protein_id="CAL93068.1"
FT                   /translation="MKPLAALFAAVLCAAAPAVHAQSGAGYEAAVAGWSRYQDVAGWLE
FT                   GNFSFDRGRLDTILQRTRQNGPAGLLARAADGTFALRSGYCTDAAAFAIQSLNRINPGY
FT                   RARYVFIKNRYGQPHHWVAGFMDGDKLMVMDYGAGPEWSAMRGVHGPYASLDDYAAFLG
FT                   SLRIARFAPESVEWRDTFPGQQD"
FT   CDS_pept        complement(482675..483571)
FT                   /transl_table=11
FT                   /gene="trxB1"
FT                   /locus_tag="azo0452"
FT                   /product="putative thioredoxin-disulfide reductase"
FT                   /function="Thioredoxin reductase"
FT                   /EC_number="1.8.1.9"
FT                   /note="Putative thioredoxin reductase. Homology to trxB of
FT                   S. coelicolor of 25% (sprot|TRXB_STRCO). Catalyse the
FT                   reaction: thioredoxin + nadp(+) = thioredoxin disulfide +
FT                   nadph. InterPro: FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase (IPR001327) Pfam:
FT                   Pyridine nucleotide-disulphide oxidoreductase no signal
FT                   peptide no TMHs"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0452"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93069"
FT                   /db_xref="GOA:A1K2L4"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2L4"
FT                   /protein_id="CAL93069.1"
FT                   /translation="MSQDFDALVIGGGPAGLTGALYLARFRRRVRLVDDGCSRATRIPR
FT                   SHNMPGYPDGVRGGELVAAIRLQATRYGVDFASGRVTALEREGTRFSARLADGSTTHAR
FT                   AVLLATGVTDVEPPMPYLAEAVRSGALRYCPVCDGYEVSGQTVGVLADGDAGAREALYL
FT                   RGFTARLHVFPLSDTVEISARERQRLRDADIMLAEHAVASLRLADGGVVVRHGDYETRC
FT                   DSVYSALGTRIQADLAPDAERDEQGYLLTDRHHMTSIGGLYAAGDVVQGLNQISVATGG
FT                   AAIAAAAIHRALGPAWA"
FT   CDS_pept        complement(483653..485464)
FT                   /transl_table=11
FT                   /gene="atm1"
FT                   /locus_tag="azo0453"
FT                   /product="probable composite transport ATP-binding permase
FT                   protein"
FT                   /function="ABC-type transport system involved in Fe-S
FT                   cluster assembly permease and ATPase components"
FT                   /note="Probable composite transport ATP-binding permease
FT                   protein. Homology to amt1 of S. cereviciae of 48%
FT                   (sprot|ATM1_YEAST). COULD BE INVOLVED IN THE TRANSPORT OF
FT                   yet unknow substrates (probable HEME) FROM THE MITOCHONDRIA
FT                   TO THE CYTOSOL. InterPro: ABC transporter transmembrane
FT                   region (IPR001140), ATP/GTP-binding site motif A (P loop)
FT                   (IPR001687), ABC transporter (IPR003439),AAA_ATPase
FT                   sperfamily (IPR003593) Pfam: ATP transporter,ABC
FT                   transporter transmembrane region no signal peptide probable
FT                   6 TMHs"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0453"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93070"
FT                   /db_xref="GOA:A1K2L5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2L5"
FT                   /protein_id="CAL93070.1"
FT                   /translation="MRRAPAPLPAPASGERHDWQTLKSLVPFIWAYKGRVIFALGCLLA
FT                   AKGANVTVPIIFKHLVDALTITPQQALIVVPAALLLAYGVLRFSTSLFTELREIVFARV
FT                   TQQAVREISLRVFRHLHALSLRFHLERQTGGLTRDIERGTRSIGSLISYTLYSILPTLV
FT                   EIGLVVGILLVQYDAVFALITLGTLAFYIVFTVKVTNWRTALRRQANELDSAANARAID
FT                   SLLNFETVKYFNNEAFEARRYDEQLKQWTRAQVRNQYSLSALNIGQAAIIAVGVTAMMW
FT                   AAASRVAAGSMTLGDIVLVNAFLIQLYIPLNFLGVIYRELRQALTDIERMFGLMHEHRE
FT                   IADRPDARVLPPGPASVRFERVGFAYDAKRPILFEVDFEIPAGRTVAVVGHSGSGKSTL
FT                   ARLLYRFYDVQSGAIRVNGHDVRDLTQDSLRAAIGIVPQDTVLFNDTLFYNIQYGRPDA
FT                   SRDEVEAAARAAQLEDFIRRLPDGYETRVGERGLKLSGGEKQRVAIARALLKNPAILIF
FT                   DEATSALDSRTEKAIQAQIERAASGRTALVIAHRLSTVMDADEIIVLDQGRIAERGHHL
FT                   DLLAQEGLYTQMWLLQQQEAERAEAAT"
FT   CDS_pept        complement(485487..486122)
FT                   /transl_table=11
FT                   /locus_tag="azo0454"
FT                   /product="conserved hypothetical threonine efflux protein"
FT                   /function="Putative threonine efflux protein"
FT                   /note="Conserved hypothetical threonine efflux protein.
FT                   Homology to rsc0148 of R. solanaxearum of 52%
FT                   (trembl|Q8Y2B8). InterPro: Lysine exporter protein
FT                   (LYSE/YGGA) (IPR001123) Pfam: LysE type translocator
FT                   Tigrfam: 2A76: Homoserine/Threonine efflux protein signal
FT                   peptide Probable 6 TMHs"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0454"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93071"
FT                   /db_xref="GOA:A1K2L6"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2L6"
FT                   /protein_id="CAL93071.1"
FT                   /translation="MPSFDTLAAFLAISVAITFAPGPDNLMVLGHSLARGRLAGFGIAL
FT                   GCALGCFTHTLWAALGVSAALASSPQVFLALKLAGAAYLAWLGVQALRFAAAPRLDGVA
FT                   ATRAPWLRDVRRGFVANAINPKVALFFLAFLPQFVSADGGHATLQMVALGSLFAVQTVL
FT                   VFGGFALAAGTLGRAIARRPAAGAWLDRIAGLIFIGLALRLATDDHTL"
FT   CDS_pept        486445..487725
FT                   /transl_table=11
FT                   /locus_tag="azo0455"
FT                   /product="putative cobalmin snthesis protein"
FT                   /function="Putative GTPases (G3E family)"
FT                   /note="This family of proteins contains P47K, a Pseudomonas
FT                   chlororaphis protein needed for nitrile hydratase
FT                   expression, and the cobW gene product, which may be
FT                   involved in cobalamin biosynthesis in Pseudomonas
FT                   denitrificans [1]. TREMBL:Q8YJP6: 40% identity, 54%
FT                   similarity. Pfam:PF02492; Cobalmine synthesis protein; pfkB
FT                   family carbohydrate kinase; FAD binding domain.
FT                   TIGRFAM:proC: pyrroline 5 carboxylate reductase. mobB:
FT                   molybdopterin-guanine dinucleotide"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0455"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93072"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2L7"
FT                   /protein_id="CAL93072.1"
FT                   /translation="MKGRGQSVGPGSFRVYWQAASRAGLPPSSRPVRTEGKGRYRSWTA
FT                   RPYHSLLTSPHHAVPMTPDTPDRRIPVTVLTGFLGAGKTTLLNHLLRQPGMEGCAVLIN
FT                   EFGEVGVDHHLVEKVDETLIVLDSGCICCSVQGDLVKALKGLFMRALRREIPALRRVLI
FT                   ETTGLADPAPVIFTLMEEPFIAERYRCDGVVTAVDATHADGQLDRQREAVRQVAMADRL
FT                   LITKCDLADAAVRAGLSVRLAQLNPAAQQIEVVRGEVAPDALFGCGLYDAAGKIPDVAA
FT                   WLGEERARAAAARAAAAAPAWRKPGAAPRHGAAARHDEGIASHVLVFDAPLTWYGFSDA
FT                   LGVILQAYGDRILRVKGLMNIAGDPLPRVVQCVQHVAYPPASLPAWPTRPPYDDRRSRL
FT                   VFIVRDLPRSELEQIFFGVAGVPVMPQ"
FT   CDS_pept        487845..488045
FT                   /transl_table=11
FT                   /locus_tag="azo0456"
FT                   /product="hypothetical secreted protein"
FT                   /note="Hypothetical secreted protein. No homology to the
FT                   data bank. No domains predicted. signal peptide. no TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:azo0456"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93073"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2L8"
FT                   /protein_id="CAL93073.1"
FT                   /translation="MNATQIKALVAGAAAALALTATAVQAADAPAGDATAPAVTKKHTA
FT                   KKTTHKKTSHKKAAAKPADAQ"
FT   CDS_pept        488198..488884
FT                   /transl_table=11
FT                   /gene="ragA"
FT                   /locus_tag="azo0457"
FT                   /product="two-component response regulator"
FT                   /function="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /note="Response regulator,"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0457"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93074"
FT                   /db_xref="GOA:A1K2L9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2L9"
FT                   /protein_id="CAL93074.1"
FT                   /translation="MKILLVEDDAQQAGYIRKGLQEAGHTVDVAADGRDGLFLATTASF
FT                   DAIVLDRMLPRVDGLTVLRTLRASRIATPVVVLSALGEVDDRVAGLRAGSDDYLVKPFA
FT                   LSELLARLDALQRRGNGRAEAEQTRLQTADLEMDLLRRSVSRGATRIELKPKEFRLLEF
FT                   LLRHSGQVVTRSMLLEAVWDYHFDPQTNVIDVHISNLRAKIDLPGLPPLIHTVRGAGYR
FT                   LGGDAA"
FT   CDS_pept        488874..490262
FT                   /transl_table=11
FT                   /gene="ragB"
FT                   /locus_tag="azo0458"
FT                   /product="putative two component sensor kinase"
FT                   /function="Signal transduction histidine kinase"
FT                   /EC_number="2.7.13.1"
FT                   /note="Putative sensor kinase,"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0458"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93075"
FT                   /db_xref="GOA:A1K2M0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2M0"
FT                   /protein_id="CAL93075.1"
FT                   /translation="MPRERAGGLRAWFASPFHRFAVALPAAIALIVGALFYPLFIEAEA
FT                   HIREEVQAAIEFEIAGLEAHFHERGLAGLRDALQRRIEISPDRAAVYLLADRDGRPLAG
FT                   NLAQWPAGVSANDEAWFHVAEADGETLEGRVFILFGGERLLVGRRSPLEAFQRNMTVRL
FT                   WWSAALIILVAGVIGGRFMQHLHRRLARLAAEAGRIQEGHLAQRLSLSARGDELDALAE
FT                   RFNSAFDEIERLVDAAKHVSSAIAHDMRRPLIALRNAIDEARRSPGADPALRTQLEGLR
FT                   DQTEELLRTFSALLSLARIEAGALGPLLQAVNLTEIARDAIDLYEPLAASQGRALNPRL
FT                   APACVRGDRDLLFQVLQNLIENALKHGAGDIDIGIDTLPDGGARLTVRDHGEAVAAADL
FT                   PHLFERFFRADSSRSAAEGAGIGLALVRGIAEAHGGSIRATDARPGLCVEILLAPGRRG
FT                   VEKS"
FT   CDS_pept        490448..491650
FT                   /transl_table=11
FT                   /gene="amtD"
FT                   /locus_tag="azo0459"
FT                   /product="probable ammonia permease"
FT                   /function="Ammonia permease"
FT                   /note="Putative ammonium transporter MJ1343. A number of
FT                   evolutionarily-related proteins have been found to be
FT                   involved in the transport of ammonium ions across
FT                   membranes.Represent a family of high affinity ammonium
FT                   transporters. These proteins are highly hydrophobic and
FT                   seem to contain from 10 to 12 transmembrane domain.
FT                   TREMBL:Q88L29: 73% identity, 84% similarity InterPro:
FT                   Ammonium transporter family InterPro: IPR001905;
FT                   Ammonium_transpt. IPR010256; RH_like_transpt. Pfam:
FT                   PF00909; Ammonium_transp; 1. PROSITE: PS01219;
FT                   AMMONIUM_TRANSP amt: ammonium transporter Non secretory
FT                   protein with signal peptide probability of 0.174 (SignalP
FT                   predicted) TMHMM predicted 11 TMH's"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0459"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93076"
FT                   /db_xref="GOA:A1K2M1"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2M1"
FT                   /protein_id="CAL93076.1"
FT                   /translation="MELHHPDNDVLFILLGAIMVLAMHAGFAFLELGTVRKKNQVNALV
FT                   KILSDFSVSALAYFFIGYGVAYGIHFFSGAEVLLERSGFELTRFFFLLTFAAAIPAIIS
FT                   GGIAERARFGPQLIATFVLVGLVYPFFEGIAWNQHFGFQAWLKDSFGAEFHDFAGSVVV
FT                   HAVGGWIALPAVLLLGARRGRYHSNGAIAAHPPSSIPFLALGAWILIIGWFGFNVMSAQ
FT                   TLEKISGLVAINSLMAMVGGTLAALALGRNDPGFAHNGPLAGLVAVCAGSDVMHPLGAL
FT                   AVGAVAGALFVQMFTLTQNRWKIDDVLGVWPLHGLCGAWGGIAAGIFGSTALGGAGGVA
FT                   FLPQLAGTVLGVAIAAGGGFAVYGALKLLVGLRLDPEAEFEGADLSIHKISATAERETA
FT                   W"
FT   CDS_pept        complement(491666..492280)
FT                   /transl_table=11
FT                   /gene="dnr"
FT                   /locus_tag="azo0460"
FT                   /product="putative Dnr-like transcriptional activator"
FT                   /function="cAMP-binding proteins - catabolite gene
FT                   activator and regulatory subunit of cAMP-dependent protein
FT                   kinases"
FT                   /note="Putative Dnr-like transcriptional activator. Similar
FT                   to SWISSPROT: sprot|FIXK_RHIME (28% Rhizobium meliloti,
FT                   FixK) InterPro: IPR000595 cNMP_binding. IPR001808 HTH_Crp.
FT                   Pfam: PF00027 cNMP_binding. HTH reporting nucleic acid
FT                   binding motif."
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0460"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93077"
FT                   /db_xref="GOA:A1K2M2"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2M2"
FT                   /protein_id="CAL93077.1"
FT                   /translation="MDIPTAPDWPQRPAFEAMPPALRAAARRRAFRRGETLFATGAAPR
FT                   EMFFILRGEVRLSRLSPDGTETVMQRARDAFLAEASLESHTYHCSAIAGEDGLALVFPL
FT                   AEFRRSLADSAAFRAQWMSHLLQEVRKRRAQCERLALRSARARILHYIEAEGADGELHL
FT                   PGSRKALAAELGLTHEALYRALARLTRDGTLEVGADFIRRR"
FT   CDS_pept        492369..492854
FT                   /transl_table=11
FT                   /locus_tag="azo0461"
FT                   /product="hypothetical secreted protein"
FT                   /note="Hypthetical secreted protein. No homology to the
FT                   data bank. No domains predicted. No TMHs. Has signal
FT                   peptide."
FT                   /db_xref="EnsemblGenomes-Gn:azo0461"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93078"
FT                   /db_xref="GOA:A1K2M3"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2M3"
FT                   /protein_id="CAL93078.1"
FT                   /translation="MRRHLPLLLLLVLPLAAPAQHDPAMHGGHHHAAGAAEVPDTREWV
FT                   RFPPAMTAHTLANMRDHLLALQQIQSALGEARYDDAAEIAEQRLGLSALRSHGAAESSR
FT                   FMPAGMQEAGTAMHRSASRFGLAARDAAATGDLAPALKSLAQVTAACVSCHAAYRLQ"
FT   CDS_pept        complement(492897..495704)
FT                   /transl_table=11
FT                   /locus_tag="azo0462"
FT                   /product="conserved hypothetical secreted protein"
FT                   /note="Conserved hypothetical secreted protein. Homology to
FT                   an orf of Trichodesmium erythraeum of 45%
FT                   (gi|48892210|ref|ZP_00325608.1|(NBCI ENTREZ)). No domains
FT                   predicted. Signal peptide present. No TMH present."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0462"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93079"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR027372"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2M4"
FT                   /protein_id="CAL93079.1"
FT                   /translation="MLPTRRLSCRVARRASAVAVSLALAALAGGAGAAPQFEPLGAYAT
FT                   GLAHLESSGETAALRGDRLYVTNAKDVSLDIVDVADPTAPRLLKRVDLRAWGAGVNSVA
FT                   VSSKNLIAVALQAQKKTDPGTIVFLTPDGTVKRSATVGALPDMVTFTHDGRRLLVANEG
FT                   EPDCYGAGCTDPEGTVSIIDVVPMKPELEVRTVSFAGVPLPAGVRIFGPGASAAQDLEP
FT                   EYITVGEDDRTAYVTLQENNAIAVIDIDKARVTEVRALGYKDFNAAPQLSIHELKDLPL
FT                   VGTTAAGQSIALGGFSGLHFEGRGADGKLHFITHTDRGPNGEPTGINRPFLLPDFTPRL
FT                   VRLTLDPATGAVELGEQILLRRGDGTPLTGLPNTALSGDTNAAYNDEVPVDLRGKVLPL
FT                   DPLGGDFEGIAVDTDGSFWLADEYRPAIYHFDPSGRLLDRFVPVGTAAAAGKAAGTFGT
FT                   EALPAVLAQRRQNRGFEAIVLQGGKLYAFVQSPLRNPAGLANSALNAMKNVRVVEFDPV
FT                   TRATRQFIYIMDNPAATGADDTRADKIGDAAALPGGGFLVVERDDDARPDDALATITKK
FT                   VYAFSLTGATDISTKDTLYTVGGVSKSLDQMTANELSSVGVKPVAKVLHVDLASAGYNA
FT                   VQKVEGLAVIDADTIALINDNDFGVAQINIDAAAGSYTLAPGYTPEPVQLGILRTGGLD
FT                   ASDKDNVVNIRNWPLRGMYQPDAIASYTVGGQRYLVTANEGDARDYPGFAEEARAKSLK
FT                   ASYPNLPEVADDLQLGRLTVTSVPPAGGVPYVFGTRSFSIWNATTGAQVWDSGSELEVR
FT                   TAAAFPKHFNSNNDENNFDNRSDNKGPEPEGVAVGTIGNNTYAFVGLERIGGVMVYDVT
FT                   RPAAPAFVQYLHSRNFAGSAVGPDSGPEIVRFIAAKDSPTGKPMVVVANEISGTVNLWG
FT                   LGAED"
FT   CDS_pept        495962..498433
FT                   /transl_table=11
FT                   /gene="fadE"
FT                   /locus_tag="azo0463"
FT                   /product="probable acyl-CoA dehydrogenase"
FT                   /function="Acyl-CoA dehydrogenases"
FT                   /EC_number="1.3.99.3"
FT                   /note="Probable acyl-CoA dehydrogenase. Homology to fadE of
FT                   E. coli of 55% (trembl|Q8KTJ8(SRS)) Catalyzes the
FT                   dehydrogenation of acyl-CoA (By similarity). Reaction:
FT                   acyl-CoA + acceptor = 2,3-dehydroacyl-CoA + reduced
FT                   acceptor. InterPro: Acyl-CoA dehydrogenase (IPR006089)
FT                   Pfam: Acyl-CoA dehydrogenase, N-terminal domain; Acyl-CoA
FT                   dehydrogenase, C-terminal domain signal peptide 2 TMHs"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0463"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93080"
FT                   /db_xref="GOA:A1K2M5"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR015396"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2M5"
FT                   /protein_id="CAL93080.1"
FT                   /translation="MVWWILLGLPPLLVALAYRRVPPVASALAVLAWLAALAWAGGWPP
FT                   MLAVGALLALGVALALLLVAPLRRRVVTAPVFAAFRRALPAMSQTERDALEAGTVWWEG
FT                   ELFRGDPDWRRFAGFPWPRLSAAEQAFLDDDTEALCRLVKDWDTTRLQDMPAPVWQFIK
FT                   ERGFLGLIIPAEYGGKGFSAYAHSQVITKLSTRSSAPAVTVMVPNSLGPAELLLHYGTP
FT                   AQKQHYLPRLAQGLEIPAFALTSPWAGSDAASIPDAGVVCTGQWQGREVLGMRVSFDKR
FT                   YITLAPVCTVFGLAFRLYDPDHLLGDTVDLGITCALVPREHPGVEIGRRHVPLNAVWMN
FT                   GPIRGKDVFMPLDFIIGGPQMAGQGWRMLMECLAAGRSISLPGSNAGMQQLTARAVGAY
FT                   ARVRHQFKTAIGRFEGVEEALTRIGANTYLSDAARVMTAGAIDLGEKPAVVSAIVKYHV
FT                   TERARQTVNDGMDVIGGKGICLGPQNFLGRAYQQVPVGITVEGANILTRSLILFGQGAI
FT                   RCHPHVLDEMHAAGRGDLTAFDRAFWGHIGYTLGNAARALVTGLTGSHVVAVPIDVAPE
FT                   TRRYYQQLTRFSAAFAFIADISMGTMGGALKRKEKLSARLGDILSLLYLATAVLKRYEA
FT                   EGRQAEDAPLMHWAIWDCMFRAQNAFEGVIANFPNPVLATLLRRLVFPLGRPYVVPSDA
FT                   LGHAVADRLIAPSATRDRLTAAVHLPADLDEPLGALEAALAATIAAEPVEAKVKAAQRE
FT                   GRFAPGALVAGGVDALWARAHADGIIDNAEFALLQRRAELRDKVIRVDDFPFDLAAETG
FT                   SEAAPKMRVVA"
FT   CDS_pept        498430..499902
FT                   /transl_table=11
FT                   /gene="fadA1"
FT                   /locus_tag="azo0464"
FT                   /product="probable 3-ketoacyl-CoA thiolase"
FT                   /function="Acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="subunit of fatty acid oxidation complex,
FT                   3-keto-acyl-coa-thiolase. Activity:-acyl-CoA + acetyl-CoA =
FT                   CoA + 3-oxoacyl-CoA Entry name TREMBL:Q8G967 Prim.
FT                   accession # Q8G967 Identities = 284/425 (66%) InterPro
FT                   IPR002155; Thiolase. Pfam PF02803; Thiolase_C; 1. PF00108;
FT                   Thiolase_N; 1. Number of predicted TMHs: 0 Prediction:
FT                   Non-secretory protein Signal peptide probability: 0.000"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0464"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93081"
FT                   /db_xref="GOA:A1K2M6"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2M6"
FT                   /protein_id="CAL93081.1"
FT                   /translation="MSTRARPPEAGASSLGEDVAQRQEGGGMSTRARPPEAGAPSLGED
FT                   VAQRQEDGGVSMNAMPEARDVYIIDGARTPFLKARNAPGPFAAADLATAAGSALLLRQS
FT                   FAPDALDEVILGCASPSPDEVNIGRVVALRMGCGPRVPGWTVMRNCASGMQALDSACAN
FT                   IRGGRADLVLAGGVDALSRAPLLFSDAMVRWLAGWYAAKGAGQKLAALRHFRPAYLAPV
FT                   IGIVRGLTDPYVGQMMGQTAENLAWQFRISREEMDVYAAESHRRAIAAHDGGRFADELA
FT                   PLVGRDGTVYAADDGVRRDSTPAALARLKPFFDKRYGRVTAGNSSQVSDGAAWLLLASA
FT                   AAVERHGLQPLGRIVDSAWAALPPEHMGLGPVHAAMPLLARHQLATRDLAAWEINEAFA
FT                   AQLIACLRALDDDGYCQDHFGLPAPGAPDPARLNVDGGAVALGHPVGASGARIVLHLLH
FT                   VLRREGVAGARGIASLCVGGGQGGAMLVEAMA"
FT   CDS_pept        499899..501935
FT                   /transl_table=11
FT                   /gene="fadB1"
FT                   /locus_tag="azo0465"
FT                   /product="probable enoyl-CoA hydratase / 3-hydroxyacyl-CoA
FT                   dehydrogenase"
FT                   /function="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="5.1.2.3"
FT                   /note="alpha-subunit of fatty acid oxidation complex. Entry
FT                   name TREMBL:Q8G968 Prim. accession # Q8G968 Identities =
FT                   373/642 (58%) InterPro IPR006108; 3HCDH_C. IPR006176;
FT                   3HCDH_N. Prediction: Non-secretory protein Signal peptide
FT                   probability: 0.000 Number of predicted TMHs: 0 IPR008927;
FT                   6DGDH_C_like. IPR001753; EnCoA_hydrtse. Pfam PF00725;
FT                   3HCDH; 1. PF02737; 3HCDH_N; 1. PF00378; ECH; 1."
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0465"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93082"
FT                   /db_xref="GOA:A1K2M7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2M7"
FT                   /protein_id="CAL93082.1"
FT                   /translation="MNAVADLARSDWHHWRIERSPDAILWLWLDRAGASANTLSAAVLD
FT                   EFEVVLAALEANLPAALVIASAKPAGFVAGADIEEFSALPDPHAARALVERGWRLFDRL
FT                   AALRCPTLALIRGHCMGGGLELALACRYRLVVDEPATRLALPEVMLGIVPAWGGMRRLP
FT                   ALIGPVAALDMMLTGRSLDARRARRIGLADDCVPPRVMENAARVLVSSGQRPALPGLLA
FT                   RLLNGPLKPLVAARAQRQTAARVSRAHYPAPFAIIDIWARHGGNALAVPAGDPASLETI
FT                   FASPTAHNLARVFFLRERLKGFGKQAAFAPRQVHVVGAGIMGGDIAAVCALAGLRVTLQ
FT                   DQGVDRIAPAIARAARLFERRLRGDARAQRLALDRLIPDPQGRGVAAADLVIEAISENL
FT                   DAKRALFADLEARARPDALLATNTSSLRLADIAAGMRTPARLVGIHFFNPVAKMPLVEV
FT                   VSAAATAAEDAARAAAFVRLLDKLALPVRDVPGFLVNAALAPYMLEALRCVEEGVAPAV
FT                   VDAALTRFGMAMGPVELVDTVGLDVALAAGKALAAGAEVPPQLAARVAEGKLGRKTGEG
FT                   YYRWAPQPGGEARIVGRAPVEAVPEGLAERVLAPLLAAVRHSVAEGVVADADLADAGLI
FT                   FGAGFAPWTGGPLHHAQGRDFRIGASAAKQQTGPAPTTQQVSR"
FT   CDS_pept        501932..502336
FT                   /transl_table=11
FT                   /locus_tag="azo0466"
FT                   /product="conserved hypothetical acyl-CoA thioesterase"
FT                   /EC_number="3.1.2.-"
FT                   /note="Conserved hypothetical acyl-CoA thioesterase.
FT                   Homology to an orf of Azoarcus sp. EbN1 (trembl|Q8G9D6).
FT                   Pfam: cytosolic long-chain acyl-CoA thioesterase Long-chain
FT                   acyl-CoA hydrolases hydrolyse palmitoyl-CoA to CoA and
FT                   palmitate, they also catalyse the hydrolysis of other long
FT                   chain fatty acyl-CoA thioesters. Interpro: Thioesterase
FT                   superfamily (IPR006683) no signal peptide no. TMHs"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0466"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93083"
FT                   /db_xref="GOA:A1K2M8"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2M8"
FT                   /protein_id="CAL93083.1"
FT                   /translation="MTPPVENISLPDDKFLTLRVVPMPGDLNPSGDVFGGWIMSMVDIA
FT                   GAIPANRRAKSRVATVAVNSFVFKQPVSVGDLVSFYARVVATGRTSVTVDVEVYAERGH
FT                   ANPFVVKVTEAKLTYVAMDEKGGKRPIPAE"
FT   CDS_pept        502438..503721
FT                   /transl_table=11
FT                   /gene="fadL"
FT                   /locus_tag="azo0467"
FT                   /product="probable long-chain fatty acid transport protein"
FT                   /function="Long-chain fatty acid transport protein"
FT                   /note="Long-chain fatty acid transport protein precursor
FT                   (Outer membrane fadL protein) (Outer membrane flp protein).
FT                   Involved in translocation of long-chain fatty acids across
FT                   the outer membrane. FadL may form a specific channel (By
FT                   similarity). Entry name:- Q8G9D7 Primary accession number:-
FT                   Q8G9D7 InterPro:- IPR005017; Toluene_X. Pfam:- PF03349;
FT                   Toluene_X; 1. identity:- 66% Prediction: Signal peptide
FT                   Signal peptide probability: 1.0 Number of predicted TMHs:
FT                   0"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0467"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93084"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2M9"
FT                   /protein_id="CAL93084.1"
FT                   /translation="MQTTTLTRVAAALALAAGPAPAFAAGFQLLEQNASGIANAYAGSA
FT                   AVAEDASTIFFNPAGMTALRERELSVGLAAVRPRFEFSDRGSTATGALGGDGGDAGSWA
FT                   YLPNAYVSWALRPDLYVGVGLGAPFGLITEYDDNWVGAAHSVSFDIKTYNINPSIAWRI
FT                   NERVSVGGGLSWQRMEVEYERVAAVLPAPLPLSSTRAILDADSDAWGWNVGALITLSPA
FT                   TRLGLSYRSAIKHTLEGDLKVKGAAAGLSPALSSGKAKADVELPDTFILSAVHRLDERW
FT                   ELLGDISWTGWSKIDKVDIVRDSGPLSGVTVQTLDTDFRDTWRVALGAGYRLNAAWKLK
FT                   AGLAWDQSPVKDRAHRLVSLPDNDRTWFAAGAQWMPGGGARVDLGLAYLYVPKTKIDND
FT                   QAALGRGRVTGEYDSSVWILGAQYSVAF"
FT   CDS_pept        503770..506154
FT                   /transl_table=11
FT                   /gene="fadB2"
FT                   /locus_tag="azo0468"
FT                   /product="probable 3-hydroxyacyl-CoA dehydrogenase /
FT                   enoyl-CoA hydratase"
FT                   /function="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="4.2.1.17"
FT                   /note="Short-chain enoyl-CoA hydratase activity .
FT                   Activity:- 3S)-3-hydroxyacyl-CoA = trans-2(or 3)-enoyl-CoA
FT                   + H2O Entry name TREMBL:Q8P986 Prim. accession # Q8P986
FT                   InterPro IPR006108; 3HCDH_C. IPR006176; 3HCDH_N. IPR008927;
FT                   6DGDH_C_like. IPR001753; EnCoA_hydrtse. IPR000205; NAD_BS.
FT                   Pfam PF00725; 3HCDH; 1. PF02737; 3HCDH_N; 1. PF00378; ECH;
FT                   1. Identities = 468/796 (58%) Prediction: Signal peptide
FT                   Signal peptide probability: 0.980 Number of predicted TMHs:
FT                   0"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0468"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93085"
FT                   /db_xref="GOA:A1K2N0"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2N0"
FT                   /protein_id="CAL93085.1"
FT                   /translation="MLIRKVAVLGAGVMGAQIAAHCANAGLQVILFDLPAPAGPPDTVV
FT                   EKAIAGLAKLDPAPLASRALAAAITPANYASDLARLGECELVIEAIAEKMAWKLDLYAK
FT                   VAPHLAPGAVFASNTSGLSIARLAEGLPAALRPRFCGVHFFNPPRYMALVELIPAPDTD
FT                   PALLDALEGWLTTRLGKRIVRARDTPNFIANRIGVFSVLAVMHHTTRLGLAFDEVDAIT
FT                   GPRIGRPKSATYRTADLVGLDTLAHVVGTMQDGLPDDPWHGHFALPGWLDTLIANGALG
FT                   QKTQAGIYRKEGRQILVFEPAQLDYRAAAGEVAVEVAEILALRDPAEKLAGLAACAHPQ
FT                   AQLLWSSFRDVFHYCAYHLEHIADNARDVDSAMRWGFGWAQGPFETWQAAGWAEVAAAI
FT                   REDIAAGRAMSDAPLPDWVFERDGVHAAGGSWSPAAAALQPRPALPVYGRQLQAERLVG
FT                   EAPPERGETLWECGERGDGVRLWRLPALDAGIGVLSFKSKMHTVGGAVLEGVLEAVARA
FT                   QRDLDGLVLWQPAPFSVGANLQQVGEACSAGEFARLEQTVARFQQAALALRHAQVPVVA
FT                   AVEGMALAGGCEFLMHCAHRVLALESYVGLVEAGVGLIPAGGGSKQFALQAHRLAQRAA
FT                   GGDVFPFIQRSFETIAKATVAKSAHEAVQLGFAAPGDDIVLHAQEVLYVALRRARALAE
FT                   AGWHPPLPERAVVVAGRNGIATCELMLVNMAEGGFISAHDYKVAKAAATALCGGEVDTN
FT                   ARVSEQWILDVERALFVELLQTEATQQRIAHMLRTGKPLRN"
FT   CDS_pept        506636..507868
FT                   /transl_table=11
FT                   /gene="fadA2"
FT                   /locus_tag="azo0469"
FT                   /product="probable 3-ketoacyl-CoA thiolase"
FT                   /function="Acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="Activity:- acyl-CoA + acetyl-CoA = CoA +
FT                   3-oxoacyl-CoA Entry name:- SWISSPROT:THIK_ECOLI Prim.
FT                   accession # P21151 InterPro:- IPR002155; Thiolase. Pfam:-
FT                   PF02803; Thiolase_C; 1. PF00108; Thiolase_N; 1. Identities
FT                   = 177/400 (44%) Number of predicted TMHs: 0"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0469"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93086"
FT                   /db_xref="GOA:A1K2N1"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2N1"
FT                   /protein_id="CAL93086.1"
FT                   /translation="MRGTERHEENRHMSTQIQDAYIVAAVRTPVAKRNGAFRHVRPDDM
FT                   LAHVLRAVVAQVPALDAGEIGDVITGCAMPEAEQGMNVARIGLLLAGLPERVPGVTLNR
FT                   FCASSLQAVADAANRIRLGEADVMIAAGTESMSAMPQIMGNKVSLNPEIFARQENIDIA
FT                   YGMGLTAEKVAEEWKVSRADQDAFALQSHQRASAAIADGSFGDEIAPYTVRSHLPGEGG
FT                   TVRIAERIVDTDEGPRADATLEALARLKPVFAARGSVTAGNSSQMSDGAGAVLLMSETA
FT                   LQRYGVTPLARFRSYAVAGVPPRVMGIGPVEAIPRALRLAGLGLDALDRIELNEAFAAQ
FT                   ALAVIRTLGLDPARVNPQGGAIALGHPLGATGAIRTATLMRAMRQGGVRHGMITMCVGT
FT                   GMGAAAIFERV"
FT   CDS_pept        507945..508745
FT                   /transl_table=11
FT                   /gene="paaG2"
FT                   /locus_tag="azo0470"
FT                   /product="putative enoyl-CoA hydratase"
FT                   /function="Enoyl-CoA hydratase/carnithine racemase"
FT                   /EC_number="4.2.1.17"
FT                   /note="Function:- COULD POSSIBLY OXIDIZES FATTY ACIDS USING
FT                   SPECIFIC COMPONENTS (BY SIMILARITY). CATALYTIC
FT                   ACTIVITY:-(3S)-3-hydroxyacyl-CoA = trans-2(or 3)-enoyl-CoA
FT                   + H(2)O. Entry name SWISSPROT:PAAG_ECOLI Prim. accession #
FT                   P77467 InterPro:- IPR001753; EnCoA_hydrtse. Pfam:-PF00378;
FT                   ECH; 1. Identities = 92/265 (34%) Prediction: Non-secretory
FT                   protein Signal peptide probability: 0.000 Number of
FT                   predicted TMHs: 0"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0470"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93087"
FT                   /db_xref="GOA:A1K2N2"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2N2"
FT                   /protein_id="CAL93087.1"
FT                   /translation="MADTVLLDVADGVATLTLNRPDVLNVLSVAMMQDLAEAVRALAAR
FT                   KDVAVVVITGAGAHFMAGGDLKDFSEHLHLSSEARLATFRAMIAQHINPTVETLQGLPQ
FT                   PVIAKVRGACAGFGLSLMLGCDFALCADNSVFTTAYSAIGLPGDGGASYFLPRLVGRRK
FT                   AAELLLLAERFDTAEALRLGLINRAVPEAELDAVTDQFVARLKAGPRHAYAEIKRLLAG
FT                   SHDNQLESQLQNEAEAFGRCGATADFAEGVTAFLGKRKPGFKGV"
FT   CDS_pept        complement(508774..509625)
FT                   /transl_table=11
FT                   /locus_tag="azo0471"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="Conserved hypothetical membrane protein. Homology to
FT                   cv1508 of C. violaceum of 37% (trembl|Q7NXW8). Pfam:
FT                   uncharacterized ACR, COG1434. no signal peptide. 2 TMHs"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0471"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93088"
FT                   /db_xref="GOA:A1K2N3"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2N3"
FT                   /protein_id="CAL93088.1"
FT                   /translation="MGAGTLRNCADNTGPTLARQIPMTFDFALLLFWLKKLVAAFVLPP
FT                   LLPLVLGAAGLLLLRRRRRLGLALAWSGIAAGLLLSTPASVSRMLVPLEPTAVVDMEAA
FT                   RGAQAIVILGGGRRSHAAEYGGDTVNRLTLERLRYGARLARATGLPLLVSGGAPSGDVP
FT                   EATLMAAALREDFGIAPRWEEGGSFDTRDNARLSAAMLRADGVTRVVLVTHAAHMRRAE
FT                   AEFALHGLAVVPAPTAWLGPGPERADDDDEVWPSLPSQGTAYAGWYALHEWMGLLAYRL
FT                   SR"
FT   CDS_pept        509624..510913
FT                   /transl_table=11
FT                   /locus_tag="azo0472"
FT                   /product="probable O-acetylhomoserine
FT                   aminocarboxypropyltransferase"
FT                   /function="O-acetylhomoserine sulfhydrylase"
FT                   /EC_number="2.5.1.49"
FT                   /note="Probable O-acetylhomoserine
FT                   aminocarboxypropyltransferase. Homology to cysD of A.
FT                   nidulans of 54% (sprot|CYSD_EMENI). Transforms
FT                   O-acetylhomoserine into homocysteine. InterPro: Cys/Met
FT                   metabolism pyridoxal-phosphate-dependent enzymes
FT                   (IPR000277) Pfam: Cys/Met metabolism PLP-dependent enzymes
FT                   no signal peptide no TMHs"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0472"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93089"
FT                   /db_xref="GOA:A1K2N4"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2N4"
FT                   /protein_id="CAL93089.1"
FT                   /translation="MPDHRFGIESLCLHAGQQPDAETGARAVPIYQTTSFVFDSPEHAA
FT                   ELFNLQTFGNVYSRISNPTVAVFEERMAALEGGRAALATSSGLAAQMTALLTLAQAGDE
FT                   IVAARTLYGGSYSQLDVSLRRLGISTVFVDPSDPENFRAAITDRTKAVYGEIIGNPSLN
FT                   VFDVAAVAAITRAAGVPLVIDSTLASPYLCRPLEHGADIVIHSATKYIGGHGTTMGGVL
FT                   VESGTFPWDNGRFPQMVEPSPGYHGVRFYETFGNFGFTMKARMETLRTFGQALSPFNAF
FT                   MLLQGLETLHVRMDRHVANARAVADFLAAHPAVAWVNYPGLAASPEHALAQRYFPKGPG
FT                   AILSFGIRGGQPAGERFIEALQMISHLANVGDAKTLVIHPASTTHRQLSEEEQRAAGVP
FT                   PDMVRLSVGIETLDDILWDLDQALARGAAA"
FT   CDS_pept        510910..511497
FT                   /transl_table=11
FT                   /locus_tag="azo0473"
FT                   /product="hypothetical membrane protein"
FT                   /note="Hypothetical membrane protein. No good homology to
FT                   the data bank. No domains predicted. 1 TMHs No signal
FT                   peptide present."
FT                   /db_xref="EnsemblGenomes-Gn:azo0473"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93090"
FT                   /db_xref="InterPro:IPR021244"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2N5"
FT                   /protein_id="CAL93090.1"
FT                   /translation="MSLRLLLGIAIALLLVYGGWQLLRAVRGGWRAGRADRPAPQRLAP
FT                   VTDDDAPDDDEDDGGFDYAPLPAAAERTPAPVATPAAGPAPVRSPPPAGPDAFQLELEL
FT                   QRLRREVADLRAALDVQQQEIGGLHDSLRTLREQLESGLAGQNASPEYSEALVFARRGL
FT                   PVEAIAERCGITVAEAELVRALAARSDDGAAR"
FT   CDS_pept        511494..512357
FT                   /transl_table=11
FT                   /locus_tag="azo0474"
FT                   /product="peptidoglycan-binding protein"
FT                   /function="Might bind murein"
FT                   /note="Exported protein with sporulation related repeat.
FT                   Pfam: Sporulation related repeat. InterPro: Proline-rich
FT                   region"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0474"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93091"
FT                   /db_xref="GOA:A1K2N6"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2N6"
FT                   /protein_id="CAL93091.1"
FT                   /translation="MSEDTRAGRNAALLRAGIAVAAALALLVGLLVVEDGRDPAADLTA
FT                   AAVQPAAVPGAAAQPAPPAQADTDKAAAAVALPPISAPAATVPAPAATAPGATAPGATA
FT                   PGATAPGATAPAATAPAATAPAATAPAAAAEAAATPAPPTAAAPTSASLPSPAEPAGAA
FT                   VSPQPAAAAIAGVAARTLPEAPASAPVTPPGAPRPPAVPAVPPVPAVVAAPVKDGYLLQ
FT                   LGVFGNPVNASALQAELAAKGLPARVESRVVLGPFPDRKSMEAAQRQLQRAHRQEGIVV
FT                   PPRGGR"
FT   CDS_pept        512441..512881
FT                   /transl_table=11
FT                   /locus_tag="azo0475"
FT                   /product="conserved hypothetical protein"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /note="Conserved hypothetical protein, 35% identity to
FT                   TrEMBL;Q8ENH9 Has PF02623, Uncharacterized BCR, COG1699;
FT                   IPR003775, DUF180 :This entry describes proteins of unknown
FT                   function."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0475"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93092"
FT                   /db_xref="GOA:A1K2N7"
FT                   /db_xref="InterPro:IPR003775"
FT                   /db_xref="InterPro:IPR024046"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1K2N7"
FT                   /protein_id="CAL93092.1"
FT                   /translation="MKIESPVFGSAEVSDDKVIEFPAGLPGFEHCKRFVLVHEEGSDTA
FT                   VFLLQSVDDADVAFSITGPEQLGINYEFALSDEEVATLGLASPAEALVAVIVRKDGEAG
FT                   SPASTGLRANFMAPLVINVEGRRGLQKVINRLGCDIVLRERA"
FT   CDS_pept        512981..513361
FT                   /transl_table=11
FT                   /locus_tag="azo0476"
FT                   /product="conserved hypothetical endoribonuclease L-PSP"
FT                   /function="Putative translation initiation inhibitor yjgF
FT                   family"
FT                   /note="Conserved hypothetical endoribonuclase L-PSP.
FT                   Homology to orf1 of A. vineladii of 74%
FT                   (sprot|YVN1_AZOVI(SRS)) This protein was described
FT                   initially as an inhibitor of protein synthesis intiation
FT                   but is now viewed as an endoribonuclease active on
FT                   single-stranded mRNA. The cleavage of mRNA is responsible
FT                   for the inhibition of protein synthesis. A role in purine
FT                   regulation has also been suggested. Tigrfam:
FT                   Endoribonuclease L-PSP, putative Pfam: Endoribonuclease
FT                   L-PSP (=YipgF family) no TMHs weak indication for signal
FT                   peptide"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0476"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93093"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2N8"
FT                   /protein_id="CAL93093.1"
FT                   /translation="MSRSIVSTPNAPAAIGTYSQAVKAGGTVYLSGQIGLDPATMQLVD
FT                   GFEAQTVRVFENLKAVAEAAGGSLADVVKLTIYLTDLANFAKVNEIMARYFAEPYPARA
FT                   AVGVKELPKGAVVEADAILVLG"
FT   CDS_pept        513369..515408
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="azo0477"
FT                   /product="ATP-dependent DNA helicase"
FT                   /function="RecG-like helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="ATP-dependent DNA helicase recG (EC 3.6.1.-).
FT                   Critical role in recombination and DNA repair. Help process
FT                   Holliday junction intermediates to mature products by
FT                   catalyzing branch migration. Has a DNA unwinding activity
FT                   characteristic of a DNA helicase with a 3 to 5 polarity.
FT                   recG unwind branched duplex DNA (Y-DNA). Has a role in
FT                   constitutive stable DNA replication (csdR) and R-loop
FT                   formation (By similarity). InterPro: ATP-dependent DNA
FT                   helicase RecG recG: ATP-dependent DNA helicase RecG"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0477"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93094"
FT                   /db_xref="GOA:A1K2N9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2N9"
FT                   /protein_id="CAL93094.1"
FT                   /translation="MQSGWAGLGEQLASRLRKLDLHRQEDLVVHLPLRYEDETRLTPIG
FT                   VARAGFPAQIEGEVTSCEVVLRPRRQLVARVRDDSGTLVARWINFYPSQQKQLAVGRRV
FT                   RLFGEVRGGFFGDEMVHPRVRNIDPGEGLPEALTPVYPTTAGLGQTTLRKLIDRALKTV
FT                   PLQDLLPEDARRALDLPGFAEALTALHHPAPDADPIALENREHPAWRRIKFEELLVQQL
FT                   SLRRAYNARRAREAVVLPARQQLTAGLVRGLPFALTSAQQRAVGEIAADLGAAHPMQRL
FT                   LQGDVGSGKTIVAALAMLQAAENGWQAALMAPTEILAEQHYKKLAAWLEPLGVGIAWLS
FT                   GSRRKREREAELARLQSGEVLLAVGTHALIEDEVALPRLALAIIDEQHRFGVRQRLALR
FT                   EKGAHGLRPHMLMMSATPIPRTLAMTHYADLDVSVLDELPPGRTPIRTKLVSDARREEV
FT                   VGRVRDACLQGRQAYWVCPLIEESEALQLQTALDTYAALSEALPELRVGLVHGRLKADE
FT                   KSATMAAFSAGELQVLVATTVIEVGVDVPNASLMVIEHAERFGLAQLHQLRGRVGRGTA
FT                   ESVCILLFAQPLSENGRARLKVIYEHTDGFAIAREDLQLRGPGEFVGARQSGVPLLRYA
FT                   DLELDAGLIEPARALAERMLRDAPAQADALMQRWLGGRESLLRA"
FT   CDS_pept        515463..516032
FT                   /transl_table=11
FT                   /gene="ubiC"
FT                   /locus_tag="azo0478"
FT                   /product="putative chorismate:pyruvate lyase"
FT                   /function="4-hydroxybenzoate synthetase (chorismate lyase)"
FT                   /EC_number="4.1.3.-"
FT                   /note="Chorismate:pyruvate lyase (EC 4.-.-.-). catalytic
FT                   activity: chorismate = 4-hydroxybenzoate + pyruvate.
FT                   pathway: ubiquinone biosynthesis; first step."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0478"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93095"
FT                   /db_xref="GOA:A1K2P0"
FT                   /db_xref="InterPro:IPR007440"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1K2P0"
FT                   /protein_id="CAL93095.1"
FT                   /translation="MQHPASGESWLARPPRTAERRLRPWLTDPASLTARIRMRCGMFGV
FT                   RVLRQSAGALTPDERRLLGLRAGERALLREVLLIADGRPVVFARSVLAQREQRGGWLRL
FT                   WRGIGSRPLGAALFSDPRIRRQPLACARIGAADARYHLARRALAGAATLPPALWARRSV
FT                   FRLHGRSLLVSEFFLPAILGLPDDPL"
FT   CDS_pept        516019..516882
FT                   /transl_table=11
FT                   /gene="ubiA"
FT                   /locus_tag="azo0479"
FT                   /product="4-hydroxybenzoate octaprenyltransferase"
FT                   /function="4-hydroxybenzoate polyprenyltransferase and
FT                   related prenyltransferases"
FT                   /EC_number="2.5.1.-"
FT                   /note="4-hydroxybenzoate octaprenyltransferase (EC 2.5.1.-)
FT                   (4-HB polyprenyltransferase). Synthesis of
FT                   3-octaprenyl-4-hydroxybenzoate. InterPro: UbiA
FT                   prenyltransferase"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0479"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93096"
FT                   /db_xref="GOA:A1K2P1"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1K2P1"
FT                   /protein_id="CAL93096.1"
FT                   /translation="MTLSDRLPLYGRLMRLDKPIGSLLLLWPTLWALWLAADGKPPLHV
FT                   LVIFTIGTVLMRSAGCVINDYADRDFDGHVERTRNRPLATRAVSTREALALAAGLSALS
FT                   FVLILPLDPLVIWLSFPALFLAASYPFTKRFFAIPQAYLGIAFGFGIPMGFAAVQGEVP
FT                   PIAWVMLLANIFWAVAYDTEYAMVDRPDDLKIGIKTSAITFGRFDVAAVMLCYAVALGL
FT                   LGWVGAQAGRGALYFAGLAVAAGMALYHYTLIRHRERAPCFKAFRHNNWLGAAVFAGLA
FT                   LDYLIG"
FT   CDS_pept        complement(516980..520849)
FT                   /transl_table=11
FT                   /locus_tag="azo0480"
FT                   /product="conserved hypothetical iron-sulfur binding
FT                   oxidase"
FT                   /function="FAD/FMN-containing dehydrogenases"
FT                   /note="Conserved hypothetical irons-sulfur binding oxidase.
FT                   Homology to cv4235 of C. violaceum of 70% (trembl|Q7NQA5)
FT                   Pfam: FAD binding domain; FAD linked oxidase, Cterminal
FT                   domain Tigrfam: glcD: glycolate oxidase subunit GlcD no
FT                   signal peptide no TMHs"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0480"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93097"
FT                   /db_xref="GOA:A1K2P2"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR021817"
FT                   /db_xref="InterPro:IPR022153"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2P2"
FT                   /protein_id="CAL93097.1"
FT                   /translation="MTQRLREIPYNYTSFSDREIVIRLLGAEAWSVLDELRSERITGRS
FT                   ARMLYEVLGDIWVVRRNPYLEDDLLASRERREALVGALNHRVSEVEKRRQGNDRVALLI
FT                   GRAREAVADFERWFDDSARKRKAVLKSLGRLTRRDNICFDGHARVSHVTDATDWRVEYP
FT                   FVVLYPDTEEEMAPLVRACIELGMTIIPRGGGTGYTGGAVPLDANSVVINTEKLLAMSA
FT                   VEDIPLPDADGKPMAAPYATIRTGAGVVTDRVSEAASAAGRVFAVDPTSASASCIGGNI
FT                   AMNAGGKKAVLWGTALDNLAWWKMVTPDGNWLEVERLDHNFGKIHEQETVRFRLRRFDG
FT                   ISYKPLGEEILAMPGAACRKDGLGKDVTDKFLGGVPGVQKEGTDGLIVAARWVLHKMPP
FT                   VTRTVCLEFFGQVREAVPAIVEITDYFKPGGAGNAAGVLLAGLEHLDERYVKAVGYTTK
FT                   AKRHGRPKMVLIGDIVGHDENAVMAAASEVVRMTNVRGAEGFIAVSPEQRKRFWLERSR
FT                   TAAISRHTNAFKVNEDVVIPLPRMGDYCDGIERINIELSIQNKLELCDTLAGFLRGELP
FT                   LDQGDANLASEELIGDRREAALNYVEAVRLRWEWLLENLDLPLAEAESRFAAYGIVAGE
FT                   LSNRAANPRLFHRLQDYSIRVSWKTELKPRLDKIFDGVVFRPVLARIAELHKQVLRGRV
FT                   FVALHMHAGDGNVHTNIPVNSDHYEMLQTANRAVDRIMALARSLDGVISGEHGIGITKL
FT                   DYLTDAEMANFWAYKQKVDPEGRFNRGKLMKGGNLDNAYTPSFNLMGHESLIMEQTEIG
FT                   EIAHDIKDCLRCGKCKPVCSTHVPRANLLYSPRNKILSTSLLVEAMLYEEQTRRGVSLA
FT                   HWAEFEDVADHCTVCHKCEKPCPVDIDFGDVSIKMRNLLRKQGKKSFNPGKAAAMAFLT
FT                   VKDPATIKLIRTGMLEWGFKAQRFAHKVGKSLGLVQPQVKAPPATLGKAPIKAQVIHLI
FT                   NKPMPGKLPKRTSRALLDIEDDKVIPVIRDPQKVNGDSEAVFYFPGCGSERLFSQVGLA
FT                   TQAMLYHVGAQTVLPPGYLCCGYPQTSAGEDDKGQKITTDNRVLFHRVANTLNYLDIKT
FT                   VIVSCGTCMDQLQKYEFEKIFPGCRLLDIHEYLMEKGVKLEGIQGVNYMYHEPCHTPMK
FT                   VHSGIKVANALMGTRVDLNDRCCGESGTLAVARPDISTQVRFRKQEEIEKGVAKLRESQ
FT                   PTAPTKILTSCPACLQGLHRYADDAGGVEPDYIVVEIAKHLLGDNWMPDYVAKANSGGI
FT                   ERVLL"
FT   CDS_pept        complement(520972..521325)
FT                   /transl_table=11
FT                   /locus_tag="azo0481"
FT                   /product="conserved hypothetical protein"
FT                   /function="Putative translation initiation inhibitor yjgF
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:azo0481"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93098"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035709"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2P3"
FT                   /protein_id="CAL93098.1"
FT                   /translation="MQPIVRKGVTARYADAVIHNQTVYLVEVPSSTGGDVTTQAGEIFA
FT                   SLERQLMDAGSSKARILMATVYLTDMADYDAMNAAWEAWLPPGEAPSRACVRVAGLAQA
FT                   GWRIEIALTAAVA"
FT   CDS_pept        complement(521370..521783)
FT                   /transl_table=11
FT                   /locus_tag="azo0482"
FT                   /product="conserved hypothetical membrane protein"
FT                   /function="predicted membrane protein"
FT                   /note="Conserved hypothetical membrane protein. Homology to
FT                   yqaA of Nitrosomonas europaea of 50% (trembl|Q82TH7(SRS))
FT                   No domains predicted. Signal peptide present. TMHMM2
FT                   reporting presence of 2 TMH's."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0482"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93099"
FT                   /db_xref="GOA:A1K2P4"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2P4"
FT                   /protein_id="CAL93099.1"
FT                   /translation="MELIAAAEPATTLGALFISALLAATVLPGGSEAAFAALLLASPQL
FT                   LWPALAAATLGNTLGGTSTYLLGRLLPRKEVPPRLALVRRYGSLSLLLSWVPLIGDALC
FT                   AGAGLLRLPWLPCLLWMAIGKGARYAAIAWLLG"
FT   CDS_pept        521919..522353
FT                   /transl_table=11
FT                   /locus_tag="azo0483"
FT                   /product="conserved hypothetical secreted protein"
FT                   /note="Conserved hypothetical secreted protein. Homology to
FT                   PA4874 of P.aeruginosa of 36% (trembl|Q9HUT9(SRS)) No
FT                   domains predicted. Signal petide present. No TMH present."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0483"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93100"
FT                   /db_xref="InterPro:IPR011690"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2P5"
FT                   /protein_id="CAL93100.1"
FT                   /translation="MKKLLSAFALAVSCTAMLPAEAQANPQHERMRRCSQEAKEQTLKG
FT                   DERKAFMSTCLKGKHDTGAETATAPAKPAAKAAAAKPAAEKSAADKTSTAKPAAADKVA
FT                   EADAAPVAQRSKMKTCNQSATEQSLKGDARKAFMSECLKG"
FT   CDS_pept        complement(522433..523299)
FT                   /transl_table=11
FT                   /locus_tag="azo0484"
FT                   /product="FHA domain containing protein"
FT                   /function="Adenylate cyclase family 3 (some proteins
FT                   contain HAMP domain)"
FT                   /note="FHA domain containing protein. Best similarity to
FT                   SWISSPROT: sprot|REPB_AGRRH (9% Agrobacterium
FT                   rhizogenes,possible replication protein b) Pfam: PF00211
FT                   Adenylate and Guanylate cyclase catalytic domain. SMART:
FT                   SM00240 FHA Forkhead associated domain."
FT                   /db_xref="EnsemblGenomes-Gn:azo0484"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93101"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2P6"
FT                   /protein_id="CAL93101.1"
FT                   /translation="MSDRRNLCLLVAEVLGHDRLVGRLGATEAGHAVERCLNRIDRAIE
FT                   GNGGTIVARADGHVDVVFERCDAAVLASCEMLERVLSLPPVSGTRLTMRIGLHYGAAEG
FT                   DSASGEGFDVARRLASLSRPGQALASGAAVMLLSASTRHFAGTEAIHDADLDKLEWPVY
FT                   AIGQRVGLVTSVPPSARVSQRLRLRHQQEILFVEEQRPVLLLGRELGNDVVIIDARASR
FT                   QHARIERRREGFILIDQSTNGSFVSIDGVGERCVKDDEIVLSGPGRIGCGFSANEIERD
FT                   LVFFDIV"
FT   CDS_pept        complement(523396..524316)
FT                   /transl_table=11
FT                   /locus_tag="azo0485"
FT                   /product="conserved hypothetical protein"
FT                   /note="Homology to hypothetical protein ydaO. InterPro:
FT                   Uncharacterized protein family UPF0021"
FT                   /db_xref="EnsemblGenomes-Gn:azo0485"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93102"
FT                   /db_xref="GOA:A1K2P7"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1K2P7"
FT                   /protein_id="CAL93102.1"
FT                   /translation="MPAVAPSAAESRHSNTFLRLKKKLERGVGEAIADYNMIGDGDTVM
FT                   VCVSGGKDSYTLLSCLLALRERAPVDFRIVAMNLDQKQPGFPDDVLPAYFESIGVEYRI
FT                   VTEDTYSIVKDKIPEGKTTCSLCSRLRRGIIYRTAKEIGATRIALGHHRDDMLETLFLN
FT                   MFFGGKIKAMPPKLVSDDGQHVVIRPLAYCTENDIERFARGMDFPIIPCNLCGSQENAQ
FT                   RKQIKTMLQGWARDYPGRIESLATSLRNVVPSHLSDSALFDFVGLTRDTRVGEGDTVFD
FT                   PPELPAAAAPITLRRADDDGDRSAT"
FT   CDS_pept        complement(524389..525135)
FT                   /transl_table=11
FT                   /locus_tag="azo0486"
FT                   /product="conserved hypothetical short-chain dehydrogenase"
FT                   /note="Conserved hypothetical short-chain dehydrogenase.
FT                   Homology to cv4132 of C. violaceum of 60% (trembl:Q7NQK5).
FT                   Pfam: short-chain dehydorgenase (PF00106). no signal
FT                   peptide. no TMHs"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0486"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93103"
FT                   /db_xref="GOA:A1K2P8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2P8"
FT                   /protein_id="CAL93103.1"
FT                   /translation="MDTAEAPVILVTGAARRVGAEIARLVHASGARVIVHHRRSAAEAE
FT                   TLAAGLNALRPGSAAVVAGDLAADGEPARVAAAALDCFGRIDGLVNNASSFFPTALGTI
FT                   DETAWSDLVGSNLKGPLFLSQALAAELTRRAGSIVNIVDIHAERPLKGYLLYCTAKAGL
FT                   VGLTRALAVELAPAVRVNGVAPGPIVWPEDTQFDAEARAQIVRHTLLQREGAPADIARA
FT                   VRFLLVDAPYVTGQILAVDGGRSAHL"
FT   CDS_pept        525247..526419
FT                   /transl_table=11
FT                   /locus_tag="azo0487"
FT                   /product="conserved hypothetical protein"
FT                   /function="uncharacterized conserved protein"
FT                   /note="Conserved hypothetical protein. Homology to NE1166
FT                   of N.europaea of 49% (tremble:Q82VC8) Has
FT                   PF02636,Uncharacterized ACR, COG1565;IPR003788 ,DUF185;
FT                   This family contains several uncharacterised proteins.
FT                   Q8YI87 has been described as an ATP synthase beta subunit
FT                   transcription termination factor rho protein. No signal
FT                   peptide. No TMHs."
FT                   /db_xref="EnsemblGenomes-Gn:azo0487"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93104"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038375"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2P9"
FT                   /protein_id="CAL93104.1"
FT                   /translation="MSSLPEPSADALDQSARLVALLHAEIAAAGGWLSFARYMEITLYA
FT                   PGLGYYSGGARKFGPGGDFITAPELTPLFGQALASQVEQVMRASAPAVIEVGAGTGLLA
FT                   TDLLLELERRGCLPDSYGILELSGELRERQFDTLASQAPHLAGRVRWLESLPESFSGAV
FT                   VANEVLDVMPVHLVVARAEGLFERGVAVVQREDGPALQWADVPAAGAVREAALALQLPT
FT                   PSSGEYVTEINLAGGAWVAAWAERLRQGAMLLIDYGYPRAEYYLPSRSGGTLLCYYRHH
FT                   AHGDPFLWPGLNDITAFVDFTAVAEAAFGAGLDVTGYTTQAQFLFNCGVLECLARRGPE
FT                   ERPEYIRAARAVQRLTAPQEMGELFKVLAVSRGLSEPLLGFARGDRLHAL"
FT   CDS_pept        complement(526459..526677)
FT                   /transl_table=11
FT                   /locus_tag="azo0488"
FT                   /product="conserved hypothetical protein"
FT                   /note="Conserved hypothetical protein. Homology to ebA3372
FT                   of Azoarcus sp. EbN1 of 47% (gnl|keqq|eba:ebA3372(KEGG)).
FT                   No domains predicted. No signal peptide. No TMHs."
FT                   /db_xref="EnsemblGenomes-Gn:azo0488"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93105"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2Q0"
FT                   /protein_id="CAL93105.1"
FT                   /translation="MVIVMEMNSGKALTEPPAYGEEILNASWLPQPTPEVAVQLQEIEL
FT                   APRRRHDSMPPPADIEAFLAAIYRNQE"
FT   CDS_pept        526664..526792
FT                   /transl_table=11
FT                   /locus_tag="azo0489"
FT                   /product="hypothetical secreted protein"
FT                   /note="Hypothetical secreted protein. No homology to the
FT                   data bank. No domains predicted. No TMHs. Signal peptide
FT                   present."
FT                   /db_xref="EnsemblGenomes-Gn:azo0489"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93106"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2Q1"
FT                   /protein_id="CAL93106.1"
FT                   /translation="MTITMMASAVLVDVLSPCLLNGRAAADLSGRRIQGKSRVALR"
FT   CDS_pept        complement(526887..527693)
FT                   /transl_table=11
FT                   /locus_tag="azo0490"
FT                   /product="putative acetone-cyanohydrin lyase"
FT                   /function="predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily)"
FT                   /EC_number="1.11.1.10"
FT                   /note="TREMBL:Q8F3A6: 43% identity, 60% similarity Non-heme
FT                   chloroperoxidase (EC 1.11.1.10) (Chloride peroxidase)
FT                   (CPO-P) (Chloroperoxidase P). CHLORINATES AND BROMINATES
FT                   SUITABLE ORGANIC COMPOUNDS. INVOLVED IN THE BIOSYNTHESIS OF
FT                   THE ANTIBIOTIC PYRROLNITRIN. InterPro: Alpha/beta hydrolase
FT                   fold InterPro:IPR000073; A/b_hydrolase. IPR003089:
FT                   AB_hydrolase. IPR000379: Ser_estrs. Pfam:PF00561;
FT                   Abhydrolase_1; 1 TIGRFAM:dsbE: periplasmic protein
FT                   thiol:disulf"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0490"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93107"
FT                   /db_xref="GOA:A1K2Q2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2Q2"
FT                   /protein_id="CAL93107.1"
FT                   /translation="MNSTRFGELEVICHAPAGTPAFETPLLFIHGAYVGAWCWEEYFLP
FT                   WFARHGWAAYALSLSGHGGSRRRDRLDAYSIADYVADVVEVAGKLPAPPILIGHSMGGM
FT                   VVQKYLERHRVPAAVLMSSVPPQGLMGSALGLMMSHPHLLNDLNRILGGSEVDIASLRE
FT                   ALFHQPVDEATLERYYRLSQPESHRAIWDMTLFNLPTPLLMHRPPLQVLGAQHDVLIPP
FT                   DQVHMTAATYGTTATIFGGMGHGLMLEQDWEQVARHMHAWLEPFGG"
FT   CDS_pept        complement(527690..528310)
FT                   /transl_table=11
FT                   /gene="isoJ"
FT                   /locus_tag="azo0491"
FT                   /product="probable glutathione S-transferase"
FT                   /function="Glutathione S-transferase"
FT                   /EC_number="2.5.1.18"
FT                   /note="Probable glutathione S-transferase. Homology to isoJ
FT                   of Rhodococcus sp AD45 of 48% (trembl|Q9RBP3). Catalysis of
FT                   the reaction: R-X + glutathione = H-X + R-S-glutathione. R
FT                   may be an aliphatic, aromatic or heterocyclic group; X may
FT                   be a sulfate, nitrile or halide group. Pfam: Glutathione
FT                   S-transferase, N-terminal domain; Glutathione
FT                   S-transferase, C-terminal domain no signal peptide no TMHs"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0491"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93108"
FT                   /db_xref="GOA:A1K2Q3"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2Q3"
FT                   /protein_id="CAL93108.1"
FT                   /translation="MITLYTWGTPNGRKISIALEELGLDYTVRPIDITRGEQHEAGFVA
FT                   LSPNNKIPVLVDDEGPGGAPITLIESGAILIYLAEKHGQLLSAEPRERLETLQWLMLQM
FT                   GSIGPMLGQAHHFLRFAPDVIPYAIDRYSKEAVRLYGVLNTRLAGRDWLAGAAYSIADI
FT                   ATWPWIDRHKWQGIDLARYPEVKRWYETIAARPAVQRGMEVPR"
FT   CDS_pept        528392..528589
FT                   /transl_table=11
FT                   /locus_tag="azo0492"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="Conserved hypothetical membrane protein. Homology to
FT                   BH1226 of Bacillus halodurans of 40% (pir|B83803) no
FT                   domains predicted. signal peptide. 1 TMHs"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0492"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93109"
FT                   /db_xref="GOA:A1K2Q4"
FT                   /db_xref="InterPro:IPR021320"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2Q4"
FT                   /protein_id="CAL93109.1"
FT                   /translation="MLKWFVVVVIVVLVSGLIQPGLARRLRLGYLPGDVAIRVRGRSYR
FT                   FPFATTLLLSLLAWLLLRAL"
FT   CDS_pept        complement(528605..529843)
FT                   /transl_table=11
FT                   /gene="cca1"
FT                   /locus_tag="azo0493"
FT                   /product="tRNA-nucleotidyltransferase"
FT                   /function="tRNA nucleotidyltransferase/poly(A) polymerase"
FT                   /EC_number="2.7.7.25"
FT                   /note="tRNA nucleotidyltransferase (EC 2.7.7.25) (tRNA
FT                   adenylyltransferase) (tRNA CCA-pyrophosphorylase)
FT                   (CCA-adding enzyme). This enzyme carries out synthesis of
FT                   the tRNA CCA terminus without the direction of a template
FT                   using the multiple accepting and donating subsites within
FT                   its active site. HDIG: uncharacterized domain HDIG"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0493"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93110"
FT                   /db_xref="GOA:A1K2Q5"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR012006"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1K2Q5"
FT                   /protein_id="CAL93110.1"
FT                   /translation="MRTYVVGGAVRDALLGLPVKDRDWVVVGATPDEMLARGFRPVGKD
FT                   FPVFLHPQTQEEHALARTERKTGRGYAGFAFHTAPDVTLEEDLARRDLTINAIARDADG
FT                   TLIDPYGGVADLHGRVFRHVSPAFAEDPVRILRVARFAARFADFSVAPETLALMRAMVD
FT                   NGEVDHLVAERVWQEFARGLMEAHPARMIRVLRDCGALARLLPELDRLFGVPQPAQHHP
FT                   EIDTGEHVLMVVEQAAARAHSLPVRWATLLHDLGKGETPAAILPHHYGHEARSADLARQ
FT                   VSERLKAPVDCRDLAVMVAREHGILAQAAVLRAETMVKVLERCDALRRPERFALMLEAA
FT                   ACDHLGRGGERPENWAPAAQWQAALAAVRSVEAGAIARACADKAQVPQRIHAARVAAVK
FT                   ALRAHPPPAEGIS"
FT   CDS_pept        complement(529843..530487)
FT                   /transl_table=11
FT                   /gene="sspA1"
FT                   /locus_tag="azo0494"
FT                   /product="putative stringent starvation protein A"
FT                   /function="Glutathione S-transferase"
FT                   /note="Putative stringent starvation protein A. Homology to
FT                   sspA of E. coli of 26% (sprot|SSPA_ECOLI). FORMS AN
FT                   EQUIMOLAR COMPLEX WITH THE RNA POLYMERASE HOLOENZYME (RNAP)
FT                   BUT NOT WITH THE CORE ENZYME. IT IS SYNTHESIZED
FT                   PREDOMINANTLY WHEN CELLS ARE EXPOSED TO AMINO ACID
FT                   STARVATION AT WHICH TIME IT ACCOUNTS FOR OVER 50% OF THE
FT                   TOTAL PROTEIN SYNTHESIZED. InterPro: Glutathione
FT                   S-transferase N terminus (IPR001045) Pfam: Glutathione
FT                   S-transferase, N-terminal domaine no signal peptide no
FT                   TMHs"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0494"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93111"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2Q6"
FT                   /protein_id="CAL93111.1"
FT                   /translation="MKLIIGNKNYSSWSLRAWLAARAGGFAFEEIRIPLFLPGSREHIL
FT                   SHSPSGKVPCLIDRGLAVWDSLAICEYLAEQAPQLWPADPAARAVARAVSAEMHSGFQN
FT                   LRQRMGMNIRKDYAGHGRSAEVDADIARITAIWNDCRARFGADGPYLFGRFSVADAMYA
FT                   PVCFRFKTYGIAPEGAAGAYLATMLAHPDMRAWQAGALAETEAIPGEDLYG"
FT   CDS_pept        complement(530568..531536)
FT                   /transl_table=11
FT                   /locus_tag="azo0495"
FT                   /product="putative NADH dehydrogenase"
FT                   /function="NADH dehydrogenase"
FT                   /EC_number="1.6.5.3"
FT                   /note="33%"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0495"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93112"
FT                   /db_xref="GOA:A1K2Q7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2Q7"
FT                   /protein_id="CAL93112.1"
FT                   /translation="MKSTRVVLIGGSGFVGSVIANRLSAAAIDLCIPTRRPARAAHLLP
FT                   LPTAQILEADVHDPVTLARLLEGADAVVNLVGILHSRPGSPYGRDFARAHVELPRKLVS
FT                   ACRSAGVRQLIHISALGANPDGPSEYQRSKAAGEAEIHAAGDDVMWTVLRPSVIFGRAD
FT                   RFLNLFADLARTLPVLPLAGARTRFQPVYVEDVAEVVWRCLGDPACARETFEVAGPTVY
FT                   TLRELVEYVSALAGHPRPVIALPEGVAMLQARLMSLLPQPLISPDNIRSMRVDNVASGA
FT                   PLPFGLRPTAVEEAAPEWIAPRVSPRAHFDEFRRRASRPRG"
FT   CDS_pept        complement(531552..533480)
FT                   /transl_table=11
FT                   /gene="sltY"
FT                   /locus_tag="azo0496"
FT                   /product="putative soulbe lytic murein transglycosylase"
FT                   /function="Soluble lytic murein transglycosylase and
FT                   related regulatory proteins (some contain LysM/invasin
FT                   domains)"
FT                   /EC_number="3.2.1.-"
FT                   /note="Putative soluble lytic murein transglycosylase.
FT                   Homology to slt of E. coli of 24% (sprot|SLT_ECOLI).
FT                   Murein-degrading enzyme. Catalyzes the cleavage of the
FT                   glycosidic bonds between N-acetylmuramic acid and
FT                   N-acetylglucosamine residues in peptidoglycan. May play a
FT                   role in recycling of muropeptides during cell elongation
FT                   and/or cell division. InterPro: SLT domain (IPR000189)
FT                   Pfam: Transglycosylase SLT domain singal peptide no TMHs"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0496"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93113"
FT                   /db_xref="GOA:A1K2Q8"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR012289"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2Q8"
FT                   /protein_id="CAL93113.1"
FT                   /translation="MKQFLWGALAAALMWFSGAAGAQTAKSGDERILAARDAIRNGDRA
FT                   ALEWLAASTENHVLNPYVRYWLLFNKLARPEPPPAAELSDFLLREAGSMLADRLRGDWL
FT                   RRMAKDGDWAGFVALYPDLVAPDAELRCLGWTARLMTGDRAVLDEVARQWMDLVDSHAA
FT                   CETSLRATLSAGLVGEDEVWWRIRRQVEGKNPAQARTTLTWLPATSAPLPGALEQALNA
FT                   PAPYLDRLPPNFAITRAGRELALAALVRLARDDLSGAYSRLIRLQDRLETGERAYAYAA
FT                   LALRAAFAQQPDAVAWFQAAGNVLLTAEQRAWRVRVALRASDWSAVRHAIAALPPAEQN
FT                   EPEWIYWLGRAHAAAGQRAEAEALYARIADQSGFYGLLAAEELGRPFAPPLKGGAITAA
FT                   DLRQAESDLGLQRALALFRLDMRTEGVREWNWSLRNQTEAFTLAAARIALDAGIYDRAI
FT                   NTAERGNPNGNFEMRFLTPYRQLIEPQVRGQGLDLSWVYGLMRQESRFVVPARSSSGAQ
FT                   GLMQVMPATGKWVAAKIGMRGYHPGLLSDPDTNVQLGTSYMRMILEDLDNHPVLASAGY
FT                   NAGPSRAKRWRDAKPLEGAIYAETIPFDETRDYVKKVMTNTVIYAAMLEGRPQSLKTRL
FT                   GTIAARN"
FT   CDS_pept        533521..534114
FT                   /transl_table=11
FT                   /locus_tag="azo0497"
FT                   /function="5-formyltetrahydrofolate cyclo-ligase"
FT                   /EC_number="6.3.3.2"
FT                   /note="5-formyltetrahydrofolate cyclo-ligase InterPro:
FT                   5-formyltetrahydrofolate cyclo-ligase"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0497"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93114"
FT                   /db_xref="GOA:A1K2Q9"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2Q9"
FT                   /protein_id="CAL93114.1"
FT                   /translation="MTGSDSPQPDAVAALRRAAREGAIAAREALPPARRAALTLHIERH
FT                   LDALLAQLAPRVLAFCWPYRAEPDLRAWVGRWLAADPRRVAALPVVLDKGAPLAFRRWT
FT                   ADVAMALDRHGIPYPAVDDPVRPELALVPLNAFDAAGFRLGYGGGYFDRTLAQLDLVAV
FT                   GVGFECGRVATVHPQPHDLPMRWIVTEGGIHAAA"
FT   CDS_pept        complement(534121..536826)
FT                   /transl_table=11
FT                   /locus_tag="azo0498"
FT                   /product="GGDEF/PAS/PAC-domain containing protein"
FT                   /function="FOG: PAS/PAC domain"
FT                   /note="GGDEF/PAS/PAC-domain containing protein. Similarity
FT                   to SWISSPROT: sprot|Y4LL_RHISN (13% Rhizobium sp. (strain
FT                   NGR234), hypothetical 91.8 kda protein y4ll) / TREMBL:
FT                   trembl|Q55955 (14% Synechocystis sp. (strain PCC
FT                   6803),sll0779) Pfam: PF00990 GGDEF domain. PF00989 PAS.
FT                   PF00785 PAC. TIGRFAM: TIGR00254 putative diguanylate
FT                   cyclase (GGDEF) domain. TIGR00229 PAS domain S-box. TMHMM
FT                   reporting 2 transmembrane helices."
FT                   /db_xref="EnsemblGenomes-Gn:azo0498"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93115"
FT                   /db_xref="GOA:A1K2R0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2R0"
FT                   /protein_id="CAL93115.1"
FT                   /translation="MDRSSVTAAPAVGAAGRRRQHLADAGFVGFIALCIVVAWYSLHYH
FT                   GQRLEQETLAARAQVADLDTQHLASHLSLTLRGVDLTLQTLLETGPPVDAVYTWNGLLR
FT                   EALRNSPQLRSLSLLDGTGTVIASSNPANLGQHPSLARFLPQAAPFAPTLRLGPPQGGR
FT                   DLADAAPISAEEAPPPLYFVPLLRGLHTPDGDGVYLLAALNMDFFTNGGALPVRGATDH
FT                   LEVINFEGQRVLDDDAPRTPEMRAADLALVERWKAGDEHGVVHLDTADGATYSVAYRLP
FT                   RNLPLGVVARFNHAEALSGARAERARQERYLLPAVGLSLGGTLFGYFLFRRAGRRERLA
FT                   REAAESALRASEERYRLTMGAVRDGMWEWHVDTGALCWDARCFEQLGFPPDGFELDIER
FT                   WKARIHPEDHARLSPMMDEMATSPEGFRIEFRMPDIQGEWHWLEARGKVVEWRGDAPLR
FT                   VVGTQTDIHVRKTGEIRLRLLEAALNAAANAVVITNANAVIEWVNPAFAALSGYNQDDA
FT                   IGRTPRELINSGAQSGEYYAALWNTILAGDVWRGELINRRRDGQLYHEALTITPMRDEN
FT                   GTLDHFIAVKEDISARKAAEAELEATHARLQAVVDNFPGAVLFEDADGTITLANQMLCS
FT                   LLGIDERASALVGRPSVELVADAAPNFTDAAAFVARIRDLRAAARPVHGEELETLGGRW
FT                   LERDFLPVRSGDTLLGFLRLYRDVTERKHHEQALQRLATLDPLTGTWNRRAFLERAEHE
FT                   RLRYLRSEHPASLVMLDLDHFKRVNDTWGHAAGDAVLCHFVRVLQQRLRATDLLGRLGG
FT                   EEFALLLVDTTPEGAAELTERLRAAIAEHPLPLGDRTISITVSAGIAPFVQDDQNVEAA
FT                   LARADAALYRAKARGRNQVVLADDECGTAR"
FT   CDS_pept        complement(536846..537652)
FT                   /transl_table=11
FT                   /gene="pheC"
FT                   /locus_tag="azo0499"
FT                   /product="putative cyclohexadienyl dehydratase"
FT                   /function="ABC-type amino acid transport/signal
FT                   transduction systems periplasmic component/domain"
FT                   /EC_number="4.2.1.91"
FT                   /note="Putative cyclohexadienyl dehydratase precursor.
FT                   Homology to pheC of P. aeruginosa of 36% (sprot|PHEC_PSEAE)
FT                   FORMS ALTERNATIVE PATHWAY FOR PHENYLALANINE BIOSYNTHESIS.
FT                   CAN CATALYZE TWO REACTIONS: PREPHENATE DEHYDRATASE AND
FT                   AROGENATE DEHYDRATASE. MAY HAVE A ROLE IN CHEMOTAXIS OR
FT                   TRANSPORT. InterPro: Bacterial extracellular solute-binding
FT                   proteins family 3 (IPR001638), solute-binding
FT                   protein/glutamate receptor (IPR001311) Pfam: Bacterial
FT                   extracellular solute-binding proteins signal peptide no
FT                   TMHs"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:azo0499"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93116"
FT                   /db_xref="GOA:A1K2R1"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2R1"
FT                   /protein_id="CAL93116.1"
FT                   /translation="MASLARLALGLLVSLTLLYTTLYAQPAQSHLDRILAERVLKVCVW
FT                   PDYYGISFRNPRTQELAGIDVDLARELARDLDVRLEFVDSSFANLIGDVLGDRCDVAMF
FT                   AIGITAQRAEKLRFTSPHLASDIYAITTRTNRRIRSWDDIDQPGVIVAVAKGTLHEPVM
FT                   RDKLRHAQLQVLASPHAREQEVESGRADVFMTDFPYSRRMLDNADWARLVAPSTRYHVT
FT                   PYAWAIAPGDDRWHQRLEAFLATIRDDGRLMAAARRHGLDPIIVNR"
FT   CDS_pept        complement(537808..539328)
FT                   /transl_table=11
FT                   /gene="ilvA"
FT                   /locus_tag="azo0500"
FT                   /product="probable threonine dehydratase"
FT                   /function="Threonine dehydratase"
FT                   /EC_number="4.3.1.19"
FT                   /note="Probable Threonine dehydratase(EC 4.3.1.19)
FT                   (Threonine deaminase, Threonine ammonia-lyase). Homology to
FT                   ilv1 of A. adeninovorans of 52% (sprot|THDH_ARXAD).
FT                   Catalyzes the formation of alpha-ketobutyrate from
FT                   threonine in a two-step reaction. The first step is a
FT                   dehydration of threonine followed by rehydration and
FT                   liberation of ammonia. InterPro:
FT                   Pyridoxal-5-phosphate-dependent enzymes beta family
FT                   (IPR001926),Serine/Threonine dehydratase
FT                   pyridoxal-hposphate attachment site (IPR000634), C-terminal
FT                   domain of threonine dehydratase (IPR001721) Pfam:
FT                   Pyridoxal-phosphate dependent enzyme, C-terminal doman of
FT                   threonin dehydratase no signal peptide no TMHs"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0500"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93117"
FT                   /db_xref="GOA:A1K2R2"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2R2"
FT                   /protein_id="CAL93117.1"
FT                   /translation="MTSASPDYLERILNAQVYDLAVETPLDLATNLSARSGNRIYLKRE
FT                   DMQPVFSFKLRGAYNKMANLSPQALQRGVICASAGNHAQGVALSAQKLGVRAVIVMPTT
FT                   TPQIKIDAVRSRGGEVVLAGESYSDAYAHALELEKAEKLTFVHPYDDPDVIAGQGTIGM
FT                   EILRAHAKPIHAIFCAVGGGGLIAGVAAYVKRLRPETRIIGVESEGAAAMTESLARGER
FT                   VSLEQVALFADGTAVKQVGGETFRLCQQYVDEMIVVDNDAICAAIKDVFEDTRSILEPS
FT                   GALAVAGAKEYARRHQLSDRSLVAVASGANMNFDRLRFVAERAELGEQREAVLAVTIPE
FT                   QPGSFRKFINILGNRDITEFNYRYADSERAHIFVGVTVRSRDEATRLVEMLGQHDLPAL
FT                   DLTDDELAKSHVRYMVGGRAPQVANELVYRFVFPERPGALLNFLSNLRSDWNISLFHYR
FT                   NHGADFGRVLVGMQVPPQDIDAFEAFLQRLGYEYAAETENPAYRLFLA"
FT   CDS_pept        complement(539453..540394)
FT                   /transl_table=11
FT                   /gene="hprK"
FT                   /locus_tag="azo0501"
FT                   /product="probable Hpr serine kinase/phosphatase"
FT                   /function="Serine kinase of the HPr protein regulates
FT                   carbohydrate metabolism"
FT                   /EC_number="3.1.3.3"
FT                   /note="Probable Hpr kinase/phosphorylase, Hpr_kinase. Pfam:
FT                   PF02603; Hpr_kinase. TIGRFAM:TIGR00679; hpr-ser."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0501"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93118"
FT                   /db_xref="GOA:A1K2R3"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1K2R3"
FT                   /protein_id="CAL93118.1"
FT                   /translation="MRQTSVARLYEDQGPRLQLTHVSGPLDAVLSVAEERMWPADLVGH
FT                   LNLIHPTRLQVLGAAELEWARRQSREKVAHHLNGILSARPPAIIVADGCETPNIVHGVC
FT                   TAHNVALFSTPHPSASVIDQLRLYLSRQLAEKISLHGVFMDVLGIGVFITGNSGAGKSE
FT                   LALELISRGHGLVADDIVEFSRTAPTVLEGRCPELLKDFIEVRGLGILNIRTIFGETAC
FT                   RRKMRLRLVCHLERRQPGQDDPNRLPVQQEQQVILGVSTPRVTLPVAAGRNLAVLLEAA
FT                   VRSTILQLRGVDSTQEFIDRQSRMLMGDGDGL"
FT   CDS_pept        complement(540363..540848)
FT                   /transl_table=11
FT                   /gene="ptsN"
FT                   /locus_tag="azo0502"
FT                   /product="protein-Npi-phosphohistidine-sugar
FT                   phosphotransferase"
FT                   /function="Phosphotransferase system
FT                   mannitol/fructose-specific IIA domain (Ntr-type)"
FT                   /EC_number="2.7.1.69"
FT                   /note="Probable nitrogen regulatory IIA protein,"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0502"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93119"
FT                   /db_xref="GOA:A1K2R4"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2R4"
FT                   /protein_id="CAL93119.1"
FT                   /translation="MSLIAQLLPLSNVVVDLDASSKKRVFEHAGLLFENNQGIARSTVF
FT                   DSLFSRERLGSTGLGQGIAIPHGRIKGLKEAAGAFLRLSAPVQFDAPDGRPVNLLFVLL
FT                   VPEQANETHLQLLSELAQMFSERAFREQLLVAPDAATIHALFANWGPDAADQRRAAV"
FT   CDS_pept        complement(540982..541305)
FT                   /transl_table=11
FT                   /gene="rpoX"
FT                   /locus_tag="azo0503"
FT                   /product="probable sigma-54 modulation protein"
FT                   /function="Ribosome-associated protein Y (PSrp-1)"
FT                   /note="Probable sigma 54 modulation protein,"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0503"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93120"
FT                   /db_xref="GOA:A1K2R5"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2R5"
FT                   /protein_id="CAL93120.1"
FT                   /translation="MNLNITGHHVEVTPAIREYVVTKLDRVIAHFDNVTSVNVILSVEK
FT                   LKQKAEVTVHVRGKDIYVESDDANLYAAIDSMADKLDRQVQKYKQKVSDHNHDALKHQS
FT                   PEA"
FT   CDS_pept        complement(541320..542780)
FT                   /transl_table=11
FT                   /gene="rpoN1"
FT                   /locus_tag="azo0504"
FT                   /product="RNA polymerase sigma-54 factor"
FT                   /function="DNA-directed RNA polymerase specialized sigma
FT                   subunit sigma54 homolog"
FT                   /note="RNA polymerase sigma-54 factor. The sigma factor is
FT                   an initiation factor that promotes attachment of the RNA
FT                   polymerase to specific initiation sites and then is
FT                   released. Similar to SWISSPROT: sprot|RP54_PSEAE (51%
FT                   Pseudomonas aeruginosa, RNA polymerase sigma-54 factor
FT                   RpoN) / sprot|RP54_ECOLI (46% Escherichia coli, RpoN or
FT                   NtrA) InterPro: IPR000394 Sigma54_factor. Pfam: PF00309
FT                   Sigma54_AID. PF04963 Sigma54_CBD. HTH reporting nucleic
FT                   acid binding motif."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0504"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93121"
FT                   /db_xref="GOA:A1K2R6"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2R6"
FT                   /protein_id="CAL93121.1"
FT                   /translation="MKPTLQLKLSQHLTLTPQLQQSIKLLQLSTLELNTEIERFLLENP
FT                   MLEREEMDGGGHDFQAQLSSGTTTASTTTESSGESGGEAESRADSAESGSFDEGMDWSS
FT                   GSGSGSSSNRDDDDDVDFQEFQAAGISLRDHLDQQVALSPLSDRDRALVRFLIEALDDD
FT                   GYLHQELEELLELLPPELDVELDDLCIALKHVQSLEPAGIGARTPQECLALQLRAMPAE
FT                   PVRDLALQIVSQHLELLAERNFAKLKKLTGCDDDALRAAHALICRLDPHPGAQHSVEET
FT                   RYVLPDVVVRKLRGRWTVQLNPEAMPRLRINQLYASILQQNRGQGGGLTSQLQEARWLI
FT                   KNVQQRFDTILRVSQAIVDQQRQFFDHGEVAMRPLTLREIADQLELHESTVSRVTTQKF
FT                   MATPRGVFELKYFFGSHVATDTGGAASSTAIRALIRQLVDAEDRKKPLSDARIAELLGQ
FT                   QGIVVARRTIAKYRESLNIPPVSLRKTI"
FT   CDS_pept        complement(542790..543512)
FT                   /transl_table=11
FT                   /gene="yhbG"
FT                   /locus_tag="azo0505"
FT                   /product="probable ATPase component of ABC transporter"
FT                   /function="ABC-type (unclassified) transport system ATPase
FT                   component"
FT                   /note="Probable ABC transporter ATP-binding protein HI1148.
FT                   ATP-binding cassette (ABC) transporters are multidomain
FT                   membrane proteins, responsible for the controlled efflux
FT                   and influx of substances (allocrites) across cellular
FT                   membranes. TREMBL:Q7NST9: 64% identity,75% similarity
FT                   InterPro: IPR003593; AAA_ATPase. IPR003439;
FT                   ABC_transporter. IPR000767; Disease_resist. IPR003016;
FT                   Lipoyl_BS. Pfam PF00005; ABC_tran; 1 mobB:
FT                   molybdopterin-guanine dinucleoti TMH's present 0"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0505"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93122"
FT                   /db_xref="GOA:A1K2R7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2R7"
FT                   /protein_id="CAL93122.1"
FT                   /translation="MSLLKVTGLQKRYKARTVVHDVGFEVGSGEVVGLLGPNGAGKTTC
FT                   FYMIVGLVRADGGEITLDDARLTHLPIHERARLGLSYLPQEMSVFRKLTVAENIQSVLE
FT                   LRGLNATRIAERLEELLEELGIAHLRNNTAVSLSGGERRRCEIARALATDPRLILLDEP
FT                   FAGVDPIAVLDIQKIIRFLKERGIGVLITDHNVRETLGICDRAAIISEGRVLASGQPRE
FT                   IIDNEKVRQVYLGEHFRL"
FT   CDS_pept        complement(543499..543948)
FT                   /transl_table=11
FT                   /gene="recX"
FT                   /locus_tag="azo0506"
FT                   /product="probable RecX-family regulatory protein"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /note="Regulatory protein recX. Modulates recA activity (By
FT                   similarity). TREMBL: Q7WKM9: 45% identity, 63% similarity
FT                   InterPro: RecX regulatory protein InterPro; IPR003783;
FT                   RecX. Pfam: PF02631; RecX PPR: pentatricopeptide repeat
FT                   domain No transmembrane helices present"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0506"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93123"
FT                   /db_xref="GOA:A1K2R8"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2R8"
FT                   /protein_id="CAL93123.1"
FT                   /translation="MGEPSLRERAIRHLARREHSRSELARKLAAHGDADAVAEVLARMD
FT                   ELGLQSDTRFAEAWVRGKAGRFGAARLRNELARRGVAAETIAEALASGCADGDFERARA
FT                   VWQSRFGAAPADAREWARQARFLQNRGFATDVIRKLLKESPDESA"
FT   CDS_pept        complement(543971..545005)
FT                   /transl_table=11
FT                   /gene="recA"
FT                   /locus_tag="azo0507"
FT                   /product="recombinase A"
FT                   /function="RecA/RadA recombinase"
FT                   /note="Recombinase A. Homology to recA of H. seropedicae of
FT                   80% (sprot|RECA_HERSE) Can catalyze the hydrolysis of ATP
FT                   in the presence of single-stranded DNA the ATP-dependent
FT                   uptake of single-stranded DNA by duplex DNA and the
FT                   ATP-dependent hybridization of homologous single-stranded
FT                   DNAs. It interacts with lexA causing its activation and
FT                   leading to its autocatalytic cleavage (By similarity).
FT                   InterPro: RecA bacterial DNA recombination protein mobB:
FT                   molybdopterin-guanine dinucleotid"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0507"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93124"
FT                   /db_xref="GOA:A1K2R9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1K2R9"
FT                   /protein_id="CAL93124.1"
FT                   /translation="MDDNKAKALAAALSQIEKQFGKGSIMRMGDGNVEKDIQTVSTGSL
FT                   GLDIALGLGGLPRGRVVEIYGPESSGKTTLTLQVVAEMQKLGGTAAFIDAEHALDVGYA
FT                   EKLGVNITDLLISQPDTGEQALEIADMLVRSGGVDVVVIDSVAALTPKAEIEGEMGDQL
FT                   PGLQARLMSQALRKLTANIKRTNTLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVR
FT                   MDIRRTGTIKRGDEVVGSETKVKVVKNKVSPPFKEAHFDILYGEGVSREGEIIDLGVDH
FT                   KIVDKSGAWYAYNGDKIGQGKDNAREFLRANPALAREIENKVRVVLGLKELPVDGAQPA
FT                   AAEA"
FT   CDS_pept        complement(545130..545615)
FT                   /transl_table=11
FT                   /gene="ygaD1"
FT                   /locus_tag="azo0508"
FT                   /product="probable CinA-related protein"
FT                   /function="uncharacterized protein (competence- and
FT                   mitomycin-induced)"
FT                   /note="Hypothetical 17.2 kDa protein 1 in recA 5region.
FT                   TREMBL:Q9KUH9: 54% identity, 64% similarity CinA is the
FT                   first gene in the competence-inducible (cin) operon, and is
FT                   thought to be specifically required at some stage in the
FT                   process of transformation [1]. This is a C-terminal region
FT                   of putative competence-damaged proteins from the cin operon
FT                   InterPro:IPR008136; CinA_C. Pfam: PF02464; CinA cinA_cterm:
FT                   competence/damage-inducible p No signal peptide. No
FT                   transmembrane helices"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0508"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93125"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2S0"
FT                   /protein_id="CAL93125.1"
FT                   /translation="MDTELATLSRQVGDALARRGWLLATAESCTGGWIAEVVTATAGSS
FT                   AWFDRGFVTYSNVAKTEMLGVSAATLGSAGAVSIATVGEMAQGAQARSAAQIAVAVSGV
FT                   AGPTGGSAEKPVGMVCLAWAWGDGQLDAETCHFAGDREAVRRQTVIRALEGVLVRCG"
FT   CDS_pept        complement(545618..546100)
FT                   /transl_table=11
FT                   /locus_tag="azo0509"
FT                   /product="putative phosphatidylglycerophosphatase A"
FT                   /function="Phosphatidylglycerophosphatase A and related
FT                   proteins"
FT                   /EC_number="3.1.3.27"
FT                   /note="Region start changed from 546007 to 546100 (93
FT                   bases)"
FT                   /db_xref="EnsemblGenomes-Gn:azo0509"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93126"
FT                   /db_xref="GOA:A1K2S1"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2S1"
FT                   /protein_id="CAL93126.1"
FT                   /translation="MRPTLRLLLSHPAHFISLGFGAGLSPRAPGTVGTLLGWALFPLLH
FT                   APLADGVFLALLVALFVAGILATERTGRALGVSDHGGIVWDEIVAIWLVLLLTPATLAW
FT                   QAAAVALFRFFDIVKPPPVSWADRRFKGGFGVMLDDLIAAGYTLLVLAALVRLLGA"
FT   CDS_pept        complement(546104..547114)
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="azo0510"
FT                   /product="thiamine-phosphate kinase"
FT                   /function="Thiamine monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /note="Thiamine-phosphate kinase. catalytic activity: atp +
FT                   thiamine phosphate = adp + thiamine diphosphate. pathway:
FT                   thiamine biosynthesis."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0510"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93127"
FT                   /db_xref="GOA:A1K2S2"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2S2"
FT                   /protein_id="CAL93127.1"
FT                   /translation="MPSSAPASRQNAPDAAATTAGEFALIQRHFSRPCGHTALAGGDDA
FT                   ALLHPRPGMELAVSADMLVAGTHFFPDADPHDLGWKTLAVNVSDLAAMGADPRWALLSL
FT                   ALPAADDAWIAAFADGFYACAERFGVDLAGGDTTRGPLTLSVTILGEVPRGQALTRAGA
FT                   NAGDDIWVSGQPGLAALGLEMLRGTFAPTADGERCLAALHRPQPRVALGQALRGLASAA
FT                   LDISDGLLGDLGHILVQSRCGATLHEDALPLAALYATGASPALARRCLLAGGDDYELLF
FT                   CAPPAARAAITALGPALALPLTRIGTLSDAPGTVALRSADGTLTALAARGYDHFG"
FT   CDS_pept        complement(547249..547530)
FT                   /transl_table=11
FT                   /locus_tag="azo0511"
FT                   /product="UPF0125 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0511"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93128"
FT                   /db_xref="InterPro:IPR005346"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="InterPro:IPR037021"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2S3"
FT                   /protein_id="CAL93128.1"
FT                   /translation="MRIGVAYADVAQPVWLKIDVPDTATVQEAIEISGILKAFPQIDLG
FT                   TQKVGIFGKLAKLDAPLKPGDRVEIYRPIICDPSQVPRKNGSDDDEDE"
FT   CDS_pept        complement(547551..548285)
FT                   /transl_table=11
FT                   /gene="rnfE1"
FT                   /locus_tag="azo0512"
FT                   /product="probable electron transport complex protein RnfE"
FT                   /function="predicted NADH:ubiquinone oxidoreductase subunit
FT                   RnfE"
FT                   /note="Probable electron transport complex protein rnfE.
FT                   Homology to rnfE of r. capsulata of 62% (sprot|RNFE_RHOCA).
FT                   Required for nitrogen fixation. May be part of a membrane
FT                   complex functioning as an intermediate in the electron
FT                   transport to nitrogenase. InterPro: RnfA-Nqr electron
FT                   transport subunit ((IPR003667) Pfam: Rnf-Nqr-subunit,
FT                   membran protein no signal peptide 5 TMHs"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0512"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93129"
FT                   /db_xref="GOA:A1K2S4"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR010968"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2S4"
FT                   /protein_id="CAL93129.1"
FT                   /translation="MSEACASAAADGAAKPAPSGPSYASLIKDGLWSNNPVLAQMVALC
FT                   PTLAVTSSATNGLGMGLATTAVLILSNMLISSIRNLVSPNVRIPVFVVVIATLVSLIDM
FT                   SMNAWMYELYQVLGLFIALIVVNCAILGRAEAFASKNTVLSSAVDGLGMGLGFTATLVV
FT                   LGGVREILGSGTLFAGASNMLGSQFAFLELTLIPGYKGFLMMILPPGAFFVIGCLIAAH
FT                   RVLSQRAERRAAAAPGADTAPA"
FT   CDS_pept        complement(548296..548922)
FT                   /transl_table=11
FT                   /gene="rnfG1"
FT                   /locus_tag="azo0513"
FT                   /product="probable electron transport complex protein RnfG"
FT                   /function="predicted NADH:ubiquinone oxidoreductase subunit
FT                   RnfG"
FT                   /note="Probable electron transport complex protein rnfG.
FT                   Homolog to rnfG of R. capsulata of 51% (sprot|RNFG_RHOCA).
FT                   Required for nitrogen fixation. May be part of a membrane
FT                   complex functioning as an intermediate in the electron
FT                   transport to nitrogenase. signal peptide no TMHs"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0513"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93130"
FT                   /db_xref="GOA:A1K2S5"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR010209"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2S5"
FT                   /protein_id="CAL93130.1"
FT                   /translation="MDIAKQFDTLWYQGASLAAVALITGAALAVAYQSAAPRIAEAQMR
FT                   KTQAALAEVLPQGSFDNDLMADTVTIKDAAGREVTVYRARKAGAVTGVVFGMENKGYSG
FT                   TIKLVMGVDLDGRLTGVRVTGHTETPGLGDKIELAKTPWVLGFNGKSLDDPAPALWAVK
FT                   KDGGVFDQFAGATITPRAVVGAVKRGLELYTGNREAMIAAGAPRS"
FT   CDS_pept        complement(548939..549994)
FT                   /transl_table=11
FT                   /gene="rnfD1"
FT                   /locus_tag="azo0514"
FT                   /product="probable electron transport complex protein RnfD"
FT                   /function="predicted NADH:ubiquinone oxidoreductase subunit
FT                   RnfD"
FT                   /note="Probable electron transport complex protein rnfD.
FT                   Homology to rnfD of R. capsulatus of 42%
FT                   (sprot|RNFD_RHOCA). Required for nitrogen fixation. May be
FT                   part of a membrane complex functioning as an intermediate
FT                   in the electron transport to nitrogenase (By similarity).
FT                   InterPro: NQR2 and RnfD/E related proteins (IPR004338)
FT                   Pfam: NQR2, RnfD, RnfE family no signal peptide probable 7
FT                   TMHs"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0514"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93131"
FT                   /db_xref="GOA:A1K2S6"
FT                   /db_xref="InterPro:IPR004338"
FT                   /db_xref="InterPro:IPR011303"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2S6"
FT                   /protein_id="CAL93131.1"
FT                   /translation="MNAISSPHAHGARKVGRVMTLVMLALVPATLAGFWRFGWPAVYLW
FT                   LVTLLSCLLAEAFSTRIRGIDTRRALFDGSAVLTGWLLALSLPPWAPWWIGALGGAFAI
FT                   IVTKHLFGGLGQNLFNPAMAARVMLLISFPVEMTQWLLPTPETLPGAIEALSITFGAGV
FT                   PDAMSSASLLGHVKSEATKGILLGQSLTGHYSAAAFGLGDRQGSLGETSALLLLAGGVF
FT                   LIFQRIITARIPLAFLAGVAAPAALASAIAPDLYLGPLTHLLSGGVMLAAFFIATDYVT
FT                   SPSTPLGQWIFGIGCGLLTWIIRTWGAYPEGIAFAVMLMNATAPLIDQYTRPRIFGRSR
FT                   DGRALNPAESR"
FT   CDS_pept        complement(549991..551550)
FT                   /transl_table=11
FT                   /gene="rnfC1"
FT                   /locus_tag="azo0515"
FT                   /product="probable electronen transport complex protein
FT                   RnfC"
FT                   /function="predicted NADH:ubiquinone oxidoreductase subunit
FT                   RnfC"
FT                   /note="Probable electron transport complex protein RnfC.
FT                   Homology to rnfC of R. capsulatus of 48% (sprot|RNFC_RHOCA)
FT                   Required for nitrogen fixation. May be part of a membrane
FT                   complex functioning as an intermediate in the electron
FT                   transport to nitrogenase. Stabilizes rnfB. InterPro:
FT                   Respiratory-chain NADH dehydrogenase 51 Kd subunit
FT                   (IPR001949); 4Fe-4S ferredoxin, iron-sulfur bidning domain
FT                   (IPR001450) Pfam: Respiratory-chain NADH dehydrogenase;
FT                   4Fe-4S binding domain no signal peptide no TMHs"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0515"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93132"
FT                   /db_xref="GOA:A1K2S7"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR010208"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR026902"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2S7"
FT                   /protein_id="CAL93132.1"
FT                   /translation="MGSPSIPPLARLARLLNPWGVHPEGRKQLTADTEIALVPLPDRLV
FT                   LPLSQHIGAPARPIVEVGTRVLRNQLLAEAQGAISAPIHAPTSGIVVGIAEVPVPHPSG
FT                   LPGPAILLEPDGADEALPAEHNDPFALSAAEISRRVAEAGIVGMGGATFPAAVKLSLGQ
FT                   KTAIPTLILNGGECEPYLTCDDRLMRDRADQVIDGARIILHAMGGREVLIGVENNKPVA
FT                   IAALEAAAGAFPEVKVVAVPSRYPMGSEKQLIEWLTGREIPAGGRPADIGVMVQNVGTA
FT                   AAIHRAIRFGEPLTRRIVTVSGGGVRTPRNVEVRIGTPLSALLAFCGGLKAEAVRYVMG
FT                   GPMMGLAVQSLEIPVIKGSGGLLALVAGEVGSYGTEDTSAGPCIRCASCVGACPIGLMP
FT                   LDMAALIKHGDLAASVDIGLKDCIGCGTCSYVCPSKIPLVHYFNHAKGELAAQDRNKMK
FT                   QDAIKQLADARTARMEQEAREKAEAAARRKAEREKAKAEAAAKAAAKKAAAPAPASEES
FT                   PA"
FT   CDS_pept        complement(551561..552088)
FT                   /transl_table=11
FT                   /gene="rnfB1"
FT                   /locus_tag="azo0516"
FT                   /product="probable electron transport complex protein RnfB"
FT                   /function="predicted NADH:ubiquinone oxidoreductase subunit
FT                   RnfB"
FT                   /note="Probable electron transport complex protein rnfB.
FT                   Homology to rnfB of R. capsulatus of 48%
FT                   (sprot|RNFB_RHOCA). Required for nitrogen fixation. May be
FT                   part of a membrane complex functioning as an intermediate
FT                   in the electron transport to nitrogenase. Stabilizes rnfC.
FT                   Pfam: 4Fe-4S binding domain signal peptide no TMHs"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0516"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93133"
FT                   /db_xref="GOA:A1K2S8"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR010207"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016463"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2S8"
FT                   /protein_id="CAL93133.1"
FT                   /translation="MLIAVTSVALIGAFCGVALGVAARRFYVEPDSAVAEIEAMMPGSQ
FT                   CGQCGFPGCAGAAAAIVAGEAPVTCCPPGGKALAVALAEKLGITVDTSGMSDDGPRIAG
FT                   VTEEICIGCTKCYKSCPTDAILGAVKQVHTVIRDACTGCAKCEDVCPTGAITLSPIPVT
FT                   QQSWVWPKPVAA"
FT   CDS_pept        complement(552106..552687)
FT                   /transl_table=11
FT                   /gene="rnfA1"
FT                   /locus_tag="azo0517"
FT                   /product="probable electron transport complex protein RnfA"
FT                   /function="predicted NADH:ubiquinone oxidoreductase subunit
FT                   RnfA"
FT                   /note="Probable electron transport complex protein RnfA.
FT                   Homology to rnfA of R. capsultatus of 66% (RNFA_RHOCA).
FT                   Required for nitrogen fixation. May be part of a membrane
FT                   complex functioning as an intermediate in the electron
FT                   transport to nitrogenase. Required for stable existence of
FT                   rnfB and rnfC. InterPro: RnfA-Nqr electron transport
FT                   subunit (IPR003667) Pfam: Rnf-Nqr subunit, membrane protein
FT                   no signal peptide 6 TMHs"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0517"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93134"
FT                   /db_xref="GOA:A1K2S9"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR011293"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1K2S9"
FT                   /protein_id="CAL93134.1"
FT                   /translation="MSEWLMLLLGTALVNNVVLVKFLGLCPFMGVSKKVDSAIGMGMAT
FT                   TFVLTLASALTWLIEHFLLVPFDFGYLRILSFILVIAATVQFVEMVIKKTAPDLYKVLG
FT                   IYLPLITTNCAVLGVALLNAGEGAGFVRSVLYGFGSALGFTMVMVLFAGLRERLALTSV
FT                   PAAFSGAPISFITAGLLSLAFMGFAGLTNH"
FT   CDS_pept        553036..554607
FT                   /transl_table=11
FT                   /gene="nifL"
FT                   /locus_tag="azo0518"
FT                   /product="nitrogen fixation regulatory protein"
FT                   /function="FOG: PAS/PAC domain"
FT                   /EC_number="2.7.13.1"
FT                   /note="Nitrogen fixation regulatory protein (EC 2.7.3.-).
FT                   Required for the inhibition of nifA activity in response to
FT                   oxygen and low level of fixed nitrogen. Similar to
FT                   SWISSPROT: sprot|NIFL_AZOVI (41% Azotobacter
FT                   vinelandii,nitrogen fixation regulatory protein (EC
FT                   2.7.3.-), NifL) InterPro: IPR003661 His_kinA_N. The
FT                   histidine kinase A (phosphoacceptor) N-terminal domain is a
FT                   dimerisation and phosphoacceptor domain of histidine
FT                   kinases. It has been found in bacterial sensor
FT                   protein/histidine kinases. IPR000014 PAS. PAS domains are
FT                   involved in many signalling proteins where they are used as
FT                   a signal sensor domain. IPR000700 PAS-assoc_C. IPR004358
FT                   Bact_sens_pr_C. IPR003594 ATPbind_ATPase. Pfam: PF00512
FT                   HisKA. PF00989 PAS. PF00785 PAC. TIGRFAM: TIGR00229 PAS
FT                   domain S-box."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0518"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93135"
FT                   /db_xref="GOA:A1K2T0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR014285"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2T0"
FT                   /protein_id="CAL93135.1"
FT                   /translation="MHEIIMPAPVPTPTIFADAIFHYAVEQSAIAISITDQHANILYVN
FT                   PAFCAITGYAAHEVVGHKQSLLSYKSTPKVVYQELWGALKKGRSWTGRLLNRRRDGSPY
FT                   VAELTVTPLKTPEHEDEDINYLGMHWDATEEHRLSRQLANHKQLIESVISVAPVAVALL
FT                   DVDGRVVLDNPAYKRIVAEMKVDEPAHAVIESLRHNLGDSFEKAFASRRALLNQEVRFD
FT                   RAGGEPRWYACSLSWFEEHHTSPDAFYGDGCSDYMLLVMHDISASKRQQEALRLAAMRA
FT                   MLSEGELNQSLREALAGAVFQLQGPVNLISAAAGLQRRRAGPGAGSDPLARALSEAQRA
FT                   GEEAIATLQAAMPPEPEEPSGPVNLNEVLRDVLMLETDALLSAGITVDWHPAHVLPTVQ
FT                   GDPTALRTLFRQLVSNAIEAMNVRGWKERALVLRTSTQNGQVDVEVTDTGPGIPEALRL
FT                   KVFEPFFSTKKARAAGRGVGLSLAQEIVTRHRGMLEIDPEYSGGCRLRISFPALRSAPL
FT                   DLEGGR"
FT   CDS_pept        554604..556157
FT                   /transl_table=11
FT                   /gene="nifA"
FT                   /locus_tag="azo0519"
FT                   /product="nif-specific regulatory protein"
FT                   /function="Transcriptional regulator containing GAF
FT                   AAA-type ATPase and DNA binding domains"
FT                   /note="Nif-specific regulatory protein. NIFA A
FT                   TRANSCRIPTIONAL ACTIVATOR IS REQUIRED FOR ACTIVATION OF
FT                   MOST NIF OPERONS WHICH ARE DIRECTLY INVOLVED IN NITROGEN
FT                   FIXATION. NIFA INTERACTS WITH SIGMA-54. InterPro: Sigma-54
FT                   factor interaction domain"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0519"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93136"
FT                   /db_xref="GOA:A1K2T1"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010113"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2T1"
FT                   /protein_id="CAL93136.1"
FT                   /translation="MSAAGPMPAAEERVAWLEATLEALYRVSRVLSRSLELRETLSEVL
FT                   RVLDEECGFNRALVTLNEPDGESMAISALHGVDAPIDPDIRWRSGEGVIGSTQQRSRPL
FT                   VVARLADDPNFLSRRGLFDGEAPFIGAPIRAGHETVGVLALQPSPTSREHLDDYAHFAE
FT                   MVANLVGQTVRLSCQVRQERRDIAEERDNLRRTVRNRFGFDNIVGHTQRMRQVFEQIRQ
FT                   VAKWNTTVLVRGETGTGKELIAQAIHYNSPRAAGPFVKLNCAALPENLLESELFGHEKG
FT                   AFTGALTQRKGRFEMADGGTLFLDEIGEISASFQAKLLRVLQEGELERVGGARTLRVDV
FT                   RVIAATNRDLELEVEAGKFREDLYYRLNVMPIMLPPLRERVEDIPEIARFLVEKVSGQQ
FT                   GRPLSITDSALRILLHHAWPGNVRELENCIERAAVMSEDGTIDRDLILISGIEERVTPL
FT                   RGGGGTVDLDDPGLDERERVIAALEQAGWVQAKAARLLGMTPRQIAYRIQTLNIKVRQI
FT                   "
FT   CDS_pept        complement(556202..557770)
FT                   /transl_table=11
FT                   /locus_tag="azo0520"
FT                   /product="conserved hypothetical secreted protein"
FT                   /note="Conserved hypothetical secreted protein. Homology to
FT                   Gmet02000900 of Geobacter metallireducens of 45%
FT                   (gi|48846570|ref|ZP_00300831.1|(NBCI ENTREZ)). No domains
FT                   predicted. Signal peptide present. No TMH reported
FT                   present."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:azo0520"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93137"
FT                   /db_xref="InterPro:IPR024453"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2T2"
FT                   /protein_id="CAL93137.1"
FT                   /translation="MRPNAPRLSTPLRRAAAILCLAACGSAGAVADLGAIAAAADIDDI
FT                   SAPCRALPAALEPALARAEMTQQLAAYQQLSEEALAMRAEAIRLFHALKARSARGEALS
FT                   GADLQRLHAGAAALLAQRRSLLQTAFAHECWLDAPAATDPALAAVQHAGILMSLAAALT
FT                   LYDNYLLAISLYQDDSVLRLKLNRGDRGFALDRGELDRITRAFASPENRRRVRRGIDWF
FT                   ERNRSTASAEAIDGSAYLGALIAQSPSYQMVREASPLAELGAHFGIFRVATADTLATLR
FT                   DESLNLYSLLFGNTVGLVETRRGKLDRRADVEARVAGTLRAGDILLEKTPFRLTDTFIP
FT                   GHWGHAAIWVGDEAELRALGIWEHPLVQAHAAQIRAGRGVVEALRSGVEMNPLAHFLNI
FT                   DDLAVLRADTMTPEGRVAVVLQALRQVGKAYDFNFDAESTQRVFCSKLVYLAYGDMQWP
FT                   TARIFGRVTVSPDNIAARATGDGPLSVALLYHDGEEVSRAPRALMEKLVPTAAPSLARS
FT                   EATLR"
FT   CDS_pept        complement(557796..558329)
FT                   /transl_table=11
FT                   /locus_tag="azo0521"
FT                   /product="hypothetical secreted protein"
FT                   /note="Hypothetical secreted protein. No Hits in the PDB.
FT                   No domains predicted. No TMHs. Signal peptide present."
FT                   /db_xref="EnsemblGenomes-Gn:azo0521"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93138"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2T3"
FT                   /protein_id="CAL93138.1"
FT                   /translation="MSPRRRPCRAAAVLLAALLTGPATAAPGAALGARGIGPLQLGAPL
FT                   QAAAAQALPLDPAAALVGPGCDSRDQVTIRVRSAGLDFEVMAMARADGRIEEVIALPQP
FT                   ASAQAADAPACRARVADLAARLAPALGQSRRESHERKPVSEEFQFHFPGAARAVARWFP
FT                   GGRSCDLALVFNLP"
FT   CDS_pept        complement(558326..558853)
FT                   /transl_table=11
FT                   /gene="sodC"
FT                   /locus_tag="azo0522"
FT                   /product="superoxide dismutase"
FT                   /function="Cu/Zn superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /note="Superoxide dismutase [Cu-Zn]precursor (EC 1.15.1.1),
FT                   sodC.Destroys radicals which are normally produced within
FT                   the cells and which are toxic to biological systems. May
FT                   function against extracytoplasmic toxic oxygen species. 45%
FT                   SOD_CU_ZN.Copper/Zinc superoxide dismutase. Pfam: PF00080;
FT                   sodcu; 1. TIGR:CC1579. Signal peptide: present."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0522"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93139"
FT                   /db_xref="GOA:A1K2T4"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR036423"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2T4"
FT                   /protein_id="CAL93139.1"
FT                   /translation="MPFAKTVAALALAACATHALAADRATAELIDRQGKAIGTATLTEG
FT                   PAGVLIHVSAKGLAAGPKGIHIHSVGTCEDADKGFVASKGHLNPTGKKHGLLNPEGPDA
FT                   GDLPVIFVHADGSVEAELYTPLASIKGAGERAALLDADGAALVIHESRDDHSTQPIGGA
FT                   GARIACGVVKGE"
FT   CDS_pept        559180..560676
FT                   /transl_table=11
FT                   /gene="nifB"
FT                   /locus_tag="azo0523"
FT                   /product="nitrogen fixation protein"
FT                   /function="predicted Fe-S oxidoreductases"
FT                   /note="FeMo cofactor biosynthesis protein nifB. PROBABLY
FT                   INVOLVED IN THE SYNTHESIS OF THE FE-MO COFACTOR."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0523"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93140"
FT                   /db_xref="GOA:A1K2T5"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR005980"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034165"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2T5"
FT                   /protein_id="CAL93140.1"
FT                   /translation="MELPVISNTAPESSGGGCSSSGCGTAPDALSHLPDSIRSKVQDHP
FT                   CYSEEAHHYFARMHVAVAPACNIQCNYCNRKYDCSNESRPGVVSEVMSPDQAVKKTLAV
FT                   AAAIPQMTVLGIAGPGDPLANPERTFETFRRLSEEAPDIKLCVSTNGLSLPESVDELAK
FT                   HNIDHVTITINCVDPEIGAKIYPWIFWENKRIFGVEGAKILIEQQQKGLEMLTSRGILV
FT                   KVNSVMIPGINDEHLKEVSKIVKAKGAFLHNVMPLIAEAEHGTYFGIMGQREPTPLELE
FT                   ALQDSCSGDMSMMRHCRQCRADAVGLLGEDRGAEFTIDKIEEMEIDYAAAMVERAKVHD
FT                   AITSELEMKRALKAAPKFNPEAGEEKPATRPIRIAIASKGGGLVNEHFGHAHEFLVYEV
FT                   GPTSHRFLTHRKCTPYCMGDESCGDGETVLGQIIKSLEGVEVLLASKIGFEPWADLEKA
FT                   GIQPNGEHAMEPIEEAIRAVYDELAAAGKLDMPAEAKAAA"
FT   CDS_pept        560794..561084
FT                   /transl_table=11
FT                   /locus_tag="azo0524"
FT                   /product="conserved hypothetical ferredoxin"
FT                   /function="Ferredoxin"
FT                   /note="Conserved hypothetical ferredoxin. Homology to fdx
FT                   of P. stuzeri of 57% (trembl|Q93JV5). Ferredoxins are
FT                   iron-sulfur proteins that transfer electrons in a wide
FT                   variety of metabolic reactions. InterPro: 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain (IPR001450) Pfam: 4FE-4S binding
FT                   domain no signal peptide no TMHs"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0524"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93141"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2T6"
FT                   /protein_id="CAL93141.1"
FT                   /translation="MALEITEVCVGCYACEPLCPNKAISAGNPVFTIDPDKCTECLGDY
FT                   DKPQCAEICPIEAAIVDEIGDPLNPLGSLTGIPIHLIEEYNTTGTVARPGV"
FT   CDS_pept        561181..561630
FT                   /transl_table=11
FT                   /locus_tag="azo0525"
FT                   /product="conserved hypothetical protein"
FT                   /note="Conserved hypothetical protein. Homology to an orf
FT                   of P. stuzeri of 49% (trembl|Q93JV4). Tigrfam: arsC:
FT                   arsenate reductase. Pfam: ArsC family (PF03960) no signal
FT                   peptide. no TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:azo0525"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93142"
FT                   /db_xref="InterPro:IPR006503"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2T7"
FT                   /protein_id="CAL93142.1"
FT                   /translation="MTTTMQIRFWWKPGCATNTRQIRLLKDAGCEVTVLDLLTEPWTPA
FT                   RLAGFLARKPVAEWFNPAAPAVKSGAVVPAAFSPEAALERLVAEPILIRRPLIEIGHAR
FT                   CSGFAPDWLAAQGVALAPEAPVPEGCSHGDAPAAFCPPPAVASPS"
FT   CDS_pept        561627..562916
FT                   /transl_table=11
FT                   /gene="fprA"
FT                   /locus_tag="azo0526"
FT                   /product="probable type A flavoprotein"
FT                   /function="uncharacterized flavoproteins"
FT                   /note="Probable type A flavoprotein fprA . Homology to frpA
FT                   of R. capsulatus of 58% (sprot|FPRA_RHOCA) Low-potential
FT                   electron donor to a number of redox enzymes (Potential).
FT                   InterPro: Metallo-beta-lactamase superfamily (IPR001279);
FT                   Flavodoxin (IPR001226) Pfam: Metallo-beta-lactamase
FT                   superfamily; Flavodoxin no singal peptide no TMHs"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0526"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93143"
FT                   /db_xref="GOA:A1K2T8"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR016440"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2T8"
FT                   /protein_id="CAL93143.1"
FT                   /translation="MNTPGAVPPDKAVAVAPGVHWVGALDPDLRQFDIILRTANGTSYN
FT                   AYAIRGTAGVAVVDTVKAEYADVFFQRLWSCCRPEEIKAIVLNHLEPDHSGALPELLRA
FT                   APQAPLYISRPAFAMLKGILKDGLDPSRIIATEPETRVELGGRSLRFLQTPYLHWPDTQ
FT                   CTWVEEDGFLFSGDVFGCHFCDPRLFNDKVGDFRFSFDYYYQHIMRPFREHVLTALKLV
FT                   EPLTLRLIAPAHGPVLRDAPQTYVRRYRQLATPQLQNEAAERAKTLLVFYISAYGNTQQ
FT                   MAHAVREGAESVDGVRVSLYDLAGGETAPFVDLIEEADGLVFGSPTINGDAVKPVWDLL
FT                   SSLTLVNVRGKFGAAFGSYGWSGEAVGLIEDRLRGLKLRVPRPGVKVKLIPTAEELAEC
FT                   ATLGRELAEQLTGKAGPRHIDFSALHARSA"
FT   CDS_pept        562926..563213
FT                   /transl_table=11
FT                   /gene="fdxC"
FT                   /locus_tag="azo0527"
FT                   /product="probable ferredoxin IV"
FT                   /function="Ferredoxin"
FT                   /note="Ferredoxin IV (FdIV) (Ferredoxin plant-type).
FT                   Homology to fdxC of R. capsulatus of 62% (FER4_RHOCA).
FT                   FERREDOXINS ARE IRON-SULFUR PROTEINS THAT TRANSFER
FT                   ELECTRONS IN A WIDE VARIETY OF METABOLIC REACTIONS. THIS
FT                   FERREDOXIN PROBABLY PARTICIPATES IN NITROGEN FIXATION.
FT                   Pfam: 2Fe-2S iron-sulfur clauster binding domain no signal
FT                   peptide no TMHs"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0527"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93144"
FT                   /db_xref="GOA:A1K2T9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2T9"
FT                   /protein_id="CAL93144.1"
FT                   /translation="MPKAQVTFEDIEVTVTVPAGTRLIEVSEKIGAGITYGCREGECGT
FT                   CMMKIVSGSEHLANPSVLEDKVLKDNFAGVANRLACQAQVLGGHVVVRPG"
FT   CDS_pept        563265..563615
FT                   /transl_table=11
FT                   /gene="fdxD"
FT                   /locus_tag="azo0528"
FT                   /product="Ferredoxin V"
FT                   /function="2-polyprenylphenol hydroxylase and related
FT                   flavodoxin oxidoreductases"
FT                   /note="Ferredoxin V (FdV) (Ferredoxin plant-type).
FT                   FERREDOXINS ARE IRON-SULFUR PROTEINS THAT TRANSFER
FT                   ELECTRONS IN A WIDE VARIETY OF METABOLIC REACTIONS. THIS
FT                   FERREDOXIN PROBABLY PARTICIPATES IN NITROGEN FIXATION.
FT                   InterPro: Ferredoxin"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:azo0528"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93145"
FT                   /db_xref="GOA:A1K2U0"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2U0"
FT                   /protein_id="CAL93145.1"
FT                   /translation="MPNITFSSPIHKDKTVYAVTGSHTNTILKVAKENHIPIDFSCEDG
FT                   ECATCLVKVTSLTRKGKMAGPLTDKEVAVLKEHKKITAEEIERMRVEDVPTTPWRLACQ
FT                   LVLRDEDLLVEY"
FT   CDS_pept        563680..564255
FT                   /transl_table=11
FT                   /gene="nifQ"
FT                   /locus_tag="azo0529"
FT                   /product="putative NifQ protein"
FT                   /note="Putative NifQ protein. Homology to nifQ of A.
FT                   vinelandii of 33% (sprot|NIFQ_AZOVI(SRS) NifQ is involved
FT                   in early stages of the biosynthesis of the iron-molybdenum
FT                   cofactor (FeMo-co), which is an integral part of the active
FT                   site of dinitrogenase [2]. The conserved C-terminal
FT                   cysteine residues may be involved in metal binding. Pfam:
FT                   NifQ no signal peptide no TMHs"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:azo0529"
FT                   /db_xref="EnsemblGenomes-Tr:CAL93146"
FT                   /db_xref="GOA:A1K2U1"
FT                   /db_xref="InterPro:IPR006975"
FT                   /db_xref="UniProtKB/TrEMBL:A1K2U1"
FT                   /protein_id="CAL93146.1"
FT                   /translation="MLAPLNHRPTPARLALHAHLMRHAAGTPNDEFIAHLIAGWTLGDG
FT                   VLPADLGLGASRFARLMAVHFPGLAWEPKPDHGPALVLYPEFDDLVRFIGAHADPTVAG
FT                   ADDMTLVLATACMGSDHLWQDLGLPSRRELSQLIALNFPELGALNNRDMKWKKFLYREL
FT                   CQREGIFVCASPSCESCADYANCFGPEV"
FT   CDS_pept        564301..565239
FT                   /transl_table=11
FT                   /gene="draG1"
FT                   /locus_tag="azo0530"
FT                   /product="probable ADP-ribosyl-[dinitrogen reductase]
FT                   hydrolase"
FT                   /function="ADP-ribosylglycohydrolase"
FT                   /EC_number="3.2.2.24"
FT                   /note="Probable ADP-ribosyl-[dinitrogen reductase]
FT                   hydrolase. Homology to draG of R. rubrum of 44%
FT                   (sprot|DRAG_RHORU) Involved in the regulation of the
FT                   nitrogen fixation activity by the reversible
FT                   ADP-ribosylation of the dinitrogenase reductase component
FT                   of the nitrogenase enzyme complex. T