(data stored in ACNUC29543 zone)

EMBL: AM408590

ID   AM408590; SV 1; circular; genomic DNA; STD; PRO; 4374522 BP.
XX
AC   AM408590;
XX
PR   Project:PRJEA18059;
XX
DT   08-JAN-2007 (Rel. 90, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 4)
XX
DE   Mycobacterium bovis BCG Pasteur 1173P2, complete genome
XX
KW   complete genome.
XX
OS   Mycobacterium tuberculosis variant bovis BCG str. Pasteur 1173P2
OC   Bacteria; Actinobacteria; Corynebacteriales; Mycobacteriaceae;
OC   Mycobacterium; Mycobacterium tuberculosis complex.
XX
RN   [1]
RP   1-4374522
RA   Garnier T.;
RT   ;
RL   Submitted (23-OCT-2006) to the INSDC.
RL   Garnier T., Unite Genetique Moleculaire Bacterienne, Institut Pasteur,
RL   28,rue du Dr ROUX, PARIS, 75015, FRANCE. Garnier T., submitted on behalf of
RL   the Mycobacterium bovis sequencing teams, TB Research Group, Veterinary
RL   Laboratories Agency Weybridge, Woodham Lane, New Haw,Addlestone, Surrey
RL   KT15 3NB, UK. Sanger Centre, Wellcome Trust Genome Campus,
RL   Hinxton,Cambridge CB10 1SA, UK. PT4 Annotation, Genopole, Institut Pasteur,
RL   28 Rue du Docteur Roux, 75724 Paris Cedex 15, France. Unite de Genetique
RL   Moleculaire Bacterienne, Institut Pasteur, 28 rue du Docteur Roux, 75724
RL   Paris Cedex 15, France.
XX
RN   [2]
RX   DOI; 10.1073/pnas.0700869104.
RX   PUBMED; 17372194.
RA   Brosch R., Gordon S.V., Garnier T., Eiglmeier K., Frigui W., Valenti P.,
RA   Dos Santos S., Duthoy S., Lacroix C., Garcia-Pelayo C., Inwald J.K.,
RA   Golby P., Garcia J.N., Hewinson R.G., Behr M.A., Quail M.A., Churcher C.,
RA   Barrell B.G., Parhill J., Cole S.T.;
RT   "Genome plasticity of BCG and impact on vaccine efficacy";
RL   Proc. Natl. Acad. Sci. U.S.A. 104(13):5596-5601(2007).
XX
DR   MD5; ea1f0c8222432122131ca1dd9fcc7c99.
DR   BioSample; SAMEA2272684.
DR   EnsemblGenomes-Gn; BCG_0014c.
DR   EnsemblGenomes-Gn; BCG_0015.
DR   EnsemblGenomes-Gn; BCG_0017.
DR   EnsemblGenomes-Gn; BCG_0055.
DR   EnsemblGenomes-Gn; BCG_0168.
DR   EnsemblGenomes-Gn; BCG_0169.
DR   EnsemblGenomes-Gn; BCG_0170.
DR   EnsemblGenomes-Gn; BCG_0202c.
DR   EnsemblGenomes-Gn; BCG_0316c.
DR   EnsemblGenomes-Gn; BCG_0576.
DR   EnsemblGenomes-Gn; BCG_0593c.
DR   EnsemblGenomes-Gn; BCG_0638.
DR   EnsemblGenomes-Gn; BCG_0676c.
DR   EnsemblGenomes-Gn; BCG_0873.
DR   EnsemblGenomes-Gn; BCG_1099c.
DR   EnsemblGenomes-Gn; BCG_1211.
DR   EnsemblGenomes-Gn; BCG_1230c.
DR   EnsemblGenomes-Gn; BCG_1843.
DR   EnsemblGenomes-Gn; BCG_1875c.
DR   EnsemblGenomes-Gn; BCG_1956c.
DR   EnsemblGenomes-Gn; BCG_2104.
DR   EnsemblGenomes-Gn; BCG_2445c.
DR   EnsemblGenomes-Gn; BCG_2446c.
DR   EnsemblGenomes-Gn; BCG_2505c.
DR   EnsemblGenomes-Gn; BCG_2828c.
DR   EnsemblGenomes-Gn; BCG_2836c.
DR   EnsemblGenomes-Gn; BCG_2853A.
DR   EnsemblGenomes-Gn; BCG_3332c.
DR   EnsemblGenomes-Gn; BCG_3355c.
DR   EnsemblGenomes-Gn; BCG_3416c.
DR   EnsemblGenomes-Gn; BCG_3420c.
DR   EnsemblGenomes-Gn; BCG_3421c.
DR   EnsemblGenomes-Gn; BCG_3798c.
DR   EnsemblGenomes-Gn; BCG_3956c.
DR   EnsemblGenomes-Gn; BCG_3969.
DR   EnsemblGenomes-Gn; EBG00001157312.
DR   EnsemblGenomes-Gn; EBG00001157313.
DR   EnsemblGenomes-Gn; EBG00001157314.
DR   EnsemblGenomes-Gn; EBG00001157315.
DR   EnsemblGenomes-Gn; EBG00001157316.
DR   EnsemblGenomes-Gn; EBG00001157317.
DR   EnsemblGenomes-Gn; EBG00001157318.
DR   EnsemblGenomes-Gn; EBG00001157319.
DR   EnsemblGenomes-Gn; EBG00001157320.
DR   EnsemblGenomes-Gn; EBG00001157321.
DR   EnsemblGenomes-Gn; EBG00001157322.
DR   EnsemblGenomes-Gn; EBG00001157323.
DR   EnsemblGenomes-Gn; EBG00001157324.
DR   EnsemblGenomes-Gn; EBG00001157325.
DR   EnsemblGenomes-Gn; EBG00001157326.
DR   EnsemblGenomes-Gn; EBG00001157327.
DR   EnsemblGenomes-Gn; EBG00001157328.
DR   EnsemblGenomes-Gn; EBG00001157329.
DR   EnsemblGenomes-Gn; EBG00001157330.
DR   EnsemblGenomes-Gn; EBG00001157331.
DR   EnsemblGenomes-Gn; EBG00001157332.
DR   EnsemblGenomes-Gn; EBG00001157333.
DR   EnsemblGenomes-Gn; EBG00001157334.
DR   EnsemblGenomes-Gn; EBG00001157335.
DR   EnsemblGenomes-Gn; EBG00001157336.
DR   EnsemblGenomes-Gn; EBG00001157337.
DR   EnsemblGenomes-Gn; EBG00001157338.
DR   EnsemblGenomes-Gn; EBG00001157339.
DR   EnsemblGenomes-Gn; EBG00001157340.
DR   EnsemblGenomes-Gn; EBG00001157341.
DR   EnsemblGenomes-Gn; EBG00001157342.
DR   EnsemblGenomes-Gn; EBG00001157343.
DR   EnsemblGenomes-Gn; EBG00001157344.
DR   EnsemblGenomes-Gn; EBG00001157345.
DR   EnsemblGenomes-Gn; EBG00001157346.
DR   EnsemblGenomes-Gn; EBG00001157347.
DR   EnsemblGenomes-Gn; EBG00001157348.
DR   EnsemblGenomes-Gn; EBG00001157349.
DR   EnsemblGenomes-Gn; EBG00001157350.
DR   EnsemblGenomes-Gn; EBG00001157351.
DR   EnsemblGenomes-Gn; EBG00001157352.
DR   EnsemblGenomes-Gn; EBG00001157353.
DR   EnsemblGenomes-Gn; EBG00001157354.
DR   EnsemblGenomes-Gn; EBG00001157355.
DR   EnsemblGenomes-Gn; EBG00001157356.
DR   EnsemblGenomes-Gn; EBG00001157357.
DR   EnsemblGenomes-Gn; EBG00001157358.
DR   EnsemblGenomes-Gn; EBG00001157359.
DR   EnsemblGenomes-Gn; EBG00001157360.
DR   EnsemblGenomes-Gn; EBG00001157361.
DR   EnsemblGenomes-Gn; EBG00001157362.
DR   EnsemblGenomes-Gn; EBG00001157363.
DR   EnsemblGenomes-Gn; EBG00001157364.
DR   EnsemblGenomes-Gn; EBG00001157365.
DR   EnsemblGenomes-Gn; EBG00001157366.
DR   EnsemblGenomes-Gn; EBG00001157367.
DR   EnsemblGenomes-Gn; EBG00001157368.
DR   EnsemblGenomes-Gn; EBG00001157369.
DR   EnsemblGenomes-Gn; EBG00001157370.
DR   EnsemblGenomes-Gn; EBG00001157371.
DR   EnsemblGenomes-Gn; EBG00001157372.
DR   EnsemblGenomes-Gn; EBG00001157373.
DR   EnsemblGenomes-Gn; EBG00001157374.
DR   EnsemblGenomes-Gn; EBG00001157375.
DR   EnsemblGenomes-Gn; EBG00001157376.
DR   EnsemblGenomes-Gn; EBG00001157377.
DR   EnsemblGenomes-Gn; EBG00001157378.
DR   EnsemblGenomes-Gn; EBG00001157379.
DR   EnsemblGenomes-Gn; EBG00001157380.
DR   EnsemblGenomes-Gn; EBG00001157381.
DR   EnsemblGenomes-Gn; EBG00001157382.
DR   EnsemblGenomes-Gn; alaT_1.
DR   EnsemblGenomes-Gn; alaT_2.
DR   EnsemblGenomes-Gn; alaU.
DR   EnsemblGenomes-Gn; alaV.
DR   EnsemblGenomes-Gn; argT.
DR   EnsemblGenomes-Gn; argU.
DR   EnsemblGenomes-Gn; argV.
DR   EnsemblGenomes-Gn; argW.
DR   EnsemblGenomes-Gn; asnT.
DR   EnsemblGenomes-Gn; aspT.
DR   EnsemblGenomes-Gn; cysU.
DR   EnsemblGenomes-Gn; glnT.
DR   EnsemblGenomes-Gn; glnU.
DR   EnsemblGenomes-Gn; gluT.
DR   EnsemblGenomes-Gn; gluU.
DR   EnsemblGenomes-Gn; glyT.
DR   EnsemblGenomes-Gn; glyU.
DR   EnsemblGenomes-Gn; glyV.
DR   EnsemblGenomes-Gn; hisT.
DR   EnsemblGenomes-Gn; ileT_1.
DR   EnsemblGenomes-Gn; ileT_2.
DR   EnsemblGenomes-Gn; leuT.
DR   EnsemblGenomes-Gn; leuU.
DR   EnsemblGenomes-Gn; leuV.
DR   EnsemblGenomes-Gn; leuW.
DR   EnsemblGenomes-Gn; leuX.
DR   EnsemblGenomes-Gn; lysT.
DR   EnsemblGenomes-Gn; lysU.
DR   EnsemblGenomes-Gn; metT.
DR   EnsemblGenomes-Gn; metU.
DR   EnsemblGenomes-Gn; metV.
DR   EnsemblGenomes-Gn; pheU.
DR   EnsemblGenomes-Gn; proT.
DR   EnsemblGenomes-Gn; proU.
DR   EnsemblGenomes-Gn; proY.
DR   EnsemblGenomes-Gn; rrf.
DR   EnsemblGenomes-Gn; rrl.
DR   EnsemblGenomes-Gn; rrs.
DR   EnsemblGenomes-Gn; serT.
DR   EnsemblGenomes-Gn; serU.
DR   EnsemblGenomes-Gn; serV.
DR   EnsemblGenomes-Gn; serX.
DR   EnsemblGenomes-Gn; thrT.
DR   EnsemblGenomes-Gn; thrU.
DR   EnsemblGenomes-Gn; thrV.
DR   EnsemblGenomes-Gn; trpT.
DR   EnsemblGenomes-Gn; tyrT.
DR   EnsemblGenomes-Gn; valT.
DR   EnsemblGenomes-Gn; valU.
DR   EnsemblGenomes-Gn; valV.
DR   EnsemblGenomes-Tr; BCG_0014c.
DR   EnsemblGenomes-Tr; BCG_0015.
DR   EnsemblGenomes-Tr; BCG_0017.
DR   EnsemblGenomes-Tr; BCG_0055.
DR   EnsemblGenomes-Tr; BCG_0168.
DR   EnsemblGenomes-Tr; BCG_0169.
DR   EnsemblGenomes-Tr; BCG_0170.
DR   EnsemblGenomes-Tr; BCG_0202c.
DR   EnsemblGenomes-Tr; BCG_0316c.
DR   EnsemblGenomes-Tr; BCG_0576.
DR   EnsemblGenomes-Tr; BCG_0593c.
DR   EnsemblGenomes-Tr; BCG_0638.
DR   EnsemblGenomes-Tr; BCG_0676c.
DR   EnsemblGenomes-Tr; BCG_0873.
DR   EnsemblGenomes-Tr; BCG_1099c.
DR   EnsemblGenomes-Tr; BCG_1211.
DR   EnsemblGenomes-Tr; BCG_1230c.
DR   EnsemblGenomes-Tr; BCG_1843.
DR   EnsemblGenomes-Tr; BCG_1875c.
DR   EnsemblGenomes-Tr; BCG_1956c.
DR   EnsemblGenomes-Tr; BCG_2104.
DR   EnsemblGenomes-Tr; BCG_2445c.
DR   EnsemblGenomes-Tr; BCG_2446c.
DR   EnsemblGenomes-Tr; BCG_2505c.
DR   EnsemblGenomes-Tr; BCG_2828c.
DR   EnsemblGenomes-Tr; BCG_2836c.
DR   EnsemblGenomes-Tr; BCG_2853A.
DR   EnsemblGenomes-Tr; BCG_3332c.
DR   EnsemblGenomes-Tr; BCG_3355c.
DR   EnsemblGenomes-Tr; BCG_3416c.
DR   EnsemblGenomes-Tr; BCG_3420c.
DR   EnsemblGenomes-Tr; BCG_3421c.
DR   EnsemblGenomes-Tr; BCG_3798c.
DR   EnsemblGenomes-Tr; BCG_3956c.
DR   EnsemblGenomes-Tr; BCG_3969.
DR   EnsemblGenomes-Tr; EBT00001745868.
DR   EnsemblGenomes-Tr; EBT00001745869.
DR   EnsemblGenomes-Tr; EBT00001745870.
DR   EnsemblGenomes-Tr; EBT00001745871.
DR   EnsemblGenomes-Tr; EBT00001745872.
DR   EnsemblGenomes-Tr; EBT00001745873.
DR   EnsemblGenomes-Tr; EBT00001745874.
DR   EnsemblGenomes-Tr; EBT00001745875.
DR   EnsemblGenomes-Tr; EBT00001745876.
DR   EnsemblGenomes-Tr; EBT00001745877.
DR   EnsemblGenomes-Tr; EBT00001745878.
DR   EnsemblGenomes-Tr; EBT00001745879.
DR   EnsemblGenomes-Tr; EBT00001745880.
DR   EnsemblGenomes-Tr; EBT00001745881.
DR   EnsemblGenomes-Tr; EBT00001745882.
DR   EnsemblGenomes-Tr; EBT00001745883.
DR   EnsemblGenomes-Tr; EBT00001745884.
DR   EnsemblGenomes-Tr; EBT00001745885.
DR   EnsemblGenomes-Tr; EBT00001745886.
DR   EnsemblGenomes-Tr; EBT00001745887.
DR   EnsemblGenomes-Tr; EBT00001745888.
DR   EnsemblGenomes-Tr; EBT00001745889.
DR   EnsemblGenomes-Tr; EBT00001745890.
DR   EnsemblGenomes-Tr; EBT00001745891.
DR   EnsemblGenomes-Tr; EBT00001745892.
DR   EnsemblGenomes-Tr; EBT00001745893.
DR   EnsemblGenomes-Tr; EBT00001745894.
DR   EnsemblGenomes-Tr; EBT00001745895.
DR   EnsemblGenomes-Tr; EBT00001745896.
DR   EnsemblGenomes-Tr; EBT00001745897.
DR   EnsemblGenomes-Tr; EBT00001745898.
DR   EnsemblGenomes-Tr; EBT00001745899.
DR   EnsemblGenomes-Tr; EBT00001745900.
DR   EnsemblGenomes-Tr; EBT00001745901.
DR   EnsemblGenomes-Tr; EBT00001745902.
DR   EnsemblGenomes-Tr; EBT00001745903.
DR   EnsemblGenomes-Tr; EBT00001745904.
DR   EnsemblGenomes-Tr; EBT00001745905.
DR   EnsemblGenomes-Tr; EBT00001745906.
DR   EnsemblGenomes-Tr; EBT00001745907.
DR   EnsemblGenomes-Tr; EBT00001745908.
DR   EnsemblGenomes-Tr; EBT00001745909.
DR   EnsemblGenomes-Tr; EBT00001745910.
DR   EnsemblGenomes-Tr; EBT00001745911.
DR   EnsemblGenomes-Tr; EBT00001745912.
DR   EnsemblGenomes-Tr; EBT00001745913.
DR   EnsemblGenomes-Tr; EBT00001745914.
DR   EnsemblGenomes-Tr; EBT00001745915.
DR   EnsemblGenomes-Tr; EBT00001745916.
DR   EnsemblGenomes-Tr; EBT00001745917.
DR   EnsemblGenomes-Tr; EBT00001745918.
DR   EnsemblGenomes-Tr; EBT00001745919.
DR   EnsemblGenomes-Tr; EBT00001745920.
DR   EnsemblGenomes-Tr; EBT00001745921.
DR   EnsemblGenomes-Tr; EBT00001745922.
DR   EnsemblGenomes-Tr; EBT00001745923.
DR   EnsemblGenomes-Tr; EBT00001745924.
DR   EnsemblGenomes-Tr; EBT00001745925.
DR   EnsemblGenomes-Tr; EBT00001745926.
DR   EnsemblGenomes-Tr; EBT00001745927.
DR   EnsemblGenomes-Tr; EBT00001745928.
DR   EnsemblGenomes-Tr; EBT00001745929.
DR   EnsemblGenomes-Tr; EBT00001745930.
DR   EnsemblGenomes-Tr; EBT00001745931.
DR   EnsemblGenomes-Tr; EBT00001745932.
DR   EnsemblGenomes-Tr; EBT00001745933.
DR   EnsemblGenomes-Tr; EBT00001745934.
DR   EnsemblGenomes-Tr; EBT00001745935.
DR   EnsemblGenomes-Tr; EBT00001745936.
DR   EnsemblGenomes-Tr; EBT00001745937.
DR   EnsemblGenomes-Tr; EBT00001745938.
DR   EnsemblGenomes-Tr; alaT_1-1.
DR   EnsemblGenomes-Tr; alaT_2-1.
DR   EnsemblGenomes-Tr; alaU-1.
DR   EnsemblGenomes-Tr; alaV-1.
DR   EnsemblGenomes-Tr; argT-1.
DR   EnsemblGenomes-Tr; argU-1.
DR   EnsemblGenomes-Tr; argV-1.
DR   EnsemblGenomes-Tr; argW-1.
DR   EnsemblGenomes-Tr; asnT-1.
DR   EnsemblGenomes-Tr; aspT-1.
DR   EnsemblGenomes-Tr; cysU-1.
DR   EnsemblGenomes-Tr; glnT-1.
DR   EnsemblGenomes-Tr; glnU-1.
DR   EnsemblGenomes-Tr; gluT-1.
DR   EnsemblGenomes-Tr; gluU-1.
DR   EnsemblGenomes-Tr; glyT-1.
DR   EnsemblGenomes-Tr; glyU-1.
DR   EnsemblGenomes-Tr; glyV-1.
DR   EnsemblGenomes-Tr; hisT-1.
DR   EnsemblGenomes-Tr; ileT_1-1.
DR   EnsemblGenomes-Tr; ileT_2-1.
DR   EnsemblGenomes-Tr; leuT-1.
DR   EnsemblGenomes-Tr; leuU-1.
DR   EnsemblGenomes-Tr; leuV-1.
DR   EnsemblGenomes-Tr; leuW-1.
DR   EnsemblGenomes-Tr; leuX-1.
DR   EnsemblGenomes-Tr; lysT-1.
DR   EnsemblGenomes-Tr; lysU-1.
DR   EnsemblGenomes-Tr; metT-1.
DR   EnsemblGenomes-Tr; metU-1.
DR   EnsemblGenomes-Tr; metV-1.
DR   EnsemblGenomes-Tr; pheU-1.
DR   EnsemblGenomes-Tr; proT-1.
DR   EnsemblGenomes-Tr; proU-1.
DR   EnsemblGenomes-Tr; proY-1.
DR   EnsemblGenomes-Tr; rrf-1.
DR   EnsemblGenomes-Tr; rrl-1.
DR   EnsemblGenomes-Tr; rrs-1.
DR   EnsemblGenomes-Tr; serT-1.
DR   EnsemblGenomes-Tr; serU-1.
DR   EnsemblGenomes-Tr; serV-1.
DR   EnsemblGenomes-Tr; serX-1.
DR   EnsemblGenomes-Tr; thrT-1.
DR   EnsemblGenomes-Tr; thrU-1.
DR   EnsemblGenomes-Tr; thrV-1.
DR   EnsemblGenomes-Tr; trpT-1.
DR   EnsemblGenomes-Tr; tyrT-1.
DR   EnsemblGenomes-Tr; valT-1.
DR   EnsemblGenomes-Tr; valU-1.
DR   EnsemblGenomes-Tr; valV-1.
DR   EuropePMC; PMC1838518; 17372194.
DR   EuropePMC; PMC2228276; 18081934.
DR   EuropePMC; PMC2277376; 18325090.
DR   EuropePMC; PMC3129352; 21779195.
DR   EuropePMC; PMC3199284; 21981907.
DR   EuropePMC; PMC4191392; 25217589.
DR   EuropePMC; PMC4219376; 24299240.
DR   EuropePMC; PMC4249275; 25287928.
DR   EuropePMC; PMC4365248; 25609722.
DR   EuropePMC; PMC4432585; 25960123.
DR   EuropePMC; PMC4676045; 26668660.
DR   EuropePMC; PMC5293778; 28223967.
DR   EuropePMC; PMC5648229; 29049400.
DR   EuropePMC; PMC6078740; 30045257.
DR   EuropePMC; PMC6156301; 30068538.
DR   EuropePMC; PMC6497762; 31080447.
DR   EuropePMC; PMC6615170; 31286858.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00634; SAM-IV.
DR   RFAM; RF01066; 6C.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01746; mraW.
DR   RFAM; RF01779; AS1726.
DR   RFAM; RF01780; AS1890.
DR   RFAM; RF01781; ASdes.
DR   RFAM; RF01782; ASpks.
DR   RFAM; RF01783; b55.
DR   RFAM; RF01791; F6.
DR   RFAM; RF01798; g2.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02003; group-II-D1D4-4.
DR   SILVA-LSU; AM408590.
DR   SILVA-SSU; AM408590.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4374522
FT                   /organism="Mycobacterium tuberculosis variant bovis BCG
FT                   str. Pasteur 1173P2"
FT                   /sub_species="bovis"
FT                   /strain="BCG Pasteur 1173P2"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:410289"
FT   CDS_pept        1..1524
FT                   /transl_table=11
FT                   /gene="dnaA_1"
FT                   /locus_tag="BCG_0001"
FT                   /product="chromosomal replication initiation protein dnaA"
FT                   /note="Differs from Rv0001 by 1aa, R156N ,and from Mb0001
FT                   by 1aa, V353I"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAL69985"
FT                   /db_xref="GOA:A0A0G2Q9F4"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2Q9F4"
FT                   /protein_id="CAL69985.1"
FT                   /translation="MTDDPGSGFTTVWNAVVSELNGDPKVDDGPSSDANLSAPLTPQQR
FT                   AWLNLVQPLTIVEGFALLSVPSSFVQNEIERHLRAPITDALSRRLGHQIQLGVRIAPPA
FT                   TDEADDTTVPPSENPATTSPDTTTDNDEIDDSAAARGDNQHSWPSYFTERPRNTDSATA
FT                   GVTSLNRRYTFDTFVIGASNRFAHAAALAIAEAPARAYNPLFIWGESGLGKTHLLHAAG
FT                   NYAQRLFPGMRVKYVSTEEFTNDFINSLRDDRKVAFKRSYRDVDVLLVDDIQFIEGKEG
FT                   IQEEFFHTFNTLHNANKQIVISSDRPPKQLATLEDRLRTRFEWGLITDVQPPELETRIA
FT                   ILRKKAQMERLAVPDDVLELIASSIERNIRELEGALIRVTAFASLNKTPIDKALAEIVL
FT                   RDLIADANTMQISAATIMAATAEYFDTTVEELRGPGKTRALAQSRQIAMYLCRELTDLS
FT                   LPKIGQAFGRDHTTVMYAQRKILSEMAERREVFDHVKELTTRIRQRSKR"
FT   CDS_pept        2052..3260
FT                   /transl_table=11
FT                   /gene="dnaN_1"
FT                   /locus_tag="BCG_0002"
FT                   /product="DNA polymerase III subunit beta dnaN"
FT                   /EC_number="2.7.7.7"
FT                   /note="Differs from Rv0002 by 1aa, G99D"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAL69986"
FT                   /db_xref="GOA:A0A0G2Q9D4"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2Q9D4"
FT                   /protein_id="CAL69986.1"
FT                   /translation="MDAATTRVGLTDLTFRLLRESFADAVSWVAKNLPARPAVPVLSGV
FT                   LLTGSDNGLTISGFDYEVSAEAQVGAEIVSPGSVLVSGRLLSDITRALPNKPVGVHVEG
FT                   NRVALTCGNARFSLPTMPVEDYPTLPTLPEETGLLPAELFAEAISQVAIAAGRDDTLPM
FT                   LTGIRVEILGETVVLAATDRFRLAVRELKWSASSPDIEAAVLVPAKTLAEAAKAGIGGS
FT                   DVRLSLGTGPGVGKDGLLGISGNGKRSTTRLLDAEFPKFRQLLPTEHTAVATMDVAELI
FT                   EAIKLVALVADRGAQVRMEFADGSVRLSAGADDVGRAEEDLVVDYAGEPLTIAFNPTYL
FT                   TDGLSSLRSERVSFGFTTAGKPALLRPVSGDDRPVAGLNGNGPFPAVSTDYVYLLMPVR
FT                   LPG"
FT   CDS_pept        3280..4437
FT                   /transl_table=11
FT                   /gene="recF_1"
FT                   /locus_tag="BCG_0003"
FT                   /product="dna replication and repair protein recF"
FT                   /note="Differs from Rv0003 by 2aa, V158L, T245I"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAL69987"
FT                   /db_xref="GOA:A0A0G2Q9F5"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2Q9F5"
FT                   /protein_id="CAL69987.1"
FT                   /translation="MYVRHLGLRDFRSWACVDLELHPGRTVFVGPNGYGKTNLIEALWY
FT                   STTLGSHRVSADLPLIRVGTDRAVISTIVVNDGRECAVDLEIATGRVNKARLNRSSVRS
FT                   TRDVVGVLRAVLFAPEDLGLVRGDPADRRRYLDDLAIVRRPAIAAVRAEYERVVRQRTA
FT                   LLKSVPGARYRGDRGVFDTLEVWDSRLAEHGAELVAARIDLVNQLAPEVKKAYQLLAPE
FT                   SRSASIGYRASMDVTGPSEQSDTDRQLLAARLLAALAARRDAELERGVCLVGPHRDDLI
FT                   LRLGDQPAKGFASHGEAWSLAVALRLAAYQLLRVDGGEPVLLLDDVFAELDVMRRRALA
FT                   TAAESAEQVLVTAAVLEDIPAGWDARRVHIDVRADDTGSMSVVLP"
FT   CDS_pept        4434..4997
FT                   /transl_table=11
FT                   /gene="BCG_0004"
FT                   /locus_tag="BCG_0004"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Differs from Mb0004 by 1aa, S16L"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAL69988"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="InterPro:IPR023007"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2Q9F6"
FT                   /protein_id="CAL69988.1"
FT                   /translation="MTGSVDRPDQNRGERSMKSPGLDLVRRTLDEARAAARARGQDAGR
FT                   GRVASVASGRVAGRRRSWSGPGPDIRDPQPLGKAARELAKKRGWSVRVAEGMVLGQWSA
FT                   VVGHQIAEHARPTALNDGVLSVIAESTAWATQLRIMQAQLLAKIAAAVGNDVVRSLKIT
FT                   GPAAPSWRKGPRHIAGRGPRDTYG"
FT   CDS_pept        5123..7267
FT                   /transl_table=11
FT                   /gene="gyrB_1"
FT                   /locus_tag="BCG_0005"
FT                   /product="DNA gyrase subunit B gyrB"
FT                   /EC_number="5.99.1.3"
FT                   /note="Differs from Rv0005 by 1aa, S442A"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAL69989"
FT                   /db_xref="GOA:A0A0G2Q9D6"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0A0G2Q9D6"
FT                   /protein_id="CAL69989.1"
FT                   /translation="MGKNEARRSALAPDHGTVVCDPLRRLNRMHATPEESIRIVAAQKK
FT                   KAQDEYGAASITILEGLEAVRKRPGMYIGSTGERGLHHLIWEVVDNAVDEAMAGYATTV
FT                   NVVLLEDGGVEVADDGRGIPVATHASGIPTVDVVMTQLHAGGKFDSDAYAISGGLHGVG
FT                   VSVVNALSTRLEVEIKRDGYEWSQVYEKSEPLGLKQGAPTKKTGSTVRFWADPAVFETT
FT                   EYDFETVARRLQEMAFLNKGLTINLTDERVTQDEVVDEVVSDVAEAPKSASERAAESTA
FT                   PHKVKSRTFHYPGGLVDFVKHINRTKNAIHSSIVDFSGKGTGHEVEIAMQWNAGYSESV
FT                   HTFANTINTHEGGTHEEGFRSALTSVVNKYAKDRKLLKDKDPNLTGDDIREGLAAVISV
FT                   KVSEPQFEGQTKTKLGNTEVKSFVQKVCNEQLTHWFEANPTDSKVVVNKAVSSAQARIA
FT                   ARKARELVRRKSATDIGGLPGKLADCRSTDPRKSELYVVEGDSAGGSAKSGRDSMFQAI
FT                   LPLRGKIINVEKARIDRVLKNTEVQAIITALGTGIHDEFDIGKLRYHKIVLMADADVDG
FT                   QHISTLLLTLLFRFMRPLIENGHVFLAQPPLYKLKWQRSDPEFAYSDRERDGLLEAGLK
FT                   AGKKINKEDGIQRYKGLGEMDAKELWETTMDPSVRVLRQVTLDDAAAADELFSILMGED
FT                   VDARRSFITRNAKDVRFLDV"
FT   CDS_pept        7302..9818
FT                   /transl_table=11
FT                   /gene="gyrA_1"
FT                   /locus_tag="BCG_0006"
FT                   /product="DNA gyrase subunit A gyrA"
FT                   /EC_number="5.99.1.3"
FT                   /note="Differs from Mb0006 by 1aa, D639A, and from Rv0006
FT                   by 3aa, Q21E, T95S, D668G"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAL69990"
FT                   /db_xref="GOA:A0A0G2Q9F8"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0A0G2Q9F8"
FT                   /protein_id="CAL69990.1"
FT                   /translation="MTDTTLPPDDSLDRIEPVDIQQEMQRSYIDYAMSVIVGRALPEVR
FT                   DGLKPVHRRVLYAMFDSGFRPDRSHAKSARSVAETMGNYHPHGDASIYDTLVRMAQPWS
FT                   LRYPLVDGQGNFGSPGNDPPAAMRYTEARLTPLAMEMLREIDEETVDFIPNYDGRVQEP
FT                   TVLPSRFPNLLANGSGGIAVGMATNIPPHNLRELADAVFWALENHDADEEETLAAVMGR
FT                   VKGPDFPTAGLIVGSQGTADAYKTGRGSIRMRGVVEVEEDSRGRTSLVITELPYQVNHD
FT                   NFITSIAEQVRDGKLAGISNIEDQSSDRVGLRIVIEIKRDAVAKVVINNLYKHTQLQTS
FT                   FGANMLAIVDGVPRTLRLDQLIRYYVDHQLDVIVRRTTYRLRKANERAHILRGLVKALD
FT                   ALDEVIALIRASETVDIARAGLIELLDIDEIQAQAILDMQLRRLAALERQRIIDDLAKI
FT                   EAEIADLEDILAKPERQRGIVRDELAEIVDRHGDDRRTRIIAADGDVSDEDLIAREDVV
FT                   VTITETGYAKRTKTDLYRSQKRGGKGVQGAGLKQDDIVAHFFVCSTHDLILFFTTQGRV
FT                   YRAKAYDLPEASRTARGQHVANLLAFQPEERIAQVIQIRGYTDAPYLVLATRNGLVKKS
FT                   KLTDFDSNRSGGIVAVNLRDNDELVGAVLCSADDDLLLVSANGQSIRFSATDEALRPMG
FT                   RATSGVQGMRFNIDDRLLSLNVVREGTYLLVATSGGYAKRTAIEEYPVQGRGGKGVLTV
FT                   MYDRRRGRLVGALIVDDDSELYAVTSGGGVIRTAARQVRKAGRQTKGVRLMNLGEGDTL
FT                   LAIARNAEESGDDNAVDANGADQTGN"
FT   CDS_pept        9914..10828
FT                   /transl_table=11
FT                   /gene="BCG_0007"
FT                   /locus_tag="BCG_0007"
FT                   /product="Possible conserved membrane protein"
FT                   /note="Differs from Rv0007 by 1aa, I272V"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAL69991"
FT                   /db_xref="GOA:A0A0G2Q9D8"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2Q9D8"
FT                   /protein_id="CAL69991.1"
FT                   /translation="MTAPNEPGALSKGDGPNADGLVDRGGAHRAATGPGRIPDAGDPPP
FT                   WQRAATRQSQAGHRQPPPVSHPEGRPTNPPAAADARLNRFISGASAPVTGPAAAVRTPQ
FT                   PDPDASLGCGDGSPAEAYASELPDLSGPTPRAPQRNPAPARPAEGGAGSRGDSAAGSSG
FT                   GRSITAESRDARVQLSARRSRGPVRASMQIRRIDPWSTLKVSLLLSVALFFVWMITVAF
FT                   LYLVLGGMGVWAKLNSNVGDLLNNASGSSAELVSSGTIFGGAFLIGLVNIVLMTALATI
FT                   GAFVYNLITDLIGGIEVTLADRD"
FT   tRNA            10887..10960
FT                   /gene="tRNA-Ile"
FT                   /locus_tag="ileT_1"
FT                   /product="transfer RNA-Ile"
FT                   /anticodon="(pos:10921..10923,aa:Ile)"
FT                   /note="ileT_1, len: 74 nt. First of two copies equivalent
FT                   to ileT, len: 74 nt, from Mycobacterium tuberculosis strain
FT                   H37Rv, (100.0% identity in 74 nt overlap). tRNA-Ile,
FT                   anticodon gat"
FT   tRNA            11112..11184
FT                   /gene="tRNA-Ala"
FT                   /locus_tag="alaT_1"
FT                   /product="transfer RNA-Ala"
FT                   /anticodon="(pos:11145..11147,aa:Ala)"
FT                   /note="alaT_1, len: 73 nt. First of two copies equivalent
FT                   to alaT, len: 73 nt, from Mycobacterium tuberculosis strain
FT                   H37Rv, (100.0% identity in 73 nt overlap). tRNA-Ala,
FT                   anticodon tgc"
FT   CDS_pept        complement(11874..12311)
FT                   /transl_table=11
FT                   /gene="BCG_0008c"
FT                   /locus_tag="BCG_0008c"
FT                   /product="Possible membrane protein"
FT                   /note="Differs from Rv0008c by 1aa, P145S"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0008c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL69992"
FT                   /db_xref="GOA:A0A0G2Q9F9"
FT                   /db_xref="InterPro:IPR024245"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2Q9F9"
FT                   /protein_id="CAL69992.1"
FT                   /translation="MSEQVETRLTPRERLTRGLAYSAVGPVDVTRGLLELGVGLGLQSA
FT                   RSTAAGLRRRYREGRLAREVAAAQETLAQELTAAQDVVANLPQALQDARTQRRSKHHLW
FT                   IFAGIAAAILAGGAVAFSIVRRSSRPEPSPRPPSVEVQPRP"
FT   CDS_pept        12468..13016
FT                   /transl_table=11
FT                   /gene="ppiA_1"
FT                   /locus_tag="BCG_0009"
FT                   /standard_name="cfp22"
FT                   /product="Probable iron-regulated peptidyl-prolyl cis-trans
FT                   isomerase A ppiA"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAL69993"
FT                   /db_xref="GOA:A0A0G2Q9G0"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2Q9G0"
FT                   /protein_id="CAL69993.1"
FT                   /translation="MADCDSVTNSPLATATATLHTNRGDIKIALFGNHAPKTVANFVGL
FT                   AQGTKDYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADEFHPE
FT                   LQFDKPYLLAMANAGPGTNGSQFFITVGKTPHLNRRHTIFGEVIDAESQRVVEAISKTA
FT                   TDGNDRPTDPVVIESITIS"
FT   CDS_pept        complement(13222..13557)
FT                   /transl_table=11
FT                   /gene="BCG_0010c"
FT                   /locus_tag="BCG_0010c"
FT                   /product="Probable conserved membrane protein"
FT                   /note="In Mycobacterium bovis BCG Pasteur, and
FT                   Mycobacterium bovis, a single base deletion (g-*) leads to
FT                   a shorter product compared to its homolog in Mycobacterium
FT                   tuberculosis strain H37Rv (111 aa versus 141 aa)"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0010c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL69994"
FT                   /db_xref="GOA:A0A0G2Q9E0"
FT                   /db_xref="InterPro:IPR019692"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2Q9E0"
FT                   /protein_id="CAL69994.1"
FT                   /translation="MQQTAWAPRTSGIAGCGAGGVVMAIASVTLVTDTPGRVLTGVAAL
FT                   GLILFASATWRARPRLAITPDGLAIRGWFRTQLLRHSNIKIIRIDEFRRYGRLVRLLEI
FT                   ETVSGGC"
FT   CDS_pept        complement(13713..13994)
FT                   /transl_table=11
FT                   /gene="BCG_0011c"
FT                   /locus_tag="BCG_0011c"
FT                   /product="Probable conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0011c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL69995"
FT                   /db_xref="GOA:A0A0G2Q9G2"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2Q9G2"
FT                   /protein_id="CAL69995.1"
FT                   /translation="MPKSKVRKKNDFTVSAVSRTPMKVKVGPSSVWFVSLFIGLMLIGL
FT                   IWLMVFQLAAIGSQAPTALNWMAQLGPWNYAIAFAFMITGLLLTMRWH"
FT   CDS_pept        14088..14876
FT                   /transl_table=11
FT                   /gene="BCG_0012"
FT                   /locus_tag="BCG_0012"
FT                   /product="Probable conserved membrane protein"
FT                   /note="Differs from Rv0012 by 2aa, E105K, R233C"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAL69996"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2Q9E2"
FT                   /protein_id="CAL69996.1"
FT                   /translation="MRLTHPTPCPENGETMIDRRRSAWRFSVPLVCLLAGLLLAATHGV
FT                   SGGTEIRRSDAPRLVDLVRRAQASVNRLATEREALTTRIDSVHGRSVDTALAAMQRRSA
FT                   ELAGVAAMNPVHGPGLVVTLQDAQRDANGRFPRDASPDDLVVHQQDIEAVLNALWNAGA
FT                   EAIQMQDQRIIAMSIARCVGNTLLLNGRTYSPPYTIAAIGDAAAMQAALAAAPLVTLYK
FT                   QYVVRFGLGYREEVHPDLQIVGYADPVRMHFAQPAGPLDY"
FT   CDS_pept        14913..15611
FT                   /transl_table=11
FT                   /gene="trpG_1"
FT                   /locus_tag="BCG_0013"
FT                   /product="Possible para-aminobenzoate synthase component II
FT                   trpG"
FT                   /EC_number="4.1.3.27"
FT                   /note="Differs from Rv0013 by 1aa, M68I"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAL69997"
FT                   /db_xref="GOA:A0A0G2Q9G3"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2Q9G3"
FT                   /protein_id="CAL69997.1"
FT                   /translation="MRILVVDNYDSFVFNLVQYLGQLGIEAEVWRNDDHRLSDEAAVAG
FT                   QFDGVLLSPGPGTPERAGASVSMVHACAAAHTPLLGVCLGHQAIGVAFGATVDRAPELL
FT                   HGKTSSVFHTNVGVLQGLPDPFTATRYHSLTILPKSLPAVLRVTARTSSGVIMAVQHTG
FT                   LPIHGVQFHPESILTEGGHRILANWLTCCGWTQDDTLVRRLENEVLTAISPHFPTSTAS
FT                   AGEATGRTSA"
FT   CDS_pept        complement(15589..16734)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="'pknB"
FT                   /locus_tag="BCG_0014c"
FT                   /product="Transmembrane serine/threonine-protein kinase b
FT                   pknB (truncated)"
FT                   /EC_number="2.7.1.-"
FT   CDS_pept        16731..18287
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="BCG_0015"
FT                   /locus_tag="BCG_0015"
FT                   /product="Probable conserved transmembrane protein"
FT   repeat_region   16733..46399
FT                   /note="DU1, len: 29667 bases. Duplicated Region DU1. In
FT                   Mycobacterium bovis BCG Pasteur, the region corresponding
FT                   to Mycobacterium tuberculosis H37Rv positions:4398597-16733
FT                   (comprising the origin of replication) has been duplicated
FT                   as tandem repeat at position: 4361588..16732 and
FT                   16733..46399. No difference has been found beetwen the two
FT                   copies"
FT   CDS_pept        18322..18912
FT                   /transl_table=11
FT                   /gene="sigMa_2"
FT                   /locus_tag="BCG_0016"
FT                   /product="Possible alternative rna polymerase sigma factor
FT                   sigMa [FIRST PART]"
FT                   /note="In Mycobacterium tuberculosis, sigM exists as a
FT                   single gene. In Mycobacterium bovis and Mycobacterium bovis
FT                   BCG Pasteur, a frameshift due to a 2bp to 1bp substitution
FT                   (cg-t) splits sigM into 2 parts, sigMa and sigMb. Differs
FT                   from Mb3941 by 1aa A160S"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70000"
FT                   /db_xref="GOA:A0A0G2PF27"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2PF27"
FT                   /protein_id="CAL70000.1"
FT                   /translation="MPPPIGYCPAVGFGGRHERSDAELLAAHVAGDRYAFDQLFRRHHR
FT                   QLHRLARLTSRTSEDADDALQDAMLSAHRGAGSFRYDAAVSSWLHRIVVNACLDRLRRA
FT                   KAHPTAPLEDVYPVADRTAQVETAIAVQRALMRLPVEQRAAVVAVDMQGYSIADTARML
FT                   GVAEGTVKSRCARARARLARLLGYLNTGVNIRR"
FT   CDS_pept        18801..18989
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="sigMb_2"
FT                   /locus_tag="BCG_0017"
FT                   /product="Possible alternative rna polymerase sigma factor
FT                   sigMb [SECOND PART]"
FT                   /note="In Mycobacterium tuberculosis, sigM exists as a
FT                   single gene. In Mycobacterium bovis, and Mycobacterium
FT                   bovis BCG Pasteur, a frameshift due to a 2bp to 1bp
FT                   substitution (cg-t) splits sigM into 2 parts, sigMa and
FT                   sigMb"
FT   CDS_pept        19005..19769
FT                   /transl_table=11
FT                   /gene="BCG_0018"
FT                   /locus_tag="BCG_0018"
FT                   /product="Hypothetical alanine rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70002"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2Q9E4"
FT                   /protein_id="CAL70002.1"
FT                   /translation="MSAADKDPDKHSADADPPLTVELLADLQAGLLDDATAARIRSRVR
FT                   SDPQAQQILRALNRVRRDVAAMGADPAWGPAARPAVVDSISAALRSARPNSSPGAAHAA
FT                   RPHVHPVRMIAGAAGLCAVATAIGVGAVVDAPPPAPSAPTTAQHITVSKPAPVIPLSRP
FT                   QVLDLLHHTPDYGPPGGPLGDPSRRTSCLSGLGYPASTPVLGAQPIDIDARPAVLLVIP
FT                   ADTPDKLAVFAVAPHCSAADTGLLASTVVPRA"
FT   CDS_pept        19863..20870
FT                   /transl_table=11
FT                   /gene="trxB2_2"
FT                   /locus_tag="BCG_0019"
FT                   /product="Probable thioredoxin reductase trxB2 (TRXR)"
FT                   /EC_number="1.8.1.9"
FT                   /note="Differs from Rv3913 by 1aa, G57D"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70003"
FT                   /db_xref="GOA:A0A0G2Q9N7"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2Q9N7"
FT                   /protein_id="CAL70003.1"
FT                   /translation="MTAPPVHDRAHHPVRDVIVIGSGPAGYTAALYAARAQLAPLVFEG
FT                   TSFGGALMTTTGVENYPGFRNGITGPELMDEMREQALRFGADLRMEDVESVSLHGPLKS
FT                   VVTADGQTHRARAVILAMGAAARYLQVPGEQELLGRGVSSCATCDGFFFRDQDIAVIGG
FT                   GDSAMEEATFLTRFARSVTLVHRRDEFRASKIMLDRARNNDKIRFLTNHTVVAVDGDTT
FT                   VTGLRVRDTNTGAETTLPVTGVFVAIGHEPRSGLVREAIDVDPDGYVLVQGRTTSTSLP
FT                   GVFAAGDLVDRTYRQAVTAAGSGCAAAIDAERWLAEHAATGEADSTDALIGAQR"
FT   CDS_pept        20867..21217
FT                   /transl_table=11
FT                   /gene="trxC_2"
FT                   /locus_tag="BCG_0020"
FT                   /standard_name="trx; trxA"
FT                   /product="Thioredoxin trxC (TRX) (MPT46)"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70004"
FT                   /db_xref="GOA:A0A0G2Q9N8"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2Q9N8"
FT                   /protein_id="CAL70004.1"
FT                   /translation="MTDSEKSATIKVTDASFATDVLSSNKPVLVDFWATWCGPCKMVAP
FT                   VLEEIATERATDLTVAKLDVDTNPETARNFQVVSIPTLILFKDGQPVKRIVGAKGKAAL
FT                   LRELSDVVPNLN"
FT   CDS_pept        21327..22547
FT                   /transl_table=11
FT                   /gene="BCG_0021"
FT                   /locus_tag="BCG_0021"
FT                   /product="Putative hydrolase"
FT                   /EC_number="3.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70005"
FT                   /db_xref="GOA:A0A0G2Q9N9"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2Q9N9"
FT                   /protein_id="CAL70005.1"
FT                   /translation="MPSPRREDGDALRCGDRSAAVTEIRAALTALGMLDHQEEDLTTGR
FT                   NVALELFDAQLDQAVRAFQQHRGLLVDGIVGEATYRALKEASYRLGARTLYHQFGAPLY
FT                   GDDVATLQARLQDLGFYTGLVDGHFGLQTHNALMSYQREYGLAADGICGPETLRSLYFL
FT                   SSRVSGGSPHAIREEELVRSSGPKLSGKRIIIDPGRGGVDHGLIAQGPAGPISEADLLW
FT                   DLASRLEGRMAAIGMETHLSRPTNRSPSDAERAATANAVGADLMISLRCETQTSLAANG
FT                   VASFHFGNSHGSVSTIGRNLADFIQREVVARTGLRDCRVHGRTWDLLRLTRMPTVQVDI
FT                   GYITNPHDRGMLVSTQTRDAIAEGILAAVKRLYLLGKNDRPTGTFTFAELLAHELSVER
FT                   AGRLGGS"
FT   CDS_pept        complement(22568..23302)
FT                   /transl_table=11
FT                   /gene="BCG_0022c"
FT                   /locus_tag="BCG_0022c"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0022c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70006"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2Q9P0"
FT                   /protein_id="CAL70006.1"
FT                   /translation="MSARITALRLEAFEQLPKHARRCVFWEVDPAILGKDDHLADPEFE
FT                   KEAWLSMVMLEWGSCGQVATAVPDERSHAEPPCLGYVLYAPPSAVPRAQRFPTAPVSAD
FT                   AVLLTSMGIERGQADDDLPHSLIARVIEELVRRGVRALEAFGRTPAATDLQNPGAVTPD
FT                   VRPVLEALGDCCVEHCIIDANFLMDVGFVVVAPHPYFPRLRLELDKGLGWKAEVEAALE
FT                   RLLENARLQEPIAAGSTAGNTS"
FT   CDS_pept        complement(23592..24626)
FT                   /transl_table=11
FT                   /gene="parB_2"
FT                   /locus_tag="BCG_0023c"
FT                   /product="Probable chromosome partitioning protein parB"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0023c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70007"
FT                   /db_xref="GOA:A0A0G2Q9E8"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2Q9E8"
FT                   /protein_id="CAL70007.1"
FT                   /translation="MTQPSRRKGGLGRGLAALIPTGPADGESGPPTLGPRMGSATADVV
FT                   IGGPVPDTSVMGAIYREIPPSAIEANPRQPRQVFDEEALAELVHSIREFGLLQPIVVRS
FT                   LAGSQTGVRYQIVMGERRWRAAQEAGLATIPAIVRETGDDNLLRDALLENIHRVQLNPL
FT                   EEAAAYQQLLDEFGVTHDELAARIGRSRPLITNMIRLLKLPIPVQRRVAAGVLSAGHAR
FT                   ALLSLEAGPEAQEELASRIVAEGLSVRATEETVTLANHEANRQAHHSDATTPAPPRRKP
FT                   IQMPGLQDVAERLSTTFDTRVTVSLGKRKGKIVVEFGSVDDLARIVGLMTTDGRDKGLH
FT                   RDAL"
FT   CDS_pept        complement(24623..25666)
FT                   /transl_table=11
FT                   /gene="parA_2"
FT                   /locus_tag="BCG_0024c"
FT                   /product="Probable chromosome partitioning protein parA"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0024c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70008"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2Q9E9"
FT                   /protein_id="CAL70008.1"
FT                   /translation="MSAPWGPVAAGPSALVRSGQASTIEPFQREMTPPTPTPEAAHNPT
FT                   MNVSRETSTEFDTPIGAAAERAMRVLHTTHEPLQRPGRRRVLTIANQKGGVGKTTTAVN
FT                   IAAALAVQGLKTLVIDLDPQGNASTALGITDRQSGTPSSYEMLIGEVSLHTALRRSPHS
FT                   ERLFCIPATIDLAGAEIELVSMVARENRLRTALAALDNFDFDYVFVDCPPSLGLLTINA
FT                   LVAAPEVMIPIQCEYYALEGVSQLMRNIEMVKAHLNPQLEVTTVILTMYDGRTKLADQV
FT                   ADEVRQYFGSKVLRTVIPRSVKVSEAPGYSMTIIDYDPGSRGAMSYLDASRELAERDRP
FT                   PSAKGRP"
FT   CDS_pept        complement(25663..26337)
FT                   /transl_table=11
FT                   /gene="gid_2"
FT                   /locus_tag="BCG_0025c"
FT                   /product="Probable glucose-inhibited division protein B
FT                   GID"
FT                   /note="Differs from Rv3919c by 1aa, F100S"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0025c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70009"
FT                   /db_xref="GOA:A1KEG3"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KEG3"
FT                   /protein_id="CAL70009.1"
FT                   /translation="MSPIEPAASAIFGPRLGLARRYAEALAGPGVERGLVGPREVGRLW
FT                   DRHLLNCAVIGELLERGDRVVDIGSGAGLPGVPLAIARPDLQVVLLEPLLRRTEFLREM
FT                   VTDLGVAVEIVRGRAEESWVQDQLGGSDAAVSRAVAALDKLTKWSMPLIRPNGRMLAIK
FT                   GERAHDEVREHRRVMIASGAVDVRVVTCGANYLRPPATVVFARRGKQIARGSARMASGG
FT                   TA"
FT   CDS_pept        complement(26469..27032)
FT                   /transl_table=11
FT                   /gene="BCG_0026c"
FT                   /locus_tag="BCG_0026c"
FT                   /product="Hypothetical protein similar to jag protein"
FT                   /note="Differs from Rv3920c by 1aa, W110R"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0026c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70010"
FT                   /db_xref="GOA:A0A0G2Q9F0"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR034079"
FT                   /db_xref="InterPro:IPR036867"
FT                   /db_xref="InterPro:IPR038008"
FT                   /db_xref="InterPro:IPR039247"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2Q9F0"
FT                   /protein_id="CAL70010.1"
FT                   /translation="MADADTTDFDVDAEAPGGGVREDTATDADEADDQEERLVAEGEIA
FT                   GDYLEELLDVLDFDGDIDLDVEGNRAVVSIDGSDDLNKLVGRGGEVLDALQELTRLAVH
FT                   QKTGVWSRLMLDIARWRRRRREELAALADEVARRVAETGDREELVPMTPFERKIVHDAV
FT                   AAVPGVHSESEGVEPERRVVVLRD"
FT   CDS_pept        complement(27104..28204)
FT                   /transl_table=11
FT                   /gene="BCG_0027c"
FT                   /locus_tag="BCG_0027c"
FT                   /product="Probable conserved transmembrane protein"
FT                   /note="Differs from Rv3921c by 1aa, V184A"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0027c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70011"
FT                   /db_xref="GOA:A0A0G2PF30"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2PF30"
FT                   /protein_id="CAL70011.1"
FT                   /translation="MSLLFDFFSLDFIYYPVSWIMWVWYRLFAFVLGPSNFFAWALSVM
FT                   FLVFTLRALLYKPFVRQIRTTRQMQELQPQIKALQKKYGKDRQRMALEMQKLQREHGFN
FT                   PILGCLPMLAQIPVFLGLYHVLRSFNRTTGGFGQPHLSVIENRLTGNYVFSPVDVGHFL
FT                   DANLFGAPIGAYMTQRSGLDVFVDFSRPALIAVGVPVMILAGIATYFNSRASIARQSAE
FT                   AAANPQTAMMNKLALYVFPLGVVVGGPFLPLAIILYWFSNNIWTFGQQHYVFGMIEKEE
FT                   EAKKQEAVRRRAANAPAPGAKPKRSPKTAPATNAAAPTEAGDTDDGAESDASTERPADT
FT                   SNPARRNSGPSARTPRPGVRPKKRKR"
FT   CDS_pept        complement(28188..28550)
FT                   /transl_table=11
FT                   /gene="BCG_0028c"
FT                   /locus_tag="BCG_0028c"
FT                   /product="Possible hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0028c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70012"
FT                   /db_xref="GOA:A0A0G2Q9F1"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2Q9F1"
FT                   /protein_id="CAL70012.1"
FT                   /translation="MSLSRQSCGRVVRVTGRASARGLIFVIQVYRHMLSPLRPASCRFV
FT                   PTCSQYAVDALTEYGLLRGSWLTMIRLAKCGPWHRGGWDPIPEGLTTGRSCQTDVDGAN
FT                   DDWNPASKRGERESFV"
FT   CDS_pept        complement(28547..28924)
FT                   /transl_table=11
FT                   /gene="rnpA_2"
FT                   /locus_tag="BCG_0029c"
FT                   /product="Ribonuclease p protein component rnpA (RNaseP)"
FT                   /EC_number="3.1.26.5"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0029c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70013"
FT                   /db_xref="GOA:A0A0G2Q9F2"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2Q9F2"
FT                   /protein_id="CAL70013.1"
FT                   /translation="MIATPGLFAVLRARNRMRRSADFETTVKHGMRTVRSDMVVYWWRG
FT                   SGGGPRVGLIIAKSVGSAVERHRVARRLRHVAGSIVKELHPSDHVVIRALPSSRHVSSA
FT                   RLEQQLRCGLRRAVELAGSDR"
FT   CDS_pept        complement(28921..29064)
FT                   /transl_table=11
FT                   /gene="rpmH_2"
FT                   /locus_tag="BCG_0030c"
FT                   /product="50S ribosomal protein L34 rpmH"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0030c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70014"
FT                   /db_xref="GOA:A0A0G2Q9F3"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2Q9F3"
FT                   /protein_id="CAL70014.1"
FT                   /translation="MTKGKRTFQPNNRRRARVHGFRLRMRTRAGRSIVSSRRRKGRRTL
FT                   SA"
FT   CDS_pept        29668..31191
FT                   /transl_table=11
FT                   /gene="dnaA_2"
FT                   /locus_tag="BCG_0031"
FT                   /product="Chromosomal replication initiator protein dnaA"
FT                   /note="Differs from Rv0001 by 1aa, R156N ,and from Mb0001
FT                   by 1aa, V353I"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70015"
FT                   /db_xref="GOA:A0A0G2Q9F4"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2Q9F4"
FT                   /protein_id="CAL70015.1"
FT                   /translation="MTDDPGSGFTTVWNAVVSELNGDPKVDDGPSSDANLSAPLTPQQR
FT                   AWLNLVQPLTIVEGFALLSVPSSFVQNEIERHLRAPITDALSRRLGHQIQLGVRIAPPA
FT                   TDEADDTTVPPSENPATTSPDTTTDNDEIDDSAAARGDNQHSWPSYFTERPRNTDSATA
FT                   GVTSLNRRYTFDTFVIGASNRFAHAAALAIAEAPARAYNPLFIWGESGLGKTHLLHAAG
FT                   NYAQRLFPGMRVKYVSTEEFTNDFINSLRDDRKVAFKRSYRDVDVLLVDDIQFIEGKEG
FT                   IQEEFFHTFNTLHNANKQIVISSDRPPKQLATLEDRLRTRFEWGLITDVQPPELETRIA
FT                   ILRKKAQMERLAVPDDVLELIASSIERNIRELEGALIRVTAFASLNKTPIDKALAEIVL
FT                   RDLIADANTMQISAATIMAATAEYFDTTVEELRGPGKTRALAQSRQIAMYLCRELTDLS
FT                   LPKIGQAFGRDHTTVMYAQRKILSEMAERREVFDHVKELTTRIRQRSKR"
FT   CDS_pept        31719..32927
FT                   /transl_table=11
FT                   /gene="dnaN_2"
FT                   /locus_tag="BCG_0032"
FT                   /product="DNA polymerase III subunit beta dnaN"
FT                   /EC_number="2.7.7.7"
FT                   /note="Differs from Rv0002 by 1aa, G99D"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70016"
FT                   /db_xref="GOA:A0A0G2Q9D4"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2Q9D4"
FT                   /protein_id="CAL70016.1"
FT                   /translation="MDAATTRVGLTDLTFRLLRESFADAVSWVAKNLPARPAVPVLSGV
FT                   LLTGSDNGLTISGFDYEVSAEAQVGAEIVSPGSVLVSGRLLSDITRALPNKPVGVHVEG
FT                   NRVALTCGNARFSLPTMPVEDYPTLPTLPEETGLLPAELFAEAISQVAIAAGRDDTLPM
FT                   LTGIRVEILGETVVLAATDRFRLAVRELKWSASSPDIEAAVLVPAKTLAEAAKAGIGGS
FT                   DVRLSLGTGPGVGKDGLLGISGNGKRSTTRLLDAEFPKFRQLLPTEHTAVATMDVAELI
FT                   EAIKLVALVADRGAQVRMEFADGSVRLSAGADDVGRAEEDLVVDYAGEPLTIAFNPTYL
FT                   TDGLSSLRSERVSFGFTTAGKPALLRPVSGDDRPVAGLNGNGPFPAVSTDYVYLLMPVR
FT                   LPG"
FT   CDS_pept        32947..34104
FT                   /transl_table=11
FT                   /gene="recF_2"
FT                   /locus_tag="BCG_0033"
FT                   /product="Dna replication and repair protein recF"
FT                   /note="Differs from Rv0003 by 2aa, V158L, T245I"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70017"
FT                   /db_xref="GOA:A0A0G2Q9F5"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2Q9F5"
FT                   /protein_id="CAL70017.1"
FT                   /translation="MYVRHLGLRDFRSWACVDLELHPGRTVFVGPNGYGKTNLIEALWY
FT                   STTLGSHRVSADLPLIRVGTDRAVISTIVVNDGRECAVDLEIATGRVNKARLNRSSVRS
FT                   TRDVVGVLRAVLFAPEDLGLVRGDPADRRRYLDDLAIVRRPAIAAVRAEYERVVRQRTA
FT                   LLKSVPGARYRGDRGVFDTLEVWDSRLAEHGAELVAARIDLVNQLAPEVKKAYQLLAPE
FT                   SRSASIGYRASMDVTGPSEQSDTDRQLLAARLLAALAARRDAELERGVCLVGPHRDDLI
FT                   LRLGDQPAKGFASHGEAWSLAVALRLAAYQLLRVDGGEPVLLLDDVFAELDVMRRRALA
FT                   TAAESAEQVLVTAAVLEDIPAGWDARRVHIDVRADDTGSMSVVLP"
FT   CDS_pept        34101..34664
FT                   /transl_table=11
FT                   /gene="BCG_0034"
FT                   /locus_tag="BCG_0034"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Differs from Mb0004 by 1aa, S16L"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0034"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70018"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="InterPro:IPR023007"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2Q9F6"
FT                   /protein_id="CAL70018.1"
FT                   /translation="MTGSVDRPDQNRGERSMKSPGLDLVRRTLDEARAAARARGQDAGR
FT                   GRVASVASGRVAGRRRSWSGPGPDIRDPQPLGKAARELAKKRGWSVRVAEGMVLGQWSA
FT                   VVGHQIAEHARPTALNDGVLSVIAESTAWATQLRIMQAQLLAKIAAAVGNDVVRSLKIT
FT                   GPAAPSWRKGPRHIAGRGPRDTYG"
FT   CDS_pept        34790..36934
FT                   /transl_table=11
FT                   /gene="gyrB_2"
FT                   /locus_tag="BCG_0035"
FT                   /product="Dna gyrase subunit B gyrB (DNA topoisomerase)"
FT                   /EC_number="5.99.1.3"
FT                   /note="Differs from Rv0005 by 1aa, S442A"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70019"
FT                   /db_xref="GOA:A0A0G2Q9D6"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0A0G2Q9D6"
FT                   /protein_id="CAL70019.1"
FT                   /translation="MGKNEARRSALAPDHGTVVCDPLRRLNRMHATPEESIRIVAAQKK
FT                   KAQDEYGAASITILEGLEAVRKRPGMYIGSTGERGLHHLIWEVVDNAVDEAMAGYATTV
FT                   NVVLLEDGGVEVADDGRGIPVATHASGIPTVDVVMTQLHAGGKFDSDAYAISGGLHGVG
FT                   VSVVNALSTRLEVEIKRDGYEWSQVYEKSEPLGLKQGAPTKKTGSTVRFWADPAVFETT
FT                   EYDFETVARRLQEMAFLNKGLTINLTDERVTQDEVVDEVVSDVAEAPKSASERAAESTA
FT                   PHKVKSRTFHYPGGLVDFVKHINRTKNAIHSSIVDFSGKGTGHEVEIAMQWNAGYSESV
FT                   HTFANTINTHEGGTHEEGFRSALTSVVNKYAKDRKLLKDKDPNLTGDDIREGLAAVISV
FT                   KVSEPQFEGQTKTKLGNTEVKSFVQKVCNEQLTHWFEANPTDSKVVVNKAVSSAQARIA
FT                   ARKARELVRRKSATDIGGLPGKLADCRSTDPRKSELYVVEGDSAGGSAKSGRDSMFQAI
FT                   LPLRGKIINVEKARIDRVLKNTEVQAIITALGTGIHDEFDIGKLRYHKIVLMADADVDG
FT                   QHISTLLLTLLFRFMRPLIENGHVFLAQPPLYKLKWQRSDPEFAYSDRERDGLLEAGLK
FT                   AGKKINKEDGIQRYKGLGEMDAKELWETTMDPSVRVLRQVTLDDAAAADELFSILMGED
FT                   VDARRSFITRNAKDVRFLDV"
FT   CDS_pept        36969..39485
FT                   /transl_table=11
FT                   /gene="gyrA_2"
FT                   /locus_tag="BCG_0036"
FT                   /product="Dna gyrase subunit A gyrA (DNA topoisomerase)"
FT                   /EC_number="5.99.1.3"
FT                   /note="Differs from Mb0006 by 1aa, D639A, and from Rv0006
FT                   by 3aa, Q21E, T95S, D668G"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70020"
FT                   /db_xref="GOA:A0A0G2Q9F8"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0A0G2Q9F8"
FT                   /protein_id="CAL70020.1"
FT                   /translation="MTDTTLPPDDSLDRIEPVDIQQEMQRSYIDYAMSVIVGRALPEVR
FT                   DGLKPVHRRVLYAMFDSGFRPDRSHAKSARSVAETMGNYHPHGDASIYDTLVRMAQPWS
FT                   LRYPLVDGQGNFGSPGNDPPAAMRYTEARLTPLAMEMLREIDEETVDFIPNYDGRVQEP
FT                   TVLPSRFPNLLANGSGGIAVGMATNIPPHNLRELADAVFWALENHDADEEETLAAVMGR
FT                   VKGPDFPTAGLIVGSQGTADAYKTGRGSIRMRGVVEVEEDSRGRTSLVITELPYQVNHD
FT                   NFITSIAEQVRDGKLAGISNIEDQSSDRVGLRIVIEIKRDAVAKVVINNLYKHTQLQTS
FT                   FGANMLAIVDGVPRTLRLDQLIRYYVDHQLDVIVRRTTYRLRKANERAHILRGLVKALD
FT                   ALDEVIALIRASETVDIARAGLIELLDIDEIQAQAILDMQLRRLAALERQRIIDDLAKI
FT                   EAEIADLEDILAKPERQRGIVRDELAEIVDRHGDDRRTRIIAADGDVSDEDLIAREDVV
FT                   VTITETGYAKRTKTDLYRSQKRGGKGVQGAGLKQDDIVAHFFVCSTHDLILFFTTQGRV
FT                   YRAKAYDLPEASRTARGQHVANLLAFQPEERIAQVIQIRGYTDAPYLVLATRNGLVKKS
FT                   KLTDFDSNRSGGIVAVNLRDNDELVGAVLCSADDDLLLVSANGQSIRFSATDEALRPMG
FT                   RATSGVQGMRFNIDDRLLSLNVVREGTYLLVATSGGYAKRTAIEEYPVQGRGGKGVLTV
FT                   MYDRRRGRLVGALIVDDDSELYAVTSGGGVIRTAARQVRKAGRQTKGVRLMNLGEGDTL
FT                   LAIARNAEESGDDNAVDANGADQTGN"
FT   CDS_pept        39581..40495
FT                   /transl_table=11
FT                   /gene="BCG_0037"
FT                   /locus_tag="BCG_0037"
FT                   /product="Possible conserved membrane protein"
FT                   /note="Differs from Rv0007 by 1aa, I272V"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0037"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70021"
FT                   /db_xref="GOA:A0A0G2Q9D8"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2Q9D8"
FT                   /protein_id="CAL70021.1"
FT                   /translation="MTAPNEPGALSKGDGPNADGLVDRGGAHRAATGPGRIPDAGDPPP
FT                   WQRAATRQSQAGHRQPPPVSHPEGRPTNPPAAADARLNRFISGASAPVTGPAAAVRTPQ
FT                   PDPDASLGCGDGSPAEAYASELPDLSGPTPRAPQRNPAPARPAEGGAGSRGDSAAGSSG
FT                   GRSITAESRDARVQLSARRSRGPVRASMQIRRIDPWSTLKVSLLLSVALFFVWMITVAF
FT                   LYLVLGGMGVWAKLNSNVGDLLNNASGSSAELVSSGTIFGGAFLIGLVNIVLMTALATI
FT                   GAFVYNLITDLIGGIEVTLADRD"
FT   tRNA            40554..40627
FT                   /gene="tRNA-Ile"
FT                   /locus_tag="ileT_2"
FT                   /product="transfer RNA-Ile"
FT                   /anticodon="(pos:40588..40590,aa:Ile)"
FT                   /note="ileT_2, len: 74 nt. Second of two copies equivalent
FT                   to ileT, len: 74 nt, from Mycobacterium tuberculosis strain
FT                   H37Rv, (100.0% identity in 74 nt overlap). tRNA-Ile,
FT                   anticodon gat"
FT   tRNA            40779..40851
FT                   /gene="tRNA-Ala"
FT                   /locus_tag="alaT_2"
FT                   /product="transfer RNA-Ala"
FT                   /anticodon="(pos:40812..40814,aa:Ala)"
FT                   /note="alaT_2, len: 73 nt. Second of two copies equivalent
FT                   to alaT, len: 73 nt, from Mycobacterium tuberculosis strain
FT                   H37Rv, (100.0% identity in 73 nt overlap). tRNA-Ala,
FT                   anticodon tgc"
FT   CDS_pept        complement(41541..41978)
FT                   /transl_table=11
FT                   /gene="BCG_0038c"
FT                   /locus_tag="BCG_0038c"
FT                   /product="Possible membrane protein"
FT                   /note="Differs from Rv0008c by 1aa, P145S"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0038c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70022"
FT                   /db_xref="GOA:A0A0G2Q9F9"
FT                   /db_xref="InterPro:IPR024245"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2Q9F9"
FT                   /protein_id="CAL70022.1"
FT                   /translation="MSEQVETRLTPRERLTRGLAYSAVGPVDVTRGLLELGVGLGLQSA
FT                   RSTAAGLRRRYREGRLAREVAAAQETLAQELTAAQDVVANLPQALQDARTQRRSKHHLW
FT                   IFAGIAAAILAGGAVAFSIVRRSSRPEPSPRPPSVEVQPRP"
FT   CDS_pept        42135..42683
FT                   /transl_table=11
FT                   /gene="ppiA_2"
FT                   /locus_tag="BCG_0039"
FT                   /standard_name="cfp22"
FT                   /product="Probable iron-regulated peptidyl-prolyL cis-trans
FT                   isomerase a ppiA"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70023"
FT                   /db_xref="GOA:A0A0G2Q9G0"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2Q9G0"
FT                   /protein_id="CAL70023.1"
FT                   /translation="MADCDSVTNSPLATATATLHTNRGDIKIALFGNHAPKTVANFVGL
FT                   AQGTKDYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADEFHPE
FT                   LQFDKPYLLAMANAGPGTNGSQFFITVGKTPHLNRRHTIFGEVIDAESQRVVEAISKTA
FT                   TDGNDRPTDPVVIESITIS"
FT   CDS_pept        complement(42889..43224)
FT                   /transl_table=11
FT                   /gene="BCG_0040c"
FT                   /locus_tag="BCG_0040c"
FT                   /product="Probable conserved membrane protein"
FT                   /note="In Mycobacterium bovis BCG Pasteur, and
FT                   Mycobacterium bovis, a single base deletion (g-*) leads to
FT                   a shorter product compared to its homolog in Mycobacterium
FT                   tuberculosis strain H37Rv (111 aa versus 141 aa)"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0040c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70024"
FT                   /db_xref="GOA:A0A0G2Q9E0"
FT                   /db_xref="InterPro:IPR019692"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2Q9E0"
FT                   /protein_id="CAL70024.1"
FT                   /translation="MQQTAWAPRTSGIAGCGAGGVVMAIASVTLVTDTPGRVLTGVAAL
FT                   GLILFASATWRARPRLAITPDGLAIRGWFRTQLLRHSNIKIIRIDEFRRYGRLVRLLEI
FT                   ETVSGGC"
FT   CDS_pept        complement(43380..43661)
FT                   /transl_table=11
FT                   /gene="BCG_0041c"
FT                   /locus_tag="BCG_0041c"
FT                   /product="Probable conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0041c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70025"
FT                   /db_xref="GOA:A0A0G2Q9G2"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2Q9G2"
FT                   /protein_id="CAL70025.1"
FT                   /translation="MPKSKVRKKNDFTVSAVSRTPMKVKVGPSSVWFVSLFIGLMLIGL
FT                   IWLMVFQLAAIGSQAPTALNWMAQLGPWNYAIAFAFMITGLLLTMRWH"
FT   CDS_pept        43755..44543
FT                   /transl_table=11
FT                   /gene="BCG_0042"
FT                   /locus_tag="BCG_0042"
FT                   /product="Probable conserved membrane protein"
FT                   /note="Differs from Rv0012 by 2aa, E105K, R233C"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70026"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2Q9E2"
FT                   /protein_id="CAL70026.1"
FT                   /translation="MRLTHPTPCPENGETMIDRRRSAWRFSVPLVCLLAGLLLAATHGV
FT                   SGGTEIRRSDAPRLVDLVRRAQASVNRLATEREALTTRIDSVHGRSVDTALAAMQRRSA
FT                   ELAGVAAMNPVHGPGLVVTLQDAQRDANGRFPRDASPDDLVVHQQDIEAVLNALWNAGA
FT                   EAIQMQDQRIIAMSIARCVGNTLLLNGRTYSPPYTIAAIGDAAAMQAALAAAPLVTLYK
FT                   QYVVRFGLGYREEVHPDLQIVGYADPVRMHFAQPAGPLDY"
FT   CDS_pept        44580..45278
FT                   /transl_table=11
FT                   /gene="trpG_2"
FT                   /locus_tag="BCG_0043"
FT                   /product="Possible anthranilate synthase component II trpG"
FT                   /EC_number="4.1.3.27"
FT                   /note="Differs from Rv0013 by 1aa, M68I"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70027"
FT                   /db_xref="GOA:A0A0G2Q9G3"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2Q9G3"
FT                   /protein_id="CAL70027.1"
FT                   /translation="MRILVVDNYDSFVFNLVQYLGQLGIEAEVWRNDDHRLSDEAAVAG
FT                   QFDGVLLSPGPGTPERAGASVSMVHACAAAHTPLLGVCLGHQAIGVAFGATVDRAPELL
FT                   HGKTSSVFHTNVGVLQGLPDPFTATRYHSLTILPKSLPAVLRVTARTSSGVIMAVQHTG
FT                   LPIHGVQFHPESILTEGGHRILANWLTCCGWTQDDTLVRRLENEVLTAISPHFPTSTAS
FT                   AGEATGRTSA"
FT   CDS_pept        complement(45256..47136)
FT                   /transl_table=11
FT                   /gene="pknB"
FT                   /locus_tag="BCG_0044c"
FT                   /product="Transmembrane serine/threonine-protein kinase B
FT                   pknB"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0044c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70028"
FT                   /db_xref="GOA:A0A0H3M746"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M746"
FT                   /protein_id="CAL70028.1"
FT                   /translation="MTTPSHLSDRYELGEILGFGGMSEVHLARDLRLHRDVAVKVLRAD
FT                   LARDPSFYLRFRREAQNAAALNHPAIVAVYDTGEAETPAGPLPYIVMEYVDGVTLRDIV
FT                   HTEGPMTPKRAIEVIADACQALNFSHQNGIIHRDVKPANIMISATNAVKVMDFGIARAI
FT                   ADSGNSVTQTAAVIGTAQYLSPEQARGDSVDARSDVYSLGCVLYEVLTGEPPFTGDSPV
FT                   SVAYQHVREDPIPPSARHEGLSADLDAVVLKALAKNPENRYQTAAEMRADLVRVHNGEP
FT                   PEAPKVLTDAERTSLLSSAAGNLSGPRTDPLPRQDLDDTDRDRSIGSVGRWVAVVAVLA
FT                   VLTVVVTIAINTFGGITRDVQVPDVRGQSSADAIATLQNRGFKIRTLQKPDSTIPPDHV
FT                   IGTDPAANTSVSAGDEITVNVSTGPEQREIPDVSTLTYAEAVKKLTAAGFGRFKQANSP
FT                   STPELVGKVIGTNPPANQTSAITNVVIIIVGSGPATKDIPDVAGQTVDVAQKNLNVYGF
FT                   TKFSQASVDSPRPAGEVTGTNPPAGTTVPVDSVIELQVSKGNQFVMPDLSGMFWVDAEP
FT                   RLRALGWTGMLDKGADVDAGGSQHNRVVYQNPPAGTGVNRDGIITLRFGQ"
FT   CDS_pept        complement(47133..48428)
FT                   /transl_table=11
FT                   /gene="pknA"
FT                   /locus_tag="BCG_0045c"
FT                   /product="Transmembrane serine/threonine-protein kinase A
FT                   pknA"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0045c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70029"
FT                   /db_xref="GOA:A0A0H3M2C1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2C1"
FT                   /protein_id="CAL70029.1"
FT                   /translation="MSPRVGVTLSGRYRLQRLIATGGMGQVWEAVDNRLGRRVAVKVLK
FT                   SEFSSDPEFIERFRAEARTTAMLNHPGIASVHDYGESQMNGEGRTAYLVMELVNGEPLN
FT                   SVLKRTGRLSLRHALDMLEQTGRALQIAHAAGLVHRDVKPGNILITPTGQVKITDFGIA
FT                   KAVDAAPVTQTGMVMGTAQYIAPEQALGHDASPASDVYSLGVVGYEAVSGKRPFAGDGA
FT                   LTVAMKHIKEPPPPLPPDLPPNVRELIEITLVKNPAMRYRSGGPFADAVAAVRAGRRPP
FT                   RPSQTPPPGRAAPAAIPSGTTARVAANSAGRTAASRRSRPATGGHRPPRRTFSSGQRAL
FT                   LWAAGVLGALAIIIAVLLVIKAPGDNSPQQAPTPTVTTTGNPPASNTGGTDASPRLNWT
FT                   ERGETRHSGLQSWVVPPTPHSRASLARYEIAQ"
FT   CDS_pept        complement(48425..49900)
FT                   /transl_table=11
FT                   /gene="pbpA"
FT                   /locus_tag="BCG_0046c"
FT                   /product="Probable penicillin-binding protein pbpA"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0046c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70030"
FT                   /db_xref="GOA:A0A0H3M9K0"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M9K0"
FT                   /protein_id="CAL70030.1"
FT                   /translation="MNASLRRISVTVMALIVLLLLNATMTQVFTADGLRADPRNQRVLL
FT                   DEYSRQRGQITAGGQLLAYSVATDGRFRFLRVYPNPEVYAPVTGFYSLRYSSTALERAE
FT                   DPILNGSDRRLFGRRLADFFTGRDPRGGNVDTTINPRIQQAGWDAMQQGCYGPCKGAVV
FT                   ALEPSTGKILALVSSPSYDPNLLASHNPEVQAQAWQRLGDNPASPLTNRAISETYPPGS
FT                   TFKVITTAAALAAGATETEQLTAAPTIPLPGSTAQLENYGGAPCGDEPTVSLREAFVKS
FT                   CNTAFVQLGIRTGADALRSMARAFGLDSPPRPTPLQVAESTVGPIPDSAALGMTSIGQK
FT                   DVALTPLANAEIAATIANGGITMRPYLVGSLKGPDLANISTTVGYQQRRAVSPQVAAKL
FT                   TELMVGAEKVAQQKGAIPGVQIASKTGTAEHGTDPRHTPPHAWYIAFAPAQAPKVAVAV
FT                   LVENGADRLSATGGALAAPIGRAVIEAALQGEP"
FT   CDS_pept        complement(49897..51306)
FT                   /transl_table=11
FT                   /gene="rodA"
FT                   /locus_tag="BCG_0047c"
FT                   /product="Probable cell division protein rodA"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0047c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70031"
FT                   /db_xref="GOA:A0A0H3M143"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M143"
FT                   /protein_id="CAL70031.1"
FT                   /translation="MTTRLQAPVAVTPPLPTRRNAELLLLCFAAVITFAALLVVQANQD
FT                   QGVPWDLTSYGLAFLTLFGSAHLAIRRFAPYTDPLLLPVVALLNGLGLVMIHRLDLVDN
FT                   EIGEHRHPSANQQMLWTLVGVAAFALVVTFLKDHRQLARYGYICGLAGLVFLAVPALLP
FT                   AALSEQNGAKIWIRLPGFSIQPAEFSKILLLIFFSAVLVAKRGLFTSAGKHLLGMTLPR
FT                   PRDLAPLLAAWVISVGVMVFEKDLGASLLLYTSFLVVVYLATQRFSWVVIGLTLFAAGT
FT                   LVAYFIFEHVRLRVQTWLDPFADPDGTGYQIVQSLFSFATGGIFGTGLGNGQPDTVPAA
FT                   STDFIIAAFGEELGLVGLTAILMLYTIVIIRGLRTAIATRDSFGKLLAAGLSSTLAIQL
FT                   FIVVGGVTRLIPLTGLTTPWMSYGGSSLLANYILLAILARISHGARRPLRTRPRNKSPI
FT                   TAAGTEVIERV"
FT   CDS_pept        complement(51303..52847)
FT                   /transl_table=11
FT                   /gene="pstP"
FT                   /locus_tag="BCG_0048c"
FT                   /product="Serine/threonine phosphatase PPP"
FT                   /EC_number="3.1.3.16"
FT                   /note="Differs from Rv0018c by 3aa, L3R, A455S, S463P"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0048c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70032"
FT                   /db_xref="GOA:A1KEI6"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A1KEI6"
FT                   /protein_id="CAL70032.1"
FT                   /translation="MALVTLVLRYAARSDRGLVRANNEDSVYAGARLLALADGMGGHAA
FT                   GEVASQLVIAALAHLDDDEPGGDLLAKLDAAVRAGNSAIAAQVEMEPDLEGMGTTLTAI
FT                   LFAGNRLGLVHIGDSRGYLLRDGELTQITKDDTFVQTLVDEGRITPEEAHSHPQRSLIM
FT                   RALTGHEVEPTLTMREARAGDRYLLCSDGLSDPVSDETILEALQIPEVAESAHRLIELA
FT                   LRGGGPDNVTVVVADVVDYDYGQTQPILAGAVSGDDDQLTLPNTAAGRASAISQRKEIV
FT                   KRVPPQADTFSRPRWSGRRLAFVVALVTVLMTAGLLIGRAIIRSNYYVADYAGSVSIMR
FT                   GIQGSLLGMSLHQPYLMGCLSPRNELSQISYGQSGGPLDCHLMKLEDLRPPERAQVRAG
FT                   LPAGTLDDAIGQLRELAANSLLPPCPAPRATSPPGRPAPPTTSETTEPNVTSSPAAPSP
FT                   TTSASAPTGTTPAIPTSASPAAPASPPTPWPVTSSPTMAALPPPPPQPGIDCRAAA"
FT   CDS_pept        complement(52936..53403)
FT                   /transl_table=11
FT                   /gene="BCG_0049c"
FT                   /locus_tag="BCG_0049c"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0049c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70033"
FT                   /db_xref="GOA:A0A0H3M0I2"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M0I2"
FT                   /protein_id="CAL70033.1"
FT                   /translation="MQGLVLQLTRAGFLMLLWVFIWSVLRILKTDIYAPTGAVMMRRGL
FT                   ALRGTLLGARQRRHAARYLVVTEGALTGARITLSEQPVLIGRADDSTLVLTDDYASTRH
FT                   ARLSMRGSEWYVEDLGSTNGTYLDRAKVTTAVRVPIGTPVRIGKTAIELRP"
FT   CDS_pept        complement(53527..55092)
FT                   /transl_table=11
FT                   /gene="TB39.8"
FT                   /locus_tag="BCG_0050c"
FT                   /product="Conserved hypothetical protein TB39.8"
FT                   /note="Differs from Mb0020c by 2aa, G47R, Y250H, and from
FT                   Rv0020c by 3aa, G222D, C298Y, Q378R, and deletion of 6aa
FT                   (EQRGYP) at position 246"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0050c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70034"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M751"
FT                   /protein_id="CAL70034.1"
FT                   /translation="MGSQKRLVQRVERKLEQTVGDAFARIFGGSIVPQEVEALLRREAA
FT                   DGIQSLQGNRLLAPNEYIITLGVHDFEKLGADPELKSTGFARDLADYIQEQGWQTYGDV
FT                   VVRFEQSSNLHTGQFRARGTVNPDVETHPPVIDCARPQSNHAFGAEPGVAPMSDNSSYR
FT                   GGQGQGRPDEYYDDRYARPQEDPRGGPDPQGGSDPRGGYPPETGGYPPQPGYPRPRHPG
FT                   QGDYPEQIGYPDQGGYPEQRGYPDQRGYQDQGRGYPDQGQGGYPPPYEQRPPVSPGPAA
FT                   GYGAPGYDQGYRQSGGCGPSPGGGQPGYGGYGEYGRGPARHEEGSYVPSGPPGPPEQRP
FT                   AYPDQGGYDQGYQQGATTYGRQDYGGGADYTRYTESPQVPGYAPQGGGYAEPAGRDYDY
FT                   GQSGAPDYGQPAPGGYSGYGQGGYGSAGTSVTLQLDDGSGRTYQLREGSNIIGRGQDAQ
FT                   FRLPDTGVSRRHLEIRWDGQVALLADLNSTNGTTVNNAPVQEWQLADGDVIRLGHSEII
FT                   VRMH"
FT   tRNA            55292..55374
FT                   /gene="tRNA-Leu"
FT                   /locus_tag="leuT"
FT                   /product="transfer RNA-Leu"
FT                   /anticodon="(pos:55325..55327,aa:Leu)"
FT                   /note="leuT, len: 83 nt. Equivalent to leuT, len: 83 nt,
FT                   from Mycobacterium tuberculosis strain H37Rv, (100.0%
FT                   identity in 83 nt overlap). tRNA-Leu, anticodon cag"
FT   CDS_pept        complement(55561..56529)
FT                   /transl_table=11
FT                   /gene="BCG_0051c"
FT                   /locus_tag="BCG_0051c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Differs from Rv0021c by 1aa, P277A"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0051c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70035"
FT                   /db_xref="GOA:A0A0H3M2C3"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2C3"
FT                   /protein_id="CAL70035.1"
FT                   /translation="MVLSTAFSQMFGIDYPIVSAPMDLIAGGELAAAVSGAGGLGLIGG
FT                   GYGDRDWLARQFDLAAGAPVGCGFITWSLARQPQLLDLALQYEPVAVMLSFGDPAVFAD
FT                   AIKSAGTRLVCQIQNRTQAERALQVGADVLVAQGTEAGGHGHGPRSTLTLVPEIVDLVT
FT                   ARGTDIPVIAAGGIADGRGLAAALMLGAAGVLVGTRFYATVEALSTPQARDPLLAATGD
FT                   DMCRTTIYDQLRRYPWPQGHTMSVLSNALTDQFEDTELDILHREEAMARYWRAVPARDY
FT                   SIANVTAGQAAGLVNAVLPAADVITGMAQQAARTLTAMRAV"
FT   CDS_pept        complement(56671..57090)
FT                   /transl_table=11
FT                   /gene="whiB5"
FT                   /locus_tag="BCG_0052c"
FT                   /product="Putative transcriptional regulatory protein
FT                   whiB-like whiB5"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0052c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70036"
FT                   /db_xref="GOA:A0A0H3M9K5"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M9K5"
FT                   /protein_id="CAL70036.1"
FT                   /translation="MAHPCATDPELWFGYPDDDGSDGAAKARAYERSATQARIQCLRRC
FT                   PLLQQRRCAQHAVEHRVEYGVWAGIKLPGGQYRKREQLAAAHDVLRRIAGGEINSRQLP
FT                   DNAALLARNEGLEVTPVPGVVVHLPIAQVGPQPAA"
FT   CDS_pept        57243..58013
FT                   /transl_table=11
FT                   /gene="BCG_0053"
FT                   /locus_tag="BCG_0053"
FT                   /product="Possible transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70037"
FT                   /db_xref="GOA:A0A0H3M147"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M147"
FT                   /protein_id="CAL70037.1"
FT                   /translation="MSRESAGAAIRALRESRDWSLADLAAATGVSTMGLSYLERGARKP
FT                   HKSTVQKVENGLGLPPGTYSRLLVAADPDAELARLIAAQPSNPTAVRRAGAVVVDRHSD
FT                   TDVLEGYAEAQLDAIKSVIDRLPATTSNEYETYILSVIAQCVKAEMLAASSWRVAVNAG
FT                   ADSTGRLMEHLRALEATRGALLERMPTSLSARFDRACAQSSLPEAVVAALIGVGADEMW
FT                   DIRNRGVIPAGALPRVRAFVDAIEASHDADEGQQ"
FT   CDS_pept        58010..58843
FT                   /transl_table=11
FT                   /gene="BCG_0054"
FT                   /locus_tag="BCG_0054"
FT                   /product="Putative secreted protein P60-related protein
FT                   [first part]"
FT                   /note="In Mycobacterium tuberculosis strain H37Rv, and
FT                   other mycobacteria, Rv0024 exists as a single gene. In
FT                   Mycobacterium bovis BCG Pasteur, and Mycobacterium bovis, a
FT                   frameshift due to a single base deletion (c-*) splits
FT                   Rv0024 into 2 parts"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0054"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70038"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M0I5"
FT                   /protein_id="CAL70038.1"
FT                   /translation="MNYSEVELLSRAHQLFAGDSRRPGLDAGTTPYGDLLSRAADLNVG
FT                   AGQRRYQLAVDHSRAALLSAARTDAAAGAVITGAQRDRAWARRSTGTVLDEARSDTTVT
FT                   AVMPIAQREAIRRRVARLRAQRAHVLTARRRARRHLAALRALRYRVAHGPGVALAKLRL
FT                   PSPSGRAGIAVHAALSRLGRPYVWGATGPTSSTVPVWSSGPTPRRVFTWIAPPINRSTR
FT                   GSRCRAHRSGRAIWSSRTPGTCSWRSATIWSSRRPMRARRFGSARWATTCRFGDR"
FT   CDS_pept        58585..58854
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="BCG_0055"
FT                   /locus_tag="BCG_0055"
FT                   /product="Putative secreted protein P60-related protein
FT                   [second part]"
FT                   /note="In Mycobacterium tuberculosis strain H37Rv, Rv0024
FT                   exists as a single gene. In Mycobacterium bovis BCG
FT                   Pasteur, and Mycobacterium bovis, a frameshift due to a
FT                   single base deletion (c-*) splits Rv0024 into 2 parts"
FT   CDS_pept        58892..59254
FT                   /transl_table=11
FT                   /gene="BCG_0056"
FT                   /locus_tag="BCG_0056"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Differs from Rv0025 by 1aa, L73P"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70040"
FT                   /db_xref="InterPro:IPR019710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M754"
FT                   /protein_id="CAL70040.1"
FT                   /translation="MSEQAGSSVAVIQERQALLARQHDAVAEADRELADVLASAHAAMR
FT                   ESVRRLDAIAAELDRAVPDQDQLAVDTLMGAREFQTFLVAKQREIVAVVAAAHELDRAK
FT                   SAVLKRLRAQYTEPAR"
FT   CDS_pept        59369..60802
FT                   /transl_table=11
FT                   /gene="BCG_0057"
FT                   /locus_tag="BCG_0057"
FT                   /product="Conserved hypothetical protein"
FT                   /note="In Mycobacterium bovis and Mycobacterium bovis BCG
FT                   Pasteur, a 4 bp insertion (*-atcg) leads to a longer
FT                   protein with a different COOH part compared to its homolog
FT                   in Mycobacterium tuberculosis strain H37Rv (477 aa versus
FT                   448 aa). Differs from Rv0026 by 1aa, P93Q"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70041"
FT                   /db_xref="InterPro:IPR019710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2C5"
FT                   /protein_id="CAL70041.1"
FT                   /translation="MAFDAAMSTHEDLLATIRYVRDRTGDPNAWQTGLTPTEVTAVVTS
FT                   TTRSEQLDAILRKIRQRHSNLYYPAPPDREQGDAARAIADAEAALAHPNSATAQLDLQV
FT                   VSAILNAHLKTVEGGESLHELQQEIEAAVRIRSDLDTPAGARDFQRFLIGKLKDIREVV
FT                   ATASLDAASKSALMAAWTSLYDASKGDRGDADDRGPASVGSGGAPARGAGQQPELPTRA
FT                   EPDCLLDSLLLEDPGLLADDLQVPGGTSAAIPSASSTPSLPNLGGATMPGGGATPALVP
FT                   GVSAPGGLPLSGLLRGVGDEPELTDFDERGQEVRDPADYEHSNEPDERRADDREGADED
FT                   AGLGKSESPPQAPTTVTLPNGETVTAASPQLAAAIKAAASGTPIADAFQQQGIAIPLPG
FT                   TAVANPVDPARISAGDVGVFTDRHALALGPSKALLDGQIQHISAVRGRNFLGWIHPAAT
FT                   ATAPARTEAPTPTRPAAAR"
FT   CDS_pept        60840..61157
FT                   /transl_table=11
FT                   /gene="BCG_0058"
FT                   /locus_tag="BCG_0058"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70042"
FT                   /db_xref="GOA:A0A0H3M9K9"
FT                   /db_xref="InterPro:IPR022536"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M9K9"
FT                   /protein_id="CAL70042.1"
FT                   /translation="MTDRIHVQPAHLRQAAAHHQQTADYLRTVPSSHDAIRESLDSLGP
FT                   IFSELRDTGRELLELRKQCYQQQADNHADIAQNLRTSAAMWEQHERAASRSLGNIIDGS
FT                   R"
FT   CDS_pept        61165..61470
FT                   /transl_table=11
FT                   /gene="BCG_0059"
FT                   /locus_tag="BCG_0059"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0059"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70043"
FT                   /db_xref="InterPro:IPR024426"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M151"
FT                   /protein_id="CAL70043.1"
FT                   /translation="MTDANPAFDTVHPSGHILVRSCRGGYMHSVSLSEAAMETDAETLA
FT                   EAILLTADVSCLKALLEVRNEIVAAGHTPSAQVPTTDDLNVAIEKLLAHQLRRRNR"
FT   CDS_pept        61708..62805
FT                   /transl_table=11
FT                   /gene="BCG_0060"
FT                   /locus_tag="BCG_0060"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Differs from Rv0029 by 1aa, N190H"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70044"
FT                   /db_xref="InterPro:IPR040604"
FT                   /db_xref="InterPro:IPR040833"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M0I9"
FT                   /protein_id="CAL70044.1"
FT                   /translation="MAIFGRWSARQRLRRATRESLTIPTFSSSLDCTTRVIGGLWPAEL
FT                   SSNTAETATLAEHLKADLHRIVGSANDELMVIWRAGMADSTRRAEEDRVIDRARASAMR
FT                   RVESAMRELRQITGRVPVEIPRMRGAGGSDLDTTRLMPAVTVVQPADQACTDWPVAAAE
FT                   DDEARLQRLLAFVARQEPRLNWAVGVNADGTTVLVTDVAHGWIPPGIALPEGVRLLAPA
FT                   RRAGRAPELVGITTCCKTYTPGDSLRRAVDSTAPTSSVQPRALPAIAGLSVELGIATQR
FT                   HDGLPKIVHAMATAAGNGAAAEEVDLLRVHVDTALHHVLAQYPRVDPALLLNCMLLAAT
FT                   ERSVTGDPIAANYHFAWFRELDSRR"
FT   CDS_pept        62875..63204
FT                   /transl_table=11
FT                   /gene="BCG_0061"
FT                   /locus_tag="BCG_0061"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70045"
FT                   /db_xref="InterPro:IPR024296"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M757"
FT                   /protein_id="CAL70045.1"
FT                   /translation="MVSGSDSRSEPSQLSDRDLVESVLRDLSEAADKWEALVTQAETVT
FT                   YSVDLGDVRAVANSDGRLLELTLHPGVMTGYAHGELADRVNLAITALRDEVEAENRARY
FT                   GGRLQ"
FT   CDS_pept        63233..63445
FT                   /transl_table=11
FT                   /gene="BCG_0062"
FT                   /locus_tag="BCG_0062"
FT                   /product="Putative remnant of a transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70046"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2C9"
FT                   /protein_id="CAL70046.1"
FT                   /translation="MLARHFGAGRKAHSRAVATLKADIQAWHPAGIQTPKPRCESDVFA
FT                   RIGHTSHPSTRKSRVGPGASEAPLA"
FT   CDS_pept        63946..66261
FT                   /transl_table=11
FT                   /gene="bioF2"
FT                   /locus_tag="BCG_0063"
FT                   /product="Possible 8-amino-7-oxononanoate synthase bioF2"
FT                   /EC_number="2.3.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70047"
FT                   /db_xref="GOA:A0A0H3M9L4"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR038740"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M9L4"
FT                   /protein_id="CAL70047.1"
FT                   /translation="MPTGLGYDFLRPVEDSGINDLKHYYFMADLADGQPLGRANLYSVC
FT                   FDLATTDRKLTPAWRTTIKRWFPGFMTFRFLECGLLTMVSNPLALRSDTDLERVLPVLA
FT                   GQMDQLAHDDGSDFLMIRDVDPEHYQRYLDILRPLGFRPALGFSRVDTTISWSSVEEAL
FT                   GCLSHKRRLPLKTSLEFRERFGIEVEELDEYAEHAPVLARLWRNVKTEAKDYQREDLNP
FT                   EFFAACSRHLHGRSRLWLFRYQGTPIAFFLNVWGADENYILLEWGIDRDFEHYRKANLY
FT                   RAALMLSLKDAISRDKRRMEMGITNYFTKLRIPGARVIPTIYFLRHSTDPVHTATLARM
FT                   MMHNIQRPTLPDDMSEEFCRWEERIRLDQDGLPEHDIFRKIDRQHKYTGLKLGGVYGFY
FT                   PRFTGPQRSTVKAAELGEIVLLGTNSYLGLATHPEVVEASAEATRRYGTGCSGSPLLNG
FT                   TLDLHVSLEQELACFLGKPAAVLCSTGYQSNLAAISALCESGDMIIQDALNHRSLFDAA
FT                   RLSGADFTLYRHNDMDHLARVLRRTEGRRRIIVVDAVFSMEGTVADLATIAELADRHGC
FT                   RVYVDESHALGVLGPDGRGASAALGVLARMDVVMGTFSKSFASVGGFIAGDRPVVDYIR
FT                   HNGSGHVFSASLPPAAAAATHAALRVSRREPDRRARVLAAAEYMATGLARQGYQAEYHG
FT                   TAIVPVILGNPTVAHAGYLRLMRSGVYVNPVAPPAVPEERSGFRTSYLADHRQSDLDRA
FT                   LHVFAGLAEDLTPQGAAL"
FT   CDS_pept        66258..66521
FT                   /transl_table=11
FT                   /gene="acpA"
FT                   /locus_tag="BCG_0064"
FT                   /standard_name="acpP"
FT                   /product="Probable acyl carrier protein acpA (ACP)"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70048"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M156"
FT                   /protein_id="CAL70048.1"
FT                   /translation="MKEAINATIQRILRTDRGITANQVLVDDLGFDSLKLFQLITELED
FT                   EFDIAISFRDAQNIKTVGDVYTSVAVWFPETAKPAPLGKGTA"
FT   CDS_pept        66518..66913
FT                   /transl_table=11
FT                   /gene="BCG_0065"
FT                   /locus_tag="BCG_0065"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70049"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M0J3"
FT                   /protein_id="CAL70049.1"
FT                   /translation="MTDDADLDLVRRTFAAFARGDLAELTQCFAPDVEQFVPGKHALAG
FT                   VFRGVDNVVACLGDTAAAADGTMTVTLEDVLSNTDGQVIAVYRLRASRAGKVLDQREAI
FT                   LVTVAGGRITRLSEFYADPAATESFWA"
FT   CDS_pept        66910..68598
FT                   /transl_table=11
FT                   /gene="fadD34"
FT                   /locus_tag="BCG_0066"
FT                   /product="Probable fatty-acid-coa ligase fadD34
FT                   (FATTY-ACID-COA SYNTHETASE) (FATTY-ACID-COA SYNTHASE)"
FT                   /EC_number="6.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70050"
FT                   /db_xref="GOA:A0A0H3M760"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M760"
FT                   /protein_id="CAL70050.1"
FT                   /translation="MTAALLSPAIAWQQISACTDRTLTITCEDSEVISYQDLIARAAAC
FT                   IPPLRRLDLKRGEPVLITAHTNLEFLSCFLGLMLHGAVPVPIPPREALKTTERFMTRLG
FT                   PLLRHHRVLICTPAEHDEIRAAASTDCQISRFTALAEAGDEQFGRATAQQLADTATADW
FT                   PLCTLDDDAYVQYTSGSTAAPRGVVITYRNLLSNMRAMAVGSQFQHGDVMGSWLPLHHD
FT                   MGLVGSLFAALFNSVSAVFTTPHRFLYDPLGFLRLLTSSGATHTFMPNFALEWLINAYH
FT                   RRGADIEGIDLHKMRRLIIASEPVHAEGMRRFAATFAGVGLAPTALGSGYGLAEATVAV
FT                   SMSAPNTGFRTETHAAAEVVTGGRVLPGYEVRIDAAPGARAGTIKLRGDSVAAKAYVGG
FT                   KKLDALDEEGFCDTHDLGFLVDDEIVILGRQDEVFIVHGENRFPYDIEFIIRGESEQHR
FT                   TKVACFGVNERVVVVLESPLDSIIDKAEADRLRCQVVAATGLQLDELITVRRGAIPTTT
FT                   SGKLKRRAVAQAYRDGTLPRLATHAWTADPDSAPKTTRSSLEGAH"
FT   CDS_pept        complement(68799..69479)
FT                   /transl_table=11
FT                   /gene="BCG_0067c"
FT                   /locus_tag="BCG_0067c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Differs from Mb0037c and Rv0036c by 1aa, L186P, and
FT                   at C-terminal end due to frameshift resulting from 1 bp
FT                   deletion at position equivalent to Mycobacterium
FT                   tuberculosis H37Rv2, 39228-39228, after codon 202"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0067c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70051"
FT                   /db_xref="GOA:A0A0H3M2D2"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR017518"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2D2"
FT                   /protein_id="CAL70051.1"
FT                   /translation="MADPGPFVADLRAESDDLDALVAHLPADRWADPTPAPGWTIAHQI
FT                   GHLLWTDRVALTAVTDEAGFAELMTAAAANPAGFVDDAATELAAVSPAELLTDWRVTRG
FT                   RLHEELLAVPDGRKLAWFGPPMSAASMATARLMETWAHGLDVADALGVIRPATQRLRSI
FT                   AHLGVRTRDYAFIVNNLTPPAELFLVELRGPSGDTWSWGHPMRPSGSPGPPRTSASWSP
FT                   SGAR"
FT   CDS_pept        complement(69527..70852)
FT                   /transl_table=11
FT                   /gene="BCG_0068c"
FT                   /locus_tag="BCG_0068c"
FT                   /product="Probable conserved integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0068c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70052"
FT                   /db_xref="GOA:A0A0H3M9L9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M9L9"
FT                   /protein_id="CAL70052.1"
FT                   /translation="MPRVEVGLVIHSRMHARAPVDVWRSVRSLPDFWRLLQVRVASQFG
FT                   DGLFQAGLAGALLFNPDRAADPMAIAGAFAVLFLPYSLLGPFAGALMDRWDRRWVLVGA
FT                   NTGRLALIAGVGTILAVGAGDVPLLVGALVANGLARFVASGLSAALPHVVPREQVVTMN
FT                   SVAIASGAVSAFLGANFMLLPRWLLGSGDEGASAIVFLVAIPVSIALLWSLRFGPRVLG
FT                   PDDTERAIHGSAVYAVVTGWLHGARTVVQLPTVAAGLSGLAAHRMVVGINSLLILLLVR
FT                   HVTARAVGGLGTALLFFAATGLGAFLANVLTPTAIRRWGRYATANGALAAAATIQVAAA
FT                   GLLVPVMVVCGFLLGVAGQVVKLCADSAMQMDVDDALRGHVFAVQDALFWVSYILSITV
FT                   AAALIPEHGHAPVFVLFGSAIYLAGLVVHTIVGRRGQPVIGR"
FT   CDS_pept        70954..71562
FT                   /transl_table=11
FT                   /gene="BCG_0069"
FT                   /locus_tag="BCG_0069"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70053"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KEK6"
FT                   /protein_id="CAL70053.1"
FT                   /translation="MVAPHEDPEDHVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVE
FT                   HNDGGTLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRVGADP
FT                   EGVPGLRHVAGRLVMVDLDADPEVLAAAVEGVRIYAGYSGWTIGQLEGEIERDDWIVLS
FT                   ALPSDVLVGPRADLWGQVLRRQPLPLSLLATHPIDLSRN"
FT   CDS_pept        complement(71654..72001)
FT                   /transl_table=11
FT                   /gene="BCG_0070c"
FT                   /locus_tag="BCG_0070c"
FT                   /product="Possible conserved transmembrane protein"
FT                   /note="Differs from Rv0039c by 1aa, F24C"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0070c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70054"
FT                   /db_xref="GOA:A0A0H3M162"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M162"
FT                   /protein_id="CAL70054.1"
FT                   /translation="MFLAGVLCMCAAAASALFGSWSLFHTPTADPTALALRAMAPTQLA
FT                   AAVMLAAGGVVAVAAPGHTALMVVIVCIAGAVGTLAAGSWQSAQYALRRETASPTANCV
FT                   GSCAVCTQACH"
FT   CDS_pept        complement(72083..73015)
FT                   /transl_table=11
FT                   /gene="mtc28"
FT                   /locus_tag="BCG_0071c"
FT                   /product="Secreted proline rich protein MTC28 (PROLINE RICH
FT                   28 KDA ANTIGEN)"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0071c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70055"
FT                   /db_xref="InterPro:IPR019674"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M0J7"
FT                   /protein_id="CAL70055.1"
FT                   /translation="MIQIARTWRVFAGGMATGFIGVVLVTAGKASADPLLPPPPIPAPV
FT                   SAPATVPPVQNLTALPGGSSNRFSPAPAPAPIASPIPVGAPGSTAVPPLPPPVTPAISG
FT                   TLRDHLREKGVKLEAQRPHGFKALDITLPMPPRWTQVPDPNVPDAFVVIADRLGNSVYT
FT                   SNAQLVVYRLIGDFDPAEAITHGYIDSQKLLAWQTTNASMANFDGFPSSIIEGTYREND
FT                   MTLNTSRRHVIATSGADKYLVSLSVTTALSQAVTDGPATDAIVNGFQVVAHAAPAQAPA
FT                   PAPGSAPVGLPGQAPGYPPAGTLTPVPPR"
FT   CDS_pept        73212..76121
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="BCG_0072"
FT                   /product="Probable leucyl-trna synthetase leuS"
FT                   /EC_number="6.1.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70056"
FT                   /db_xref="GOA:A1KEK9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KEK9"
FT                   /protein_id="CAL70056.1"
FT                   /translation="MTESPTAGPGGVPRADDADSDVPRYRYTAELAARLERTWQENWAR
FT                   LGTFNVPNPVGSLAPPDGAAVPDDKLFVQDMFPYPSGEGLHVGHPLGYIATDVYARYFR
FT                   MVGRNVLHALGFDAFGLPAEQYAVQTGTHPRTRTEANVVNFRRQLGRLGFGHDSRRSFS
FT                   TTDVDFYRWTQWIFLQIYNAWFDTTANKARPISELVAEFESGARCLDGGRDWAKLTAGE
FT                   RADVIDEYRLVYRADSLVNWCPGLGTVLANEEVTADGRSDRGNFPVFRKRLRQWMMRIT
FT                   AYADRLLDDLDVLDWPEQVKTMQRNWIGRSTGAVALFSARAASDDGFEVDIEVFTTRPD
FT                   TLFGATYLVLAPEHDLVDELVAASWPAGVNPLWTYGGGTPGEAIAAYRRAIAAKSDLER
FT                   QESREKTGVFLGSYAINPANGEPVPIFIADYVLAGYGTGAIMAVPGHDQRDWDFARAFG
FT                   LPIVEVIAGGNISESAYTGDGILVNSDYLNGMSVPAAKRAIVDRLESAGRGRARIEFKL
FT                   RDWLFARQRYWGEPFPIVYDSDGRPHALDEAALPVELPDVPDYSPVLFDPDDADSEPSP
FT                   PLAKATEWVHVDLDLGDGLKPYSRDTNVMPQWAGSSWYELRYTDPHNSERFCAKENEAY
FT                   WMGPRPAEHGPDDPGGVDLYVGGAEHAVLHLLYSRFWHKVLYDLGHVSSREPYRRLVNQ
FT                   GYIQAYAYTDARGSYVPAEQVIERGDRFVYPGPDGEVEVFQEFGKIGKSLKNSVSPDEI
FT                   CDAYGADTLRVYEMSMGPLEASRPWATKDVVGAYRFLQRVWRLVVDEHTGETRVADGVE
FT                   LDIDTLRALHRTIVGVSEDFAALRNNTATAKLIEYTNHLTKKHRDAVPRAAVEPLVQML
FT                   APLAPHIAEELWLRLGNTTSLAHGPFPKADAAYLVDETVEYPVQVNGKVRGRVVVAADT
FT                   DEETLKAAVLTDEKVQAFLAGATPRKVIVVAGRLVNLVI"
FT   CDS_pept        complement(76231..76857)
FT                   /transl_table=11
FT                   /gene="BCG_0073c"
FT                   /locus_tag="BCG_0073c"
FT                   /product="Possible transcriptional regulatory protein
FT                   (marR-FAMILY)"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0073c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70057"
FT                   /db_xref="GOA:A0A0H3M764"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M764"
FT                   /protein_id="CAL70057.1"
FT                   /translation="MSVVRSIGKKMQRISGPNALAVKGRPTQVYGHTHVRLDCRFMADS
FT                   EFTAPEVTQLAEGLHRALSKLISMLRRGDPNGAAAGDLTLAQLSILVTLLDQGPIRMTD
FT                   LAAHERVRTPTTTVAIRRLEKIGLVKRSRDPSDLRAVLVDITPQGRAVHGESLANRRAA
FT                   LAALLSQLPRSDLETLRKALAPLERLASGEPASGPASNSPARKRA"
FT   CDS_pept        complement(77016..77750)
FT                   /transl_table=11
FT                   /gene="BCG_0074c"
FT                   /locus_tag="BCG_0074c"
FT                   /product="Probable transcriptional regulatory protein
FT                   (probably gntR-FAMILY)"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0074c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70058"
FT                   /db_xref="GOA:A0A0H3M2D6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2D6"
FT                   /protein_id="CAL70058.1"
FT                   /translation="MPKKYGVKEKDQVVAHILNLLLTGKLRSGDRVDRNEIAHGLGVSR
FT                   VPIQEALVQLEHDGIVSTRYHRGAFIERFDVATILEHHELDGLLNGIASARAAANPTPR
FT                   ILGQLDAVMRSLRNSKESRAFAECVWEYRRTVNDEYAGPRLHATIRASQNLIPRVFWMT
FT                   YQNSRDDVLPFYEEENAAIHRREPEAARAACIGRSELMAQTMLAELFRRRVLVPPEGAC
FT                   PGPFGAPIPGFARSYQPSSPVP"
FT   CDS_pept        complement(77883..78677)
FT                   /transl_table=11
FT                   /gene="BCG_0075c"
FT                   /locus_tag="BCG_0075c"
FT                   /product="Possible oxidoreductase"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0075c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70059"
FT                   /db_xref="GOA:A0A0H3M9M2"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR022480"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M9M2"
FT                   /protein_id="CAL70059.1"
FT                   /translation="MTSLVRPDLPVRIGVQLQPQHAPHYRAVRDAVRRCEDIGVDIAFT
FT                   WDHFFPLYGDPDGPHFECWTVLGAWAEQTSHIEIGALVTCNSYRNPELLADMARTVDHI
FT                   SGGRLILGIGSGWKQKDYDEYGYRFGTAGSRLDDLAAALPRIKARLGKLNPPPTRDIPV
FT                   LIGGGGERKTLRLVAEYADIWHSFTAGDSYLAKSAVLSTHCSTVGRNPATIERSAAVDG
FT                   GGLIASAEALAGLGVTLLTVGCDGPDYDLSAAAALCRWRDGR"
FT   CDS_pept        complement(78693..79589)
FT                   /transl_table=11
FT                   /gene="BCG_0076c"
FT                   /locus_tag="BCG_0076c"
FT                   /product="Possible hydrolase"
FT                   /EC_number="3.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0076c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70060"
FT                   /db_xref="GOA:A0A0H3M168"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M168"
FT                   /protein_id="CAL70060.1"
FT                   /translation="MLSDDELTGLDEFALLAENAEQAGVNGPLPEVERVQAGAISALRW
FT                   GGSAPRVIFLHGGGQNAHTWDTVIVGLGEPALAVDLPGHGHSAWREDGNYSPQLNSETL
FT                   APVLRELAPGAEFVVGMSLGGLTAIRLAAMAPDLVGELVLVDVTPSALQRHAELTAEQR
FT                   GTVALMHGEREFPSFQAMLDLTIAAAPHRDVKSLRRGVFHNSRRLDNGNWVWRYDAIRT
FT                   FGDFAGLWDDVDALSAPITLVRGGSSGFVTDQDTAELHRRATHFRGVHIVEKSGHSVQS
FT                   DQPRALIEIVRGVLDTR"
FT   CDS_pept        complement(79671..80774)
FT                   /transl_table=11
FT                   /gene="ino1"
FT                   /locus_tag="BCG_0077c"
FT                   /standard_name="tbINO"
FT                   /product="Myo-inositol-1-phosphate synthase INO1"
FT                   /EC_number="5.5.1.4"
FT                   /note="Differs from Mb0047c by 1aa, T120I, and from Rv0046c
FT                   by 2aa, T120I, G190R"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0077c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70061"
FT                   /db_xref="GOA:A0A0H3M0K1"
FT                   /db_xref="InterPro:IPR002587"
FT                   /db_xref="InterPro:IPR013021"
FT                   /db_xref="InterPro:IPR017815"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M0K1"
FT                   /protein_id="CAL70061.1"
FT                   /translation="MSEHQSLPAPEASTEVRVAIVGVGNCASSLVQGVEYYYNADDTST
FT                   VPGLMHVRFGPYHVRDVKFVAAFDVDAKKVGFDLSDAIFASENNTIKIADVAPTNVIVQ
FT                   RGPTLDGIGKYYADTTELSDAEPVDVVQALKEAKVDVLVSYLPVGSEEADKFYAQCAID
FT                   AGVAFVNALPVFIASDPVWAKKFTDAGVPIVGDDIKSQVGATITHRVLAKLFEDRGVQL
FT                   DRTMQLNVGGNMDFLNMLERERLESKKISKTQAVTSNLKREFKTKDVHIGPSDHVGWLD
FT                   DRKWAYVRLEGRAFGDVPLNLEYKLEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPVIPA
FT                   SAYLMKSPPEQLPDDIARAQLEEFIIG"
FT   CDS_pept        complement(80835..81377)
FT                   /transl_table=11
FT                   /gene="BCG_0078c"
FT                   /locus_tag="BCG_0078c"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0078c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70062"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M768"
FT                   /protein_id="CAL70062.1"
FT                   /translation="MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRR
FT                   MQADGLIAENAAPAGTPVRRARRVYQLTDKGRRRFGELVADTGPHNYTDDGFGVHLAFF
FT                   NRTPAEARMRILEGRRRQVEERREGLREAVARASSSFDRYTRQLHQLGLESSEREVKWL
FT                   NELIAAERAAPNPAEQT"
FT   CDS_pept        complement(81478..82347)
FT                   /transl_table=11
FT                   /gene="BCG_0079c"
FT                   /locus_tag="BCG_0079c"
FT                   /product="Possible membrane protein"
FT                   /note="Differs from Rv0048c by 1aa, A250V"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0079c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70063"
FT                   /db_xref="GOA:A0A0H3M2E0"
FT                   /db_xref="InterPro:IPR012551"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2E0"
FT                   /protein_id="CAL70063.1"
FT                   /translation="MAKWLGAPLARGVSTATRAKDSDRQDACRILDDALRDGELSMEEH
FT                   RERVSAATKAVTLGDLQRLVADLQVESAPAQMPALKSRAKRTELGLLAAAFVASVLLGV
FT                   GIGWGVYGNTRSPLDFTSDPGAKPDGIAPVVLTPPRQLHSLGGLTGLLEQTRKRFGDTM
FT                   GYRLVIYPEYASLDRVDPADDRRVLAYTYRGGWGDATSSAKSIADVSVVDLSKFDAKTA
FT                   VSIMRGAPETLGLKQSDVKSMYLIVEPAKDPTTPAALSLSLYVSSDYGGGYLVFAGDGT
FT                   IKHVSYPS"
FT   CDS_pept        82481..82894
FT                   /transl_table=11
FT                   /gene="BCG_0080"
FT                   /locus_tag="BCG_0080"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70064"
FT                   /db_xref="InterPro:IPR035169"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M9M8"
FT                   /protein_id="CAL70064.1"
FT                   /translation="MDYTLRRRSLLAEVYSGRTGVSEVCDANPYLLRAAKFHGKPSRVI
FT                   CPICRKEQLTLVSWVFGEHLGAVSGSARTAEELILLATRFSEFAVHVVEVCRTCSWNHL
FT                   VKSYVLGAARPARPPRGSGGTRTARNGARTASE"
FT   CDS_pept        83313..85358
FT                   /transl_table=11
FT                   /gene="ponA1"
FT                   /locus_tag="BCG_0081"
FT                   /product="Probable bifunctional penicillin-binding protein
FT                   1A/1B PONA1"
FT                   /EC_number="2.4.2.-"
FT                   /EC_number="3.4.-.-"
FT                   /note="In Mycobacterium bovis BCG Pasteur, insertion of 3
FT                   codons after position 632 leads to a slightly longer
FT                   product compared to its homologs in Mycobacterium
FT                   tuberculosis strain H37Rv (681 aa versus 678 aa) and
FT                   Mycobacterium bovis AF2122/97 (681 aa versus 680 aa). In
FT                   addition, differs from Rv0050 by 1aa, L6P"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0081"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70065"
FT                   /db_xref="GOA:A0A0H3M173"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M173"
FT                   /protein_id="CAL70065.1"
FT                   /translation="MVILLLMVTFTMAYLIVDVPKPGDIRTNQVSTILASDGSEIAKIV
FT                   PPEGNRVDVNLSQVPMHVRQAVIAAEDRNFYSNPGFSFTGFARAVKNNLFGGDLQGGST
FT                   ITQQYVKNALVGSAQHGWSGLMRKAKELVIATKMSGEWSKDDVLQAYLNIIYFGRGAYG
FT                   ISAASKAYFDKPVEQLTVAEGALLAALIRRPSTLDPAVDPEGAHARWNWVLDGMVETKA
FT                   LSPNDRAAQVFPETVPPDLARAENQTKGPNGLIERQVTRELLELFNIDEQTLNTQGLVV
FT                   TTTIDPQAQRAAEKAVAKYLDGQDPDMRAAVVSIDPHNGAVRAYYGGDNANGFDFAQAG
FT                   LQTGSSFKVFALVAALEQGIGLGYQVDSSPLTVDGIKITNVEGEGCGTCNIAEALKMSL
FT                   NTSYYRLMLKLNGGPQAVADAAHQAGIASSFPGVAHTLSEDGKGGPPNNGIVLGQYQTR
FT                   VIDMASAYATLAASGIYHPPHFVQKVVSANGQVLFDASTADNTGDQRIPKAVADNVTAA
FT                   MEPIAGYSRGHNLAGGRDSAAKTGTTQFGDTTANKDAWMVGYTPSLSTAVWVGTVKGDE
FT                   PLVTASGAAIYGSGLPSDIWKATMDGALKGTSNETFPKPTEVGGYAGVPPPPPPPPPSE
FT                   VPPSETVIQPTVEIAPGITIPIGPPTTITLAPPPPAPPAATPTPPP"
FT   CDS_pept        85355..87037
FT                   /transl_table=11
FT                   /gene="BCG_0082"
FT                   /locus_tag="BCG_0082"
FT                   /product="Probable conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70066"
FT                   /db_xref="GOA:A0A0H3M0K6"
FT                   /db_xref="InterPro:IPR016570"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M0K6"
FT                   /protein_id="CAL70066.1"
FT                   /translation="MTGALSQSSNISPLPLAADLRSADNRDCPSRTDVLGAALANVVGG
FT                   PVGRHALIGRTRLMTPLRVMFAIALVFLALGWSTKAACLQSTGTGPGDQRVANWDNQRA
FT                   YYQLCYSDTVPLYGAELLSQGKFPYKSSWIETDSNGTPQLRYDGQIAVRYMEYPVLTGI
FT                   YQYLSMAIAKTYTALSKVAPLPVVAEVVMFFNVAAFGLALAWLTTVWATSGLAGRRIWD
FT                   AALVAASPLVIFQIFTNFDALATGLATSGLLAWARRRPVLAGVLIGLGSAAKLYPLLFL
FT                   YPLLLLGIRAGRLNALARTMAAAAATWLLVNLPVMLLFPRGWSEFFRLNTRRGDDMDSL
FT                   YNVVKSFTGWRGFDPTLGFWEPPLVLNTVVTLLFVLCCAAIAYIALTAPHRPRVAQLTF
FT                   LTVASFLLVNKVWSPQFSLWLVPLAVLALPHRRILLAWMTIDALVWVPRMYYLYGNPSR
FT                   SLPEQWFTTTVLLRDIAVMVLCGLVVWQIYRPGRDLVRTGGPGALPACGGVDDPVGGVF
FT                   ANAADAPPGRLPSWLRPRLGDEHARERTPDAGRDRTFSGQHRA"
FT   CDS_pept        87069..87632
FT                   /transl_table=11
FT                   /gene="BCG_0083"
FT                   /locus_tag="BCG_0083"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70067"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M772"
FT                   /protein_id="CAL70067.1"
FT                   /translation="MPSFDVVFVGHRRGEVRSDNAMLGLLCDAAFDELTRPDVVIFPGG
FT                   IGTRTLIHDQTVLDWVREAHRHTLLTTSVCTGGLVLAAAGLLNGLTATTHWRVQDLFNS
FT                   LGARYVPQRVVEHLPERVITAAGVSSGIDMGLRLVELLVSREAAEASQLMIEYDPQPPV
FT                   DAGSLAKASPATHRLALEFYQHRL"
FT   CDS_pept        87851..88141
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="BCG_0084"
FT                   /product="Probable 30s ribosomal protein s6 rpsF"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0084"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70068"
FT                   /db_xref="GOA:A1KEM1"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KEM1"
FT                   /protein_id="CAL70068.1"
FT                   /translation="MRPYEIMVILDPTLDERTVAPSLETFLNVVRKDGGKVEKVDIWGK
FT                   RRLAYEIAKHAEGIYVVIDVKAAPATVSELDRQLSLNESVLRTKVMRTDKH"
FT   CDS_pept        88245..88739
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="BCG_0085"
FT                   /product="Probable single-strand binding protein ssb"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0085"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70069"
FT                   /db_xref="GOA:A0A0H3M2E5"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2E5"
FT                   /protein_id="CAL70069.1"
FT                   /translation="MAGDTTITIVGNLTADPELRFTPSGAAVANFTVASTPRIYDRQTG
FT                   EWKDGEALFLRCNIWREAAENVAESLTRGARVIVSGRLKQRSFETREGEKRTVIEVEVD
FT                   EIGPSLRYATAKVNKASRSGGFGSGSRPAPAQTSSASGDDPWGSAPASGSFGGGDDEPP
FT                   F"
FT   CDS_pept        88781..89035
FT                   /transl_table=11
FT                   /gene="rpsR1"
FT                   /locus_tag="BCG_0086"
FT                   /product="Probable 30s ribosomal protein s18-1 rpsR1"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0086"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70070"
FT                   /db_xref="GOA:A1KEM3"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KEM3"
FT                   /protein_id="CAL70070.1"
FT                   /translation="MAKSSKRRPAPEKPVKTRKCVFCAKKDQAIDYKDTALLRTYISER
FT                   GKIRARRVTGNCVQHQRDIALAVKNAREVALLPFTSSVR"
FT   CDS_pept        89068..89526
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="BCG_0087"
FT                   /product="Probable 50s ribosomal protein l9 rplI"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0087"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70071"
FT                   /db_xref="GOA:A1KEM4"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KEM4"
FT                   /protein_id="CAL70071.1"
FT                   /translation="MKLILTADVDHLGSIGDTVEVKDGYGRNFLLPRGLAIVASRGAQK
FT                   QADEIRRARETKSVRDLEHANEIKAAIEALGPIALPVKTSADSGKLFGSVTAADVVAAI
FT                   KKAGGPNLDKRIVRLPKTHIKAVGTHFVSVHLHPEIDVEVSLDVVAQS"
FT   CDS_pept        89555..90076
FT                   /transl_table=11
FT                   /gene="BCG_0088"
FT                   /locus_tag="BCG_0088"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70072"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M9N3"
FT                   /protein_id="CAL70072.1"
FT                   /translation="MPVVTAVGRRRGFAMPWVSTARSGAVMLANYSAGVCGRVSSPGLN
FT                   VRKMCLKANTPGAVTWLDTPKRFLSTQTASRCMAVNSSDVVTGRIDPQVLHTPLNTDVD
FT                   GYAHAMHSSINSGPLEYLPATFSVFPALGDVGDLGGGVGAATYALDRLSNMRSGACVGG
FT                   GESPWRSLMT"
FT   CDS_pept        90055..92679
FT                   /transl_table=11
FT                   /gene="dnaB"
FT                   /locus_tag="BCG_0089"
FT                   /product="Probable replicative dna helicase dnaB"
FT                   /EC_number="3.6.1.-"
FT                   /note="Differs from Rv0058 by 1aa, G552R"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70073"
FT                   /db_xref="GOA:A0A0H3M178"
FT                   /db_xref="InterPro:IPR003586"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004042"
FT                   /db_xref="InterPro:IPR004860"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR006142"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR030934"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M178"
FT                   /protein_id="CAL70073.1"
FT                   /translation="MAVVDDLAPGMDSSPPSEDYGRQPPQDLAAEQSVLGGMLLSKDAI
FT                   ADVLERLRPGDFYRPAHQNVYDAILDLYGRGEPADAVTVAAELDRRGLLRRIGGAPYLH
FT                   TLISTVPTAANAGYYASIVAEKALLRRLVEAGTRVVQYGYAGAEGADVAEVVDRAQAEI
FT                   YDVADRRLSEDFVALEDLLQPTMDEIDAIASSGGLARGVATGFTELDEVTNGLHPGQMV
FT                   IVAARPGVGKSTLGLDFMRSCSIRHRMASVIFSLEMSKSEIVMRLLSAEAKIKLSDMRS
FT                   GRMSDDDWTRLARRMSEISEAPLFIDDSPNLTMMEIRAKARRLRQKANLKLIVVDYLQL
FT                   MTSGKKYESRQVEVSEFSRHLKLLAKELEVPVVAISQLNRGPEQRTDKKPMLADLRESG
FT                   CLTASTRILRADTGAEVAFGELMRSGERPMVWSLDERLRMVARPMINVFPSGRKEVFRL
FT                   RLASGREVEATGSHPFMKFEGWTPLAQLKVGDRIAAPRRVPEPIDTQRMPESELISLAR
FT                   MIGDGSCLKNQPIRYEPVDEANLAAVTVSAAHSDGAAIRDDYLAARVPSLRPARQRLPR
FT                   GRCTPIAAWLAGLGLFTKRSHEKCVPEAVFRAPNDQVALFLRHLWSAGGSVRWDPTNGQ
FT                   GRVYYGSTSRRLIDDVAQLLLRVGIFSWITHAPKLGGHDSWRLHIHGAKDQVRFLRHVG
FT                   VHGAEAVAAQEMLRQLKGPVRNPNLDSAPKKVWAQVRNRLSAKQMMDIQLHEPTMWKHS
FT                   PSRSRPHRAEARIEDRAIHELARGDAYWDTVVEITSIGDQHVFDGTVSGTHNFVANGIS
FT                   LHNSLEQDADVVILLHRPDAFDRDDPRGGEADFILAKHRNGPTKTVTVAHQLHLSRFAN
FT                   MAR"
FT   CDS_pept        92859..93551
FT                   /transl_table=11
FT                   /gene="BCG_0090"
FT                   /locus_tag="BCG_0090"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0090"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70074"
FT                   /db_xref="InterPro:IPR029494"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M0L1"
FT                   /protein_id="CAL70074.1"
FT                   /translation="MITRYKPESGFVARSGGPDRKRPHDWIVWHFTHADNLPGIITAGR
FT                   LLADSAVTPTTEVAYNPVKELRRHKVVAPDSRYPASMASDHVPFYIAARSPMLYVVCKG
FT                   HSGYSGGAGPLVHLGVALGDIIDADLTWCASDGNAAASYTKFSRQVDTLGTFVDFDLLC
FT                   QRQWHNTDDDPNRQSRRAAEILVYGHVPFELVSYVCCYNTETMTRVRTLLDPVGGVRKY
FT                   VIKPGMYY"
FT   CDS_pept        93568..94626
FT                   /transl_table=11
FT                   /gene="BCG_0091"
FT                   /locus_tag="BCG_0091"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0091"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70075"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M776"
FT                   /protein_id="CAL70075.1"
FT                   /translation="MITYGSGDLLRADTEALVNTVNCVGVMGKGIALQFKRRYPEMFTA
FT                   YEKACKRGEVTIGKMFVVDTGQLDGPKHIINFPTKKHWRAPSKLAYIDAGLIDLIRVIR
FT                   ELNIASVAVPPLGVGNGGLDWEDVEQRLVSAFQQLPDVDAVIYPPSGGSRAIEGVEGLR
FT                   MTWGRAVILEAMRRYLQQRRAMEPWEDPAGISHLEIQKLMYFANEADPDLALDFTPGRY
FT                   GPYSERVRHLLQGMEGAFTVGLGDGTARVLANQPISLTTKGTDAITDYLATDAAADRVS
FT                   AAVDTVLRVIEGFEGPYGVELLASTHWVATREGAKEPATAAAAVRKWTKRKGRIYSDDR
FT                   IGVALDRILMTA"
FT   CDS_pept        94650..95075
FT                   /transl_table=11
FT                   /gene="BCG_0092"
FT                   /locus_tag="BCG_0092"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0092"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70076"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2E9"
FT                   /protein_id="CAL70076.1"
FT                   /translation="MCADAQPSGSVGLLGRNCPTATTRWRRAGEGLTAADTIEVKLWAG
FT                   KPRLHPLVPKRAVGVLLAVAHGQVAKTPSATRAIAFRHVRLMRVRWICAGNRGRKHKRR
FT                   CTTQYRSTQASKLQLHFKLRQTLNRLGGLQAMVSACG"
FT   CDS_pept        95211..96353
FT                   /transl_table=11
FT                   /gene="celA1"
FT                   /locus_tag="BCG_0093"
FT                   /product="Possible cellulase celA1 (ENDOGLUCANASE)"
FT                   /EC_number="3.2.1.4"
FT                   /note="Differs from Mb0063 by 1aa, A72D, and from Rv0062 by
FT                   2aa, A72D, V106I"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0093"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70077"
FT                   /db_xref="GOA:A0A0H3M9N6"
FT                   /db_xref="InterPro:IPR016288"
FT                   /db_xref="InterPro:IPR036434"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M9N6"
FT                   /protein_id="CAL70077.1"
FT                   /translation="MTRRTGQRWRGTLPGRRPWTRPAPATCRRHLAFVELRHYFARVMS
FT                   SAIGSVARWIVPLLGVAAVASIGVIAAPVRVVRAPALILVDAANPLAGKPFYVDPASAA
FT                   MVAARNANPPNAELTSVANTPQSYWLDQAFPPATVGGTVARYTGAAQAAGAMPVLTLYG
FT                   IPHRDCGSYASGGFATGTDYRGWIDAVASGLGSSPATIIVEPDALAMADCLSPDQRQER
FT                   FDLVRYAVDTLTRDPAAAVYVDAGHSRWLSAEAMAARLNDVGVGRARGFSLNVSNFYTT
FT                   DEEIGYGEAISGLTNGSHYVIDTSRNGAGPAPDAPLNWCNPSGRALGAPPTTATAGAHA
FT                   DAYLWIKRPGESDGTCGRGEPQAGRFVSQYAIDLAHNAGQ"
FT   CDS_pept        96582..98021
FT                   /transl_table=11
FT                   /gene="BCG_0094"
FT                   /locus_tag="BCG_0094"
FT                   /product="Possible oxidoreductase"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70078"
FT                   /db_xref="GOA:A0A0H3M182"
FT                   /db_xref="InterPro:IPR006093"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M182"
FT                   /protein_id="CAL70078.1"
FT                   /translation="MAREISRQTFLRGAAGALAAGAVFGSVRATADPAASGWEALSSAL
FT                   GGKVLQPDDGPQFATAKQVFNTNYNGYTPAVIVTPTSQLDVQKAMAFAAANNLKVAPRG
FT                   GGHSYVGASTANGAMVLDLRQLPGDINYDATTGRVTVTPATGLYAMHQVLAAAGRGIPT
FT                   GTCPTVGVAGHALGGGLGANSRHAGLLCDQLTSASVVLPSGQAVTASATDHPDLFWALR
FT                   GGGGGNFGVTTSLTFATFPSGDLDVVNLNFPPQSFAQVLVGWQNWLRTADRGSWALADA
FT                   TVDPLGTHCRILATCPAGSGGSVAAAIVSAVGTQPTGTENHTFNYLDLVRYLAVGNLNP
FT                   SPLGYVGGSDVFTTITPATAQGIASAVDAFPRGAGRMLAIMHALDGALATVSPGATAFP
FT                   WRRQSALVQWYVETSGSPSEATSWLNTAHQAVRAYSVGGYVNYLEVNQPPARYFGPNLS
FT                   RLSAVRQKYDPSRVMFSGLNF"
FT   CDS_pept        98279..101218
FT                   /transl_table=11
FT                   /gene="BCG_0095"
FT                   /locus_tag="BCG_0095"
FT                   /product="Probable conserved transmembrane protein"
FT                   /note="Differs from Mb0065 by 1aa, T435I, and from Rv0064
FT                   by 4aa, T435I, D457G, F550V, P906R"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0095"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70079"
FT                   /db_xref="GOA:A1KEN2"
FT                   /db_xref="InterPro:IPR005372"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KEN2"
FT                   /protein_id="CAL70079.1"
FT                   /translation="METGSPGKRPVLPKRARLLVTAGMGMLALLLFGPRLVDIYVDWLW
FT                   FGEVGFRSVWITVLLTRLAIVAAVALVVAGIVLAALLLAYRSRPFFVPDEPQRDPVAPL
FT                   RSAVMRRPRLFGWGIAVTLGVVCGLIASFDWVKVQLFVHGGTFGIVDPEFGYDIGFFVF
FT                   DLPFYRSVLNWLFVAVVLAFLASLLTHYLFGGLRLTTGRGMLTQAARVQLAVFAGAVVL
FT                   LKAVAYWLDRYELLSSGRKEPTFTGAGYTDIHAELPAKLVLVAIAVLCAVSFFTAIFLR
FT                   DLRIPAMAAALLVLSAILVGGLWPLLMEQFSVRPNAADVERPYIQRNIEATREAYRIGG
FT                   DWVQYRSYPGIGTKQPRDVPVDVTTIAKVRLLDPHILSRTFTQQQQLKNFFSFAEILDI
FT                   DRYRIDGELQDYIVGVRELSPKSLTGNQTDWINKHTVYTHGNGFVAAPANRVNAAARDA
FT                   ENISDSNSGYPIYAVSDIASLGSGRQVIPVEQPRVYYGEVIAQADPDYAIVGGAPGSAP
FT                   REYDTDTSKYTYTGAGGVSIGNWFNRTVFATKFAQHKFLFSREIGSESKVLIHRDPKER
FT                   VQRVAPWLTTDDNPYPVVVNGRIVWIVDAYTTLDTYPYAQRSSLEGPVTSPTGIVRQGK
FT                   QVSYVRNSVKATVDAYDGTVTLFQFDRDDPVLRTWMRAFPGTVKSEDQIPDELRAHFRY
FT                   PEDLFEVQRSLLAKYHVDEPREFFTTNAFWSVPSDPTNDANATQPPFYVLVGDQQSAQP
FT                   SFRLASAMVGYNREFLSAYISAHSDPANYGKLTVLELPTDTLTQGPQQIQNSMISDTRV
FT                   ASERTLLERSNRIHYGNLLSLPIADGGVLYVEPLYTERISTSPSSSTFPQLSRVLVSVR
FT                   EPRTEGGVRVGYAPTLAESLDQVFGPGTGRVATAPGGDAASAPPPGAGGPAPPQAVPPP
FT                   RTTQPPAAPPRGPDVPPATVAELRETLADLRAVLDRLEKAIDAAETPGG"
FT   CDS_pept        101285..101524
FT                   /transl_table=11
FT                   /gene="BCG_0095A"
FT                   /locus_tag="BCG_0095A"
FT                   /product="Conserved hypothetical protein, antitoxin"
FT                   /note="Differs from Rv0064A by 1aa,V48A"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0095A"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70080"
FT                   /db_xref="GOA:A0A0H3M0L5"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M0L5"
FT                   /protein_id="CAL70080.1"
FT                   /translation="MATIQVRDLPEDVAETYRRRATAAGQSLQTYMRTKLIEGVRGRDK
FT                   AEVIEILEQALASTASPGISRETIEASRRELRGG"
FT   CDS_pept        101517..101918
FT                   /transl_table=11
FT                   /gene="BCG_0096"
FT                   /locus_tag="BCG_0096"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0096"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70081"
FT                   /db_xref="GOA:A0A0H3M778"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M778"
FT                   /protein_id="CAL70081.1"
FT                   /translation="MDECVVDAAAVVDALAGKGASAIVLRGLLKESISNAPHLLDAEVG
FT                   HALRRAVLSDEISEEQARAALDALPYLIDNRYPHSPRLIEYTWQLRHNVTFYDALYVAL
FT                   ATALDVPLLTGDSRLAAAPGLPCEIKLVR"
FT   CDS_pept        complement(101970..104207)
FT                   /transl_table=11
FT                   /gene="icd2"
FT                   /locus_tag="BCG_0097c"
FT                   /product="Probable isocitrate dehydrogenase"
FT                   /EC_number="1.1.1.42"
FT                   /note="Differs from Rv0066c by 1aa, N117K"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0097c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70082"
FT                   /db_xref="GOA:A0A0H3M2F3"
FT                   /db_xref="InterPro:IPR004436"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2F3"
FT                   /protein_id="CAL70082.1"
FT                   /translation="MSAEQPTIIYTLTDEAPLLATYAFLPIVRAFAEPAGIKIEASDIS
FT                   VAARILAEFPDYLTEEQRVPDNLAELGRLTQLPDTNIIKLPNISASVPQLVAAIKELQD
FT                   KGYAVPDYPADPNTDQEKAIKERYARCLGSAVNPVLRQGNSDRRAPKAVKEYARKHPHS
FT                   MGEWSMASRTHVAHMRHGDFYAGEKSMTLDRARNVRMELLAKSGKTIVLKPEVPLDDGD
FT                   VIDSMFMSKKALCDFYEEQMQDAFETGVMFSLHVKATMMKVSHPIVFGHAVRIFYKDAF
FT                   AKHQELFDDLGVNVNNGLSDLYSKIESLPASQRDEIIEDLHRCHEHRPELAMVDSARGI
FT                   SNFHSPSDVIVDASMPAMIRAGGKMYGADGKLKDTKAVNPESTFSRIYQEIINFCKTNG
FT                   QFDPTTMGTVPNVGLMAQQAEEYGSHDKTFEIPEDGVANIVDVATGEVLLTENVEAGDI
FT                   WRMCIVKDAPIRDWVKLAVTRARISGMPVLFWLDPYRPHENELIKKVKTYLKDHDTEGL
FT                   DIQIMSQVRSMRYTCERLVRGLDTIAATGNILRDYLTDLFPILELGTSAKMLSVVPLMA
FT                   GGGMYETGAGGSAPKHVKQLVEENHLRWDSLGEFLALGAGFEDIGIKTGNERAKLLGKT
FT                   LDAAIGKLLDNDKSPSRKTGELDNRGSQFYLAMYWAQELAAQTDDQQLAEHFASLADVL
FT                   TKNEDVIVRELTEVQGEPVDIGGYYAPDSDMTTAVMRPSKTFNAALEAVQG"
FT   CDS_pept        complement(104325..104894)
FT                   /transl_table=11
FT                   /gene="BCG_0098c"
FT                   /locus_tag="BCG_0098c"
FT                   /product="Possible transcriptional regulatory protein
FT                   (possibly tetR-family)"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0098c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70083"
FT                   /db_xref="GOA:A0A0H3M9P3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M9P3"
FT                   /protein_id="CAL70083.1"
FT                   /translation="MAPTDRRVRADAARNRARVLEVAYQTFAADGLSVPVDEIARRAGV
FT                   GAGTVYRHFPTKEALFQAVIADRMHRIIDKGHALLKSKHPGDALFAFLRSMVLQWGATD
FT                   RGLVEALAGVGIEISSAAPEAEADFLDLLTDLLRAAQRAGTVRPDVDVLEVKTLLVGCQ
FT                   AMQSYNAELAAKVTDVALDGLRANRK"
FT   CDS_pept        104997..105908
FT                   /transl_table=11
FT                   /gene="BCG_0099"
FT                   /locus_tag="BCG_0099"
FT                   /product="Probable oxidoreductase"
FT                   /EC_number="1.-.-.-"
FT                   /note="Differs from Rv0068 by 1aa, L214V"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0099"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70084"
FT                   /db_xref="GOA:A0A0H3M187"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M187"
FT                   /protein_id="CAL70084.1"
FT                   /translation="MTKWTAADIPDQTGRTAVITGANTGLGFETAAALAAHGAHVVLAV
FT                   RNLDKGKQAAARITEATPGAEVELQELDLTSLASVRAAAAQLKSDHQRIDLLINNAGVM
FT                   YTPRQTTADGFEMQFGTNHLGHFALTGLLIDRLLPVAGSRVVTISSVGHRIRAAIHFDD
FT                   LQWERRYRRVAAYGQAKLANLLFTYELQRRLAPGGTTIAVASHPGVSNTELVRNMPRPL
FT                   VAVAAILAPLMQDAELGALPTLRAATDPAVRGGQYFGPDGFGEIRGYPKVVASSAQSHD
FT                   EQLQRRLWAVSEELTGVVYPVG"
FT   CDS_pept        complement(105933..107318)
FT                   /transl_table=11
FT                   /gene="sdaA"
FT                   /locus_tag="BCG_0100c"
FT                   /product="Probable l-serine dehydratase sdaA"
FT                   /EC_number="4.3.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0100c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70085"
FT                   /db_xref="GOA:A0A0H3M0L9"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M0L9"
FT                   /protein_id="CAL70085.1"
FT                   /translation="MTISVFDLFTIGIGPSSSHTVGPMRAANQFVVALRRRGHLDDLEA
FT                   MRVDLFGSLAATGAGHGTMSAILLGLEGCQPETITTEHKERRLAEIAASGVTRIGGVIP
FT                   VPLTERDIDLHPDIVLPTHPNGMTFTAAGPHGRVLATETYFSVGGGFIVTEQTSGNSGQ
FT                   HPCSVALPYVSAQELLDICDRLDVSISEAALRNETCCRTENEVRAALLHLRDVMVECEQ
FT                   RSIAREGLLPGGLRVRRRAKVWYDRLNAEDPTRKPEFAEDWVNLVALAVNEENASGGRV
FT                   VTAPTNGAAGIVPAVLHYAIHYTSAGAGDPDDVTVRFLLTAGAIGSLFKERASISGAEV
FT                   GCQGEVGSAAAMAAAGLAEILGGTPRQVENAAEIAMEHSLGLTCDPIAGLVQIPCIERN
FT                   AISAGKAINAARMALRGDGIHRVTLDQVIDTMRATGADMHTKYKETSAGGLAINVAVNI
FT                   VEC"
FT   CDS_pept        complement(107315..108592)
FT                   /transl_table=11
FT                   /gene="glyA2"
FT                   /locus_tag="BCG_0101c"
FT                   /product="Probable serine hydroxymethyltransferase glyA2"
FT                   /EC_number="2.1.2.1"
FT                   /note="Differs from Rv0070c by 1aa, G265E"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0101c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70086"
FT                   /db_xref="GOA:A0A0H3M782"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M782"
FT                   /protein_id="CAL70086.1"
FT                   /translation="MNTLNDSLTAFDPDIAALIDGELRRQESGLEMIASENYAPLAVMQ
FT                   AQGSVLTNKYAEGYPGRRYYGGCEFVDGVEQLAIDRVKALFGAEYANVQPHSGATANAA
FT                   TMHALLNPGDTILGLSLAHGGHLTHGMRINFSGKLYHATAYEVSKEDYLVDMDAVAEAA
FT                   RTHRPKMIIAGWSAYPRQLDFARFRAIADEVDAVLMVDMAHFAGLVAAGVHPSPVPHAH
FT                   VVTSTTHKTLGGPRGGIILCNDPAIAKKINSAVFPGQQGGPLGHVIAAKATAFKMAAQP
FT                   EFAQRQQRCLDGARILAGRLTQPDVAERGIAVLTGGTDVHLVLVDLRDAELDGQQAEDR
FT                   LAAVDITVNRNAVPFDPRPPMITSGLRIGTPALAARGFSHNDFRAVADLIAAALTATND
FT                   DQLGPLRAQVQRLAARYPLYPELHRT"
FT   CDS_pept        109182..109934
FT                   /transl_table=11
FT                   /gene="BCG_0102"
FT                   /locus_tag="BCG_0102"
FT                   /product="Possible maturase"
FT                   /note="In Mycobacterium bovis BCG Pasteur, a 45 bp
FT                   insertion (5 copies of VDP repeat) leads to longer products
FT                   compared to its homologs in Mycobacterium tuberculosis
FT                   strain H37Rv (250 aa versus 235 aa) and Mycobacterium bovis
FT                   (250 aa versus 238 aa)"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0102"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70087"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2F7"
FT                   /protein_id="CAL70087.1"
FT                   /translation="MSSITVSVDPVDPVDPVDPVDPVDPVDPVDPVDPVDPVDAVVAAG
FT                   SDGLTVARIESEIGALEFLNELRTELKSGQFRPQPVRERKIPKPGGLGKVRRLGIPTVA
FT                   DRVVQAALKLVLEPIFETDFEPVSYGFRPARRAHDTIAEIHLFGTQEYRWVLDADIKAC
FT                   FDRIDHADLMDRVRHRIKDKRVLRLVNWQRIRHRWNWTDVRRWLTDPTGRWHPISADGI
FT                   TLFNPAAVPIRRYRYRGNTIPTPWTQAV"
FT   repeat_region   109977..110291
FT                   /locus_tag="REP'-1"
FT                   /rpt_family="REP"
FT                   /note="REP'-1, len: 315 nt. Equivalent to REP', len: 315
FT                   nt, from Mycobacterium tuberculosis strain H37Rv, (100.0%
FT                   identity in 315 nt overlap). Probable pseudogene fragment,
FT                   len: 105 aa; similar to many Mycobacterium tuberculosis
FT                   proteins inside REP13E12 elements eg. TR:Q50655
FT                   (EMBL:Z95390) MTCY13E12.20 (317 aa), FASTA scores; opt: 324
FT                   z-score: 432.5 E(): 6.8e-17, 43.4% identity in 99 aa
FT                   overlap, but no possible startsite"
FT   CDS_pept        110365..111414
FT                   /transl_table=11
FT                   /gene="BCG_0103"
FT                   /locus_tag="BCG_0103"
FT                   /product="Probable glutamine-transport transmembrane
FT                   protein ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0103"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70088"
FT                   /db_xref="GOA:A0A0H3M9Q2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M9Q2"
FT                   /protein_id="CAL70088.1"
FT                   /translation="MLFAALRDMQWRKRRLVITIISTGLIFGMTLVLTGLANGFRVEAR
FT                   HTVDSMGVDVFVVRSGAAGPFLGSIPFPDVDLARVAAEPGVMAAAPLGSVGTIMKEGTS
FT                   TRNVTVFGAPEHGPGMPRVSEGRSPSKPDEVAASSTMGRHLGDTVEVGARRLRVVGIVP
FT                   NSTALAKIPNVFLTTEGLQKLAYNGQPNITSIGIIGMPRQLPEGYQTFDRVGAVNDLVR
FT                   PLKVAVNSISIVAVLLWIVAVLIVGSVVYLSALERLRDFAVFKAIGTPTRSIMAGLALQ
FT                   ALVIALLAAVVGVVLAQVLAPLFPMIVAVPVGAYLALPVAAIVIGLFASVAGLKRVVTV
FT                   DPAQAFGGP"
FT   CDS_pept        111417..112409
FT                   /transl_table=11
FT                   /gene="BCG_0104"
FT                   /locus_tag="BCG_0104"
FT                   /product="Probable glutamine-transport atp-binding protein
FT                   ABC transporter glnQ"
FT                   /note="In Mycobacterium tuberculosis strain H37Rv, Rv0073
FT                   exists as a single gene as in Mycobacterium bovis BCG
FT                   Pasteur. In Mycobacterium bovis, a frameshift due to a
FT                   single base deletion (a-*) splits Rv0073 into 2 parts,
FT                   Mb0074 and Mb0075"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0104"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70089"
FT                   /db_xref="GOA:A0A0H3M191"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M191"
FT                   /protein_id="CAL70089.1"
FT                   /translation="MGDLSIQNLVVEYYSGGYALRPINGLNLDVAAGSLVMLLGPSGCG
FT                   KTTLLSCLGGILRPKSGAIKFDEVDITTLQGAELANYRRNKVGIVFQAFNLVPSLTAVE
FT                   NVMVPLRSAGMSRRASRRRAEELLARVNLAERMNHRPGDLSGGQQQRVAVARAIALDPP
FT                   LILADEPTAHLDFIQVEEVLRLIRELADGERVVVVATHDSRMLPMADRVVELTPDFAET
FT                   NRPPETVHLQAGEVLFEQSTMGDLIYVVSEGEFEIVHELADGGEELVKVAGPGDYFGEI
FT                   GVLFHLPRSATVRARSDATAVGYTVQAFRERLGVGGLRDLIEHRALAND"
FT   CDS_pept        112489..113724
FT                   /transl_table=11
FT                   /gene="BCG_0105"
FT                   /locus_tag="BCG_0105"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0105"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70090"
FT                   /db_xref="GOA:A0A0H3M0M3"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M0M3"
FT                   /protein_id="CAL70090.1"
FT                   /translation="MGDLSISQVSARPGRIGIRARQMFDGYRFQRGPVLVVVEDGRISA
FT                   VDFAGSACPDMNLVDLGESTLLPGLVDAHAHLCWDPDGRPEDLAGDPHAVLVGRARRHA
FT                   AAALRSGITTIRDLGDRDYAALALREEYRQKTTVGPELVVSGPPLTRSGGHCWFLGGVA
FT                   DSVEELVDAVQERAARGADWIKVMATGGFVTTASDPWQPQYGSGQLAAVVAAAEQVGLP
FT                   VTAHAHATAGIAAAVAAGVDGIEHCTFLSEGSAAASPDVVEAIVAQGVWCGMTIPRVYP
FT                   EMPENLVAVVQDGWRNIRRLIDAGARVALSTDAGVAPGRRHDVLPDDLVYLSRHGFTST
FT                   EVLTGATAAAAASCGLGHRKGRIAPGYDADLLAVAAGVDHDPAGLCDVKAVWRSGTQVP
FT                   LQASAVGYNTPS"
FT   CDS_pept        113737..114909
FT                   /transl_table=11
FT                   /gene="BCG_0106"
FT                   /locus_tag="BCG_0106"
FT                   /product="Probable aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="Differs from Rv0075 and Mb0077 by 1aa, G326D"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0106"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70091"
FT                   /db_xref="GOA:A0A0H3M786"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M786"
FT                   /protein_id="CAL70091.1"
FT                   /translation="MQDSIFNLLTEEQLRGRNTLKWNYFGPDVVPLWLAEMDFPTAPAV
FT                   LDGVRACVDNEEFGYPPLGEDSLPRATADWCRQRYGWCPRPDWVRVVPDVLKGMEVVVE
FT                   FLTRPESPVALPVPAYMPFFDVLHVTGRQRVEVPMVQQDSGRYLLDLDALQAAFVRGAG
FT                   SVIICNPNNPLGTAFTEAELRAIVDIAARHGARVIADEIWAPVVYGSRHVAAASVSEAA
FT                   AEVVVTLVSASKGWNLPGLMCAQVILSNRRDAHDWDRINMLHRMGASTVGIRANIAAYH
FT                   HGESWLDELLPYLRANRDHLARALPELAPGVEVNAPDGTYLSWVGFRALALPSEPAEYL
FT                   LSKAKVALSPGIPFGAAVGSGFARLNFATTRAILDRAIEAIAAALRDIID"
FT   CDS_pept        complement(114924..115313)
FT                   /transl_table=11
FT                   /gene="BCG_0107c"
FT                   /locus_tag="BCG_0107c"
FT                   /product="Probable membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0107c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70092"
FT                   /db_xref="GOA:A0A0H3M2G1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2G1"
FT                   /protein_id="CAL70092.1"
FT                   /translation="MPAVTTPSNHWGDERRKLSHQPPVRGQILGRRQARRLSQHFARVG
FT                   VEAPPKRLQEMLLGAPAADEEWTDVKFALIVTQLNHEKRVAKFHRLQRRATHSLICLGL
FT                   VLVALNFLICLAYIFFSLTQHAAAL"
FT   CDS_pept        complement(115377..116207)
FT                   /transl_table=11
FT                   /gene="BCG_0108c"
FT                   /locus_tag="BCG_0108c"
FT                   /product="Probable oxidoreductase"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0108c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70093"
FT                   /db_xref="GOA:A0A0H3M9Q4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M9Q4"
FT                   /protein_id="CAL70093.1"
FT                   /translation="MSTIDISAGTIHYEATGPETGRPVVFVHGYMMGGQLWRRVSERLA
FT                   GRGLRCIAPTWPLGAHPKPLRPGADQTIGGVAGIVADVLAALELKDVVLVGNDTGGVVT
FT                   QLVAVHYPERLGALVLTSCDAFEHFPPPILKPVILAAKSATLFRAAIQVMRAPAARNRA
FT                   YAGLSHHNIDHLTRAWVRPALSNPAIAEDLRQLSLSLRTEVTTAVAARLPEFDKPALIA
FT                   WSADDVFFALENGQRLAATIPRARFEVIEGARTFSMVDSPDRLADQLSTVAVRT"
FT   CDS_pept        116269..116874
FT                   /transl_table=11
FT                   /gene="BCG_0109"
FT                   /locus_tag="BCG_0109"
FT                   /product="Probable transcriptional regulatory protein"
FT                   /note="Differs from Rv0078 by 1aa, V113I"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70094"
FT                   /db_xref="GOA:A0A0H3M195"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M195"
FT                   /protein_id="CAL70094.1"
FT                   /translation="MEIKRRTQEERSAATREALITGARKLWGLRGYAEVGTPEIATEAG
FT                   VTRGAMYHQFADKAALFRDVVEVVEQDVMARMATLVAASGAATPADAIRAAVDAWLEVS
FT                   GDPEVRQLVLLDAPVVLGWAGFRDVAQRYSLGMTEQLITEAIRAGQLARQPVRPLAQVL
FT                   IGALDEAAMFIATADDPKRARRETRQVLRRLIDGMLNG"
FT   CDS_pept        complement(116949..117542)
FT                   /transl_table=11
FT                   /gene="BCG_0110c"
FT                   /locus_tag="BCG_0110c"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0110c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70095"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M0M7"
FT                   /protein_id="CAL70095.1"
FT                   /translation="MNAVESTLRRVAKDLTGLRQRWALVGGFAVSARSEPRFTRDVDIV
FT                   VAVANDDAAESLVRQLLTQQYHLLASVEQDAARRLAAVRLGATADTAANVVVDLLFASC
FT                   GIEPEIAEAAEEIEILPDLVAPVATTAHLIAMKLLARDDDRRPQDRSDLRALVDAASPQ
FT                   DIQDARKAIELITLRGFHRDRDLAAEWTRLAAKW"
FT   CDS_pept        complement(117539..117751)
FT                   /transl_table=11
FT                   /gene="BCG_0111c"
FT                   /locus_tag="BCG_0111c"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0111c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70096"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M789"
FT                   /protein_id="CAL70096.1"
FT                   /translation="MSVAVSVAAQKLRLALDMYEVGEQMQRMRLGRERPNADVVEIEAA
FT                   IDAWRMTRPGAEEGDSAGPTSTRFT"
FT   CDS_pept        117945..118766
FT                   /transl_table=11
FT                   /gene="BCG_0112"
FT                   /locus_tag="BCG_0112"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0112"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70097"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2G5"
FT                   /protein_id="CAL70097.1"
FT                   /translation="MEPKRSRLVVCAPEPSHAREFPDVAVFSGGRANASQAERLARAVG
FT                   RVLADRGVTGGARVRLTMANCADGPTLVQINLQVGDTPLRAQAATAGIDDLRPALIRLD
FT                   RQIVRASAQWCPRPWPDRPRRRLTTPAEALVTRRKPVVLRRATPLQAIAAMDAMDYDVH
FT                   LFTDAETGEDAVVYRAGPSGLRLARQHHVFPPGWSRCRAPAGPPVPLIVNSRPTPVLTE
FT                   AAAVDRAREHGLPFLFFTDQATGRGQLLYSRYDGNLGLITPTGDGVADGLA"
FT   CDS_pept        118763..119221
FT                   /transl_table=11
FT                   /gene="BCG_0113"
FT                   /locus_tag="BCG_0113"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Differs from Mb0083 by 1aa, C35R, and from Rv0080 by
FT                   2aa, C35R, V60G"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0113"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70098"
FT                   /db_xref="GOA:A0A0H3M9Q8"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M9Q8"
FT                   /protein_id="CAL70098.1"
FT                   /translation="MSPGSRRASPQSAREVVELDRDEAMRLLASVDHGCVVFTRAALPA
FT                   IRPVNHLVVDGRVIVRTRLTAKVSVAVRSSADAGVVVAYEADDLDPRRRTGWSVVVTGL
FT                   ATEVSDPEQVARYQRLLHPWVNMAMDTVVAIEPEIVTGIRIVADSRTP"
FT   CDS_pept        119316..119660
FT                   /transl_table=11
FT                   /gene="BCG_0114"
FT                   /locus_tag="BCG_0114"
FT                   /product="Probable transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0114"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70099"
FT                   /db_xref="GOA:A0A0H3M199"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M199"
FT                   /protein_id="CAL70099.1"
FT                   /translation="MESEPLYKLKAEFFKTLAHPARIRILELLVERDRSVGELLSSDVG
FT                   LESSNLSQQLGVLRRAGVVAARRDGNAMIYSIAAPDIAELLAVARKVLARVLSDRVAVL
FT                   EDLRAGGSAT"
FT   CDS_pept        119665..120144
FT                   /transl_table=11
FT                   /gene="BCG_0115"
FT                   /locus_tag="BCG_0115"
FT                   /product="Probable oxidoreductase"
FT                   /EC_number="1.-.-.-"
FT                   /note="Differs from Rv0082 by 1aa, R74Q"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0115"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70100"
FT                   /db_xref="GOA:A0A0H3M0M9"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M0M9"
FT                   /protein_id="CAL70100.1"
FT                   /translation="MGWVAKIFRVGRVVEPAAPLPAAIAEPPAGVRGSLQIRHVDAGSC
FT                   NGCEVEISGAFGPVYDAERFGARLVASPRHADALLVTGVVTHNMAGPLRKTLEATPRPR
FT                   VVIACGDCALNRGVFADAYGVVGAVGEVVPVDVEIAGCPPTPAAIMAALRSVTGK"
FT   CDS_pept        120141..122069
FT                   /transl_table=11
FT                   /gene="BCG_0116"
FT                   /locus_tag="BCG_0116"
FT                   /product="Probable oxidoreductase"
FT                   /EC_number="1.-.-.-"
FT                   /note="In Mycobacterium bovis, a single base transversion
FT                   (a-t) leads to a slightly longer product compared to its
FT                   homolog in Mycobacterium tuberculosis strain H37Rv (642 aa
FT                   versus 640 aa). Differs from Mb0086 by 1aa, A177V"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0116"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70101"
FT                   /db_xref="GOA:A0A0H3M793"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M793"
FT                   /protein_id="CAL70101.1"
FT                   /translation="MTAAPTAGGVVTSGVGVAGVGVGLLGMFGPVRVVHVGWLLPLSGV
FT                   HIELDRLGGFFMALTGAVAAPVGCYLIGYVRREHLGRVPMAVVPLFVAAMLLVPAAGSV
FT                   TTFLLAWELMAIASLILVLSEHARPQVRSAGLWYAVMTQLGFIAILVGLVVLAAAGGSD
FT                   RFAGLGAVCDGVRAAVFMLTLVGFGSKAGLVPLHAWLPRAHPEAPSPVSALMSAAMVNL
FT                   GIYGIVRFDLQLLGPGPRWWGLALLAVGGTSALYGVLQASVAADLKRLLAYSTTENMGL
FT                   ITLALGAATLFADTGAYGPASIAAAAAMLHMIAHAAFKSLAFMAAGSVLAATGLRDLDL
FT                   LGGLARRMPATTVFFGVAALGACGLPLGAGFVSEWLLVQSLIHAAPGHDPIVALTTPLA
FT                   VGVVALATGLSVAAMTKAFGIGFLARPRSTQAEAAREAPASMRAGMAIAAGACLVLAVA
FT                   PLLVAPMVRRAAATLPAAQAVKFTGLGAVVRLPAMSGSIAPGVIAAAVLAAALAVAVLA
FT                   RWRFRRRPAPARLPLWACGAADLTVRMQYTATSFAEPLQRVFGDVLRPDTDIEVTHTAE
FT                   SRYMAERITYRTAVADAIEQRLYTPVVGAVAAMAELLRRAHTGSVHRYLAYGALGVLIV
FT                   LVVARCT"
FT   CDS_pept        122069..123019
FT                   /transl_table=11
FT                   /gene="hycD"
FT                   /locus_tag="BCG_0117"
FT                   /product="Possible formate hydrogenlyase hycD (FHL)"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0117"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70102"
FT                   /db_xref="GOA:A0A0H3M2G9"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2G9"
FT                   /protein_id="CAL70102.1"
FT                   /translation="MSYLAGAAQIGGVMVGAPLVIGMTRQVRARWEGRAGAGLLQPWRD
FT                   LLKQLGKQQITPAGTTIVFAAAPVIVAGTTLLIAAIAPLVATGSPLDPSADLFAVVGLL
FT                   FLGTVALTLAGIDTGTSFGGMGASREITIAALVEPTILLAVFALSIPAGSANLGALVAS
FT                   TIDHPGHVVSLAGVLAFVALVIVIVAETGRLPVDNPATHLELTMVHEAMVLEYAGPRLA
FT                   LVEWAAGMRLTVLLALLANLFLPWGIAGAAPTALDVLTGVVAVAAKVAILAVLLATFEV
FT                   FLAKLRLFRVPELLAGSFLLALLAVTAANFFTVGA"
FT   CDS_pept        123030..123692
FT                   /transl_table=11
FT                   /gene="hycP"
FT                   /locus_tag="BCG_0118"
FT                   /product="Possible hydrogenase hycP"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0118"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70103"
FT                   /db_xref="GOA:A0A0H3M9R3"
FT                   /db_xref="InterPro:IPR038730"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M9R3"
FT                   /protein_id="CAL70103.1"
FT                   /translation="MSNANFSILVDFAAGGLVLASVLIVWRRDLRAIVRLLAWQGAALA
FT                   AIPLLRGIRDNDRALIAVGIAVLALRALVLPWLLARAVGAEAAAQREATPLVNTASSLL
FT                   ITAGLTLTAFAITQPVVNLEPGVTINAVPAAFAVVLIALFVMTTRLHAVSQAAGFLMLD
FT                   NGIAATAFLLTAGVPLIVELGASLDVLFAVIVIGVLTGRLRRIFGDADLDKLRELRD"
FT   CDS_pept        123692..125158
FT                   /transl_table=11
FT                   /gene="hycQ"
FT                   /locus_tag="BCG_0119"
FT                   /product="Possible hydrogenase hycQ"
FT                   /EC_number="1.-.-.-"
FT                   /note="Differs from Rv0086 by 1aa, T118M"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0119"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70104"
FT                   /db_xref="GOA:A0A0H3M1A3"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1A3"
FT                   /protein_id="CAL70104.1"
FT                   /translation="MTGLLLAAILAPLAASIASLITGWRRTTATLTALSATTVLACAVA
FT                   MGFWMGSGAQFGLGGLLRADALTVVMLVVIGIVGTLATAASIGYIDTELAHGHIDGRSA
FT                   RLYGVLTPAFLCATVLAVCANNIGVIWVAIEATTVITAFLVGHRRTRTALEATWKYVVI
FT                   CSVGIAVAFLGTVLLYFAARDSGAAAAGALNLDILAEHAAGLDPGVARLAGGLLLIGYG
FT                   AKAGLFPFHTWLADAHSQAPAPVSALMSGVLLAVAFSVLIRLRPILDAVSGPAYLRNGL
FT                   LVVGLATLLVAVLMLTVTGDVKRMLAYSSMEHMGLIAIAAAAGTTLAIAALLLHVLAHG
FT                   IGKTVLFLAGGQLQAAHDSTAIADITGVMRRSRLIGVSFAVGLIVLLGLPPFAMFASEL
FT                   AIARSLANERLAWVLGAALLLIAIGFTALARNSGRMLLGTPAAGAPAITVPATAAAALM
FT                   VGIVVSAALGITAGPLADLLGIAASNVGLP"
FT   CDS_pept        125155..126633
FT                   /transl_table=11
FT                   /gene="hycE"
FT                   /locus_tag="BCG_0120"
FT                   /product="Possible formate hydrogenase hycQ (FHL)"
FT                   /EC_number="1.-.-.-"
FT                   /note="Differs from Rv0087 by 1aa, I230V"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0120"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70105"
FT                   /db_xref="GOA:A0A0H3M0N3"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR020396"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M0N3"
FT                   /protein_id="CAL70105.1"
FT                   /translation="MMSASWLRHRVSERGLIATAEQLWADSFRLALVAAHDDGDSLRVV
FT                   YLFLAGYPDRRVELEYVVPADNPEIRSLAYLSFPAGRFEREMADLYGIRPVGHPKPRRL
FT                   VRHAHWPDWHPMRTDAGPAPEFTDTGAFPFLAVEGPGVYEIPVGPVHAGLIEPGHFRFS
FT                   VAGETIVRLKARLWFVHRGIEKLFHGRPATAAVDLAERISGDTSAAHALAHSLAIEDAL
FT                   GIELPHEIHRLRALIVELERLYNHAADLGALANDVGYSLANAHAQRIRENLLRRNAAVT
FT                   GHRLLRGAIRAGGVALRALPDTDELAALAVDLAEVATLTLANSVVYDRFAGTAVLHPDD
FT                   ASALGCLGYVARASGLRSDARVEHPTIVLPITEIGAPDGDVLARYTVRRDEFAASAALA
FT                   QHIVESHTGPIEYAATLHPVGAPSSGIGIVEGWRGTIVHRVEIDVDGRITRAKVVDPSW
FT                   FNWPALPVAMADTIVPDFPLANKSFNQSYAGNDL"
FT   CDS_pept        126668..127342
FT                   /transl_table=11
FT                   /gene="BCG_0121"
FT                   /locus_tag="BCG_0121"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0121"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70106"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M796"
FT                   /protein_id="CAL70106.1"
FT                   /translation="MSVYKHAPSRVRLRQTRSTVVKGRSGSLSWRRVRTGDLGLAVWGG
FT                   REEYRAVKPGTPGIQPKGDMMTVTVVDAGPGRVSRSVEVAAPAAELFAIVADPRRHREL
FT                   DGSGTVRGNIKVPAKLVVGSKFSTKMKLFGLPYRITSRVTALKPNELVEWSHPLGHRWR
FT                   WEFESLSPTLTRVTETFDYHAAGAIKNGLKFYEMTGFAKSNAAGIEATLAKLSDQYARG
FT                   RA"
FT   CDS_pept        127499..128092
FT                   /transl_table=11
FT                   /gene="BCG_0122"
FT                   /locus_tag="BCG_0122"
FT                   /product="Possible methyltransferase/methylase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0122"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70107"
FT                   /db_xref="GOA:A0A0H3M2H4"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2H4"
FT                   /protein_id="CAL70107.1"
FT                   /translation="MDQPWNANIHYDALLDAMVPLGTQCVLDVGCGDGLLAARLARRIP
FT                   YVTAVDIDAPVLRRAQTRFANAPIRWLHADIMTAELPNAGFDAVVSNAALHHIEDTRTA
FT                   LSRLGGLVTPGGTLAVVTFVTPSLRNGLWHLTSWVACGMANRVKGKWEHSAPIKWPPPQ
FT                   TLHELRSHVRALLPGACIRRLLYGRVLVTWRAPV"
FT   CDS_pept        128221..128991
FT                   /transl_table=11
FT                   /gene="BCG_0123"
FT                   /locus_tag="BCG_0123"
FT                   /product="Possible membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0123"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70108"
FT                   /db_xref="GOA:A0A0H3M9R6"
FT                   /db_xref="InterPro:IPR014511"
FT                   /db_xref="InterPro:IPR021125"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M9R6"
FT                   /protein_id="CAL70108.1"
FT                   /translation="MAKNQNRIRNRWELITCGLGGHVTYAPDDAALAARLRASTGLGEV
FT                   WRCLRCGDFALGGPQGRGAPEDAPLIMRGKALRQAIIIRALGVERLVRALVLALAAWAV
FT                   WEFRGARGAIQATLDRDLPVLRAAGFKVDQMTVIHALEKALAAKPSTLALITGMLAAYA
FT                   VLQAVEGVGLWLLKRWGEYFAVVATSIFLPLEVHDLAKGITTTRVVTFSINVAAVVYLL
FT                   ISKRLFGVRGGRKAYDVERRGEQLLDLERAAMLT"
FT   CDS_pept        129425..130192
FT                   /transl_table=11
FT                   /gene="mtn"
FT                   /locus_tag="BCG_0124"
FT                   /product="Probable bifunctional mta/sah nucleosidase mtn"
FT                   /EC_number="3.2.2.16"
FT                   /EC_number="3.2.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0124"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70109"
FT                   /db_xref="GOA:A0A0H3M1B0"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1B0"
FT                   /protein_id="CAL70109.1"
FT                   /translation="MAVTVGVICAIPQELAYLRGVLVDAKRQQVAQILFDSGQLDAHRV
FT                   VLAAAGMGKVNTGLTATLLADRFGCRTIVFTGVAGGLDPELCIGDIVIADRVVQHDFGL
FT                   LTDERLRPYQPGHIPFIEPTERLGYPVDPAVIDRVKHRLDGFTLAPLSTAAGGGGRQPR
FT                   IYYGTILTGDQYLHCERTRNRLHHELGGMAVEMEGGAVAQICASFDIPWLVIRALSDLA
FT                   GADSGVDFNRFVGEVAASSARVLLRLLPVLTAC"
FT   CDS_pept        130324..132609
FT                   /transl_table=11
FT                   /gene="ctpA"
FT                   /locus_tag="BCG_0125"
FT                   /product="Probable cation transporter p-type atpase A ctpA"
FT                   /EC_number="3.6.3.-"
FT                   /note="Differs from Rv0092 by 1aa, A3T"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0125"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70110"
FT                   /db_xref="GOA:A0A0H3M0N6"
FT                   /db_xref="InterPro:IPR000579"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M0N6"
FT                   /protein_id="CAL70110.1"
FT                   /translation="MTAAVTGEHHASVQRIQLRISGMSCSACAHRVESTLNKLPGVRAA
FT                   VNFGTRVATIDTSEAVDAAALCQAVRRAGYQADLCTDDGRSASDPDADHARQLLIRLAI
FT                   AAVLFVPVADLSVMFGVVPATRFTGWQWVLSALALPVVTWAAWPFHRVAMRNARHHAAS
FT                   METLISVGITAATIWSLYTVFGNHSPIERSGIWQALLGSDAIYFEVAAGVTVFVLVGRY
FT                   FEARAKSQAGSALRALAALSAKEVAVLLPDGSEMVIPADELKEQQRFVVRPGQIVAADG
FT                   LAVDGSAAVDMSAMTGEAKPTRVRPGGQVIGGTTVLDGRLIVEAAAVGADTQFAGMVRL
FT                   VEQAQAQKADAQRLADRISSVFVPAVLVIAALTAAGWLIAGGQPDRAVSAALAVLVIAC
FT                   PCALGLATPTAMMVASGRGAQLGIFLKGYKSLEATRAVDTVVFDKTGTLTTGRLQVSAV
FT                   TAAPGWEADQVLALAATVEAASEHSVALAIAAATTRRDAVTDFRAIPGRGVSGTVSGRA
FT                   VRVGKPSWIGSSSCHPNMRAARRHAESLGETAVFVEVDGEPCGVIAVADAVKDSARDAV
FT                   AALADRGLRTMLLTGDNPESAAAVATRVGIDEVIADILPEGKVDVIEQLRDRGHVVAMV
FT                   GDGINDGPALARADLGMAIGRGTDVAIGAADIILVRDHLDVVPLALDLARATMRTVKLN
FT                   MVWAFGYNIAAIPVAAAGLLNPLVAGAAMAFSSFFVVSNSLRLRKFGRYPLGCGTVGGP
FT                   QMTAPSSA"
FT   CDS_pept        complement(132556..133404)
FT                   /transl_table=11
FT                   /gene="BCG_0126c"
FT                   /locus_tag="BCG_0126c"
FT                   /product="Probable conserved membrane protein"
FT                   /note="Differs from Rv0093c by 1aa, R22C"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0126c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70111"
FT                   /db_xref="GOA:A0A0H3M7A1"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7A1"
FT                   /protein_id="CAL70111.1"
FT                   /translation="MLAQATTAGSFNHHASTVLQGRRGVPAAMWSEPAGAIRRHCATID
FT                   GMDCEVAREALSARLDGERAPVPSARVDEHLGECSACRAWFTQVASQAGDLRRLAESRP
FT                   VVPPVGRLGIRRAPRRQHSPMTWRRWALLCVGIAQIALGTVQGFGLDVGLTHQHPTGAG
FT                   THLLNESTSWSIALGVIMVGAALWPSAAAGLAGVLTAFVAILTGYVIVDALSGAVSTTR
FT                   ILTHLPVVIGAVLAIMVWRSASGPRPRPDAVAAEPDIVLPDNASRGRRRGHLWPTDGSA
FT                   A"
FT   CDS_pept        complement(133451..134404)
FT                   /transl_table=11
FT                   /gene="BCG_0127c"
FT                   /locus_tag="BCG_0127c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Differs from Rv0094c by 3aa, D256E, W296R, K315E"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0127c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70112"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2H8"
FT                   /protein_id="CAL70112.1"
FT                   /translation="MSTRQAAEADLAGKAAQYRPDELARYAQRVMDWLHPDGDLTDTER
FT                   ARKRGITLSNQQYDGMSRLSGYLTPQARATFEAVLAKLAAPGATNPDDHTPVIDTTPDA
FT                   AAIDRDTRSQAQRNHDGLLAGLRALIASGELGQHNGLPVSIVVTTTLTDLQTGAGKGFT
FT                   GGGTLLPMADVIRMTSHAHHYSPASGRYPQAIFDHGTPLALYHTKRLASPAQRIMLFAN
FT                   DRGCTKPGCDAPAYHSQAHHVTGWTSTGRTDITDLTLACDPDNRLAEKGWTTRKNTHGH
FT                   TEWLPPPHLDHGQPWTNTFHHPERFLHNQDDDDKPD"
FT   repeat_region   complement(133454..134957)
FT                   /locus_tag="REP-2"
FT                   /rpt_family="REP"
FT                   /note="REP-2, len: 1504 nt. Equivalent to REP, len: 1503
FT                   nt, from Mycobacterium tuberculosis strain H37Rv, (97.0%
FT                   identity in 1504 nt overlap). REP251, member of REP13E12
FT                   family"
FT   CDS_pept        complement(134175..134957)
FT                   /transl_table=11
FT                   /gene="BCG_0128c"
FT                   /locus_tag="BCG_0128c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="In Mycobacterium tuberculosis strain H37Rv, Rv0095c
FT                   and Rv1588 exist as separate genes in their respective
FT                   positions. In Mycobacterium bovis BCG Pasteur, and
FT                   Mycobacterium bovis, a 73 bp substitution leads to a single
FT                   combined gene. Differs from Rv0095c by 5aa, E57D, T70S,
FT                   V85A, V91G, A92Q"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0128c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70113"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M9R9"
FT                   /protein_id="CAL70113.1"
FT                   /translation="MRYLPVSTRRIWVNPLCHFSFTVISGALFVSARRYDSNMLANSRE
FT                   ELVEVFDALDAELDRLDEVSFEVLTTPERLRSLERLECLVRRLPAVGHTLINQLDTQAS
FT                   EEELGGTLCCALANRLRITKPDAALRIADAADLGPRRALTGEPLAPQLTATATAQRQGL
FT                   IGEAHIKVIRALFRPPARRGGCVHPPGRRSRPGRQSRSISSRRAGPLRPAGHGLATPRR
FT                   RPHRHRTRPQTRHHPEQPAIRRHVTAKWLPDPPSAGHL"
FT   CDS_pept        135066..136457
FT                   /transl_table=11
FT                   /gene="PPE1"
FT                   /locus_tag="BCG_0129"
FT                   /product="PPE family protein"
FT                   /note="Differs from Rv0096 by 1aa, W182R"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70114"
FT                   /db_xref="GOA:A0A0H3M1B6"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1B6"
FT                   /protein_id="CAL70114.1"
FT                   /translation="MAIPPEVHSGLLSAGCGPGSLLVAAQQWQELSDQYALACAELGQL
FT                   LGEVQASSWQGTAATQYVAAHGPYLAWLEQTAINSAVTAAQHVAAAAAYCSALAAMPTP
FT                   AELAANHAIHGVLIATNFFGINTVPIALNEADYVRMWLQAADTMAAYQAVADAATVAVP
FT                   STQPAPPIRAPGGDAADTWLDVLSSIGQLIRDILDFIANPYKYFLEFFEQFGFSPAVTV
FT                   VLALVALQLYDFLWYPYYASYGLLLLPFFTPTLSALTALSALIHLLNLPPAGLLPIAAA
FT                   LGPGDQWGANLAVAVTPATAAVPGGSPPTSNPAPAAPSSNSVGSASAAPGISYAVPGLA
FT                   PPGVSSGPKAGTKSPDTAADTLATAGAARPGLARAHRRKRSESGVGIRGYRDEFLDATA
FT                   TVDAATDVPAPANAAGSQGAGTLGFAGTAPTTSGAAAGMVQLSSHSTSTTVPLLPTTWT
FT                   TDAEQ"
FT   CDS_pept        136476..137345
FT                   /transl_table=11
FT                   /gene="BCG_0130"
FT                   /locus_tag="BCG_0130"
FT                   /product="Possible oxidoreductase"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0130"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70115"
FT                   /db_xref="GOA:A0A0H3M0N8"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M0N8"
FT                   /protein_id="CAL70115.1"
FT                   /translation="MTLKVKGEGLGAQVTGVDPKNLDDITTDEIRDIVYTNKLVVLKDV
FT                   HPSPREFIKLGRIIGQIVPYYEPMYHHEDHPEIFVSSTEEGQGVPKTGAFWHIDYMFMP
FT                   EPFAFSMVLPLAVPGHDRGTYFIDLARVWQSLPAAKRDPARGTVSTHDPRRHIKIRPSD
FT                   VYRPIGEVWDEINRTTPPIKWPTVIRHPKTGQEILYICATGTTKIEDKDGNPVDPEVLQ
FT                   ELMAATGQLDPEYQSPFIHTQHYQVGDIILWDNRVLMHRAKHGSAAGTLTTYRLTMLDG
FT                   LKTPGYAA"
FT   CDS_pept        137342..137893
FT                   /transl_table=11
FT                   /gene="BCG_0131"
FT                   /locus_tag="BCG_0131"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0131"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70116"
FT                   /db_xref="InterPro:IPR022598"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7A2"
FT                   /protein_id="CAL70116.1"
FT                   /translation="MSHTDLTPCTRVLASSGTVPIAEELLARVLEPYSCKGCRYLIDAQ
FT                   YSATEDSVLAYGNFTIGESAYIRSTGHFNAVELILCFNQLAYSAFAPAVLNEEIRVLRG
FT                   WSIDDYCQHQLSSMLIRKASSRFRKPLNPQKFSARLLCRDLQVIERTWRYLKVPCVIEF
FT                   WDENGGAASGEIELAALNIP"
FT   CDS_pept        137898..139520
FT                   /transl_table=11
FT                   /gene="fadD10"
FT                   /locus_tag="BCG_0132"
FT                   /product="Possible fatty-acid-CoA ligase fadD10"
FT                   /EC_number="6.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0132"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70117"
FT                   /db_xref="GOA:A0A0H3M2I5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2I5"
FT                   /protein_id="CAL70117.1"
FT                   /translation="MGGKKFQAMPQLPSTVLDRVFEQARQQPEAIALRRCDGTSALRYR
FT                   ELVAEVGGLAADLRAQSVSRGSRVLVISDNGPETYLSVLACAKLGAIAVMADGNLPIAA
FT                   IERFCQITDPAAALVAPGSKMASSAVPEALHSIPVIAVDIAAVTRESEHSLDAASLAGN
FT                   ADQGSEDPLAMIFTSGTTGEPKAVLLANRTFFAVPDILQKEGLNWVTWVVGETTYSPLP
FT                   ATHIGGLWWILTCLMHGGLCVTGGENTTSLLEILTTNAVATTCLVPTLLSKLVSELKSA
FT                   NATVPSLRLVGYGGSRAIAADVRFIEATGVRTAQVYGLSETGCTALCLPTDDGSIVKIE
FT                   AGAVGRPYPGVDVYLAATDGIGPTAPGAGPSASFGTLWIKSPANMLGYWNNPERTAEVL
FT                   IDGWVNTGDLLERREDGFFYIKGRSSEMIICGGVNIAPDEVDRIAEGVSGVREAACYEI
FT                   PDEEFGALVGLAVVASAELDESAARALKHTIAARFRRESEPMARPSTIVIVTDIPRTQS
FT                   GKVMRASLAAAATADKARVVVRG"
FT   CDS_pept        139525..139761
FT                   /transl_table=11
FT                   /gene="BCG_0133"
FT                   /locus_tag="BCG_0133"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0133"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70118"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M9S4"
FT                   /protein_id="CAL70118.1"
FT                   /translation="MRDRILAAVCDVLYIDEADLIDGDETDLRDLGLDSVRFVLLMKQL
FT                   GVNRQSELPSRLAANPSIAGWLRELEAVCTEFG"
FT   CDS_pept        139743..147281
FT                   /transl_table=11
FT                   /gene="nrp"
FT                   /locus_tag="BCG_0134"
FT                   /product="Probable peptide synthetase nrp"
FT                   /EC_number="6.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70119"
FT                   /db_xref="GOA:A0A0H3M1C1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR010080"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1C1"
FT                   /protein_id="CAL70119.1"
FT                   /translation="MHRVRLSRSQRNLYNGVRQDNNPALYLIGKSYRFRRLELARFLAA
FT                   LHATVLDNPVQLCVLENSGADYPDLVPRLRFGDIVRVGSADEHLQSTWCSGILGKPLVR
FT                   HTVHTDPNGYVTGLDVHTHHILLDGGATGTIEADLARYLTTDPAGETPSVGAGLAKLRE
FT                   AHRRETAKVEESRGRLSAVVQRELADEAYHGGHGHSVSDAPGTAAKGVLHESATICGNA
FT                   FDAILTLSEAQRVPLNVLVAAAAVAVDASLRQNTETLLVHTVDNRFGDSDLNVATCLVN
FT                   SVAQTVRFPPFASVSDVVRTLDRGYVKAVRRRWLREEHYRRMYLAINRTSHVEALTLNF
FT                   IREPCAPGLRPFLSEVPIATDIGPVEGMTVASVLDEEQRTLNLAIWNRADLPACKTHPK
FT                   VAERIAAALESMAAMWDRPIAMIVNDWFGIGPDGTRCQGDWPARQPSTPAWFLDSARGV
FT                   HQFLGRRRFVYPWVAWLVQRGAAPGDVLVFTDDDTDKTIDLLIACHLAGCGYSVCDTAD
FT                   EISVRTNAITEHGDGILVTVVDVAATQLAVVGHDELRKVVDERVTQVTHDALLATKTAY
FT                   IMPTSGTTGQPKLVRISHGSLAVFCDAISRAYGWGAHDTVLQCAPLTSDISVEEIFGGA
FT                   ACGARLVRSAAMKTGDLAALVDDLVARETTIVDLPTAVWQLLCADGDAIDAIGRSRLRQ
FT                   IVIGGEAIRCSAVDKWLESAASQGISLLSSYGPTEATVVATFLPIVCDQTTMDGALLRL
FT                   GRPILPNTVFLAFGEVVIVGDLVADGYLGIDGDGFGTVTAADGSRRRAFATGDRVTVDA
FT                   EGFPVFSGRKDAVVKISGKRVDIAEVTRRIAEDPAVSDVAVELHSGSLGVWFKSQRTRE
FT                   GEQDAAAATRIRLVLVSLGVSSFFVVGVPNIPRKPNGKIDSDNLPRLPQWSAAGLNTAE
FT                   TGQRAAGLSQIWSRQLGRAIGPDSSLLGEGIGSLDLIRILPETRRYLGWRLSLLDLIGA
FT                   DTAANLADYAPTPDAPTGEDRFRPLVAAQRPAAIPLSFAQRRLWFLDQLQRPAPVYNMA
FT                   VALRLRGYLDTEALGAAVADVVGRHESLRTVFPAVDGVPRQLVIEARRADLGCDIVDAT
FT                   AWPADRLQRAIEEAARHSFDLATEIPLRTWLFRIADDEHVLVAVAHHIAADGWSVAPLT
FT                   ADLSAAYASRCAGRAPDWAPLPVQYVDYTLWQREILGDLDDSDSPIAAQLAYWENALAG
FT                   MPERLRLPTARPYPPVADQRGASLVVDWPASVQQQVRRIARQHNATSFMVVAAGLAVLL
FT                   SKLSGSPDVAVGFPIAGRSDPALDNLVGFFVNTLVLRVNLAGDPSFAELLGQVRARSLA
FT                   AYENQDVPFEVLVDRLKPTRAMTHHPLIQVMLAWQDNPVGQLNLGDLQATPMPIDTRTA
FT                   RMDLVFSLAERFSEGSEPAGIGGAVEYRTDVFEAQAIDVLIERLRKVLVAVAAAPERTV
FT                   SSIDALDGTERARLDEWGNRAVLTAPAPTPVSIPQMLAAQVARIPEAEAVCCGDASMTY
FT                   RELDEASNRLAHRLAGCGAGPGECVALLFERCAPAVVAMVAVLKTGAAYLPIDPANPPP
FT                   RVAFMLGDAVPVAAVTTAGLRSRLAGHDLPIIDVVDALAAYPGTPPPMPAAVNLAYILY
FT                   TSGTTGEPKGVGITHRNVTRLFASLPARLSAAQVWSQCHSYGFDASAWEIWGALLGGGR
FT                   LVIVPESVAASPNDFHGLLVAEHVSVLTQTPAAVAMLPTQGLESVALVVAGEACPAALV
FT                   DRWAPGRVMLNAYGPTETTICAAISAPLRPGSGMPPIGVPVSGAALFVLDSWLRPVPAG
FT                   VAGELYIAGAGVGVGYWRRAGLTASRFVACPFGGSGARMYRTGDLVCWRADGQLEFLGR
FT                   TDDQVKIRGYRIELGEVATALAELAGVGQAVVIAREDRPGDKRLVGYATEIAPGAVDPA
FT                   GLRAQLAQRLPGYLVPAAVVVIDALPLTVNGKLDHRALPAPEYGDTNGYRAPAGPVEKT
FT                   VAGIFARVLGLERVGVDDSFFELGGDSLAAMRVIAAINTTLNADLPVRALLHASSTRGL
FT                   SQLLGRDARPTSDPRLVSVHGDNPTEVHASDLTLDRFIDADTLATAVNLPGPSPELRTV
FT                   LLTGATGFLGRYLVLELLRRLDVDGRLICLVRAESDEDARRRLEKTFDSGDPELLRHFK
FT                   ELAADRLEVVAGDKSEPDLGLDQPMWRRLAETVDLIVDSAAMVNAFPYHELFGPNVAGT
FT                   AELIRIALTTKLKPFTYVSTADVGAAIEPSAFTEDADIRVISPTRTVDGGWAGGYGTSK
FT                   WAGEVLLREANDLCALPVAVFRCGMILADTSYAGQLNMSDWVTRMVLSLMATGIAPRSF
FT                   YEPDSEGNRQRAHFDGLPVTFVAEAIAVLGARVAGSSLAGFATYHVMNPHDDGIGLDEY
FT                   VDWLIEAGYPIRRIDDFAEWLQRFEASLGALPDRQRRHSVLPMLLASNSQRLQPLKPTR
FT                   GCSAPTDRFRAAVRAAKVGSDKDNPDIPHVSAPTIINYVTNLQLLGLL"
FT   CDS_pept        147456..149441
FT                   /transl_table=11
FT                   /gene="BCG_0135"
FT                   /locus_tag="BCG_0135"
FT                   /product="Probable conserved integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0135"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70120"
FT                   /db_xref="GOA:A0A0H3M0P2"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR019108"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M0P2"
FT                   /protein_id="CAL70120.1"
FT                   /translation="MGTHGATKSATSAVPTPRSNSMAMVRLAIGLLGVCAVVAAFGLVS
FT                   GARRYAEAGNPYPGAFVSVAEPVGFFAASLAGALCLGALIHVVMTAKPEPDGLIDAAAF
FT                   RIHLLAERVSGLWLGLAATMVVIQAAHDTGVGPARLLASGALSDSVAASEMARGWIVAA
FT                   ICALVVATALRLYTRWLGHVVLLVPTVLAVVATAVTGNPGQGPDHDYATSAAIVFAVAF
FT                   ATLTGLKIAAALAGTTPSRAVLVTQVTCGALALAYGAMLLYLFIPGWAVDSDFARLGLL
FT                   AGVILTSVWLFDCWRLLVRPPHAGRRRGGGSGAALAMMAAMASIAAMAVMTAPRFLTHA
FT                   FTAWDVFLGYELPQPPTIARVLTVWRFDSLIGAAGVVLAIGYAAGFAALRRRGNSWPVG
FT                   RLIAWLTGCAALVFTSGSGVRAYGSAMFSVHMAEHMTLNMFIPVLLVLGGPVTLALRVL
FT                   PVTGDGRPPGAREWLTWLLHSRVTTFLSHPITAFVLFVASPYIVYFTPLFDTFVRYHWG
FT                   HEFMAIHFLVVGYLFYWAIIGIDPGPRRLPYPGRIGLLFAVMPFHAFFGIALMTMSSTV
FT                   GATFYRSVNLPWLSSIIADQHLGGGIAWSLTELPVIMVIVALVTQWARQDRRVASREDR
FT                   HADSDYADDELEAYNAMLRELSRMRR"
FT   CDS_pept        complement(149657..151915)
FT                   /transl_table=11
FT                   /gene="ctpB"
FT                   /locus_tag="BCG_0136c"
FT                   /product="Probable cation-transporter P-type atpase B ctpB"
FT                   /EC_number="3.6.3.-"
FT                   /note="Differs from Rv0103c by 1aa, S22L"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0136c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70121"
FT                   /db_xref="GOA:A0A0H3M7A7"
FT                   /db_xref="InterPro:IPR000579"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7A7"
FT                   /protein_id="CAL70121.1"
FT                   /translation="MAAPVVGDADLQSVRRIRLDVSGMSCAACASRVETKLNKIPGVRA
FT                   SVNFATRVATIDAVGMAADELCGVVEKAGYHAAPHTETTVLDKRTKDPDGAHARRLLRR
FT                   LLVAAVLFVPLADLSTLFAIVPSARVPGWGYILTALAAPVVTWAAWPFHSVALRNARHR
FT                   TTSMETLISVGIVAATAWSLSSVFGDQPPREGSGIWRAILNSDSIYLEVAAGVTVFVLA
FT                   GRYFEARAKSKAGSALRALAELGAKNVAVLLPDGAELVIPASELKKRQRFVTRPGETIA
FT                   ADGVVVDGSAAIDMSAMTGEAKPVRAYPAASVVGGTVVMDGRLVIEATAVGADTQFAAM
FT                   VRLVEQAQTQKARAQRLADHIAGVFVPVVFVIAGLAGAAWLVSGAGADRAFSVTLGVLV
FT                   IACPCALGLATPTAMMVASGRGAQLGIFIKGYRALETIRSIDTVVFDKTGTLTVGQLAV
FT                   STVTMAGSGTSERDREEVLGLAAAVESASEHAMAAAIVAASPDPGPVNGFVAVAGCGVS
FT                   GEVGGHHVEVGKPSWITRTTPCHDAALVSARLDGESRGETVVFVSVDGVVRAALTIADT
FT                   LKDSAAAAVAALRSRGLRTILLTGDNRAAADAVAAQVGIDSAVADMLPEGKVDVIQRLR
FT                   EEGHTVAMVGDGINDGPALVGADLGLAIGRGTDVALGAADIILVRDDLNTVPQALDLAR
FT                   ATMRTIRMNMIWAFGYNVAAIPIAAAGLLNPLIAGAAMAFSSFFVVSNSLRLRNFGAQ"
FT   CDS_pept        152059..153573
FT                   /transl_table=11
FT                   /gene="BCG_0137"
FT                   /locus_tag="BCG_0137"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0137"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70122"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2J0"
FT                   /protein_id="CAL70122.1"
FT                   /translation="MTPVTTFPLVDAILAGRDRNLDGVILIAAQHLLQTTHAMLRSLFR
FT                   VGLDPRNVAVIGKCYSTHPGVVDAMRADGIYVDDCSDAYAPHESFDTQYTRHVEWFFAE
FT                   SWARLTAGRTARVVLLDDGGSLLAVAGAMLDASADVIGIEQTSAGYAKIVGCALGFPVI
FT                   NIARSSAKLLYESPIIAARVTQTAFERTAGIDSSAAILITGAGAIGTALADVLRPLHDR
FT                   VDVYDTRSGCMTPIDLPNAIGGYDVIIGATGATSVPASMHELLRPGVLLMSASSSDREF
FT                   DAVALRRRTTPNPDCHADLRVADGSVDATLLNSGFPVNFDGSPMCGDASMALTMALLAA
FT                   AVLYASVAVADEMSSDHPHLGLIDQGDIVASFLNIDVPLQALSRLPLLSIDGYRRLQVR
FT                   SGHTLFRQGERADHFFVIESGELEALVDGKVILRLGAGDHFGEACLLGGMRRIATVRAC
FT                   EPSVLWELDGKAFGDALHGDAAMREIAYGVARTRLMHAGASESLMV"
FT   CDS_pept        complement(153722..154006)
FT                   /transl_table=11
FT                   /gene="rpmB1"
FT                   /locus_tag="BCG_0138c"
FT                   /product="Probable 50s ribosomal protein L28-1 rpmB1"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0138c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70123"
FT                   /db_xref="GOA:A0A0H3M9S9"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M9S9"
FT                   /protein_id="CAL70123.1"
FT                   /translation="MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDR
FT                   RIKVRVSAQGIKVIDRDGHRGRRRAARAGSAPAHFARQAGSSLRTAAIL"
FT   CDS_pept        154116..155312
FT                   /transl_table=11
FT                   /gene="BCG_0139"
FT                   /locus_tag="BCG_0139"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70124"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1C7"
FT                   /protein_id="CAL70124.1"
FT                   /translation="MRTPVILVAGQDHTDEVTGALLRRTGTVVVEHRFDGHVVRRMTAT
FT                   LSRGELITTEDALEFAHGCVSCTIRDDLLVLLRRLHRRDNVGRIVVHLAPWLEPQPICW
FT                   AIDHVRVCVGHGYPDGPAALDVRVAAVVTCVDCVRWLPQSLGEDELPDGRTVAQVTVGQ
FT                   AEFADLLVLTHPEPVAVAVLRRLAPRARITGGVDRVELALAHLDDNSRRGRTDTPHTPL
FT                   LAGLPPLAADGEVAIVEFSARRPFHPQRLHAAVDLLLDGVVRTRGRLWLANRPDQVMWL
FT                   ESAGGGLRVASAGKWLAAMAASEVAYVDLERRLFADLMWVYPFGDRHTAMTVLVCGADP
FT                   TDIVNALNAALLSDDEMASPQRWQSYVDPFGDWHDDPCHEMPDAAGEFSAHRNSGESR"
FT   CDS_pept        complement(155407..160284)
FT                   /transl_table=11
FT                   /gene="ctpI"
FT                   /locus_tag="BCG_0140c"
FT                   /product="Probable cation-transporter atpase I ctpI"
FT                   /EC_number="3.6.3.-"
FT                   /note="In Mycobacterium bovis BCG Pasteur, and
FT                   Mycobacterium bovis, a single base insertion (*-t) leads to
FT                   a product with a different COOH part compared to its
FT                   homolog in Mycobacterium tuberculosis strain H37Rv"
FT                   /note="differs from Rv0107c by 3aa, V136A, P1247S, S1327A"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0140c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70125"
FT                   /db_xref="GOA:A0A0H3M0P5"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M0P5"
FT                   /protein_id="CAL70125.1"
FT                   /translation="MKIPGVATVLGGVTNGVAQTVRAGARLPGSAAAAVQTLASPVLEL
FT                   TGPVVQSVVQTTGRAIGVRGSHNESPDGMTPPVRWRSGRRVHFDLDPLLPFPRWHEHAA
FT                   MVEEPVRRIPGVAEAHVEGSLGRLVVELEPDVDSDIAVDEVRDVVSAVAADIFLAGSVS
FT                   SPNSAPFADPGNPLAILVPLTAAAMDLVAMGATVTGWVARLPAAPQTTRALAALINHQP
FT                   RMVSLMESRLGRVGTDIALAATTAAANGLTQSLGTPLLDLVQRSLQISEAAAHRRVWRD
FT                   REPALASPRRPQAPVVPIISSAGAKSQEPRHSWAAAAAGEASHVVVGGSIDAAIDTAKG
FT                   SRAGPVEQYVNQAANGSLIAAASALVAGGGTEDAAGAILAGVPRAAHMGRQAFAAVLGR
FT                   GLANTGQLVLDPGALRRLDRVRVVVIDGAALRGDNRAVLHAQGDEPGWDDDRVYEVADA
FT                   LLHGEQAPEPDPDELPATGARLRWAPAQGPSATPAQGLEHADLVVDGQCVGSVDVGWEV
FT                   DPYAIPLLQTAHRTGARVVLRHVAGTEDLSASVGSTHPPGTPLLKLVRELRADRGPVLL
FT                   ITAVHRDFASTDTLAALAIADVGVALDDPRGATPWTADLITGTDLAAAVRILSALPVAR
FT                   AASESAVHLAQGGTTLAGLLLVTGEQDKTTNPASFRRWLNPVNAAAATALVSGMWSAAK
FT                   VLRMPDPTPQPLTAWHALDPEIVYSRLAGGSRPLAVEPGIPAWRRILDDLSYEPVMAPL
FT                   RGPARTLAQLAVATRHELADPLTPILAVGAAASAIVGSNIDALLVAGVMTVNAITGGVQ
FT                   RLRAEAAAAELFAEQDQLVRRVVVPAVATTRRRLEAARHATRTATVSAKSLRVGDVIDL
FT                   AAPEVVPADARLLVAEDLEVDESFLTGESLPVDKQVDPVAVNDPDRASMLFEGSTIVAG
FT                   HARAIVVATGVGTAAHRAISAVADVETAAGVQARLRELTSKVLPMTLAGGAAVTALALL
FT                   RRASLRQAVADGVAIAVAAVPEGLPLVATLSQLAAAQRLTARGALVRSPRTIEALGRVD
FT                   TICFDKTGTLTENRLRVVCALPSSTAAERDPLPQTTDAPSAEVLRAAARASTQPHNGEG
FT                   HAHATDEAILAAASALAGSLSSQGDSEWVVLAEVPFESSRGYAAAIGRVGTDGIPMLML
FT                   KGAPETILPRCRLADPGVDHEHAESVVRHLAEQGLRVLAVAQRTWDNGTTHDDETDADA
FT                   VDAVAHDLELIGYVGLADTARPSSRPLIEALLDAERNVVLITGDHPITARAIARQLGLP
FT                   ADARVVTGAELAVLDEEAHAKLAADMQVFARVSPEQKVQIVASLQRCGRVTAMVGDGAN
FT                   DAAAIRMADVGIGVSGRGSSAARGAADIVLTDDDLGVLLDALVEGRSMWAGVRDAVTIL
FT                   VGGNVGEVLFTVIGTAFGAGRAPVGTRQLLLVNLLTDMFPALAVAVTSQFAEPDDAEYP
FT                   TDDAAERAQREHRRAVLIGPTPSLDAPLLRQIVNRGVVTAAGATAAWAIGRWTPGTERR
FT                   TATMGLTALVMTQLAQTLLTRRHSPLVIATALGSAGVLVGIIQTPVISHFFGCTPLGPV
FT                   AWTGVFSATAGATAVSALAPKWLASTVGVVQPDERPDDAEDSDAGG"
FT   CDS_pept        complement(160638..160847)
FT                   /transl_table=11
FT                   /gene="BCG_0141c"
FT                   /locus_tag="BCG_0141c"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0141c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70126"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7A8"
FT                   /protein_id="CAL70126.1"
FT                   /translation="MVPVETLHSGDPITDVNGGGQRYIVLESKTVGDSCVVLELESRVN
FT                   HQLQVIEKSFPAGYHVGRAHHRIL"
FT   CDS_pept        161126..162616
FT                   /transl_table=11
FT                   /gene="PE_PGRS1"
FT                   /locus_tag="BCG_0142"
FT                   /product="PE-PGRS family protein"
FT                   /note="Differs from Rv0109 by 1aa, G346R"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70127"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2J4"
FT                   /protein_id="CAL70127.1"
FT                   /translation="MSLLITSPATVAAAATHLAGIGSALSTANAAAAAPTTALSVAGAD
FT                   EVSVLIAALFEAYAQEYQALSAQALAFHDQFVQALNMGAVCYAAAETANATPLQALQTV
FT                   QQNVLTVVNAPTQALLGRPIIGNGANGLPNTGQDGGPGGLLFGNGGNGGSGGVDQAGGN
FT                   GGAAGLIGNGGSGGVGGPGIAGSAGGAGGAGGLLFGNGGPGGAGGIGTTGDGGPGGAGG
FT                   NAIGLFGSGGTGGMGGVGGMGGVGNGGNAGNGGTAGLFGHGGAGGAGGIGSADGGLGGG
FT                   GGNGRFMGNGGVGGAGGYGASGDGGNAGNGGLGGVFGDGGAGGTGGLGDVNGGLAGIGG
FT                   NAGFVGNGGAGGNGQLGSGAVSSAGGMGGNGGLVFGNGGPGGLGGPGTSAGNGGMGGNA
FT                   VGLFGQGGAGGAGGSGFGAGIPGGRGGDGGSGGLIGDGGTGGGAGAGDAAASAGGNGGN
FT                   ARLIGNGGDGGPGMFGGPGGAGGSGGTIFGFAGTPGPS"
FT   CDS_pept        162764..163513
FT                   /transl_table=11
FT                   /gene="BCG_0143"
FT                   /locus_tag="BCG_0143"
FT                   /product="Probable conserved integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0143"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70128"
FT                   /db_xref="GOA:A0A0H3M9T3"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M9T3"
FT                   /protein_id="CAL70128.1"
FT                   /translation="MRVGPVGHQCAECVREGARAVRQPRTPFGGRQRSATPVVTYTLIS
FT                   LNALVFVMQVTVMGLERQLALWPPAVASGQTYRLVTSAFLHYGAMHLLLNMWALYVVGP
FT                   PLEMWLGRLRFGALYAVSALGGSVLVYLIAPLNTATAGASGAVFGLFGATFMVARRLHL
FT                   DVRWVVALIVINLAFTFLAPAISWQGHVGGLVTGALVAATYVYAPRERRNLIQATVTIT
FT                   VLVAFVVLIGWRTVDLLALFGGRLNLS"
FT   CDS_pept        163694..165751
FT                   /transl_table=11
FT                   /gene="BCG_0144"
FT                   /locus_tag="BCG_0144"
FT                   /product="Possible transmembrane acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70129"
FT                   /db_xref="GOA:A0A0H3M1D0"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1D0"
FT                   /protein_id="CAL70129.1"
FT                   /translation="MPARSVPRPRWVAPVRRVGRLAVWDRPERRSGIPALDGLRAIAVA
FT                   LVLASHGGIPGMGGGFIGVDAFFVLSGFLITSLLLDELGRTGRIDLSGFWIRRARRLLP
FT                   ALVLMVLTVSAARALFPDQALTGLRSDAIAAFLWTANWRFVAQNTDYFTQGAPPSPLQH
FT                   TWSLGVEEQYYVVWPLLLIGATLLLAARARRRCRRATVGGVRFAAFLIASLGTMASATA
FT                   AVAFTSAATRDRIYFGTDTRAQALLIGSAAAALLVRDWPSLNRGWCLIRTRWGRRIARL
FT                   LPFVGLAGLAVTTHVATGSVGEFRHGLLIVVAGAAVIVVASVAMEQRGAVARILAWRPL
FT                   VWLGTISYGVYLWHWPIFLALNGQRTGWSGPALFAARCAATVVLAGASWWLIEQPIRRW
FT                   RPARVPLLPLAAATVASAAAVTMLVVPVGAGPGLREIGLPPGVSAVAAVSPSPPEASQP
FT                   APGPRDPNRPFTVSVFGDSIGWTLMHYLPPTPGFRFIDHTVIGCSLVRGTPYRYIGQTL
FT                   EQRAECDGWPARWSAQVNRDQPDVALLIVGRWETVDRVNEGRWTHIGDPTFDAYLNAEL
FT                   QRALSIVGSTGVRVMVTTVPYSRGGEKPDGRLYPEDQPERVNKWNAMLHNAISQHSNVG
FT                   MIDLNKKLCPDGVYTAKVDGIKVRSDGVHLTQEGVKWLIPWLEDSVRVAS"
FT   CDS_pept        166033..166989
FT                   /transl_table=11
FT                   /gene="gca"
FT                   /locus_tag="BCG_0145"
FT                   /product="Possible gdp-mannose 4,6-dehydratase gca"
FT                   /EC_number="4.2.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0145"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70130"
FT                   /db_xref="GOA:A0A0H3M0Q0"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M0Q0"
FT                   /protein_id="CAL70130.1"
FT                   /translation="MKVWITGAGGMMGSHLAEMLLAAGHDVYATYCRPTIDPSDLQFNG
FT                   AEVDITDWCSVYDSIATFRPDAVFHLAAQSYPAVSWARPVETLTTNMVGTAIVFEALRR
FT                   VRPHAKIIVAGSSAEYGFVDPSEVPINERRELRPLHPYGVSKAATDMLAYQYHKSYGMH
FT                   TVVARIFNCTGPRKVGDALSDFVRRCTWLEHHPEQSAIRVGNLKTKRTIVDVRDLNRAL
FT                   MLMLDKGEAGADYNVGGSIAYEMGDVLKQVIAACKRDDIVPEVDPALLRPTDEKIIYGD
FT                   CSKLAAITGWQQEICLTQTIADMFDYWRSKSESALMV"
FT   CDS_pept        167063..167653
FT                   /transl_table=11
FT                   /gene="gmhA"
FT                   /locus_tag="BCG_0146"
FT                   /product="Probable phosphoheptose isomerase gmhA"
FT                   /EC_number="5.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0146"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70131"
FT                   /db_xref="GOA:A1KET4"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KET4"
FT                   /protein_id="CAL70131.1"
FT                   /translation="MCTARTAEEIFVETIAVKTRILNDRVLLEAARAIGDRLIAGYRAG
FT                   ARVFMCGNGGSAADAQHFAAELTGHLIFDRPPLGAEALHANSSHLTAVANDYDYDTVFA
FT                   RALEGSARPGDTLFAISTSGNSMSVLRAAKTARELGVTVVAMTGESGGQLAEFADFLIN
FT                   VPSRDTGRIQESHIVFIHAISEHVEHALFAPRQ"
FT   CDS_pept        167685..168257
FT                   /transl_table=11
FT                   /gene="BCG_0147"
FT                   /locus_tag="BCG_0147"
FT                   /product="Possible dehydratase"
FT                   /EC_number="4.-.-.-"
FT                   /note="Differs from Rv0114 by 1aa, R121G"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0147"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70132"
FT                   /db_xref="GOA:A0A0H3M7B2"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7B2"
FT                   /protein_id="CAL70132.1"
FT                   /translation="MVAERAGHQWCLFLDRDGVINRQVVGDYVRNWRQFEWLPGAARAL
FT                   KKLRAWAPYIVVVTNQQGVGAGLMSAVDVMVIHRHLQMQLASDGVLIDGFQVCPHHRSQ
FT                   RCGCRKPRPGLVLDWLRRHPDSEPLLSIVVGDSLSDLELAHNVAAAAGACASVQIGGAS
FT                   SGGVADASFDSLWEFAVAVGHARGERG"
FT   CDS_pept        168257..169324
FT                   /transl_table=11
FT                   /gene="BCG_0149"
FT                   /locus_tag="BCG_0149"
FT                   /product="Possible sugar kinase"
FT                   /EC_number="2.-.-.-"
FT                   /note="In Mycobacterium bovis BCG Pasteur, and
FT                   Mycobacterium bovis, a single base insertion (*-c)
FT                   equivalent to Mycobacterium tuberculosis H37Rv position
FT                   139559, leads to shorter product with a different COOH part
FT                   compared to its homolog in Mycobacterium tuberculosis
FT                   strain H37Rv. In addition, in Mycobacterium bovis, a single
FT                   base insertion, at position equivalent to 138823, leads to
FT                   a different NH2 part"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0149"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70133"
FT                   /db_xref="GOA:A0A0H3M2J9"
FT                   /db_xref="InterPro:IPR001174"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014606"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2J9"
FT                   /protein_id="CAL70133.1"
FT                   /translation="MAILRGRAPLRLGLGGGGTDVEPYSSQFGGRILSVTIDKYAYAFA
FT                   ERGTGDEIAFRSPDRDRAGQASIDDLASLEEDFPLHVAVYRRVIAEFNGGTPFPLQLAT
FT                   QVDAPPGSGLGSSSALVVAMLLTTCALIGSSPGPYELARLAWEIERVDLGMAGGWQDHY
FT                   AAAFGGFNFMESRPNGEVVVNPLRIRREVIAELEASLLLYFGGVSRLSSEVIADQQRNV
FT                   VERDADALAATHSICAEALEMKDLLVVGDIPGFADSLLRGWQAKKRTSTRISNPAIEHA
FT                   YQVAQSSGMVAGKVSGAGGGGFLMMIVDPRRRIEVARSLERECGGSVAPCLFTKGGAVT
FT                   WHIPESTAPRKAWSC"
FT   CDS_pept        complement(170012..170767)
FT                   /transl_table=11
FT                   /gene="BCG_0150c"
FT                   /locus_tag="BCG_0150c"
FT                   /product="Possible conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0150c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70134"
FT                   /db_xref="GOA:A0A0H3M9T9"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="InterPro:IPR041280"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M9T9"
FT                   /protein_id="CAL70134.1"
FT                   /translation="MRRVVRYLSVVVAITLMLTAESVSIATAAVPPLQPIPGVASVSPA
FT                   NGAVVGVAHPVVVTFTTPVTDRRAVERSIRISTPHNTTGHFEWVASNVVRWVPHRYWPP
FT                   HTRVSVGVQELTEGFETGDALIGVASISAHTFTVSRNGEVLRTMPASLGKPSRPTPIGS
FT                   FHAMSKERTVVMDSRTIGIPLNSSDGYLLTAHYAVRVTWSGVYVHSAPWSVNSQGYANV
FT                   SHGCINLSPDNAAWYFDAVTVGDPIEVVG"
FT   CDS_pept        170945..171889
FT                   /transl_table=11
FT                   /gene="oxyS"
FT                   /locus_tag="BCG_0151"
FT                   /product="Oxidative stress response regulatory protein
FT                   oxyS"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0151"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70135"
FT                   /db_xref="GOA:A0A0H3M1D5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1D5"
FT                   /protein_id="CAL70135.1"
FT                   /translation="MLFRQLEYFVAVAQERHFARAAEKCYVSQPALSSAIAKLERELNV
FT                   TLINRGHSFEGLTREGERLVVWAKRILAEHAAFKAEVDAVRSGITGTLRLGTVPTASTT
FT                   ASLVLSAFCSAHPLAKVQVCSRLAATELYRRLREFELDAVIVHPETQDSDDVDLVPLYE
FT                   EQYVLLSPADMLPPGTSTLVWRDAAQLPLALLTADMRDRQVIDAAFADHAVSAIPQVET
FT                   DSVASLFAQVATGNWASIVPHTWLWAMPMSGPTGGEIRAVELVDPVLKAQIALATNALG
FT                   PGSPVARALITCAQALALNEFFDTQLRGITRRR"
FT   CDS_pept        complement(171873..173621)
FT                   /transl_table=11
FT                   /gene="oxcA"
FT                   /locus_tag="BCG_0152c"
FT                   /product="Probable oxalyl-CoA decarboxylase oxcA"
FT                   /EC_number="4.1.1.8"
FT                   /note="Differs from Rv0118c by 1aa, G224S"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0152c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70136"
FT                   /db_xref="GOA:A0A0H3M0Q5"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR017660"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M0Q5"
FT                   /protein_id="CAL70136.1"
FT                   /translation="MTTRSASPCTVLTDGCHLVVDALKANDVDTIYGVVGIPITDLARA
FT                   AQASGIRYIGFRHEASAGNAAAAAGFLTARPGVCLTTSGPGFLNGLPALANATTNCFPM
FT                   IQISGSSSRPMVDLQRGDYQDLDQLNAARPFVKAAYRIGQVQDIGRGVARAIRTATSGR
FT                   PGGVYLDIPGDVLGQAVEASAASGAIWRPVDPAPRLLPAPEAIDRALDVLAQAQRPLLV
FT                   LGKGAAYAQADNVIREFVEHTGIPFLPMSMAKGLLPDSHPQSAAAARSLAMARADVVLL
FT                   VGARLNWLLGNGESPQWSADAKFIQVDIEASEFDSNRPIVAPLTGDIGSVMSALLEAAA
FT                   DRSSVASAAWTGELADRKARNSAKMRRRLADDHHPMRFYNALGAIRSVLQRNPDVYVVN
FT                   EGANALDLARNIIDMHLPRHRLDSGTWGVMGIGMGYAIAAAVETGRPVVAIEGDSAFGF
FT                   SGMEFETICRYRLPVTVVILNNGGVYRGDEATIFRSAAPVWRHDPAPTVLNAHARHELI
FT                   AEAFGGKGYHVSTPTELESALTDALASNGPSLIDCELDPADGVESGHLAKLNTTSAATP
FT                   AISGDG"
FT   CDS_pept        173794..175371
FT                   /transl_table=11
FT                   /gene="fadD7"
FT                   /locus_tag="BCG_0153"
FT                   /product="Probable fatty-acid-CoA ligase fadD7"
FT                   /EC_number="6.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0153"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70137"
FT                   /db_xref="GOA:A0A0H3M7B7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7B7"
FT                   /protein_id="CAL70137.1"
FT                   /translation="MASDFGPRIADLVEVAATRLPEAPALVVTADRIAISHRDLARLVD
FT                   ELAGQLTRSGLLPGDRVALRMGSNAEFVVALLAASRADLVVVPLDPALPITEQRVRSQA
FT                   AGARVVLIDADGPHDRAEPTTRWWPLTVNVGGDSGPSGGTLSVHLDAATEPNPATSTPE
FT                   GLRPDDAMIMFTGGTTGLPKMVPWTHANIASSVRAIITGYRLSPRDATVAVMPLYHGHG
FT                   LIASLLATLASGGAVSLPARGRFSAHTFWDDIKAVGATWYTAVPTIHQILLERSATEPS
FT                   GRKPAALRFIRSCSAPLTAQAALALQTEFAAPVVCAFGMTEATHQVTTTQIEGIDQTET
FT                   PVVSTGLVGRSTGAQIRIVGSDGLPLPAGAVGEIWLRGTTVVRGYLGDPTITAANFTDG
FT                   WLRTGDLGSLSAAGDLSIRGRIKELINRGGEKISPERVEGVLASHPNVMEAAVFGVPHQ
FT                   LYGEAVAAVIVPRESAPPTREELVQFCRERLAAFEIPASFQEASGLPHTAKGSLDRRAV
FT                   AERFGHSV"
FT   CDS_pept        complement(175372..177516)
FT                   /transl_table=11
FT                   /gene="fusA2b"
FT                   /locus_tag="BCG_0154c"
FT                   /standard_name="fus2"
FT                   /product="Probable elongation factor g fusA2b [second
FT                   part]"
FT                   /note="In Mycobacterium bovis BCG Pasteur and Mycobacterium
FT                   tuberculosis strain H37Rv, fusA2 exists as a single gene.
FT                   In Mycobacterium bovis, a frameshift due to a 2bp to 1bp
FT                   substitution (gc-t), splits fusA2 into 2 parts, fusA2a and
FT                   fusA2b"
FT                   /note="Differs from Rv0120c by 2aa, W106R, S562N"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0154c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70138"
FT                   /db_xref="GOA:A0A0H3M2K3"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2K3"
FT                   /protein_id="CAL70138.1"
FT                   /translation="MADRVNASQGAAAAPTANGPGGVRNVVLVGPSGGGKTTLIEALLV
FT                   AAKVLSRPGSVTEGTTVCDFDEAEIRQQRSVGLAVASLAYDGIKVNLVDTPGYADFVGE
FT                   LWAGLRAADCALFVIAANEGVDEPTKSLWQECSQVGMPRAVVITKLDHARANYREALTA
FT                   AQDAFGDKVLPLYLPSGDGLIGLLSQALYEYADGKRTTRTPAESDTERIEEARGALIEG
FT                   IIEESEDESLMERYLGGETIDESVLIQDLEKAVARGSFFPVIPVCSSTGVGTLELLEVA
FT                   TRGFPSPMEHPLPEVFTPQGVPHAELACDNDAPLLAEVVKTTSDPYVGRVSLVRVFSGT
FT                   IRPDTTVHVSGHFSSFFGGGTSNTHPDHDEDERIGVLSFPLGKQQRPAAAVVAGDICAI
FT                   GKLSRAETGDTLSDKAEPLVLKPWTMPEPLLPIAIAAHAKTDEDKLSVGLGRLAAEDPT
FT                   LRIEQNQETHQVVLWCMGEAHAGVVLDTLANRYGVSVDTIELRVPLRETFAGNAKGHGR
FT                   HIKQSGGHGQYGVCDIEVEPLPEGSGFEFLDKVVGGAVPRQFIPSVEKGVRAQMDKGVH
FT                   AGYPVVDIRVTLLDGKAHSVDSSDFAFQMAGALALREAAAATKVILLEPIDEISVLVPD
FT                   DFVGAVLGDLSSRRGRVLGTETAGHDRTVIKAEVPQVELTRYAIDLRSLAHGAASFTRS
FT                   FARYEPMPESAAARVKAGAG"
FT   CDS_pept        complement(177652..178086)
FT                   /transl_table=11
FT                   /gene="BCG_0155c"
FT                   /locus_tag="BCG_0155c"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0155c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70139"
FT                   /db_xref="GOA:A0A0H3M9U3"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019967"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M9U3"
FT                   /protein_id="CAL70139.1"
FT                   /translation="MGEFDPKLRFAQSPVARLATSTPDGTPHLVPVVFALGARRPAEAT
FT                   GADVIYTAVDAKRKTTQRLRRLANLEHNPRASVLVDSYADDWTQLWWVRADGVAAIHRD
FT                   GEVMRAAYRLLRAKYAQYQSVPLNGPVIAIAVQRWASWHA"
FT   CDS_pept        178235..178603
FT                   /transl_table=11
FT                   /gene="BCG_0156"
FT                   /locus_tag="BCG_0156"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0156"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70140"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1E0"
FT                   /protein_id="CAL70140.1"
FT                   /translation="MAGSVSAAAGIGWVGLNVTETNRDQCYRVERTTVDALTHPEYRVH
FT                   TRGVQRVRVTRNARKHRVSKHRIVAAMRHCGVPVIQEDGSLYYQGRDTSGRLTEVVAVE
FT                   ADDGDLIITHAMPKEWKR"
FT   CDS_pept        178600..178968
FT                   /transl_table=11
FT                   /gene="BCG_0157"
FT                   /locus_tag="BCG_0157"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0157"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70141"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M0R1"
FT                   /protein_id="CAL70141.1"
FT                   /translation="MTKKPRNPADYVIGDDVEVSDVDLKQEEVYVDGERLTDERVEQMA
FT                   SESLRLAREREANLIPGGKSLSGGSAHSPAVQVVVSKATHAKLKELARSRKMSVSKLLR
FT                   PVLDEFVQRETGRILPRR"
FT   CDS_pept        179277..180893
FT                   /transl_table=11
FT                   /gene="PE_PGRS2"
FT                   /locus_tag="BCG_0158"
FT                   /product="PE-PGRS family protein"
FT                   /note="In Mycobacterium bovis and Mycobacterium bovis BCG
FT                   Pasteur, a 180 bp insertion leads to a longer product in
FT                   the 3' direction compared to its homolog in Mycobacterium
FT                   tuberculosis strain H37Rv (538 aa versus 487 aa)"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0158"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70142"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7C1"
FT                   /protein_id="CAL70142.1"
FT                   /translation="MSFVSVAPEIVVAAATDLAGIGSAISAANAAAAAPTTAVLAAGAD
FT                   EVSAAIAALFSGHAQAYQALSAQAAAFHQQFVQTLAGGAGAYAAAEAQVEQQLLAAINA
FT                   PTQALLGRPLIGNGADGAPGTGQAGGAGGILYGNGGNGGSGAAGQAGGAGGPAGLIGHG
FT                   GSGGAGGHGGWLWGNGGVGGSGGAGVGAGVAGGHGGAGGAAGLWGAGGGGGNGGNGADA
FT                   NIVSGGDGGLGGAGGGGGWLYGDGGAGGHGGQGAIGLGGGAGGDGGQGGAGRGLWGTGG
FT                   AGGHGGQGGGTGGPPLPGQAGMGAAGGAGGLIGNGGAGGDGGVGASGGVAGVGGAGGNA
FT                   MLIGHGGAGGAGGDSSFANGAAGGAGGAGGHLFGNGGSGGHGGAVTAGNTGIGGAGGVG
FT                   GDARLIGHGGAGGAGGDRAGALVGRDGGPGGNGGAGGQLYGNGGDGGPGGQGGQAFGAN
FT                   NIGGTGGAGGNGGPAILSGNGGNGGAGGAGGAGGAGGGAGGVGGAGGAPGTGGTLQAAV
FT                   SGLVTALFGAPGQPGDTGQPG"
FT   CDS_pept        181045..182112
FT                   /transl_table=11
FT                   /gene="pepA"
FT                   /locus_tag="BCG_0159"
FT                   /product="Probable serine protease pepA"
FT                   /EC_number="3.4.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0159"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70143"
FT                   /db_xref="GOA:A0A0H3M2K8"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2K8"
FT                   /protein_id="CAL70143.1"
FT                   /translation="MSNSRRRSLRWSWLLSVLAAVGLGLATAPAQAAPPALSQDRFADF
FT                   PALPLDPSAMVAQVGPQVVNINTKLGYNNAVGAGTGIVIDPNGVVLTNNHVIAGATDIN
FT                   AFSVGSGQTYGVDVVGYDRTQDVAVLQLRGAGGLPSAAIGGGVAVGEPVVAMGNSGGQG
FT                   GTPRAVPGRVVALGQTVQASDSLTGAEETLNGLIQFDAAIQPGDSGGPVVNGLGQVVGM
FT                   NTAASDNFQLSQGGQGFAIPIGQAMAIAGQIRSGGGSPTVHIGPTAFLGLGVVDNNGNG
FT                   ARVQRVVGSAPAASLGISTGDVITAVDGAPINSATAMADALNGHHPGDVISVTWQTKSG
FT                   GTRTGNVTLAEGPPA"
FT   CDS_pept        182221..184026
FT                   /transl_table=11
FT                   /gene="treS"
FT                   /locus_tag="BCG_0160"
FT                   /product="Trehalose synthase treS"
FT                   /EC_number="5.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0160"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70144"
FT                   /db_xref="GOA:A0A0H3M9U6"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012810"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M9U6"
FT                   /protein_id="CAL70144.1"
FT                   /translation="MNEAEHSVEHPPVQGSHVEGGVVEHPDAKDFGSAAALPADPTWFK
FT                   HAVFYEVLVRAFFDASADGSGDLRGLIDRLDYLQWLGIDCIWLPPFYDSPLRDGGYDIR
FT                   DFYKVLPEFGTVDDFVALVDAAHRRGIRIITDLVMNHTSESHPWFQESRRDPDGPYGDY
FT                   YVWSDTSERYTDARIIFVDTEESNWSFDPVRRQFYWHRFFSHQPDLNYDNPAVQEAMID
FT                   VIRFWLGLGIDGFRLDAVPYLFEREGTNCENLPETHAFLKRVRKVVDDEFPGRVLLAEA
FT                   NQWPGDVVEYFGDPNTGGDECHMAFHFPLMPRIFMAVRRESRFPISEIIAQTPPIPDMA
FT                   QWGIFLRNHDELTLEMVTDEERDYMYAEYAKDPRMKANVGIRRRLAPLLDNDRNQIELF
FT                   TALLLSLPGSPVLYYGDEIGMGDVIWLGDRDGVRIPMQWTPDRNAGFSTANPGRLYLPP
FT                   SQDPVYGYQAVNVEAQRDTSTSLLNFTRTMLAVRRRHPAFAVGAFQELGGSNPSVLAYV
FT                   RQVAGDDGDTVLCVNNLSRFPQPIELDLQQWTNYTPVELTGHVEFPRIGQVPYLLTLPG
FT                   HGFYWFQLTTHEVGAPPTCGGERRL"
FT   CDS_pept        184129..185496
FT                   /transl_table=11
FT                   /gene="BCG_0161"
FT                   /locus_tag="BCG_0161"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Differs from Rv0127 by 1aa, P18S"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0161"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70145"
FT                   /db_xref="GOA:A1KEU8"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR040999"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KEU8"
FT                   /protein_id="CAL70145.1"
FT                   /translation="MTRSDTLATKLPWSDWLPRQRWYAGRNRELATVKPGVVVALRHNL
FT                   DLVLVDVTYTDGATERYQVLVGWDFEPASEYGTKAAIGVADDRTGFDALYDVAGPQFLL
FT                   SLIVSSAVCGTSTGEVTFTREPDVELPFAAQPRVCDAEQSNTSVIFDRRAILKVFRRVS
FT                   SGINPDIELNRVLTRAGNPHVARLLGAYQFGRPNRSPTDALAYALGMVTEYEANAAEGW
FT                   AMATASVRDLFAEGDLYAHEVGGDFAGESYRLGEAVASVHATLADSLGTAQATFPVDRM
FT                   LARLSSTVAVVPELREYAPTIEQQFQKLAAEAITVQRVHGDLHLGQVLRTPESWLLIDF
FT                   EGEPGQPLDERRAPDSPLRDVAGVLRSFEYAAYGPLVDQATDKQLAARAREWVERNRAA
FT                   FCDGYAVASGIDPRDSALLLGAYELDKAVYETGYETRHRPGWLPIPLRSIARLTAS"
FT   CDS_pept        185564..186343
FT                   /transl_table=11
FT                   /gene="BCG_0162"
FT                   /locus_tag="BCG_0162"
FT                   /product="Probable conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0162"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70146"
FT                   /db_xref="GOA:A0A0H3M1E3"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1E3"
FT                   /protein_id="CAL70146.1"
FT                   /translation="MQREIYDGEARLSWVLAALAGILGATAFTHSAGYFVTFMTGNSQR
FT                   AVLGLFGDDAWMSVTASLLILFFVAGVVIASVCRRHFWAAHPHGPTVLTTFSLIFAAGV
FT                   DIMLGGWHESMLDFVPILFVVFGIGALNTSFVKDGEVSVPLSYVTGTLVKMGQGIERHL
FT                   AGGKVEDWLGYFLLHASFVLGAAAGGAISMVVTGPQMLAVAAVVCAATTGYTYLHADRR
FT                   GLVNQKRPQPGKRLFRALRRGELDSGTSTPATNYGSS"
FT   CDS_pept        complement(186475..187497)
FT                   /transl_table=11
FT                   /gene="fbpC"
FT                   /locus_tag="BCG_0163c"
FT                   /standard_name="mpt45; 85C; fbpC2"
FT                   /product="Secreted antigen 85-c fbpC (85C)"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0163c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70147"
FT                   /db_xref="GOA:A0A0H3M0R3"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M0R3"
FT                   /protein_id="CAL70147.1"
FT                   /translation="MTFFEQVRRLRSAATTLPRRLAIAAMGAVLVYGLVGTFGGPATAG
FT                   AFSRPGLPVEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEE
FT                   YYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTG
FT                   NAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANS
FT                   MWGPSSDPAWKRNDPMVQIPRLVANNTRIWVYCGNGTPSDLGGDNIPAKFLEGLTLRTN
FT                   QTFRDTYAADGGRNGVFNFPPNGTHSWPYWNEQLVAMKADIQHVLNGATPPAAPAAPAA
FT                   "
FT   CDS_pept        187744..188199
FT                   /transl_table=11
FT                   /gene="BCG_0164"
FT                   /locus_tag="BCG_0164"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0164"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70148"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039375"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7C4"
FT                   /protein_id="CAL70148.1"
FT                   /translation="MRTFESVADLAAAAGEKVGQSDWVTITQEEVNLFADATGDHQWIH
FT                   VDPERAAAGPFGTTIAHGFMTLALLPRLQHQMYTVKGVKLAINYGLNKVRFPAPVPVGS
FT                   RVRATSSLVGVEDLGNGTVQATVSTTVEVEGSAKPACVAESIVRYVA"
FT   CDS_pept        complement(188212..189555)
FT                   /transl_table=11
FT                   /gene="fadE1"
FT                   /locus_tag="BCG_0165c"
FT                   /product="Probable acyl-CoA dehydrogenase fadE1"
FT                   /EC_number="1.3.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0165c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70149"
FT                   /db_xref="GOA:A0A0H3M2L2"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2L2"
FT                   /protein_id="CAL70149.1"
FT                   /translation="MPVRRRAGERLPTVWDFETDPQYQSKLDWVEKFMAEELEPLDLVA
FT                   LDPYDKKNADTMAILRPLQRQVKDQGLWAAHLRPELGGQGFGQVKLALLNEIIGRSRWA
FT                   PSAFGCQAPDSGNAEILALFGTDEQKARYLRPLLDGEITSCYSMTEPQGGSDPGLFVTA
FT                   ATRDAAGNGDWIINGEKWFSTNAKHASFFIVMAVTKPEARTYEKMSLFIVPADTPGIEI
FT                   VRNVGVGAESTRHASHGYIRYHDVRVPADHVLGGEGQAFMIAQTRLGGGRIHHAMRTIA
FT                   LARRAFDMMCERALSRQTRHGRLADLQMTQEKIADSWIQIEQFRLLVLRTAWLIDKHHD
FT                   YQKVRRDIAAVKVAMPQVLHDVVQRAMHLHGALGVSDEMPFVKMMLAAESLGIADGATE
FT                   LHKMTVARRTLREYQPVTTLFPSQHIPTRRAHAEAWLAQRLEHAIAEF"
FT   CDS_pept        complement(189597..190679)
FT                   /transl_table=11
FT                   /gene="fgd2"
FT                   /locus_tag="BCG_0166c"
FT                   /product="Putative f420-dependant glucose-6-phosphate
FT                   dehydrogenase fgd2"
FT                   /EC_number="1.-.-.-"
FT                   /note="Differs from Rv0132c by 1aa, E147K"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0166c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70150"
FT                   /db_xref="GOA:A0A0H3M9V0"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019945"
FT                   /db_xref="InterPro:IPR031017"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M9V0"
FT                   /protein_id="CAL70150.1"
FT                   /translation="MTGISRRTFGLAAGFGAIGAGGLGGGCSTRSGPTPTPEPASRGVG
FT                   VVLSHEQFRTDRLVAHAQAAEQAGFRYVWASDHLQPWQDNEGHSMFPWLTLALVGNSTS
FT                   SILFGTGVTCPIYRYHPATVAQAFASLAILNPGRVFLGLGTGERLNEQAATDTFGNYRE
FT                   RHDRLIEAIVLIRQLWSGERISFTGHYFRTDELKLYDTPAMPPPIFVAASGPQSATLAG
FT                   RYGDGWIAQARDINDAKLLAAFAAGAQAAGRDPTTLGKRAELFAVVGDDKAAARAADLW
FT                   RFTAGAVDQPNPVEIQRAAESNPIEKVLANWAVGTDPGVHIGAVQAVLDAGAVPFLHFP
FT                   QDDPITAIDFYRTNVLPELR"
FT   CDS_pept        190766..191248
FT                   /transl_table=11
FT                   /gene="BCG_0167"
FT                   /locus_tag="BCG_0167"
FT                   /product="Putative acetyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="In Mycobacterium tuberculosis strain H37Rv, and
FT                   Mycobacterium bovis AF2122/97, codon 161 is TAC and in
FT                   Mycobacterium bovis BCG Pasteur, TAA"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0167"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70151"
FT                   /db_xref="GOA:A0A0H3M1E9"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1E9"
FT                   /protein_id="CAL70151.1"
FT                   /translation="MTPQARPARRADVRELSRTMARAFYDDPFMSWLLSNDNARTARLT
FT                   RLFATIVRHQHLAGGGVEVARGAAGIGGAALWDPPDRWRESRRQQLAMTPGFLRVFGFR
FT                   TAKARAALDVMMRVHPEEPHWYLAAIGSDPTVRGQGFGQVLMRSRLDRCDAEHCPA"
FT   CDS_pept        191668..192051
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="BCG_0168"
FT                   /locus_tag="BCG_0168"
FT   CDS_pept        192051..192158
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="BCG_0169"
FT                   /locus_tag="BCG_0169"
FT   CDS_pept        192160..192570
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="BCG_0170"
FT                   /locus_tag="BCG_0170"
FT                   /note="differs from Mb0139-3 by 1aa, G16R"
FT   CDS_pept        complement(192541..193146)
FT                   /transl_table=11
FT                   /gene="BCG_0171c"
FT                   /locus_tag="BCG_0171c"
FT                   /product="Possible transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0171c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70155"
FT                   /db_xref="GOA:A0A0H3M0R6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M0R6"
FT                   /protein_id="CAL70155.1"
FT                   /translation="MTAVAAGALVVETDSFRLRLLDGLVASIGERGYRATTVSDIVRHA
FT                   RTSKRTFYDRFTSKEQCFLELLLADNETLGNSIRAAVDPNADWHDQIRQAVEAYVTHIE
FT                   SRPAVTLSWIREFPSLGAAAYPVQRRGMEQLTSLLIELSASPGFRRANLPPLNVPLAVI
FT                   LLGGLRELTALTVEDGQPIRNIVEPAVDASIALLGPRS"
FT   CDS_pept        193263..194588
FT                   /transl_table=11
FT                   /gene="cyp138"
FT                   /locus_tag="BCG_0172"
FT                   /product="Probable cytochrome p450 138 cyp138"
FT                   /EC_number="1.14.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0172"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70156"
FT                   /db_xref="GOA:A0A0H3M7C6"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7C6"
FT                   /protein_id="CAL70156.1"
FT                   /translation="MSEVVTAAPAPPVVRLPPAVRGPKLFQGLAFVVSRRRLLGRFVRR
FT                   YGKAFTANILMYGRVVVVADPQLARQVFTSSPEELGNIQPNLSRMFGSGSVFALDGDDH
FT                   RRRRRLLAPPFHGKSMKNYETIIEEETLRETANWPQGQAFATLPSMMHITLNAILRAIF
FT                   GAGGSELDELRRLIPPWVTLGSRLAALPKPKRDYGRLSPWGRLAEWRRQYDTVIDKLIE
FT                   AERADPNFADRTDVLALMLRSTYDDGSIMSRKDIGDELLTLLAAGHETTAATLGWAFER
FT                   LSRHPDVLAALVEEVDNGGHELRQAAILEVQRARTVIDFAARRVNPPVYQLGEWVIPRG
FT                   YSIIINIAQIHGDPDVFPQPDRFDPQRYIGSKPSPFAWIPFGGGTRRCVGAAFANMEMD
FT                   VVLRTVLRHFTLETTTAAGERSHGRGVAFTPKDGGRVVMRRR"
FT   CDS_pept        complement(194609..195157)
FT                   /transl_table=11
FT                   /gene="msrA"
FT                   /locus_tag="BCG_0173c"
FT                   /product="Probable peptide methionine sulfoxide reductase
FT                   msrA"
FT                   /EC_number="1.8.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0173c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70157"
FT                   /db_xref="GOA:A1KEV7"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KEV7"
FT                   /protein_id="CAL70157.1"
FT                   /translation="MTSNQKAILAGGCFWGLQDLIRNQPGVVSTRVGYSGGNIPNATYR
FT                   NHGTHAEAVEIIFDPTVTDYRTLLEFFFQIHDPTTKDRQGNDRGTSYRSAIFYFDEQQK
FT                   RIALDTIADVEASGLWPGKVVTEVSPAGDFWEAEPEHQDYLQRYPNGYTCHFVRPGWRL
FT                   PRRTAESALRASLSPELGT"
FT   CDS_pept        195220..195723
FT                   /transl_table=11
FT                   /gene="BCG_0174"
FT                   /locus_tag="BCG_0174"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Differs from Mb0143 by 1aa, D96G"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0174"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70158"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2L6"
FT                   /protein_id="CAL70158.1"
FT                   /translation="MSASEFSRAELAAAFEKFEKTVARAAATRDWDCWVQHYTPDVEYI
FT                   EHAAGIMRGRQRVRAWIQETMTTFPGSHMVAFPSLWSVIDESTGRIICELDNPMLDPGD
FT                   GSVISATNISIITYAGNGQWCRQEDIYNPLRFLRAAMKWCRKAQELGTLDEDAARWMRR
FT                   HGGP"
FT   CDS_pept        195724..196746
FT                   /transl_table=11
FT                   /gene="BCG_0175"
FT                   /locus_tag="BCG_0175"
FT                   /product="Putative oxidoreductase"
FT                   /EC_number="1.-.-.-"
FT                   /note="Differs from Rv0139 by 1aa, R227H"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0175"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70159"
FT                   /db_xref="GOA:A0A0H3M9V5"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M9V5"
FT                   /protein_id="CAL70159.1"
FT                   /translation="MNAPKLVIGANGFLGSHVTRQLVADCAPQKGEVRAMVRPAANTRS
FT                   IDDLPLTRFHGDVFDTATVAEAMAGCDDVYYCVVDTRAWLRDPSPLFRTNVAGLRNVLD
FT                   VATDASLRRFVFTSSYATVGRRRGHVATEEDRVDTRKVTPYVRSRVAAEDLVLQYAHDA
FT                   GLPAVAMCVSTTYGGGDWGRTPHGAFIAGAVFGRLPFTMRGIRLEAVGVDDAARALILA
FT                   AERGRNGERYLISERMMPLQEVVRIAADEAGVPPPRWSISVPVLYALGALGSLRARLTG
FT                   KDTELSLASVRMMRSEADVDHGKAVRELGWQPRPVEESIREAARFWAAMRTVGKDPAAS
FT                   "
FT   CDS_pept        196807..197187
FT                   /transl_table=11
FT                   /gene="BCG_0176"
FT                   /locus_tag="BCG_0176"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0176"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70160"
FT                   /db_xref="InterPro:IPR007361"
FT                   /db_xref="InterPro:IPR038694"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1F5"
FT                   /protein_id="CAL70160.1"
FT                   /translation="MSNRIVLEPSADHPITIEPTNRRVQVRVNGEVVADTAAALCLQEA
FT                   SYPAVQYIPLADVVQDRLIRTETSTYCPFKGEASYYSVTTDAGDIVDDVMWTYENPYPA
FT                   VAAIAGHVACYPDKAEISIFPG"
FT   CDS_pept        complement(197168..197578)
FT                   /transl_table=11
FT                   /gene="BCG_0177c"
FT                   /locus_tag="BCG_0177c"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0177c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70161"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M0S1"
FT                   /protein_id="CAL70161.1"
FT                   /translation="MTPFDDPQAELAWMFLQSLCEGGDLDEGFALLSNDFTYWSIVTRT
FT                   ELDKKTFRRAVERRKQVFEVNIELIRCVNEGETVVVEGHCDGVSADRTRYDSPFVCIFE
FT                   TRDGMIISLREYSDTQSLAEVYPVACATPGRC"
FT   CDS_pept        197608..198534
FT                   /transl_table=11
FT                   /gene="BCG_0178"
FT                   /locus_tag="BCG_0178"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0178"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70162"
FT                   /db_xref="GOA:A0A0H3M7D0"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7D0"
FT                   /protein_id="CAL70162.1"
FT                   /translation="MRSIDVVVEAVVTFAGAAGFAHTLAPLRRGQQDPCFRVPGDGTIW
FT                   RTSLLPTGPVTARISRAGRDAARCVAWGSGAEEFVDMAPAMLGAADDASDFVPLHPAVA
FT                   AAHRRLPNLRLGRTGQVLEALIPAVIEQRVPGADAFRSWRLLVSKYGTQAPGPAPPGMR
FT                   VPPSAEVWRHIPSWEFHRANVDPGRARAVVGCAQRAASLERLVSLPAARAAEALTSLPG
FT                   VGVWTAAETTQRVFGDADAVSVGDYHIPKMIGWTLVGRPVDDAGMLELLEPMRPHRHRV
FT                   VRLLEASGLAREPRRGPRLPVQNIRAL"
FT   CDS_pept        complement(198601..200079)
FT                   /transl_table=11
FT                   /gene="BCG_0179c"
FT                   /locus_tag="BCG_0179c"
FT                   /product="Probable conserved transmembrane protein"
FT                   /note="Differs from Rv0143c by 1aa, L34F"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0179c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70163"
FT                   /db_xref="GOA:A0A0H3M2M2"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2M2"
FT                   /protein_id="CAL70163.1"
FT                   /translation="MAPGDWSVFAWHAANLPTMPEAEDIGNEAAGGRLGVSIRSAGYLR
FT                   KWFLLGITIGVIAGLGAVVFYLALKYTSEFLLGYLADYQIPTPVGEGGHRGSTGFARPW
FT                   AIPLVTTGGAVLSALIVAKLAPEATGHGTDEAIESVHGDPRAIRGRAVLVKMVASALTI
FT                   GSGGSGGREGPTAQISAGFCSLLTRRLNLSNEDGRTAVALGIGAGIGAIFAAPLGGAAL
FT                   GASIPYRDDFDYRNLLPGFIASGTAYAVLGAFLGFDPLFGYIDAEYRFEKAWPLLWFVV
FT                   IGLIAAAVGYLYARVFHASVAITRRLPGGPVLKPAIGGLLVGLLGLPIPQILSSGYGWA
FT                   QLAADRGTLLSIPLWIVIVLPIAKILATSLSIGTGGSGGLFGPGIVIGAFVGAAIWRLG
FT                   ELTELPGVPHEPGIFVVVAMMACFGSVSRAPLAVMIMVAEMTGSFSVVPGAIIAVGIAA
FT                   LLLSRTNVTIYETQRLNRQTAEAERGGSDRPTTA"
FT   CDS_pept        200181..201023
FT                   /transl_table=11
FT                   /gene="BCG_0180"
FT                   /locus_tag="BCG_0180"
FT                   /product="Probable transcriptional regulatory protein
FT                   (possibly tetR-family)"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0180"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70164"
FT                   /db_xref="GOA:A0A0H3M9V9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M9V9"
FT                   /protein_id="CAL70164.1"
FT                   /translation="MPHSWTPTSVMTPPLVVAAFRPVGHYRLATDRAGGPCSPPATGAK
FT                   LTSSVASRPTVGTKPQWWHTLVMSMSLTAGRGPGRPPAAKADETRKRILHAARQVFSER
FT                   GYDGATFQEIAVRADLTRPAINHYFANKRVLYQEVVEQTHELVIVAGIERARREPTLMG
FT                   RLAVVVDFAMEADAQYPASTAFLATTVLESQRHPELSRTENDAVRATREFLVWAVNDAI
FT                   ERGELAADVDVSSLAETLLVVLCGVGFYIGFVGSYQRMATITDSFQQLLAGTLWRPPT"
FT   CDS_pept        201112..202065
FT                   /transl_table=11
FT                   /gene="BCG_0181"
FT                   /locus_tag="BCG_0181"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0181"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70165"
FT                   /db_xref="GOA:A1KEW5"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KEW5"
FT                   /protein_id="CAL70165.1"
FT                   /translation="MTELDDVSSLPSSRRTAGDTWAITESVGATALGVAAARAVETAAT
FT                   NPLIRDEFAKVLVSSAGTAWARLADADLAWLDGDQLGRRVHRVACDYQAVRTHFFDEYF
FT                   GAAVDAGVRQVVILAAGLDARAYRLNWPAGTVVYEIDQPSVLEYKAGILQSHGAVPTAR
FT                   RHAVAVDLRDDWPAALIAAGFDGTQPTAWLAEGLLPYLPGDAADRLFDMVTALSAPGSQ
FT                   VAVEAFTMNTKGNTQRWNRMRERLGLDIDVQALTYHEPDRSDAAQWLATHGWQVHSVSN
FT                   REEMARLGRAIPQDLVDETVRTTLLRGRLVTPAQPA"
FT   CDS_pept        202108..203040
FT                   /transl_table=11
FT                   /gene="BCG_0182"
FT                   /locus_tag="BCG_0182"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0182"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70166"
FT                   /db_xref="GOA:A1KEW6"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KEW6"
FT                   /protein_id="CAL70166.1"
FT                   /translation="MRTHDDTWDIKTSVGATAVMVAAARAVETDRPDPLIRDPYARLLV
FT                   TNAGAGAIWEAMLDPTLVAKAAAIDAETAAIVAYLRSYQAVRTNFFDTYFASAVAAGIR
FT                   QVVILASGLDSRAYRLDWPAGTIVYEIDQPKVLSYKSTTLAENGVTPSAGRREVPADLR
FT                   QDWPAALRDAGFDPTARTAWLAEGLLMYLPAEAQDRLFTQVGAVSVAGSRIAAETAPVH
FT                   GEERRAEMRARFKKVADVLGIEQTIDVQELVYHDQDRASVADWLTDHGWRARSQRAPDE
FT                   MRRVGRWVEGVPMADDPTAFAEFVTAERL"
FT   CDS_pept        203135..204655
FT                   /transl_table=11
FT                   /gene="BCG_0183"
FT                   /locus_tag="BCG_0183"
FT                   /product="Probable aldehyde dehydrogenase (nad+) dependant"
FT                   /EC_number="1.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0183"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70167"
FT                   /db_xref="GOA:A0A0H3M1F9"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1F9"
FT                   /protein_id="CAL70167.1"
FT                   /translation="MSDRVKAVAPPDGRTMMTTESVARKTQKSETEAPREPAPVSDEKQ
FT                   TDVAKTVARLRKTFASGRTRSVEWRKQQLRALQKLMDENEDAIAAALAEDLDRNPFEAY
FT                   LADIATTSAEAKYAAKRVRRWMRRRYLLLEVPQLPGRGWVEYEPYGTVLIIGAWNYPFY
FT                   LTLGPAVGAIAAGNAVVLKPSEIAAASAHLMTELVYRYLDTEAIAVVQGDGAVSQELIA
FT                   QGFDRVMFTGGTEIGRKVYEGAAPHLTPVTLELGGKSPVIVAADADVDVAAKRIAWIKL
FT                   LNAGQTCVAPDYVLADATVRDELVSKITAALTKFRSGAPQGMRIVNQRQFDRLSGYLAA
FT                   AKTDAAADGGGVVVGGDCDASNLRIQPTVVVDPDPDGPLMSNEIFGPILPVVTVKSLDD
FT                   AIRFVNSRPKPLSAYLFTKSRAVRERVIREVPAGGMMVNHLAFQVSTAKLPFGGVGASG
FT                   MGAYHGRWGFEEFSHRKSVLTKPTRPDLSSFIYPPYTERAIKVARRLF"
FT   CDS_pept        204730..205590
FT                   /transl_table=11
FT                   /gene="BCG_0184"
FT                   /locus_tag="BCG_0184"
FT                   /product="Probable short-chain type
FT                   dehydrogenase/reductase"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0184"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70168"
FT                   /db_xref="GOA:A0A0H3M0S5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M0S5"
FT                   /protein_id="CAL70168.1"
FT                   /translation="MPGVQDRVIVVTGAGGGLGREYALTLAGEGASVVVNDLGGARDGT
FT                   GAGSAMADEVVAEIRDKGGRAVANYDSVATEDGAANIIKTALDEFGAVHGVVSNAGILR
FT                   DGTFHKMSFENWDAVLKVHLYGGYHVLRAAWPHFREQSYGRVVVATSTSGLFGNFGQTN
FT                   YGAAKLGLVGLINTLALEGAKYNIHANALAPIAATRMTQDILPPEVLEKLTPEFVAPVV
FT                   AYLCTEECADNASVYVVGGGKVQRVALFGNDGANFDKPPSVQDVAARWAEITDLSGAKI
FT                   AGFKL"
FT   CDS_pept        205597..206565
FT                   /transl_table=11
FT                   /gene="BCG_0185"
FT                   /locus_tag="BCG_0185"
FT                   /product="Putative quinone oxidoreductase"
FT                   /EC_number="1.6.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0185"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70169"
FT                   /db_xref="GOA:A0A0H3M7D2"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7D2"
FT                   /protein_id="CAL70169.1"
FT                   /translation="MKACVVKELSGPSGMVYTDIDEVSGDGGKVVIDVRAAGVCFPDLL
FT                   LTKGEYQLKLTPPFVPGMETAGVVRSAPSDAGFHVGERVSAFGVLGGYAEQIAVPVANV
FT                   VRSPVELDDAGAVSLLVNYNTMYFALARRAALRPGDTVLVLGAAGGVGTAAVQIAKAMQ
FT                   AGKVIAMVHREGAIDYVASLGADVVLPLTEGWAQQVRDHTYGQGVDIVVDPIGGPTFDD
FT                   ALGVLAIDGKLLLIGFAAGAVPTLKVNRLLVRNISVVGVGWGEYLNAVPGSAALFAWGL
FT                   NQLVFLGLRPPPPQRYPLSEAQAALQSLDDGGVLGKVVLEP"
FT   CDS_pept        complement(206562..206849)
FT                   /transl_table=11
FT                   /gene="BCG_0186c"
FT                   /locus_tag="BCG_0186c"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0186c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70170"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2M8"
FT                   /protein_id="CAL70170.1"
FT                   /translation="MLTLPDDRAPTGLPDPGIEALAHTKIASTISTVVADGYAVVLSTA
FT                   DIANSLLANAIGYPIAASVALVTPAAGANSSCWPADPSQHHRIAESRACA"
FT   CDS_pept        complement(207440..209206)
FT                   /transl_table=11
FT                   /gene="PE1"
FT                   /locus_tag="BCG_0187c"
FT                   /product="PE family protein"
FT                   /note="Differs from Rv0151c by 1aa, R26G"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0187c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70171"
FT                   /db_xref="GOA:A0A0H3M9W4"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="InterPro:IPR013228"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M9W4"
FT                   /protein_id="CAL70171.1"
FT                   /translation="MAPFGFTPKARHNRGVALRSTYRLDRWVMGPVDKEGWGLSYVFAQ
FT                   PSVLAAAATDLAGIGSAINQATAAVAAPTTGLAAAAADEVSTALATLFGAYGQQFQAIS
FT                   AQVAAFHNEFTQRLAAAANAFVNAEATNTSALVQEATAGLFKPTSPPVLPPMFNQNTAI
FT                   IMGGTGSPIPTPSYVNAITTLFIDPVVSNPVVKALVTPEELYPITGVKSLPFQTSVQLG
FT                   LQILDGAIWEQINAGNHVTVFGYSQSAVIASLEMQHLISLGPNAPSPSQLNFILIGNEM
FT                   NPNGGILARIPGLNVTTLGLPFYGATPDNPYPTTTYTLEYDGFADFPRYPLNVLSDINA
FT                   VFGILTVHTTYADLTPAQIASATQLPTQGTTSNTYYIIETEHLPLLAPLRAIPVIGPPL
FT                   AALVEPNLEVIVNLGYGDPRFGYSTSPANVPTPFGLFPDVPASVVADALVAGTQQGVND
FT                   FMVELPAALNTLPQTPMPAFPPYVPTLLPPPPPPQPATLINIADTFASVVSTGYSILLP
FT                   TADLGLAFVTILPAYDLTLFVNQLAAGNLRAAIELPLAATIGLAALGGMIEFIAIVVTL
FT                   ADITQQLQSFSI"
FT   CDS_pept        complement(209216..210793)
FT                   /transl_table=11
FT                   /gene="PE2"
FT                   /locus_tag="BCG_0188c"
FT                   /product="PE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0188c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70172"
FT                   /db_xref="InterPro:IPR013228"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1G6"
FT                   /protein_id="CAL70172.1"
FT                   /translation="MRCRPPSRNRSAHTARNTRPCSLKSRRFTVRFHQTLAAAANSYAD
FT                   AEAAIASTRQNQLAVPAAAPTPAAAAMIPPFPANLTTLFFGPTGIPLPPPSMLTPPIRC
FT                   RSVRRALQAVFTPEELYPLTGVRSLVLNTSVEEGLTILHDAIMVELATTGNAVTVFGWS
FT                   QSAIIASLEMQRFTAMGGAAPSASDLNFVLVGNEMNPNGGMLARFPDLTLPTLDLTFYG
FT                   ATPSDTIYPTAIYTLEYDGFADFSRYPLNFISDLNAVAGITFVHTKYLDLTPAQVEGAT
FT                   KLPTSPGYTGVTDYYIIRTENRPLLQPLRAVPVIGDPLADLIQPNLKVIVNLGYGDPNY
FT                   GYSTSYADVRTPFGLWPNVPPQVIADALAAGTQEGILDFTADLQALSAQPLTLPQIQLP
FT                   QPADLVAAVAAAPTPAEVVNTLARIISTNYAVLLPTVDIALALVTTLPLYTTQLFVRQL
FT                   AAGNLINAIGYPLAATVGLGTIDSGRRGIAHPPRGGLGHRSKHRGPRHLTDSRRHRRPP
FT                   TTVYRPRQ"
FT   CDS_pept        complement(211052..211882)
FT                   /transl_table=11
FT                   /gene="ptbB"
FT                   /locus_tag="BCG_0189c"
FT                   /standard_name="MPtpB"
FT                   /product="Phosphotyrosine protein phosphatase ptpB"
FT                   /EC_number="3.1.3.48"
FT                   /note="Differs from Rv0153c by 1aa, G105D"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0189c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70173"
FT                   /db_xref="GOA:A0A0H3M0T0"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR026893"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M0T0"
FT                   /protein_id="CAL70173.1"
FT                   /translation="MAVRELPGAWNFRDVADTATALRPGRLFRSSELSRLDDAGRATLR
FT                   RLGITDVADLRSSREVARRGPGRVPDGIDVHLLPFPDLADDDADDSAPHETAFKRLLTN
FT                   GGSNGESGESSQSINDAATRYMTDEYRQFPTRNGAQRALHRVVTLLAAGRPVLTHCFAG
FT                   KDRTGFVVALVLEAVGLDRDVIVADYLRSNDSVPQLRARISEMIQQRFDTELAPEVVTF
FT                   TKARLSDGVLGVRAEYLAAARQTIDETYGSLGGYLRDAGISQATVNRMRGVLLG"
FT   CDS_pept        complement(211884..213095)
FT                   /transl_table=11
FT                   /gene="fadE2"
FT                   /locus_tag="BCG_0190c"
FT                   /product="Probable acyl-CoA dehydrogenase fadE2"
FT                   /EC_number="1.3.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0190c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70174"
FT                   /db_xref="GOA:A0A0H3M7D5"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7D5"
FT                   /protein_id="CAL70174.1"
FT                   /translation="MSAKAIDYRTRLSDFMTEHVFGAEADYDDYRRAAGPADHTAPPII
FT                   EELKTKAKDRGLWNLFLSAESGLTNLEYAPLAEMTGWSMEIAPEALNCAAPDTGNMEIL
FT                   HMFGTEQQRAQWLRPLLDGKIRSAFSMTEPAVASSDARNIETTISRDGADYVINGRKWW
FT                   TSGAADPRCKILIVMGRTNPDAAAHQQQSMVLVPIDTPGVTIVRSTPVFGWQDRHGHCE
FT                   IDYHNVRVPATNLLGEEGSGFAIAQARLGPGRIHHCMRALGAAERALALMVNRVRNRVA
FT                   FGRPLAEQGVVQQAIAQSRNEIDQARLLCEKAAWTIDQHGNKEARHLVAMIKAVAPRVA
FT                   CDVIDRAIQVHGAAGVSDDTPLARLYGWHRAMRIFDGPDEVHLRSIARAELSREKSTFA
FT                   AAVT"
FT   CDS_pept        213519..214619
FT                   /transl_table=11
FT                   /gene="pntAa"
FT                   /locus_tag="BCG_0191"
FT                   /standard_name="pntAA"
FT                   /product="Probable nad(p) transhydrogenase (subunit alpha)
FT                   pntAa [first part]"
FT                   /EC_number="1.6.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0191"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70175"
FT                   /db_xref="GOA:A0A0H3M2N0"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2N0"
FT                   /protein_id="CAL70175.1"
FT                   /translation="MTDPQTQSTRVGVVAESGPDERRVALVPKAVASLVNRGVAVVVEA
FT                   GAGERALLPDELYTAVGASIGDAWAADVVVKVAPPTAAEVGRLRGGQTLIGFLAPRNAD
FT                   NSIGALTQAGVQAFALEAIPRISRAQVMDALSSQANVSGYKAVLLAASESTRFFPMLTT
FT                   AAGTVKPATVLVLGVGVAGLQALATAKRLGARTTGYDVRPEVADQVRSVGAQWLDLGIS
FT                   ASGEGGYARELTDDERAQQQKALEEAISGFDVVITTALVPGRPAPTLVTAAAVEAMKPG
FT                   SVVVDLAGETGGNCELTEPGRTVVKHDVTIAAPLNLPATMPEHASELYSKNITALLDLL
FT                   IKDGRLAPDFDDEVIAQSCVTRGKDS"
FT   CDS_pept        214620..214952
FT                   /transl_table=11
FT                   /gene="pntAb"
FT                   /locus_tag="BCG_0192"
FT                   /standard_name="pntAB"
FT                   /product="Probable nad(p) transhydrogenase (subunit alpha)
FT                   pntAb [second part]"
FT                   /note="Differs from Rv0156 by 1aa, C2Y"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0192"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70176"
FT                   /db_xref="GOA:A0A0H3M9W8"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M9W8"
FT                   /protein_id="CAL70176.1"
FT                   /translation="MCNELLENLAILVLSGFVGFAVISKVPNTLHTPLMSGTNAIHGIV
FT                   VLGALVVFGEIEHPSLVLQVILFVAVVFGTLNVIGGFIVTDRMLGMFKAKKPAVPAKPD
FT                   RDEALR"
FT   CDS_pept        214949..216376
FT                   /transl_table=11
FT                   /gene="pntB"
FT                   /locus_tag="BCG_0193"
FT                   /product="Probable nad(p) transhydrogenase (subunit beta)
FT                   pntB"
FT                   /EC_number="1.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0193"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70177"
FT                   /db_xref="GOA:A0A0H3M1H2"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1H2"
FT                   /protein_id="CAL70177.1"
FT                   /translation="MNLHYLVEILYIISFSLFIYGLMGLTGPKTAVRGNLIAAAGMTIA
FT                   VAATLVMIRHTSQWPLIIAGLVVGVVLGVPPARLTKMTAMPQLVAFFNGVGGGTVALIA
FT                   LSEFIDTTGFSAFQHGESPTVHIVVASLFAAIIGSISFWGSIVAFGKLQEIISGRPIGL
FT                   GKAQQPINLLLLAVAVAAAVVIGLHAHPGSGGVALWWMIGLLVAAGVLGLMVVLPIGGA
FT                   DMPVVISMLNAMTGLSAAAAGLALNNTAMIVAGMIVGASGSILTNLMAKAMNRSIPAIV
FT                   AGGFGGGGVAPSGGGDDKHVKATSAADAAIQMAYANQVIVVPGYGLAVAQAQHAVKDLA
FT                   TLLEDRGVPVKYAIHPVAGRMPGHMNVLLAEAEVDYDAMKDMDDINDEFARTDVTIVIG
FT                   ANDVTNPAARNETSSPIYGMPILNVDKSRSVIVLKRSMNSGFAGIDNPLFYADGTTMLF
FT                   GDAKKSVTEVSEELKAL"
FT   CDS_pept        216682..217326
FT                   /transl_table=11
FT                   /gene="BCG_0194"
FT                   /locus_tag="BCG_0194"
FT                   /product="Probable transcriptional regulatory protein
FT                   (possibly tetR-family)"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0194"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70178"
FT                   /db_xref="GOA:A0A0H3M0T4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M0T4"
FT                   /protein_id="CAL70178.1"
FT                   /translation="MPSDTSPNGLSRREELLAVATKLFAARGYHGTRMDDVADVIGLNK
FT                   ATVYHYYASKSLILFDIYRQAAEGTLAAVHDDPSWTAREALYQYTVRLLTAIASNPERA
FT                   AVYFQEQPYITEWFTSEQVAEVREKEQQVYEHVHGLIDRGIASGEFYECDSHVVALGYI
FT                   GMTLGSYRWLRPSGRRTAKEIAAEFSTALLRGLIRDESIRNQSPLGTRKET"
FT   CDS_pept        complement(217330..218736)
FT                   /transl_table=11
FT                   /gene="PE3"
FT                   /locus_tag="BCG_0195c"
FT                   /product="PE family protein"
FT                   /note="Differs from Rv0159c by 1aa, T255P"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0195c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70179"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="InterPro:IPR013228"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7D8"
FT                   /protein_id="CAL70179.1"
FT                   /translation="MSYVIAAPEMLATAAADVDGIGSAIRAASASAAGPTTGLLAAAAD
FT                   EVSSAAAALFSEYARECQEVLKQAAAFHGEFTRALAAAGAAYAQAEASNTAAMSGTAGS
FT                   SGALGSVGMLSGNPLTALMMGGTGEPILSDRVLAIIDSAYIRPIFGPNNPVAQYTPEQW
FT                   WPFIGNLSLDQSIAQGVTLLNNGINAELQNGHDVVVFGYSQSAAVATNEIRALMALPPG
FT                   QAPDPSRLAFTLIGNINNPNGGVLERYVGLYLTFLDMSFNGATPPDSPYQTYMYTGQYD
FT                   GYAHNPQYPLNILSDLNAFMGIRWVHNAYPFTAAEVANAVPLPTSPGYTGNTHYYMFLT
FT                   QDLPLLQPIRAIPFVGTPIAELIQPDLRVLVDLGYGYGYADVPTPASLFAPINPIAVAS
FT                   ALATGTVQGPQAALVSIGLLPQSALPNTYPYLPSANPGLMFNFGQSSVTELSVLSGALG
FT                   SVARLIPPIA"
FT   CDS_pept        complement(218828..220336)
FT                   /transl_table=11
FT                   /gene="PE4"
FT                   /locus_tag="BCG_0196c"
FT                   /product="PE family protein"
FT                   /note="Differs from Rv0160c by 2aa, T116A, T211A"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0196c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70180"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="InterPro:IPR013228"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2N5"
FT                   /protein_id="CAL70180.1"
FT                   /translation="MSHLVTAPDMLATAAAHVDEIASTLRAANAAAAGPTCNLLAAAGD
FT                   EVSAATAALFSAYGREYQAVVKQAAAFHSEFTRTLEAAGNAYAHAEAANAARVSHALDT
FT                   INAPIRTLLGRTPLSPNGSSGAGGLPAIAQLAAESPITALIMGGTNNPLPDPEYVTDIN
FT                   KAFIQTLFPGAVSQGLFTPEQFWPVTPDLGNLTFNQSVTEGVALLNTTVNNQLALDNKV
FT                   VAFGYSQSATIINNYINSLMAMGSPNPDDISFVMIGSGNNPVGGLLARFPGFYIPFLDV
FT                   PFNGATPANSPYPTHIYTAQYDGIAHAPQFPLRILSDINAFMGYFYVHNTYPELMATQV
FT                   DNAVPLPTSPGYTGNTQYYMFLTQDLPLLQPIRDIPYAGPPIADLFQPQLRVLVDLGYA
FT                   DYGPGGNYADIPTPAGLFSIPNPFAVTYYLIKGSLQAPYGAIVEIGVEAGLIGPEWFPD
FT                   SYPWVPSINPGLNFYFGQPQVTLLSLMSGGLGNILHLIPPPVFT"
FT   CDS_pept        220504..221853
FT                   /transl_table=11
FT                   /gene="BCG_0197"
FT                   /locus_tag="BCG_0197"
FT                   /product="Putative oxidoreductase"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0197"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70181"
FT                   /db_xref="GOA:A0A0H3M9X4"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M9X4"
FT                   /protein_id="CAL70181.1"
FT                   /translation="MLTSLVSAVGSHHVTTDPDVLAGRSVDHTGRYRGRASALVRPGSA
FT                   EEVAEVLRVCRDAGAYVTVQGGRTSLVAGTVPEHDDVLLSTERLCVVSDVDTVERRIEI
FT                   GAGVTLAAVQHAASTAGLVFGVDLSARDTATVGGMASTNAGGLRTVRYGNMGEQVVGLD
FT                   VALPDGTVLRRHSRVRRDNTGYDLPALFVGAEGTLGVITALDLRLHPTPSHRVTAVCGF
FT                   AELAALVDAGRMFRDVEGIAALELIDGRAAALTREHLGVRPPVEADWLLLVELAADHDQ
FT                   TDRLADLLGGARMCGEPAVGVDAAAQQRLWRTRESLAEVLGVYGPPLKFDVSLPLSAIS
FT                   GFARDAVALVHRHVPDSPEALPLLFGHIGEGNLHLNVLRCPPDREPALYAKMMGLIAEC
FT                   GGNVSSEHGVGSRKRAYLGMSRQANDVAAMRRVKAALDPTGYLNAAVLFD"
FT   CDS_pept        complement(221881..223032)
FT                   /transl_table=11
FT                   /gene="adhE1"
FT                   /locus_tag="BCG_0198c"
FT                   /product="Putative zinc-type alcohol dehydrogenase (e
FT                   subunit) adhE"
FT                   /EC_number="1.1.1.1"
FT                   /note="Differs from Rv0162c and Mb0167c by 1aa, R41H"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0198c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70182"
FT                   /db_xref="GOA:A0A0H3M1H6"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1H6"
FT                   /protein_id="CAL70182.1"
FT                   /translation="MPAVQPWLYSNMPAIRGAVLDQIGVPRPYWRSKPISVVELRLDPP
FT                   DRGEVLVRIEAAGVCHSDLSVVDGTRVRPVPILLGHEAAGIVEQVGDGVDGVAVGQRVV
FT                   LVFLPRCGQCAACATDGRTPCEPGSAANKAGTLLGGGIRLSRGGRPVYHHLGVSGFATH
FT                   VVVNRASVVPVPHEVPPTVAALLGCAVLTGGGAVLNVGDPQPGQSVAVVGLGGVGMAAV
FT                   LTALTYTDVRVVAVDQLPEKLSAAKALGAHEIYTPQQATAGGVKAAVVVEAVGHPAALH
FT                   TAIGLTAPGGRTITVGLPPPDVRISLSPLDFVTEGRSLIGSYLGSAVPSHDIPRFVSLW
FT                   QSGRLPVESLVTSTIRLDDINEAMDHLADGIAVRQLISFTGDL"
FT   CDS_pept        223014..223469
FT                   /transl_table=11
FT                   /gene="BCG_0199"
FT                   /locus_tag="BCG_0199"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0199"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70183"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M0T8"
FT                   /protein_id="CAL70183.1"
FT                   /translation="MAALPAPEKLLRSDFPVLWPVGTRWADNDMFGHLNNAVYYQLFDT
FT                   AINAWINTSTGVDPLAMPVLGIVAESGCRYFSELRFPESLMVGLAVTRLGRSSVTYRLG
FT                   VFKEPDDAGVITALGHWVHVYVDRTSRRPVPIPEAIRSLLSTACVSG"
FT   CDS_pept        223523..224008
FT                   /transl_table=11
FT                   /gene="TB18.5"
FT                   /locus_tag="BCG_0200"
FT                   /product="Conserved hypothetical protein TB18.5"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0200"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70184"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7E1"
FT                   /protein_id="CAL70184.1"
FT                   /translation="MTAISCSPRPRYASRMPVLSKTVEVTADAASIMAIVADIERYPEW
FT                   NEGVKGAWVLARYDDGRPSQVRLDTAVQGIEGTYIHAVYYPGENQIQTVMQQGELFAKQ
FT                   EQLFSVVATGAASLLTVDMDVQVTMPVPEPMVKMLLNNVLEHLAENLKQRAEQLAAS"
FT   CDS_pept        complement(224022..224837)
FT                   /transl_table=11
FT                   /gene="BCG_0201c"
FT                   /locus_tag="BCG_0201c"
FT                   /product="Possible transcriptional regulatory protein
FT                   (probably gntR-family)"
FT                   /note="In Mycobacterium tuberculosis strain H37Rv, Rv0165c
FT                   exists as a single gene. In Mycobacterium bovis BCG
FT                   Pasteur, and Mycobacterium bovis, a frameshift due to a 2
FT                   bp insertion (*-cc) leads to a product with a different
FT                   COOH terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0201c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70185"
FT                   /db_xref="GOA:A0A0H3M2P1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2P1"
FT                   /protein_id="CAL70185.1"
FT                   /translation="MIKHDVVWVTLWPERPNNKPPPSPRQVPGNPGPTLKVLASHVNAP
FT                   LSAKPRSQLPLRRAQLSDEVAGHLRAAIMSGALRSGTFIRLDETAAELGVSVTPVREAL
FT                   LKLRGEGMVGLEPHRGHVVLPLTRQDIDDIFWLQATIAQELATSATAHITDVEIDELDR
FT                   INNALAGAIGSGDAKTIASIEFAFHRVFNKASRRIKLAWFLLNAARYMPAQVFAADPRW
FT                   GADAVNSHRQLIAALRRRDTAAVIEHTVWQFTDGARRLTEALAETEVFG"
FT   CDS_pept        complement(224041..224220)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="BCG_0202c"
FT                   /locus_tag="BCG_0202c"
FT                   /product="Possible transcriptional regulatory protein
FT                   (probably gntR-family)"
FT                   /note="In Mycobacterium tuberculosis strain H37Rv, Rv0165c
FT                   exists as a single gene. In Mycobacterium bovis BCG
FT                   Pasteur, and Mycobacterium bovis, a frameshift due to a 2
FT                   bp insertion (*-cc) leads to a product with a different
FT                   COOH part. Mb0171c corresponds to the remnant COOH part of
FT                   Rv0165c"
FT   CDS_pept        224892..226556
FT                   /transl_table=11
FT                   /gene="fadD5"
FT                   /locus_tag="BCG_0203"
FT                   /product="Probable fatty-acid-CoA ligase fadD5"
FT                   /EC_number="6.2.1.-"
FT                   /note="Differs from Rv0166 by 2aa, A123V, A192S"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0203"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70187"
FT                   /db_xref="GOA:A0A0H3M9X9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M9X9"
FT                   /protein_id="CAL70187.1"
FT                   /translation="MTAQLASHLTRALTLAQQQPYLARRQNWVNQLERHAMMQPDAPAL
FT                   RFVGNTMTWADLRRRVAALAGALSGRGVGFGDRVMILMLNRTEFVESVLAANMIGAIAV
FT                   PLNFRLTPTEIAVLVEDCAAHVMLTEAALAPVAIGVRNIQPLLSVIVVAGGSSQDSVFG
FT                   YEDLLNEAGDVHEPVDIPNDSPALIMYTAGTTGRPKGAVLTHANLTGQAMTALYTSGAN
FT                   INSDVGFVGVPLFHIAGIGNMLTGLLLGLPTVIYPLGAFDPGQLLDVLEAEKVTGIFLV
FT                   PAQWQAVCTEQQARPRDLRLRVLSWGAAPAPDALLRQMSATFPETQILAAFGQTEMSPV
FT                   TCMLLGEDAIAKRGSVGRVIPTVAARVVDQNMNDVPVGEVGEIVYRAPTLMSCYWNNPE
FT                   ATAEAFAGGWFHSGDLVRMDSDGYVWVVDRKKDMIISGGENIYCAELENVLASHPDIAE
FT                   VAVIGRADEKWGEVPIAVAAVTNDDLRIEDLGEFLTDRLARYKHPKALEIVDALPRNPA
FT                   GKVLKTELRLRYGACVNVERRSASAGFTERRENRQKL"
FT   CDS_pept        226760..227557
FT                   /transl_table=11
FT                   /gene="yrbE1A"
FT                   /locus_tag="BCG_0204"
FT                   /product="Conserved hypothetical integral membrane protein
FT                   yrbE1A"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0204"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70188"
FT                   /db_xref="GOA:A0A0H3M1I3"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1I3"
FT                   /protein_id="CAL70188.1"
FT                   /translation="MTTSTTLGGYVRDQLQTPLTLVGGFFRMCVLTGKALFRWPFQWRE
FT                   FILQCWFIMRVGFLPTIMVSIPLTVLLIFTLNILLAQFGAADISGSGAAIGAVTQLGPL
FT                   TTVLVVAGAGSTAICADLGARTIREEIDAMEVLGIDPIHRLVVPRVLASMLVATLLNGL
FT                   VITVGLVGGFLFGVYLQNVSGGAYLATLTLITGLPEVVIATIKAATFGLIAGLVGCYRG
FT                   LTVRGGSKGLGTAVNETVVLCVIALFAVNVILTTIGVRFGTGR"
FT   CDS_pept        227559..228428
FT                   /transl_table=11
FT                   /gene="yrbE1B"
FT                   /locus_tag="BCG_0205"
FT                   /product="Conserved hypothetical integral membrane protein
FT                   yrbE1B"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0205"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70189"
FT                   /db_xref="GOA:A0A0H3M0U3"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M0U3"
FT                   /protein_id="CAL70189.1"
FT                   /translation="MSTAAVLRARFPRAVANLRQYGGAAARGLDEAGQLTWFALTSIGQ
FT                   IAHALRYYRKETLRLIAQIGMGTGAMAVVGGTVAIVGFVTLSGSSLVAIQGFASLGNIG
FT                   VEAFTGFFAALINVRIAGPVVTGVALAATVGAGATAELGAMRISEEIDALEVMGIKSIS
FT                   FLASTRIMAGLVVIIPLYALAMIMSFLSPQITTTVLYGQSNGTYEHYFQTFLRPDDVFW
FT                   SFLEALIITAIVMVSHCYYGYAAGGGPVGVGEAVGRSMRFSLVSVQVVVLFAALALYGV
FT                   DPNFNLTV"
FT   CDS_pept        228433..229797
FT                   /transl_table=11
FT                   /gene="mce1A"
FT                   /locus_tag="BCG_0206"
FT                   /standard_name="mce1"
FT                   /product="MCE-family protein mce1A"
FT                   /note="Differs from Rv0169 by 2aa, A313S, S359P"
FT                   /note="Differs from Rv0169 by 2aa, A313S, S359P"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0206"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70190"
FT                   /db_xref="GOA:A0A0H3M7E6"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7E6"
FT                   /protein_id="CAL70190.1"
FT                   /translation="MTTPGKLNKARVPPYKTAGLGLVLVFALVVALVYLQFRGEFTPKT
FT                   QLTMLSARAGLVMDPGSKVTYNGVEIGRVDTISEVTRDGESAAKFILDVDPRYIHLIPA
FT                   NVNADIKATTVFGGKYVSLTTPKNPTKRRITPKDVIDVRSVTTEINTLFQTLTSIAEKV
FT                   DPVKLNLTLSAAAEALTGLGDKFGESIVNANTVLDDLNSRMPQSRHDIQQLAALGDVYA
FT                   DAAPDLFDFLDSSVTTARTINAQQAELDSALLAAAGFGNTTADVFDRGGPYLQRGVADL
FT                   VPTATLLDTYSPELFCTIRNFYDADPLAKAAAGGGNGYSLRTNSEILSGIGISLLSPLA
FT                   LATNGAAIGIGLVAGLIASPLAVAANLAGALPGIVGGAPNPYTYPENLPRVNARGGPGG
FT                   APGCWQPITRDLWPAPYLVMDTGASLAPYNHMEVGSPYAVEYVWGRQVGDNTINP"
FT   CDS_pept        229794..230834
FT                   /transl_table=11
FT                   /gene="mce1B"
FT                   /locus_tag="BCG_0207"
FT                   /standard_name="mceD"
FT                   /product="MCE-family protein mce1B"
FT                   /note="Differs from Rv0170 by 1aa, T179I"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0207"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70191"
FT                   /db_xref="GOA:A0A0H3M2P5"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2P5"
FT                   /protein_id="CAL70191.1"
FT                   /translation="MKITGTVVKLGIVSVVLLFFTVMIIVIFGQMRFDRTNGYTAEFSN
FT                   VSGLRQGQFVRASGVEIGKVKALHLVDGGRRVRVEFNIDRSVPLYQSTTAQIRYSDLIG
FT                   NRYVELKRGEGKGANDLLPPGGLIPLSRTSPALDLDALIGGFKPVFRALDPAKVNNIAN
FT                   ALITVFQGQGGTINDTLDQTAQLTSQIAERDQAIGEVVKNLNIVLDTTVKHRKEFDETV
FT                   NNLENLITGLRNHSDQLAGGLAHISNGAGTVADLLAENRTLVRKAVSYLDAIQQPVIDQ
FT                   RVELDDLLHKTPTALTALGRANGTYGDFQNFYLCDLQIKWNGFQAGGPVRTVKLFSQPT
FT                   GRCTPQ"
FT   CDS_pept        230831..232378
FT                   /transl_table=11
FT                   /gene="mce1C"
FT                   /locus_tag="BCG_0208"
FT                   /product="MCE-family protein mce1C"
FT                   /note="Differs from Rv0171 by 1aa, D212E"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0208"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70192"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M9Y2"
FT                   /protein_id="CAL70192.1"
FT                   /translation="MRTLEPPNRMRIGLMGIVVALLVVAVGQSFTSVPMLFAKPSYYGQ
FT                   FTDSGGLHKGDRVRIAGLGVGTVEGLKIDGDHIVVKFSIGTNTIGTESRLAIRTDTILG
FT                   RKVLEIEPRGAQALPPGGVLPVGQSTTPYQIYDAFFDVTKAASGWDIETVKRSLNVLSE
FT                   TVDQTYPHLSAALDGVAKFSDTIGKRDEQITHLLAQANQVASILGDRSDQVDRLLVNAK
FT                   TLIAAFNERGRAVDALLGNISAFSAQVQNLINDNPNLNHVLEQLRILTDLLVDRKEDLA
FT                   ETLTILGRFSASFGETFASGPYFKVLLANLVPGQILQPFVDAAFKKRGISPEDFWRSAG
FT                   LPAYRWPDPNGTRFPNGAPPPPPPVLEGTPEHPGPAVPPGSPCSYTPPADGLPRPWDPL
FT                   PCANLTQGPFGGPDFPAPLDVATSPPNPDGPPPAPGLPIAGRPGEVPPNVPGTPVPIPQ
FT                   EAPPGARTLPLGPAPGPAPPPAAPGPPAPPGPGPQLPAPFINPGGTGGSGVTGGSEN"
FT   CDS_pept        232375..233967
FT                   /transl_table=11
FT                   /gene="mce1D"
FT                   /locus_tag="BCG_0209"
FT                   /product="MCE-family protein mce1D"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0209"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70193"
FT                   /db_xref="GOA:A0A0H3M1I8"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1I8"
FT                   /protein_id="CAL70193.1"
FT                   /translation="MSTIFDIRNLRLPQLSRASVVIGSLVVVLALAAGIVGVRLYQKLT
FT                   NNTVVAYFTQANALYVGDKVQIMGLPVGSIDKIEPAGDKMKVTFHYQNKYKVPANASAV
FT                   ILNPTLVASRNIQLEPPYRGGPVLADNAVIPVERTQVPTEWDELRDSVSHIIDELGPTP
FT                   EQPKGPFGEVIEAFADGLAGKGKQINTTLNSLSQALNALNEGRGDFFAVVRSLALFVNA
FT                   LHQDDQQFVALNKNLAEFTDRLTHSDADLSNAIQQFDSLLAVARPFFAKNREVLTHDVN
FT                   NLATVTTTLLQPDPLDGLETVLHIFPTLAANINQLYHPTHGGVVSLSAFTNFANPMEFI
FT                   CSSIQAGSRLGYQESAELCAQYLAPVLDAIKFNYFPFGLNVASTASTLPKEIAYSEPRL
FT                   QPPNGYKDTTVPGIWVPDTPLSHRNTQPGWVVAPGMQGVQVGPITQGLLTPESLAELMG
FT                   GPDIAPPSSGLQTPPGPPNAYDEYPVLPPIGLQAPQVPIPPPPPGPDVIPGPVPPTPAP
FT                   VGAPLPAEAGGGQ"
FT   CDS_pept        233964..235136
FT                   /transl_table=11
FT                   /gene="lprK"
FT                   /locus_tag="BCG_0210"
FT                   /standard_name="mce1E"
FT                   /product="Possible mce-family lipoprotein lprK (MCE-family
FT                   lipoprotein mce1E)"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0210"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70194"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M0U8"
FT                   /protein_id="CAL70194.1"
FT                   /translation="MMSVLARMRVMRHRAWQGLVLLVLALLLSSCGWRGISNVAIPGGP
FT                   GTGPGSYTIYVQMPDTLAINGNSRVMVADVWVGSIRAIKLKNWVATLTLSLKKDVTLPK
FT                   NATAKIGQTSLLGSQHVELAAPPDPSPVPLKDGDTIPLKRSSAYPTTEQTLASIATLLR
FT                   GGGLVNLEGIQQEINAIVTGRADQIRAFLGKLDTFTDELNQQRDDITRAIDSTNRLLAY
FT                   VGGRSEVLNRVLTDLPPLIKHFADKQELLINASDAVGRLSQSADQYLSAARGDLHQDLQ
FT                   ALQCPLKELRRAAPYLVGALKLILTQPFDVDTVPQLVRGDYMNLSLTLDLTYSAIDNAF
FT                   LTGTGFSGALRALEQSFGRDPETMIPDIRYTPNPNDAPGGPLVERGNRQC"
FT   CDS_pept        235130..236677
FT                   /transl_table=11
FT                   /gene="mce1F"
FT                   /locus_tag="BCG_0211"
FT                   /product="MCE-family protein mce1F"
FT                   /note="Differs from Rv0174 by 1aa, P370L"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0211"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70195"
FT                   /db_xref="GOA:A0A0H3M7F0"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7F0"
FT                   /protein_id="CAL70195.1"
FT                   /translation="MLTRFIRRQLILFAIVSVVAIVVLGWYYLRIPSLVGIGQYTLKAD
FT                   LPASGGLYPTANVTYRGITIGKVTAVEPTDQGARVTMSIASNYKIPVDASANVHSVSAV
FT                   GEQYIDLVSTGAPGKYFSSGQTITKGTVPSEIGPALDNSNRGLAALPTEKIGLLLDETA
FT                   QAVGGLGPALQRLVDSTQAIVGDFKTNIGDVNDIIENSGPILDSQVNTGDQIERWARKL
FT                   NNLAAQTATRDQNVRSILSQAAPTADEVNAVFSGVRDSLPQTLANLEVVFDMLKRYHAG
FT                   VEQLLVFLPQGAAIAQTVLTPTPGAAQLPLAPAINYPPPCLTGFLPASEWRSPADTSPR
FT                   PLPSGTYCKIPQDAQLQVRGARNIPCVDVPGKRAATPKECRSKDPYVPLGTNPWFGDPN
FT                   QILTCPAPGARCDQPVKPGLVIPAPSINTGLNPAPADQVQGTPPPVSDPLQRPGSGTVQ
FT                   CNGQQPNPCVYTPTSGPSAVYSPASGELVGPDGVKYAVANSSTTGDDGWKEMLAPAS"
FT   CDS_pept        236713..237354
FT                   /transl_table=11
FT                   /gene="BCG_0212"
FT                   /locus_tag="BCG_0212"
FT                   /product="Probable conserved mce associated membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0212"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70196"
FT                   /db_xref="GOA:A0A0H3M2Q0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2Q0"
FT                   /protein_id="CAL70196.1"
FT                   /translation="MKAADSAESDAGADQTGPQVKAADSAESDAGELGEDACPEQALVE
FT                   RRPSRLRRGWLVGIAATLLALAGGLGAAGYFALRSHQESQSIAREDLAAIEAAKDCVAA
FT                   TQAPDAGAMSASMQKIIECGTGDFGAQASLYTSMLVEAYQAASVHVQVTDMRAAVERNN
FT                   NDGSVDVLVALRVKVSNTDSDAHEVGYRLRVRMALDEGRYKIAKLDQVTK"
FT   CDS_pept        237351..238319
FT                   /transl_table=11
FT                   /gene="BCG_0213"
FT                   /locus_tag="BCG_0213"
FT                   /product="Probable conserved mce associated transmembrane
FT                   protein"
FT                   /note="Differs from Mb0182 by 1aa, S285N, and from Rv0176
FT                   by 3aa, S285N, S290Q, A291S"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0213"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70197"
FT                   /db_xref="GOA:A0A0H3M9Y7"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M9Y7"
FT                   /protein_id="CAL70197.1"
FT                   /translation="MTVVVEKTPTTLPQATPNGAAPWHVRAGAFAIDVLPGLAVAATMA
FT                   LTALTVPPGSAWRWLCACLLGLTILLLAVNRLLLPTITGWSLGRALTGIRVVRRDGSAI
FT                   GPWRLLVRDLAHLVDTLSLFVGWLWPLWDSRRRTFADLLLRTEVRRVEPVQRPAVIRRL
FT                   TAAVALAAAGACASATAVGAAVVYVNEWQTDHTRAQLATRGPKLVVDVLSYDPETVQRD
FT                   FERARSLATDRYRPQLSIQQDSVRESGPVRNQYWVTDSAVLSATPAQATMLLFMQGERG
FT                   TPPSQRYISATVRAIFQKSRGQWRLDDLAVVMKPRQPTGEK"
FT   CDS_pept        238316..238870
FT                   /transl_table=11
FT                   /gene="BCG_0214"
FT                   /locus_tag="BCG_0214"
FT                   /product="Probable conserved mce associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0214"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70198"
FT                   /db_xref="GOA:A0A0H3M1J3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1J3"
FT                   /protein_id="CAL70198.1"
FT                   /translation="MSPRRKFEPGEGALLAPQSIEPSRRWGLPLALTASAVVMAAAISA
FT                   CALMRISHESHQRAAHKDIVMLSDVRSFMTMFTSPDPFHANEYAERVLSHATGDFAKQY
FT                   HERANDILIRISGVEPTTGTVLDAGVQRWNEDGSANVLVVTQITSKSADGKRVVSNANR
FT                   WLVTAKQEGNEWKISSLLPVI"
FT   CDS_pept        238837..239571
FT                   /transl_table=11
FT                   /gene="BCG_0215"
FT                   /locus_tag="BCG_0215"
FT                   /product="Probable conserved MCE associated membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0215"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70199"
FT                   /db_xref="GOA:A0A0H3M0V2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M0V2"
FT                   /protein_id="CAL70199.1"
FT                   /translation="MEDQQSASGDLTQKSVANGESTDTASAATEGHRGEIDAAGEPDER
FT                   GAAVADSQADEDDSAATAARGGKTRARRSRGRRLAITVGVAAALFVGSAAFAGATVEPY
FT                   LSERAVVATKLMVARTAANAITTLWTYTPENMDTLADRAANYLSGDFAAQYRRFVDQIA
FT                   AANKQAKITNDTEVTGAAVESLSGRDAVAIVYTNTTTTSPVTKNIPALKYLSYRLFMKR
FT                   YDARWLVTRMTTITSLDLTPQV"
FT   CDS_pept        complement(239602..240711)
FT                   /transl_table=11
FT                   /gene="lprO"
FT                   /locus_tag="BCG_0216c"
FT                   /product="Putative lipoprotein lprO"
FT                   /note="Differs from Rv0179c by 1aa, H124R"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0216c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70200"
FT                   /db_xref="InterPro:IPR018711"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7F4"
FT                   /protein_id="CAL70200.1"
FT                   /translation="MWIRAERVAVLTPTASLRRLTACYAALAVCAALACTTGQPAARAA
FT                   DGREMLAQAIATTRGSYLVYNFGGGHPMPLLNAGGHWYEMNNGGHLMIIKNASQRLSPH
FT                   LLVDTHTGDQARCEHNPGAHTGEGLWQASEIYPPLKAWQRMGRPTIAVNANFFDVRGQK
FT                   GGSWRSTGCSSPLGAYVDNTRGQGRANQAVTGTVAYAGKQGLSGGNELWSSLTTMILPV
FT                   GGAPYVLRPKSRQDYDLATPVIEDLLNKNARFVAVAGIGLLSPGNTGQLHDGGPSAART
FT                   ALAYAKQKDEMYIFQGGNYTPDNIQDLFRGLGSDTAILLDGGGSSAIVLRRDTGGMWAG
FT                   AGSPKGSCDTRQVLCDSHERALPSWLAFN"
FT   CDS_pept        complement(240791..242149)
FT                   /transl_table=11
FT                   /gene="BCG_0217c"
FT                   /locus_tag="BCG_0217c"
FT                   /product="Probable conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0217c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70201"
FT                   /db_xref="GOA:A0A0H3M2Q5"
FT                   /db_xref="InterPro:IPR022703"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2Q5"
FT                   /protein_id="CAL70201.1"
FT                   /translation="MSQAQPRPAAPNPKRNVKAIRTVRFWMAPIATTLALMSALAALYL
FT                   GGILNPMTNLRHFPIALVNEDAGPAGQQIVDGLVSGLDKNKFDIRVVSPDEARRLLDTA
FT                   AVYGSALIPPTFSSQLRDFGASAVTPTRTDRPAITISTNPRAGTLAASIAGQTLTRALT
FT                   VVNGKVGERLTAEVAAQTGGVALAGAAAAGLASPIDVKSTAYNPLPNGTGNGLSAFYYA
FT                   LLLLLAGFTGSIVVSTLVDSMLGYVPAEFGPVYRFAEQVNISRFRTLLVKWAVMVVLAL
FT                   LTSGVYLAIAHGLGMPIPLGWQVWLYGVFAIIAVGVTSSSLIAVLGSMGLLVSMLIFVI
FT                   LGLPSAGATVPLEAVPAFFRWLAQFEPMHQVFLGVRSLLYLNGNADAGLSQALTMTSIG
FT                   LIIGLLLGGFITHLYDRSSFHRIPGAVEMAIAVEHQAQYQARQSARESSSEQP"
FT   CDS_pept        complement(242176..242910)
FT                   /transl_table=11
FT                   /gene="BCG_0218c"
FT                   /locus_tag="BCG_0218c"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0218c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70202"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR041602"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M9Z2"
FT                   /protein_id="CAL70202.1"
FT                   /translation="MTATVEIRRAADRAVTTTSWLKSRHSFSFGDHYDPDNTHHGLLLV
FT                   NNDDQMEPASGFDPHPHRDMEIVTWVLRGALRHQDSAGNSGVIYPGLAQRMSAGTGILH
FT                   SEMNDSATEPVHFVQMWVIPDATGITASYQQQEIDDELLRAGLVTIASGIPGQDAALTL
FT                   HNSSASLHGARLRPGATVSLPCAPFLHLFVAYGRLTLEGGGELADGDAVRFTDADARGL
FT                   TANEPSEVLIWEMHAKLGDSAT"
FT   CDS_pept        complement(242927..244039)
FT                   /transl_table=11
FT                   /gene="sigG"
FT                   /locus_tag="BCG_0219c"
FT                   /product="Probable alternative rna polymerase sigma factor
FT                   sigG"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0219c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70203"
FT                   /db_xref="GOA:A0A0H3M1J7"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014305"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1J7"
FT                   /protein_id="CAL70203.1"
FT                   /translation="MRTSPMPAKFRSVRVVVITGSVTAAPVRVSETLRRLIDVSVLAEN
FT                   SGREPADERRGDFSAHTEPYRRELLAHCYRMTGSLHDAEDLVQETLLRAWKAYEGFAGK
FT                   SSLRTWLHRIATNTCLTALEGRRRRPLPTGLGRPSADPSGELVERREVSWLEPLPDVTD
FT                   DPADPSTIVGNRESVRLAFVAALQHLSPRQRAVLLLRDVLQWKSAEVADAIGTSTVAVN
FT                   SLLQRARSQLQTVRPSAADRLSAPDSPEAQDLLARYIAAFEAYDIDRLVELFTAEAIWE
FT                   MPPYTGWYQGAQAIVTLIHQQCPAYSPGDMRLISLIANGQPAAAMYMRAGDVHLPFQLH
FT                   VLDMAADRVSHVVAFLDTTLFPKFGLPDSL"
FT   CDS_pept        243987..244826
FT                   /transl_table=11
FT                   /gene="BCG_0220"
FT                   /locus_tag="BCG_0220"
FT                   /product="Possible lysophospholipase"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0220"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70204"
FT                   /db_xref="GOA:A0A0H3M0V8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M0V8"
FT                   /protein_id="CAL70204.1"
FT                   /translation="MTTTRTERNFAGIGDVRIVYDVWTPDTAPQAVVVLAHGLGEHARR
FT                   YDHVAQRLGAAGLVTYALDHRGHGRSGGKRVLVRDISEYTADFDTLVGIATREYPGCKR
FT                   IVLGHSMGGGIVFAYGVERPDNYDLMVLSAPAVAAQDLVSPVVAVAAKLLGVVVPGLPV
FT                   QELDFTAISRDPEVVQAYNTDPLVHHGRVPAGIGRALLQVGETMPRRAPALTAPLLVLH
FT                   GTDDRLIPIEGSRRLVECVGSADVQLKEYPGLYHEVFNEPERNQVLDDVVAWLTERL"
FT   CDS_pept        244868..245617
FT                   /transl_table=11
FT                   /gene="BCG_0221"
FT                   /locus_tag="BCG_0221"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0221"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70205"
FT                   /db_xref="InterPro:IPR024498"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7F8"
FT                   /protein_id="CAL70205.1"
FT                   /translation="MTNDKMLARIAALLRQAEGTDNPHEADAFMSTAQRLATAASIDLA
FT                   VARSHAGNRSPAQAPTQRTITIGAAGTRGLRTYVQLFVLIAAANDVRCDVASNSTFVYA
FT                   YGFAEDIDTSHALYASLVVQMVRASDAYLASGAHRPTPTITARLNFQLAFGARVGQRLA
FT                   DAREQTRQEATKDRDRPPGTAIALRDKDIELHEYYRRSSKARGAWRASRATAGYSSAAR
FT                   RAGDRAGRQARLGNNPELPGARAALGR"
FT   CDS_pept        245614..246123
FT                   /transl_table=11
FT                   /gene="BCG_0222"
FT                   /locus_tag="BCG_0222"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0222"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70206"
FT                   /db_xref="InterPro:IPR027595"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2R0"
FT                   /protein_id="CAL70206.1"
FT                   /translation="MIGADVPRDSQRARVYAAEAFVRTLFDRVTAHGSPTVEFFGTQLT
FT                   LPPEGRFGSVASVQRYVDDVLALPAVGQNWPTVSPVRVRARRAATAAHYENHGGTGTIA
FT                   VPDRHTAGWAMRELVVLHEVAHHLCQVPPPHGPEFVATVCTLTELVMGPEVGHVFRVVY
FT                   AQEGVR"
FT   CDS_pept        246168..248243
FT                   /transl_table=11
FT                   /gene="bglS"
FT                   /locus_tag="BCG_0223"
FT                   /product="Probable beta-glucosidase bglS"
FT                   /EC_number="3.2.1.21"
FT                   /note="Differs from Mb0192 by 1aa, S504I, and from Rv0186
FT                   by 2aa, S504I, R532P"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0223"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70207"
FT                   /db_xref="GOA:A0A0H3M9Z7"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M9Z7"
FT                   /protein_id="CAL70207.1"
FT                   /translation="MTDDERFSLLVGLTGASDLWPVRDERIPQGVPMCAGYVPGIPRLG
FT                   VPALLMSDAGLGVTNPGYRPGDTATALPAGLALAASFNPVLARSSGKAIGREARSRGFN
FT                   VQLAGAINLARDPRNGRNFEYLSEDPLLSATMAAESIIGIQQQGVIATTKHFSLNCNET
FT                   NRHWLDAVIDPDAHRESDLLAFEIVIERSQPGAVMAAYNKVNGDYAAGNDHLLNDVLKG
FT                   AWGYRGWVMSDWGGTPSWECALAGLDQECGAQIDAVLWQSEAFTDRLRAAYADGNLPKG
FT                   RLSDMVRRILRSMFAVGIDRWKPAPAPDMNAHNEIAAQMARQGIVLLQNRGLLPLAPES
FT                   AGRIAVIGGYAHLGVPAGYGSSAVTPPGGYAGVIPIGGSGLAAGLRNLYLLPSSPLSEL
FT                   RKRLPNAQFEFDPGINPAEAVLAARRADIAIVFAIRAEGEGFDSADLSLPWGQDALIAA
FT                   VASANANTVVVLETGNPVTMPWRDSVNAIMQAWYPGQAGGQAVAESVTGQVNPSGRLPI
FT                   TFPVDLGQTPRSQPRELGAPWGTSTTIHYTEGADVGYRWFASTNQTPMFAFGHGLSYTS
FT                   FEYRDLVVTGGHTVHASFSVTNTGDRSGADVPQLYMIAAPGESRLRLLGFERVELEPGQ
FT                   TRRVRIEADPRLLARYDGEARSWRIEPGGYTVAVGASAVALKLAAKVKLAGRGFGR"
FT   CDS_pept        248604..249266
FT                   /transl_table=11
FT                   /gene="BCG_0224"
FT                   /locus_tag="BCG_0224"
FT                   /product="Probable o-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="Differs from Rv0187 and Mb0193 by 1aa, V147A"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0224"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70208"
FT                   /db_xref="GOA:A0A0H3M1K2"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1K2"
FT                   /protein_id="CAL70208.1"
FT                   /translation="MGMDQQPNPPDVDAFLDSTLVGDDPALAAALAASDAAELPRIAVS
FT                   AQQGKFLCLLAGAIQARRVLEIGTLGGFSTIWLARGAGPQGRVVTLEYQPKHAEVARVN
FT                   LQRAGVADRVEVVVGPALDTLPTLAGGPFDLVFIDADKENNVVYIQWAIRLARRGAVIV
FT                   VDNVIRGGGILAESDDADAVAARRTLQMMGEHPGLDATAIQTVGRKGWDGFALALVR"
FT   CDS_pept        249385..249816
FT                   /transl_table=11
FT                   /gene="BCG_0225"
FT                   /locus_tag="BCG_0225"
FT                   /product="Probable conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0225"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70209"
FT                   /db_xref="GOA:A0A0H3M0W2"
FT                   /db_xref="InterPro:IPR005530"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M0W2"
FT                   /protein_id="CAL70209.1"
FT                   /translation="MSTVHSSIDQHPDLLALRASFDRAAESTIAHFTFGLALLAGLYVA
FT                   ASPWIVGFSATRGLPTCDLIVGIAVAYLAYGFASALDRTHGMTWTLPVLGVWVIFSPWV
FT                   LPGVAVTAGMMWSHIIAGAVVAVLGFYFGMRTRAAANQG"
FT   CDS_pept        complement(249895..251622)
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="BCG_0226c"
FT                   /product="Probable dihydroxy-acid dehydratase ilvD (DAD)"
FT                   /EC_number="4.2.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0226c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70210"
FT                   /db_xref="GOA:A0A0H3M7G4"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7G4"
FT                   /protein_id="CAL70210.1"
FT                   /translation="MPQTTDEAASVSTVADIKPRSRDVTDGLEKAAARGMLRAVGMDDE
FT                   DFAKPQIGVASSWNEITPCNLSLDRLANAVKEGVFSAGGYPLEFGTISVSDGISMGHEG
FT                   MHFSLVSREVIADSVEVVMQAERLDGSVLLAGCDKSLPGMLMAAARLDLAAVFLYAGSI
FT                   LPGRAKLSDGSERDVTIIDAFEAVGACSRGLMSRADVDAIERAICPGEGACGGMYTANT
FT                   MASAAEALGMSLPGSAAPPATDRRRDGFARRSGQAVVELLRRGITARDILTKEAFENAI
FT                   AVVMAFGGSTNAVLHLLAIAHEANVALSLQDFSRIGSGVPHLADVKPFGRHVMSDVDHI
FT                   GGVPVVMKALLDAGLLHGDCLTVTGHTMAENLAAITPPDPDGKVLRALANPIHPSGGIT
FT                   ILHGSLAPEGAVVKTAGFDSDVFEGTARVFDGERAALDALEDGTITVGDAVVIRYEGPK
FT                   GGPGMREMLAITGAIKGAGLGKDVLLLTDGRFSGGTTGLCVGHIAPEAVDGGPIALLRN
FT                   GDRIRLDVAGRVLDVLADPAEFASRQQDFSPPPPRYTTGVLSKYVKLVSSAAVGAVCG"
FT   CDS_pept        251770..252060
FT                   /transl_table=11
FT                   /gene="BCG_0227"
FT                   /locus_tag="BCG_0227"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0227"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70211"
FT                   /db_xref="GOA:A0A0H3M2R5"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2R5"
FT                   /protein_id="CAL70211.1"
FT                   /translation="MTAAHGYTQQKDNYAKRLRRVEGQVRGIARMIEEDKYCIDVLTQI
FT                   SAVTSALRSVALNLLDEHLSHCVTRAVAEGGPGADGKLAEASAAIARLVRS"
FT   CDS_pept        252188..253429
FT                   /transl_table=11
FT                   /gene="BCG_0228"
FT                   /locus_tag="BCG_0228"
FT                   /product="Probable conserved integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0228"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70212"
FT                   /db_xref="GOA:A0A0H3MA02"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MA02"
FT                   /protein_id="CAL70212.1"
FT                   /translation="MTAPTGTSATTTRPWTPRIATQLSVLACAAFIYVTAEILPVGALS
FT                   AIARNLRVSVVLVGTLLSWYALVAAVTTVPLVRWTAHWPRRRALVVSLVCLTVSQLVSA
FT                   LAPNFAVLAAGRVLCAVTHGLLWAVIAPIATRLVPPSHAGRATTSIYIGTSLALVVGSP
FT                   LTAAMSLMWGWRLAAVCVTGAAAAVALAARLALPEMVLRADQLEHVGRRARHHRNPRLV
FT                   KVSVLTMIAVTGHFVSYTYIVVIIRDVVGVRGPNLAWLLAAYGVAGLVSVPLVARPLDR
FT                   WPKGAVIVGMTGLTAAFTLLTALAFGERHTAATALLGTGAIVLWGALATAVSPMLQSAA
FT                   MRSGGDDPDGASGLYVTAFQIGIMAGALLGGLLYERSLAMMLTASAGLMGVALFGMTVS
FT                   QHLFENPTLSPGDG"
FT   CDS_pept        253506..254564
FT                   /transl_table=11
FT                   /gene="BCG_0229"
FT                   /locus_tag="BCG_0229"
FT                   /product="Conserved hypothetical protein"
FT                   /note="In Mycobacterium tuberculosis strain H37Rv, Rv0192
FT                   and Rv0192A exist as 2 genes with an overlap region. In
FT                   Mycobacterium bovis BCG Pasteur, and Mycobacterium bovis, a
FT                   single base insertion (*-g) leads to a single product.
FT                   Differs from Mb0198 by 1aa, A279V and from Rv0192 by 2aa,
FT                   P113S, A279V"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0229"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70213"
FT                   /db_xref="GOA:A0A0H3M1K8"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="InterPro:IPR041280"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1K8"
FT                   /protein_id="CAL70213.1"
FT                   /translation="MSRWKQGWTRGSLFAALNIAAVVAVLMLGAGVAVADPDAAPGDPG
FT                   GPGGPGGTAGPVDPPAVDLLAPPPDPLALPPALDPLAPPPPDPLAPPPPDPLAVPVAAG
FT                   PVAGQDPTPFVGPPPFRPPTFNPVDGAMVGVAKPIVINFAVPIADRAMAESAIHISSIP
FT                   PVPGKFYWMSPTQVRWRPFEFWPANTAVNIDAAGTKSSFRTGDSLVATADDATHQMTIT
FT                   RNGVVQKTFPMSMGMVSGGHQTPNGTYYVLEKFATVVMDSSTYGVPVNSAQGYKLTASD
FT                   AVRIDNSGNFVHSAPWSVADQGKRNVTHGCINLSPANAKWFYDNFGSGDPVVVKNSVGT
FT                   YNKNDGAQDWQI"
FT   CDS_pept        complement(254624..256471)
FT                   /transl_table=11
FT                   /gene="BCG_0230c"
FT                   /locus_tag="BCG_0230c"
FT                   /product="Hypothetical protein"
FT                   /note="Differs from Rv0193c and Mb0199c by 1aa, E417K"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0230c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70214"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M0W8"
FT                   /protein_id="CAL70214.1"
FT                   /translation="MIQISRDMSSLGQTATTQALPDNSDGIQLTKFAADDILPLEYAPP
FT                   IGPELVSQDQLPAAWAYKRFRDLDDKESYRRKLLQELTDALAAQGSEAAEIATAALRDL
FT                   IDQMAEQGAVVLADIVESDDFLELVKRYDELMAREGSRSFIHRFLDLRRSPGMLTDPAV
FT                   NGALVHPLMIALISYAVGGPIRMIDARGKDAEPLSVLAQDNMLHIDNTPFNDEYKILIT
FT                   WRRGTAQGPAGQNFTFLPGTHKLARTCFVNEDGVPWSSENASIFTTPDSIRKVFDAQRQ
FT                   LGGQDHPTVIEVTDSERPLSSVFAAGSLVHHRFRTASGSARSCIILVFHRVADNPGRMV
FT                   SDVEDSSDVSLSELLTRGVPDESYQQRFIATLCAAADEIAELLLKWKKTPQRPVSLPLQ
FT                   TKQIDGARFEEWISAATEAPEVREIRNRELTIPYGEVLSAEEFFDLIWRLMRFDKHGPL
FT                   DLILYHDNREEPRKWARNLIREMSADRLYERLLGWLADIQQPRPADCLRPLQIHALISE
FT                   VLKTLPLDEDQDPPADWHFDLLGMSHAEAARSVKHLLEDVAEALLRCEDMAAYLSTSLF
FT                   AFWAVDAAYSLDGRRNLVVKDCARRLLRHYTMLSLTCFQ"
FT   CDS_pept        256778..260362
FT                   /transl_table=11
FT                   /gene="BCG_0231"
FT                   /locus_tag="BCG_0231"
FT                   /product="Probable drugs-transport transmembrane
FT                   ATP-binding protein ABC transporter"
FT                   /note="Differs from Mb0200 by 1aa, I49V, and from Rv0194 by
FT                   2aa, T74M, M223T"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0231"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70215"
FT                   /db_xref="GOA:A1KF14"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KF14"
FT                   /protein_id="CAL70215.1"
FT                   /translation="MRTNCWWRLSGYVMRHRRDLLLGFGAALAGTVIAVLVPLVTKRVI
FT                   DDAIAADHRPLAPWAVVLVAAAGATYLLTYVRRYYGGRIAHLVQHDLRMDAFQALLRWD
FT                   GRQQDRWSSGQLIVRTTNDLQLVQALLFDVPNVLRHVLTLLLGVAVMTWLSVPLALLAV
FT                   LLVPVIGLIAHRSRRLLAAATHCAQEHKAAVTGVVDAAVCGIRVVKAFGQEERETVKLV
FT                   MASRALYAAQLRVARLNAHFGPLLQTLPALGQMAVFALGGWMAAQGSITVGTFVAFWAC
FT                   LTLLARPACDLAGMLTIAQQARAGAVRVLELIDSRPTLVDGTKPLSLEARLSLEFQRVS
FT                   FGYVADRPVLREISLSVRAGETLAVVGAPGSGKSTLASLATRCYDVTQGAVRIGGQDVR
FT                   ELTLDSLRSAIGLVPEDAVLFSGTIGANIAYGRPDATPEQIATAARAAHIEEFVNTLPD
FT                   GYQTAVGARGLTLSGGQRQRIALARALLHQPRLLIMDDPTSAVDAVIECGIQEVLREAI
FT                   ADRTAVIFTRRRSMLTLADRVAVLDSGRLLDVGTPDEVWERCPRYRELLSPAPDLADDL
FT                   VVAERSPVCRPVAGLGTKAAQHTNVHNPGPHDHPPGPDPLRRLLREFRGPLALSLLLVA
FT                   VQTCAGLLPPLLIRHGIDVGIRRHVLSALWWAALAGTATVVIRWVVQWGSAMVAGYTGE
FT                   QVLFRLRSVVFAHAQRLGLDAFEDDGDAQIVTAVTADVEAIVAFLRTGLVVAVISVVTL
FT                   VGILVALLAIRARLVLLIFTTMPVLALATWQFRRASNWTYRRARHRLGTVTATLREYAA
FT                   GLRIAQAFRAEYRGLQSYFAHSDDYRRLGVRGQRLLALYYPFVALLCSLATTLVLLDGA
FT                   REVRAGVISVGALVTYLLYIELLYTPIGELAQMFDDYQRAAVAAGRIRSLLSTRTPSSP
FT                   AARPVGTLRGEVVFDAVHYSYRTREVPALAGINLRIPAGQTVVFVGSTGSGKSTLIKLV
FT                   ARFYDPTHGTVRVDGCDLREFDVDGYRNRLGIVTQEQYVFAGTVRDAIAYGRPDATDAQ
FT                   VERAAREVGAHPMITALDNGYLHQVTAGGRNLSAGQLQLLALARARLVDPDILLLDEAT
FT                   VALDPATEAVVQRATLTLAARRTTLIVAHGLAIAEHADRIVVLEHGTVVEDGAHTELLA
FT                   AGGHYSRLWAAHTRLCSPEITQLQCIDA"
FT   CDS_pept        260800..261435
FT                   /transl_table=11
FT                   /gene="BCG_0232"
FT                   /locus_tag="BCG_0232"
FT                   /product="Putative two component transcriptional regulatory
FT                   protein (probably luxR-family)"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0232"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70216"
FT                   /db_xref="GOA:A0A0H3M7G9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7G9"
FT                   /protein_id="CAL70216.1"
FT                   /translation="MAPVNVISVAVVASDPLTRDGALARLSSHRELDVRAWQAGCETSV
FT                   LLVLATTITAPLLCQIEDVQKDGPSHAPKLVVVADEFSAEQVFRMIKLGLTGLLYRSQS
FT                   TFDCIVETIRLSAEGRLRLPERVQRYLVGRIKSTPTAEPDTPCAAALAEREVAVLRLLA
FT                   DGLSTHQVAVQLNYCERTIKNIVHDIVTRLKLRNRTHAVAHALRAGLI"
FT   CDS_pept        261548..262132
FT                   /transl_table=11
FT                   /gene="BCG_0233"
FT                   /locus_tag="BCG_0233"
FT                   /product="Putative transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0233"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70217"
FT                   /db_xref="GOA:A0A0H3M2R7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2R7"
FT                   /protein_id="CAL70217.1"
FT                   /translation="MQGPRERMVVSAALLIRERGAHATAISDVLQHSGAPRGSAYHYFP
FT                   GGRTQLLCEAVDYAGEHVAAMINEAEGGLELLDALIDKYRQQLLSTDFRAGCPIAAVSV
FT                   EAGDEQDRERMAPVIARAAAVFDRWSDLTAQRFIADGIPPDRAHELAVLATSTLEGAIL
FT                   LARVRRDLTPLDLVHRQLRNLLLAELPERSR"
FT   CDS_pept        262132..264378
FT                   /transl_table=11
FT                   /gene="BCG_0234"
FT                   /locus_tag="BCG_0234"
FT                   /product="Possible oxidoreductase"
FT                   /EC_number="1.-.-.-"
FT                   /note="In Mycobacterium bovis BCG Pasteur, and
FT                   Mycobacterium bovis, a single base transversion (t-g)
FT                   introduces a stop codon that leads to a shorter product
FT                   compared to its homolog in Mycobacterium tuberculosis
FT                   strain H37Rv (748 aa versus 762 aa). Differs from Rv0197 by
FT                   1aa, S378R"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0234"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70218"
FT                   /db_xref="GOA:A0A0H3MA06"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MA06"
FT                   /protein_id="CAL70218.1"
FT                   /translation="MTSSDWLPTACILCECNCGIVVQVDDRRLARIRGDKAHPGSAGYT
FT                   CNKALRLDHYQNNRARLSSPMRRRADGTYEEIDWDTAIVEIAEGFKQIRDTHGGDKIFY
FT                   YGGGGQGNHLGGAYSGAFLKALGSRYRSNALAQEKTGEAWVDFQLYGGHTRGEFENAEV
FT                   SVFVGKNPWMSQSFPRARVVLNEIAKDPGRSMIVIDPVVTDTAKMADFHLRVQPGCDAW
FT                   CLAALAAVLVQENLCNEAFLAAHVHGVDTVRAALQEVPVADYAQRCGVDEELLRAAARR
FT                   IGTAASVSVFEDLGIQQAPNSTVCSYLNKLLWILTGNFAKKGGQHLHSSFAPLFSQVSG
FT                   RTPVTGAPIIAGLIPGNVVPEEILTEHPDRFRAMIVESGNPAHSLADSAACRAAFQALE
FT                   LMVVVDVAMTETARLAHYVLPAASQFEKPEATFFNFEFPRNGFQLRRPLFPPLPGTLPE
FT                   PEIWARLVRALGVVDEADLRPLREAAAQGRQAYTEAFLAAAATNPTVAKLTAYVLYETL
FT                   GPTLPDGLAGAAALWGLAQKTAMAYPDAVRRAGHADGNALFDAILERPSGVTFTVHNYE
FT                   DDFALISHPDHKIALEIPEMLAEIRSLTQTPSRLTTPQLPIVLSVGERRAYTANDIFRD
FT                   PSWRKRDANGALRVSVEDAQALGLADGCLARITTAAGSAEATVEVTETMLAGHAALPNG
FT                   FGLDYTGDDGRTVVAGVAPNALTSTRWRDPYAGTPWHKHVPAAIRRADAESPIW"
FT   CDS_pept        complement(264419..266410)
FT                   /transl_table=11
FT                   /gene="BCG_0235c"
FT                   /locus_tag="BCG_0235c"
FT                   /product="Probable zinc metalloprotease"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0235c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70219"
FT                   /db_xref="GOA:A0A0H3M1L3"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR042089"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1L3"
FT                   /protein_id="CAL70219.1"
FT                   /translation="MTLAIPSGIDLSHIDADARPQDDLFGHVNGRWLAEHEIPADRATD
FT                   GAFRSLFDRAETQVRDLIIQASQAGAAVGTDAQRIGDLYASFLDEEAVERAGVQPLHDE
FT                   LATIDSAADATELAAALGTLQRAGVGGGIGVYVDTDSKDSTRYLVHFTQSGIGLPDESY
FT                   YRDEQHAAVLAAYPGHIARMFGLVYGGESRDHAKTADRIVALETKLADAHWDVVKRRDA
FT                   DLGYNLRTFAQLQTEGAGFDWVSWVTALGSAPDAMTELVVRQPDYLVTFASLWASVNVE
FT                   DWKCWARWRLIRARAPWLTRALVAEDFEFYGRTLTGAQQLRDRWKRGVSLVENLMGDAV
FT                   GKLYVQRHFPPDAKSRIDTLVDNLQEAYRISISELDWMTPQTRQRALAKLNKFTAKVGY
FT                   PIKWRDYSKLAIDRDDLYGNVQRGYAVNHDRELAKLFGPVDRDEWFMTPQTVNAYYNPG
FT                   MNEIVFPAAILQPPFFDPQADEAANYGGIGAVIGHEIGHGFDDQGAKYDGDGNLVDWWT
FT                   DDDRTEFAARTKALIEQYHAYTPRDLVDHPGPPHVQGAFTIGENIGDLGGLSIALLAYQ
FT                   LSLNGNPAPVIDGLTGMQRVFFGWAQIWRTKSRAAEAIRRLAVDPHSPPEFRCNGVVRN
FT                   VDAFYQAFDVTEDDALFLDPQRRVRIWN"
FT   CDS_pept        266453..267112
FT                   /transl_table=11
FT                   /gene="BCG_0236"
FT                   /locus_tag="BCG_0236"
FT                   /product="Probable conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0236"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70220"
FT                   /db_xref="GOA:A0A0H3M0X2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M0X2"
FT                   /protein_id="CAL70220.1"
FT                   /translation="MPDGEQSQPPAQEDAEDDSRPDAAEAAAAEPKSSAGPMFSTYGIA
FT                   STLLGVLSVAAVVLGAMIWSAHRDDSGERTYLTRVMLTAAEWTAVLINMNADNIDASLQ
FT                   RLHDGTVGQLNTDFDAVVQPYRQVVEKLRTHSSGRIEAVAIDTVHRELDTQSGAARPVV
FT                   TTKLPPFATRTDSVLLVATSVSENAGAKPQTVHWNLRLDVSDVDGKLMISRLESIR"
FT   CDS_pept        267109..267798
FT                   /transl_table=11
FT                   /gene="BCG_0237"
FT                   /locus_tag="BCG_0237"
FT                   /product="Possible conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0237"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70221"
FT                   /db_xref="GOA:A0A0H3M7H4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7H4"
FT                   /protein_id="CAL70221.1"
FT                   /translation="MRNAWRLVVFDVLAPLATIAALAAIGVLLGWPLWWVSTCSVLVLL
FT                   VVEGVAINFWLLRRDSVTVGTDDDAPGLRLAVVFLCAAAISAAVVTGYLRWTTPDRDFN
FT                   RDSREVVHLATGMAETVASFSPSAPAAAVDRAAAMMVPEHAGGFKEQYAKSSADLARRG
FT                   VTAQAATLAAGVEAIGPSAASVAVILRVSQSIPGQPTSQAARALRVTLTKRGSGWLVLD
FT                   VTPINAR"
FT   CDS_pept        complement(267795..268298)
FT                   /transl_table=11
FT                   /gene="BCG_0238c"
FT                   /locus_tag="BCG_0238c"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0238c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70222"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2S1"
FT                   /protein_id="CAL70222.1"
FT                   /translation="MTLAAEPHPAPPQQPTVAWSEPDVDRRVEFWPTVAIRSALESGDI
FT                   ATWQRIAAALKRDPYGRTARQVEEVLEGIPATGIANAFWEVLDRARTHLDANERAEVAR
FT                   QVGLLLDRSGLQRQEFASRIGVTAQDLTAYLDGIVSPSASLMIRMRRLSDRFVRAKSVR
FT                   AADS"
FT   CDS_pept        complement(268295..271195)
FT                   /transl_table=11
FT                   /gene="mmpL11"
FT                   /locus_tag="BCG_0239c"
FT                   /product="Probable conserved transmembrane transport
FT                   protein mmpL11"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0239c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70223"
FT                   /db_xref="GOA:A0A0H3MA10"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MA10"
FT                   /protein_id="CAL70223.1"
FT                   /translation="MMRLSRNLRRCRWLVFTGWLLALVPAVYLAMTQSGNLTGGGFEVA
FT                   GSQSLLVHDQLDAHYPDRGAPALALVAAPRPDASYQDIDNAVALLRQIASELPGVTEAP
FT                   NPTQRPPQPDRPYVVSLRLDARNAGTSDVAKKLRDRIGVKGDQSGQTANGKVRLYVIGQ
FT                   GALSAAAAANTKHDIANAERWNLPIILMVLVAVFGSLAAAAIPLALAVCTVVITMGLVF
FT                   VLSMHTTMSVFVTSTVSMFGIALAVDYSLFILMRYREELRCGRRPPDAVDAAMATSGLA
FT                   VVLSGMTVIASLTGIYLINTPALRSMATGAILAVAVAMLTSATLTPAVLATFARAAAKR
FT                   SALVHWSRRPASTQSWFWSRWVGWVMRRPWITALAASTVLLVMAAPATLMVLGNSLLRQ
FT                   FDSSHEIRTGAAAAAQALGPGALGPVQVLVRFDAGGASAPEHSQTIAAIRHRIAQAPNV
FT                   VSVAPPRFADDNGSALLSAVLSVDPEDLGARDTITWMRTQLPRVAGAAQVDVGGPTALI
FT                   KDFDDRVSATQPLVLVFVAVIAFLMLLISIRSVFLAFKGVLMTLLSVAAAYGSLVMVFQ
FT                   WGWARGLGFPALHSIDSTVPPLVLAMTFGLSMDYEIFLLTRIRERFLQTGQTRDAVAYG
FT                   VRTSARTITSAALIMIAVFCGFAFAGMPLVAEIGVACAVAIAVDATVVRLVLVPALMAM
FT                   FDRWNWWLPRWLAHILPSVDFDRPLPKVDLGDVVVIPDDFAAAIPPSADVRMVLKSAAK
FT                   LKRLAPDAICVTDPLAFTGCGCDGKALDQVQLAYRNGIARAISWGQRPVHPVTVWRKRL
FT                   AVALDALQTTTWECGGVQTHRAGPGYRRRSPVETTNVALPTGDRLQIPTGAETLRFKGY
FT                   LIMSRNSSHDYADFADLVDTMAPETAAAVLAGMDRYYSCQAPGRQWMATQLVGRLADPQ
FT                   PSDLGDQSPGADAQAKWEEVRRRCLSVAVAMLEEAR"
FT   CDS_pept        271417..271827
FT                   /transl_table=11
FT                   /gene="BCG_0240"
FT                   /locus_tag="BCG_0240"
FT                   /product="Possible exported protein"
FT                   /note="Differs from Rv0203 and Mb0209 by 1aa, T88K"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0240"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70224"
FT                   /db_xref="GOA:A0A0H3M1L8"
FT                   /db_xref="InterPro:IPR030937"
FT                   /db_xref="InterPro:IPR032407"
FT                   /db_xref="InterPro:IPR038378"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1L8"
FT                   /protein_id="CAL70224.1"
FT                   /translation="MKTGTATTRRRLLAVLIALALPGAAVALLAEPSATGASDPCAASE
FT                   VARTVGSVAKSMGDYLDSHPETNQVMTAVLQQQVGPGSVASLTAHFEANPKVASDLHAL
FT                   SQPLTDLSTRCSLPISGLQAIGLMQAVQGARR"
FT   CDS_pept        complement(271879..273162)
FT                   /transl_table=11
FT                   /gene="BCG_0241c"
FT                   /locus_tag="BCG_0241c"
FT                   /product="Probable conserved transmembrane protein"
FT                   /note="In Mycobacterium bovis BCG Pasteur, and
FT                   Mycobacterium bovis, the presence of a more likely start
FT                   codon leads to a longer product compared to its homolog in
FT                   Mycobacterium tuberculosis strain H37Rv (427 a versus 412
FT                   aa). Differs from Rv0204c by 1aa, L321V"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0241c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70225"
FT                   /db_xref="GOA:A0A0H3M0X9"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M0X9"
FT                   /protein_id="CAL70225.1"
FT                   /translation="MYRDYGATCTVTLKHVSHDAPARNLRQRVGALPRTRVGAPPAEGV
FT                   PPRGKYWWLRWAVLAIVAIVLAIEVALGWDQLAKAWVSLYRAKWWWLLAAVAAAGASMH
FT                   SFAQIQRTLLKSAGVHVKQWRSEAAFYAANSLSTTLPGGPVLSATFLLRQQRIWGASTV
FT                   VASWQLVMSGVLQAVGLALLGLGGAFFLGAKNNPFSLLFTLGGFVTLLLLAQAVASRPE
FT                   LIEGIGRRVLSWANSVRGRPADAGLPKWRETLMQLESVSLGRRDLGVAFGWSLFNWIAD
FT                   VACLGFAAYAAGDHASVGGLAVAYAAARAVGTIPLMPGGLLVVEAVLVPGLVSSGMPLP
FT                   SAISAMLIYRLISWLLIAAIGWVVFFFMFRTESTADSDNDRDPPTDPNLRLVIQPQGTP
FT                   CDDPVETTPQGPAPTPDLRPEGGETPPR"
FT   CDS_pept        273287..274390
FT                   /transl_table=11
FT                   /gene="BCG_0242"
FT                   /locus_tag="BCG_0242"
FT                   /product="Probable conserved transmembrane protein"
FT                   /note="Differs from Rv0205 by 1aa, R72H"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0242"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70226"
FT                   /db_xref="GOA:A0A0H3M7H8"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7H8"
FT                   /protein_id="CAL70226.1"
FT                   /translation="MSASLDDASVAPLVRKTAAWAWRFLVILAAMVALLWVLNKFEVIV
FT                   VPVLLALMLSALLVPPVDWLDSRGLPRAVAVTLVLLSGFAVLGGILTFVVSQFIAGLPH
FT                   LVTEVERSIDSARRWLIEGPAHLRGEQIDNAGNAAIEALRNNQAKLTSGALSTAATITE
FT                   LVTAAVLVLFTLIFFLYGGRSIWQYVTKAFPASVRDRVRAAGRAGYASLIGYARATFLV
FT                   ALTDAAGVGAGLAVMGVPLALPLASLVFFGAFIPLIGAVVAGFLAVVVALLAKGIGYAL
FT                   ITVGLLIAVNQLEAHLLQPLVMGRAVSIHPLAVVLAIAAGGVLAGVVGALLAVPTAAFF
FT                   NNAVQVLLGGNPFADVADVSSDHLTEV"
FT   CDS_pept        complement(274387..277221)
FT                   /transl_table=11
FT                   /gene="mmpL3"
FT                   /locus_tag="BCG_0243c"
FT                   /product="Conserved transmembrane transport protein mmpL3"
FT                   /note="Differs from Rv0206c by 2aa, I384F, E466D"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0243c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70227"
FT                   /db_xref="GOA:A0A0H3M2S6"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2S6"
FT                   /protein_id="CAL70227.1"
FT                   /translation="MFAWWGRTVYRYRFIVIGVMVALCLGGGVFGLSLGKHVTQSGFYD
FT                   DGSQSVQASVLGDQVYGRDRSGHIVAIFQAPAGKTVDDPAWSKKVVDELNRFQQDHPDQ
FT                   VLGWAGYLRASQATGMATADKKYTFVSIPLKGDDDDTILNNYKAIAPDLQRLDGGTVKL
FT                   AGLQPVAEALTGTIATDQRRMEVLALPLVAVVLFFVFGGVIAAGLPVMVGGLCIAGALG
FT                   IMRFLAIFGPVHYFAQPVVSLIGLGIAIDYGLFIVSRFREEIAEGYDTETAVRRTVITA
FT                   GRTVTFSAVLIVASAIGLLLFPQGFLKSLTYATIASVMLSAILSITVLPACLGILGKHV
FT                   DALGVRTLFRVPFLANWKISAAYLNWLADRLQRTKTREEVEAGIWGKLVNRVMKRPVLF
FT                   AAPIVIIMILLIIPVGKLSLGGISEKYLPPTNSVRQAQEEFDKLFPGYRTNPLTLVIQT
FT                   SNHQPVTEAQIADIRSKAMAIGGFIEPDNDPANMWQERAYAVGASKDPSVRVLQNGLIN
FT                   PADASKKLTELRAITPPKGITVLVGGTPALELDSIHGLFAKMPLMVVILLTTTIVLMFL
FT                   AFGSVVLPIKATLMSALTLGSTMGILTWIFVDGHFSKWLNFTPTPLTAPVIGLIIALVF
FT                   GLSTDYEVFLVSRMVEARERGMSTQEAIRIGTAATGRIITAAALIVAVVAGAFVFSDLV
FT                   MMKYLAFGLMAALLLDATVVRMFLVPSVMKLLGDDCWWAPRWARRLQTRIGLGEIHLPD
FT                   ERKRPVSNGRPARPPVTAGLVAARAAGDPRPPHDPTHPLAESPRPARSSPASSPELTPA
FT                   LEATAAPAAPSGASTTRMQIGSSTEPPTTRLAAAGRSVQSPASTPPPTPTPPSAPSAGQ
FT                   TRAMPLAANRSTDAAGDPAEPTAALPIIRSDGDDSEAATEQLNARGTSDKTRQRRRGGG
FT                   ALSAQDLLRREGRL"
FT   CDS_pept        complement(277287..278015)
FT                   /transl_table=11
FT                   /gene="BCG_0244c"
FT                   /locus_tag="BCG_0244c"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0244c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70228"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MA14"
FT                   /protein_id="CAL70228.1"
FT                   /translation="MSLTEDVTSQTSESLARHSVLAEDLSQDGLTSLGAPGARVLLVWD
FT                   APNLDMGLGSILGRRPTALERPRFDALGRWLLARTAEIVAGRPGISTEPEATVFTNIAP
FT                   GSAEVVRPWVDALRNVGFAVFAKPKVDEDSDVDRDMLAHIDERYREGLAALVVASADGQ
FT                   AFRQPLEAVARSGTPVQVLGFREHASWALASDTLEFVDLEDIAGVFREPLPRIGLDSLP
FT                   EQGAWLQPFRPLSSLLTSRV"
FT   CDS_pept        complement(278018..278809)
FT                   /transl_table=11
FT                   /gene="BCG_0245c"
FT                   /locus_tag="BCG_0245c"
FT                   /product="Hypothetical methlytransferase (methylase)"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0245c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70229"
FT                   /db_xref="GOA:A1KF28"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KF28"
FT                   /protein_id="CAL70229.1"
FT                   /translation="MVHHGQMHAQPGVGLRPDTPVASGQLPSTSIRSRRSGISKAQRET
FT                   WERLWPELGLLALPQSPRGTPVDTRAWFGRDAPVVLEIGSGSGTSTLAMAKAEPHVDVI
FT                   AVDVYRRGLAQLLCAIDKVGSDGINIRLILGNAVDVLQHLIAPDSLCGVRVFFPDPWPK
FT                   ARHHKRRLLQPATMALIADRLVPSGVLHAATDHPGYAEHIAAAGDAEPRLVRVDPDTEL
FT                   LPISVVRPATKYERKAQLGGGAVIELLWKKHGCSERDLKIR"
FT   CDS_pept        278941..280026
FT                   /transl_table=11
FT                   /gene="BCG_0246"
FT                   /locus_tag="BCG_0246"
FT                   /product="Hypothetical protein"
FT                   /note="Differs from Rv0209 by 1aa, A162V"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0246"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70230"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1M1"
FT                   /protein_id="CAL70230.1"
FT                   /translation="MRGQGHQIFVDELARFATSSADQRVVAIAQRAAEPLRVAVRGRPG
FT                   VGCRTVARALQGAGSSSGMTVTPQARAADSDVDLVVYVTVEVVKPEDREAIAATRRPVV
FT                   AVLNKADLAGPLSGAGPIVMAQARCAQFSTLLGVPMESMIGLLAVAALDDLDDTLRAAL
FT                   RALAAHPDGFDALDRAVAGFLAAALPVPTEVRLRLLDTLDLFGIALGMAAFRPGRPSRT
FT                   PAQLRTLLRRVSGVDAVIDKVTAAGSEVRYRRLLDAVAELEALAAQAKEIGGPIGEFLR
FT                   DDDTVLARMAAAVDVALAVGLDVGPLDDPAAHLPRAVRWHRYSLDNGDMHRTCGADIAR
FT                   GSLRLWSLAGGMPLHRYRKSS"
FT   CDS_pept        280023..281501
FT                   /transl_table=11
FT                   /gene="BCG_0247"
FT                   /locus_tag="BCG_0247"
FT                   /product="Hypothetical protein"
FT                   /note="Differs from Rv0210 by 1aa, T486A"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0247"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70231"
FT                   /db_xref="GOA:A0A0H3M0Y4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M0Y4"
FT                   /protein_id="CAL70231.1"
FT                   /translation="MIRAASDDPAGVDELVAAIAPGLAGLGLPVINRREVVLVTGPWLA
FT                   GVSGVRAALAERLPQRRFVETAELGPGDAPVAVVFVVSAATALTESDCVLLDTAAEHTD
FT                   AVVAVVSKIDVHRGWRDVLTSNRDRLAARASRYARVPWVGAAAAPELGEPYLDDLVAAI
FT                   QKQLADPAVARRNMLRAWESRLLMVARRFDGDAQSAGRRARVDALRQQRRTVLRQGRQS
FT                   KSEHTIALRAQIQHARVKLSYFARNRCSLLRVELQEHVAGLSRKDIARFAAYTRGRVQE
FT                   VVAEVGEGAVAHLADVAQLLGVPVQPPVLENLPAVLPTVVAPPLTSRRLEIRLTTLLGA
FT                   GFGLGIALTLSRLVAGLTPGLAASGMVAGVAIGLAVTAWVVNARALLHDRVVVDRWTGE
FT                   VTASLRSVVEQLVATRVVAVETLLSTAISERDDAENARVADQVSIIDGELREHAVAAAR
FT                   AAALRDREMPAVRAALEAVRAELGEPGTPTTGLF"
FT   CDS_pept        281685..283505
FT                   /transl_table=11
FT                   /gene="pckA"
FT                   /locus_tag="BCG_0248"
FT                   /standard_name="pckG; pck1"
FT                   /product="Probable phosphoenolpyruvate carboxykinase pckA"
FT                   /EC_number="4.1.1.32"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0248"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70232"
FT                   /db_xref="GOA:A1KF31"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KF31"
FT                   /protein_id="CAL70232.1"
FT                   /translation="MTSATIPGLDTAPTNHQGLLSWVEEVAELTQPDRVVFTDGSEEEF
FT                   QRLCDQLVEAGTFIRLNPEKHKNSYLALSDPSDVARVESRTYICSAKEIDAGPTNNWMD
FT                   PGEMRSIMKDLYRGCMRGRTMYVVPFCMGPLGAEDPKLGVEITDSEYVVVSMRTMTRMG
FT                   KAALEKMGDDGFFVKALHSVGAPLEPGQKDVAWPCSETKYITHFPETREIWSYGSGYGG
FT                   NALLGKKCYSLRIASAMAHDEGWLAEHMLILKLISPENKAYYFAAAFPSACGKTNLAML
FT                   QPTIPGWRAETLGDDIAWMRFGKDGRLYAVNPEFGFFGVAPGTNWKSNPNAMRTIAAGN
FT                   TVFTNVALTDDGDVWWEGLEGDPQHLIDWKGNDWYFRETETNAAHPNSRYCTPMSQCPI
FT                   LAPEWDDPQGVPISGILFGGRRKTTVPLVTEARDWQHGVFIGATLGSEQTAAAEGKVGN
FT                   VRRDPMAMLPFLGYNVGDYFQHWINLGKHADESKLPKVFFVNWFRRGDDGRFLWPGFGE
FT                   NSRVLKWIVDRIEHKAGGATTPIGTVPAVEDLDLDGLDVDAADVAAALAVDADEWRQEL
FT                   PLIEEWLQFVGEKLPTGVKDEFDALKERLG"
FT   CDS_pept        complement(283572..284543)
FT                   /transl_table=11
FT                   /gene="nadR"
FT                   /locus_tag="BCG_0249c"
FT                   /product="Possible transcriptional regulatory protein nadR
FT                   (probably asnC-family)"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0249c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70233"
FT                   /db_xref="GOA:A0A0H3M7I3"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR006417"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR016429"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038727"
FT                   /db_xref="InterPro:IPR041749"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7I3"
FT                   /protein_id="CAL70233.1"
FT                   /translation="MTHGMVLGKFMPPHAGHVYLCEFARRWVDELTIVVGSTAAEPIPG
FT                   AQRVAWMRELFPFDRVVHLANENPQRPWEHPDFWDIWKASLQGVLATRPDFVFGAEPYN
FT                   ADFAQVLGARFVAVDHGRTVVPVTATDIRADPLGHWQHIPRCVRPAFVKRVSIIGPEST
FT                   GKTTLAQAVAEKLRTKWVPERAKMLRELNGGSLIGLEWAEIVRGQIASEEALARDADRV
FT                   LICDTDPLATTVWAEFLAGGCPQELRDLARRPYDLTLLTTPDVPWDADDGRCVPGARGT
FT                   FFARCEQALRAAGRSFVVITGGWEERLSVSLRAVEELVRARR"
FT   CDS_pept        complement(284540..285853)
FT                   /transl_table=11
FT                   /gene="BCG_0250c"
FT                   /locus_tag="BCG_0250c"
FT                   /product="Possible methyltransferase (methylase)"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0250c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70234"
FT                   /db_xref="GOA:A0A0H3M2T1"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2T1"
FT                   /protein_id="CAL70234.1"
FT                   /translation="MSIKAYAKTQGIAVTSVNGLVAGHGSVQETWLAMQSAAALSGTPR
FT                   LVGFSCIDTFPEVLWLAQRARQAWDGVRIVIGNAMATLNYERILRQHDCFDYVVVGDGE
FT                   VAFTKLALALANDAAVDDVPGLARRSEQGQILRTPSSLVDLDELPRPARDELPTVLADG
FT                   FAASVFSTRGCPYRCTFCGTGAMSAMLGKDSYRAKSVDAVVDEIDYLVSDYDVNFLSIT
FT                   DDLFISKHPGSQQRAADFANAVLRRGISVNFMVDIRLDSVVDLDLFKHLHRAGLRRVFI
FT                   GVETGSYEQLRAYRKQILTRGQDAADTINALQQLGIDVIPGTIMFHPTVQPDELRETVR
FT                   LLRATKYTVGFKFMSRIVPYPGTPLYQAYSDAGYLTAKWPLGQWEFVDPEASRVYADVV
FT                   AKVAPDVGISFDEAEAYFLSRLDEWENVIAGRIAEATS"
FT   CDS_pept        285967..287580
FT                   /transl_table=11
FT                   /gene="fadD4"
FT                   /locus_tag="BCG_0251"
FT                   /product="Probable fatty-acid-CoA ligase fadD4"
FT                   /EC_number="6.2.1.-"
FT                   /note="Differs from Rv0214 by 1aa, A40G"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0251"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70235"
FT                   /db_xref="GOA:A0A0H3MA19"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MA19"
FT                   /protein_id="CAL70235.1"
FT                   /translation="MPRGELYKRFRLVMGGIAPCGSGRRAATYPRRMQIRPYIAADKPA
FT                   VILYPSGTVISFDELEARANRLAHWFRQAGLREDDVVAILMENNEHVHAVMWAARRSGL
FT                   YYVPINTHLTASEAAYIVDNSGAKAIVGSAALRETCHGLAEHLPGGLPDLLMLAGGGLV
FT                   GWMTYPECVADQPDTPIEDEREGDLLQYSSGTTGRPKGIKRELPHVSPDAAPGMMPALL
FT                   DFWMDADSVYLSPAPMYHTAPSVWTMSALAAGVTTVVMEKFDAEGALDAIQRYRVTHAQ
FT                   FVPAMFVRMLKLPEAVRNSYDMSSLRRVIHAAAPCPVQIKEQMIHWWGPIIDEYYASSE
FT                   ASGSTLITAEDWLTHPGSVGKPIQGGVHIVGADGSELPPNQPGEIYFEGGYPFEYLNDP
FT                   AKTAASRNKHGWVTVGDVGYLDDDGYLFLTGRRHHMIISGGVNIYPQEAENLLVAHPKV
FT                   LDAAVFGVPDDEMGQRVMAAVQTVDSADANDQFAGELLAWLRDRLSHFKCPRSIAFEPQ
FT                   LPRTDTGKLYKSGLVEKYSV"
FT   CDS_pept        complement(287622..288788)
FT                   /transl_table=11
FT                   /gene="fadE3"
FT                   /locus_tag="BCG_0252c"
FT                   /product="Probable acyl-CoA dehydrogenase fadE3"
FT                   /EC_number="1.3.99.-"
FT                   /note="In Mycobacterium bovis BCG Pasteur, and
FT                   Mycobacterium bovis, a 29 bp insertion leads to a longer
FT                   product compared to its homolog in Mycobacterium
FT                   tuberculosis strain H37Rv (388 aa versus 357 aa). Differs
FT                   from Mb0221c by 1aa, S361A"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0252c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70236"
FT                   /db_xref="GOA:A0A0H3M1M6"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1M6"
FT                   /protein_id="CAL70236.1"
FT                   /translation="MRNELNDDEAMLVATVRAFIDRDVKPTVREVEHANSYPEAWIEQM
FT                   KHIGIYGLAIDEQYGGSPVSMPCYVQVTQELARGWMSLAGAMGGHTVVAKLLTLFGTEE
FT                   QRRTYLPPMASGELRATMALTEPGGGSDLQNMSTTALADGPEGSAGLLINGCKTWISNA
FT                   RRSGLFAVLCKTDPNATPRHQGMSIVLVEPGPGLTVSRDLPKLGYKGVESCELSFDNLR
FT                   VPVSAILGGAMGQGFSQMMKGLETGRIQVAARALGVATAALEDSLAYAQQRESFGRPIW
FT                   QHQAVGNYLADMATKLTAARQLTRYAAERYDSGQRCDMEAGMAKLFASEVAMEIALNAV
FT                   RIHGGYGYSTEYDVERYFRDSPLMILGEGTNEIQRNVIAGQLVARGGI"
FT   CDS_pept        288845..289858
FT                   /transl_table=11
FT                   /gene="BCG_0253"
FT                   /locus_tag="BCG_0253"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0253"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70237"
FT                   /db_xref="InterPro:IPR016790"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M0Z1"
FT                   /protein_id="CAL70237.1"
FT                   /translation="MASGYGGIRVGGPYFDDLSKGQVFDWAPGVTLSLGLAAAHQSIVG
FT                   NRLRLALDSDLCAAVTGMPGPLAHPGLVCDVAIGQSTLATQRVKANLFYRGLRFHRFPA
FT                   VGDTLYTRTEVVGLRANSPKPGRAPTGLAGLRMTTIDRTDRLVLDFYRCAMLPASPDWK
FT                   PGAVPGDDLSRIGADAPAPAADPTAHWDGAVFRKRVPGPHFDAGIAGAVLHSTADLVSG
FT                   APELARLTLNIAATHHDWRVSGRRLVYGGHTIGLALAQATRLLPNLATVLDWESCDHTA
FT                   PVHEGDTLYSELHIESAQAHADGGVLGLRSLVYAVSDSASEPDRQVLDWRFSALQF"
FT   CDS_pept        complement(289855..290763)
FT                   /transl_table=11
FT                   /gene="lipW"
FT                   /locus_tag="BCG_0254c"
FT                   /product="Possible esterase lipW"
FT                   /EC_number="3.1.1.-"
FT                   /note="Differs from Rv0217c by 1aa T184P"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0254c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70238"
FT                   /db_xref="GOA:A0A0H3M7I8"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7I8"
FT                   /protein_id="CAL70238.1"
FT                   /translation="MSGNEVHPDLRRIAVVTPRQLVGPRTLPVMRALIVVAGLRMSRTP
FT                   PDIEVLTLESGVGVRLYRPAGSNEPAPALLWIHAGGYVMGTAQQDDRLCLRFSSRLGIT
FT                   VASVDYRLAPENPYPAALGDCYSALTWLASLPAVDPARVAIGGASAGGGLAAALALLAR
FT                   DRGGITPAFQLLVYPMLDDRTSIAPANPHYRLWNGRANRFGWRAYLGDADARVAVPGRR
FT                   DDLGGLAPAWIGVGTHDLLHDEDLAYAERLTAAGVPCQVEVVEGAFHGFDRVAPNVGVS
FT                   QRFFTSQCNSLRAALALSNRT"
FT   CDS_pept        290856..292184
FT                   /transl_table=11
FT                   /gene="BCG_0255"
FT                   /locus_tag="BCG_0255"
FT                   /product="Probable conserved transmembrane protein"
FT                   /note="Differs from Rv0218 by 2aa, R316C, N413D"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0255"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70239"
FT                   /db_xref="GOA:A0A0H3M2T5"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2T5"
FT                   /protein_id="CAL70239.1"
FT                   /translation="MSDPARGAEAEDAYGFPAGLWRWLQRHPPPALHRLTRFRSPLRGP
FT                   WLTSVFGLVLLVALPFVIITGLLSYIAYAPQLGQAIPGDVGWLRLPAFTWPTRPSWLYR
FT                   LTQGLHVGLGLVIIPVVLAKLWSVIPRLFVWPPARSIAQVLERLSVLMLVGGILFQIVT
FT                   GVLNIQYDYIFGFSFYTGHYFGAWVFIAGFLLHIVVKIPHMVTGLRSIPMREVLGTNVA
FT                   DTRAQPCDPDGLVSVNPGEATLSRRGALGLVGAGVLLIGVLTVGQTLGGFTRKAALLLP
FT                   RGRVVSPGDFPVNKTAAAAGITAEAIGPDWRLVLRGGPAEVVLDRATLAGLPQRTARLP
FT                   LACVEGWSAVRTWSGVPLAELALLAGVPAARSARVTSLQRGGAFGEAKLAANQIADPDA
FT                   LLALRVDGADLSLNHGYPARIIVPALPGVHNTKWVAGIEFHKR"
FT   CDS_pept        292186..292734
FT                   /transl_table=11
FT                   /gene="BCG_0256"
FT                   /locus_tag="BCG_0256"
FT                   /product="Probable conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0256"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70240"
FT                   /db_xref="GOA:A0A0H3MA23"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MA23"
FT                   /protein_id="CAL70240.1"
FT                   /translation="MFDIATRFKNSYGSGPLHLLAMVSGFALLGYIVATARPSALWNQA
FT                   TWWQSIAVWFVAAVVAHDLLLYPLYALADRILARLVGRRDVSAPRRRPELPVRNYIRIP
FT                   ALAAGLTLLVFLPGIIRQGAPTYLDATGQTQEPFLGRWLLLTAVAFGISAAAYAIRLVV
FT                   AHVRRRRAGCSRVDAIDEE"
FT   CDS_pept        292744..293985
FT                   /transl_table=11
FT                   /gene="lipC"
FT                   /locus_tag="BCG_0257"
FT                   /product="Probable esterase lipC"
FT                   /EC_number="3.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0257"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70241"
FT                   /db_xref="GOA:A0A0H3M1N1"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1N1"
FT                   /protein_id="CAL70241.1"
FT                   /translation="MNQRRAAGSTGVAYIRWLLRARPADYMLALSVAGGSLPVVGKHLK
FT                   PLGGVTAIGVWGARHASDFLSATAKDLLTPGINEVRRRDRASTQEVSVAALRGIVSPDD
FT                   LAVEWPAPERTPPVCGALRHRRYVHRRRVLYGDDPAQLLDVWRRKDMPTKPAPVLIFVP
FT                   GGAWVHGSRAIQGYAVLSRLAAQGWVCLSIDYRVAPHHRWPRHILDVKTAIAWARANVD
FT                   KFGGDRNFIAVAGCSAGGHLSALAGLTANDPQYQAELPEGSDTSVDAVVGIYGRYDWED
FT                   RSTPERARFVDFLERVVVQRTIDRHPEVFRDASPIQRVTRNAPPFLVIHGSRDCVIPVE
FT                   QARSFVERLRAVSRSQVGYLELPGAGHGFDLLDGARTGPTAHAIALFLNQVHRSRAQFA
FT                   KEVIQTPANCMVAL"
FT   CDS_pept        293999..294772
FT                   /transl_table=11
FT                   /gene="BCG_0258"
FT                   /locus_tag="BCG_0258"
FT                   /product="Conserved hypothetical protein"
FT                   /note="In Mycobacterium bovis and Mycobacterium bovis BCG
FT                   Pasteur, RD10, a 1902 bp deletion leads to a shorter
FT                   product with a different COOH part, compared to its homolog
FT                   in Mycobacterium tuberculosis strain H37Rv (257 aa versus
FT                   469 aa). It also leads to the deletion of the next protein,
FT                   echA1 (Rv0222)"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0258"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70242"
FT                   /db_xref="GOA:A0A0H3M0Z7"
FT                   /db_xref="InterPro:IPR004255"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M0Z7"
FT                   /protein_id="CAL70242.1"
FT                   /translation="MKRLSGWDAVLLYSETPNVHMHTLKVAVIELDSDRQEFGVDAFRE
FT                   VIAGRLHKLEPLGYQLVDVPLKFHHPMWREHCQVDLNYHIRPWRLRAPGGRRELDEAVG
FT                   EIASTPLNRDHPLWEMYFVEGLANHRIAVVAKIHHALADGVASANMMARGMDLLPGPEV
FT                   GRYVPDPAPTKRQLLSAAFIDHLRHLGRIPATIRYTTQGLGRVRRSSRKLSPALTMPFT
FT                   PPPTFMNRIKKPLSKPSGRPPPHTNRAPSSMPLAM"
FT   CDS_pept        complement(294638..295447)
FT                   /transl_table=11
FT                   /gene="BCG_0259c"
FT                   /locus_tag="BCG_0259c"
FT                   /product="Probable aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.-"
FT                   /note="In mycobacterium bovis strain AF2122/97 and
FT                   Mycobacterium bovis BCG Pasteur, RD10, a 1902 bp deletion,
FT                   compared to Mycobacterium tuberculosis H37Rv, truncates
FT                   Rv0221c and Rv0223c and removes Rv0222c"
FT                   /note="In Mycobacterium bovis BCG Pasteur, a single base
FT                   deletion at position equivalent to Mycobacterium
FT                   tuberculosis H37Rv2 267419-267419(*-c) splits gene into two
FT                   parts compared to its homologs in Mycobacterium
FT                   tuberculosis strain H37Rv and Mycobacterium bovis AF2122/97
FT                   (116 aa and 269 aa, versus 487 aa and 385 aa, respectively.
FT                   Also has same 1 bp insertion, as Mycobacterium bovis
FT                   AF2122/97, at position equivalent to Mycobacterium
FT                   tuberculosis H37Rv2 base 266743. Deletion in Mycobacterium
FT                   bovis and bovis BCG Pasteur of region RD10 leads to a
FT                   different COOH part compared to Mycobacterium tuberculosis
FT                   strain H37Rv. May be pseudogene"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0259c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70243"
FT                   /db_xref="GOA:A0A0H3M7J2"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7J2"
FT                   /protein_id="CAL70243.1"
FT                   /translation="MNYFAGAADKVTWTETRTGSYGQSIVSRESVGVVGAIVAWNVPLF
FT                   LAVNKIAPALLAGCTIVLKPAAETPLTANALAEVFAEVGLPEGVLSVVPGGIETGQALT
FT                   SNPDIDMFTFTGSSAVGREVGRRAAEMLKPCTLELGGKSAAIILEDVDLAAAIPMMVFS
FT                   GVMNAGQGCVNQTRILAPRSRYDEIVAAVTNFVTALPVGPPSDPAAQIGPLISEKQRTR
FT                   VEALHRQGHRGGRSVGVRRRPSRGLGQRLLYPIHERRWRGKWHGQCG"
FT   misc_feature    294686..294687
FT                   /note="RD10, 1902 bp. Region of Difference RD10, deleted
FT                   region in Mycobacterium bovis BCG Pasteur (position
FT                   294686..294687) and Mycobacterium bovis AF2122/97 (position
FT                   264979..264980) compared to Mycobacterium tuberculosis
FT                   H37Rv2 (position: 264755..266656, 1902bp). Removes gene
FT                   Rv0222 and truncates genes Rv0221 and Rv0223"
FT   CDS_pept        complement(295444..295794)
FT                   /transl_table=11
FT                   /gene="BCG_0260c"
FT                   /locus_tag="BCG_0260c"
FT                   /product="Probable aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.-"
FT                   /note="In Mycobacterium bovis BCG Pasteur, a single base
FT                   deletion at position equivalent to Mycobacterium
FT                   tuberculosis H37Rv2 267419-267419(*-c) splits gene into two
FT                   parts compared to its homologs in Mycobacterium
FT                   tuberculosis strain H37Rv and Mycobacterium bovis AF2122/97
FT                   (116 aa and 269 aa, versus 487 aa and 385 aa, respectively.
FT                   Also has same 1 bp insertion, as Mycobacterium bovis
FT                   AF2122/97, at position equivalent to Mycobacterium
FT                   tuberculosis H37Rv2 base 266743. May be pseudogene"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0260c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70244"
FT                   /db_xref="GOA:A0A0H3M2T9"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2T9"
FT                   /protein_id="CAL70244.1"
FT                   /translation="MSDSATEYDKLFIGGKWTKPSTSDVIEVRCPATGEYVGKVPMAAA
FT                   ADVDAAVAAARAAFDNGPWPSTPPHERAAVIAAAVKMLAERKDLFTKLLAAETGQPPTI
FT                   IETMHWMGSMGR"
FT   CDS_pept        complement(295893..296657)
FT                   /transl_table=11
FT                   /gene="BCG_0261c"
FT                   /locus_tag="BCG_0261c"
FT                   /product="Possible methyltransferase (methylase)"
FT                   /EC_number="2.1.1.-"
FT                   /note="Differs from Rv0224c by 1aa, L117F"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0261c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70245"
FT                   /db_xref="GOA:A1KF44"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KF44"
FT                   /protein_id="CAL70245.1"
FT                   /translation="MAVTDVFARRATLRRSLRLLADFRYEQRDPARFYRTLAADTAAMI
FT                   GDLWLATHSEPPVGRTLLDVGGGPGYFATAFSDAGVGYIGVEPDPDEMHAAGPAFTGRP
FT                   GMFVRASGMALPLADDSVDICLSSNVAEHVPRPWQLGTEMLRVTKPGGLVVLSYTVWLG
FT                   PFGGHEMGLSHYLGGARAAARYVRKHGHPAKNNYGSSLFAVSAAEGLRWAAGTGAALAV
FT                   FPRYHPRWAWWLTSVPVLREFLVSNLVLVLTP"
FT   CDS_pept        296693..297847
FT                   /transl_table=11
FT                   /gene="BCG_0262"
FT                   /locus_tag="BCG_0262"
FT                   /product="Possible conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0262"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70246"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MA28"
FT                   /protein_id="CAL70246.1"
FT                   /translation="MSALRSVLLLCWRDIGHPQGGGSEAYLQRIGAQLAASGIAVTLRT
FT                   ARYPGAPRHELVDGVRISRAGGRYSVYLWALLAMAAARCGLGPLRRVRPDVVVDTQNGW
FT                   PFVARLLYGRRSLVLVHHCHREQWPVAGRMMGRLGWYVESMLSPRLHRRNQYVTVSLPS
FT                   ARDLIALGVDSERIAVVRNGLDEAPSPTLSGPRAPTPRVVVLSRLVPHKQIEDALAAVA
FT                   ELQPRIPGLHLDIVGGGWWRQRLVDHVHRLDIADAVTFHGHVDDVTKHHVLQSSWVHLL
FT                   PSRKEGWGLAVIEAAQHGVPTIGYRSSGGLADSIVDGVTGILVDDRAELVAWLEQLLSD
FT                   SVLRDQLGAKAQARSGEFSWRQSAEALRSVLEAVQASRFVSGVV"
FT   CDS_pept        complement(297864..299594)
FT                   /transl_table=11
FT                   /gene="BCG_0263c"
FT                   /locus_tag="BCG_0263c"
FT                   /product="Probable conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0263c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70247"
FT                   /db_xref="GOA:A0A0H3M1N7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1N7"
FT                   /protein_id="CAL70247.1"
FT                   /translation="MRWFRPGYALVLVLLLAAPLLRPGYLLLRDAVSTPRSYVSANALG
FT                   LTSAPRATPQDFAVALASHLVDGGVVVKALLLLGLWLAGWGAARLVATALPAAGAAGQF
FT                   VAITLAIWNPYVAERLLQGHWSLLVGYGCLPWVATAMLTMRTTVGAGWFGLFGLAFWVA
FT                   LAGLTPSGLLLAATVAVVCVAMPGAGRPRWQCGVAALGSALVGALPWLTASALGSSLTS
FT                   HTAANQLGVTAFAPRAEPGLGTLGSLASLGGIWNGEAVPSSRTTLFAVASAVVLLAMVA
FT                   IGLPTVARRPVAVPLLTLAAVSVMVPAVLATGPGLHALRVVVDAAPGLGVLRDGQKWVA
FT                   LAVPGYTLSGAGTVLTLRRWLRPATAAVVCCLALVLTLPDLAWGVWGKVAPVHYPSGWA
FT                   AVAAAINADPRTVAVLPAGTMRRFSWSGSAPVLDPLPRWVRADVLTTGDLVISGVTVPG
FT                   EDAHARAVQELLLTGPHPSTLAAAGVGWLVVESDSAGDMGAAARTLGRLAAAHRDDELA
FT                   LYRVGGQTSGASSARLKATMLAHWAWLSMLLVGGAGAAGYWVRRHLHHCEDTPASRAQD
FT                   "
FT   CDS_pept        complement(299604..300869)
FT                   /transl_table=11
FT                   /gene="BCG_0264c"
FT                   /locus_tag="BCG_0264c"
FT                   /product="Probable conserved membrane protein"
FT                   /note="Differs from Rv0227c by 1aa, R29S, and from Mb0232c
FT                   by 1aa, S392N"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0264c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70248"
FT                   /db_xref="GOA:A0A0H3M102"
FT                   /db_xref="InterPro:IPR021424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M102"
FT                   /protein_id="CAL70248.1"
FT                   /translation="MLRFAACGAIGLGAALLIAALLLSTYTTRRIAEIPLDIDATLISD
FT                   GTGTALDSASLATEHIVVNQDVPLVSQQQVTVESPANADVVTLQVGSSLRRTDKQKDSG
FT                   LLLAIVDTVTLNRKTAMAVSDDTHTGGAVQKPRGLNDENPPTAIPLRHDGLSYRFPFHT
FT                   EKKTYPYFDPIAQKAFDANYEGEEDVNGLTTYRFTQNVGYTPEGKLVAPLKYPSLYAGD
FT                   EDGKVTTSAAMWGLPGDPNEQITMTRYYAAQRTFWVDPVSGTIVKETERANHYFARDPL
FT                   KPEVTFADYQVTSTEETVESQVNAARDERDRLALWSRVLPITFTAAGLVALVGGGLFAS
FT                   FSLRTEGALMAASGDRDDHDYRRGGFEEPVPGAEAETEKLPTQRPDFPREPSGSDPPRL
FT                   GSAQPPPPPDAGHPDPGPPERR"
FT   CDS_pept        301085..302308
FT                   /transl_table=11
FT                   /gene="BCG_0265"
FT                   /locus_tag="BCG_0265"
FT                   /product="Probable integral membrane acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0265"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70249"
FT                   /db_xref="GOA:A0A0H3M7J7"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7J7"
FT                   /protein_id="CAL70249.1"
FT                   /translation="MGPADESGAPIRPQTPHRHTVLVTNGQVVGGTRGFLPAVEGMRAC
FT                   AAVGVVVTHVAFQTGHSSGVGGRLFGRFDLAVAVFFAVSGFLLWRGHAAAARDLRSHPR
FT                   TGPYLRSRVARIMPAYVVAVVVILSLLPDADHASLTVWLANLTLTQIYVPLTLTGGLTQ
FT                   MWSLSVEVAFYAALPVLALLGRRIPVGARVPAIAALAALSWAWGWLPLDAGSGINPLTW
FT                   PPAFFSWFAAGMLLAEWAYSPVGLPHRWARRRVAMAVTALLGYLVAASPLAGPEGLVPG
FT                   TAAQFAVKTAMGSLVAFALVAPLVLDRPDTSHRLLGSPAMVTLGRWSYGLFIWHLAALA
FT                   MVFPVIGAFPFTGRMPTVLVLTLIFGFAIAAVSYALVESPCREALRRWERRNEPISVGE
FT                   LQADAIAP"
FT   CDS_pept        complement(302336..303016)
FT                   /transl_table=11
FT                   /gene="BCG_0266c"
FT                   /locus_tag="BCG_0266c"
FT                   /product="Possible conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0266c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70250"
FT                   /db_xref="GOA:A0A0H3M2U5"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2U5"
FT                   /protein_id="CAL70250.1"
FT                   /translation="MRQPRRANAMGLALCIYIGSLLIYTPIHGETSRRHRRAGFKHGSY
FT                   RIGHDDDQRHRQRGPAASHVSASSTRRRRSRHAGRRTARGPRRSMALKYLLDTSVIKRL
FT                   SRPAVRRAVEPLAEAGAVARTQITDLEVGYSARNETEWQRLMVALSAFDLIESTASHHR
FT                   RALGIQRLLAARSQRGRKIPDLLIAAAGEEHGLVVLHYDADFDLIAAVTGQPCQWIVPA
FT                   GTID"
FT   CDS_pept        complement(303013..303993)
FT                   /transl_table=11
FT                   /gene="php"
FT                   /locus_tag="BCG_0267c"
FT                   /product="Probable phosphotriesterase php"
FT                   /EC_number="3.1.8.1"
FT                   /note="Differs from Rv0230c by 1aa, E199D"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0267c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70251"
FT                   /db_xref="GOA:A0A0H3MA30"
FT                   /db_xref="InterPro:IPR001559"
FT                   /db_xref="InterPro:IPR017947"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MA30"
FT                   /protein_id="CAL70251.1"
FT                   /translation="MPELNTARGPIDTADLGVTLMHEHVFIMTTEIAQNYPEAWGDEDK
FT                   RVAGAIARLGELKARGVDTIVDLTVIGLGRYIPRIARVAAATELNIVVATGLYTYNDVP
FT                   FYFHYLGPGAQLDGPEIMTDMFVRDIEHGIADTGIKAGILKCATDEPGLTPGVERVLRA
FT                   VAQAHKRTGAPISTHTHAGLRRGLDQQRIFAEEGVELSRVVIGHCGDSTDVGYLEELIA
FT                   AGSYLGMDRFGVDVISPFQDRVNIVARMCERGHADKMVLSHDACCYFDALPEELVPVAM
FT                   PNWHYLHIHNDVIPALKQHGVTDEQLHTMLVDNPRRIFERQGGYQ"
FT   CDS_pept        304088..305794
FT                   /transl_table=11
FT                   /gene="fadE4"
FT                   /locus_tag="BCG_0268"
FT                   /product="Probable acyl-CoA dehydrogenase fadE4"
FT                   /EC_number="1.3.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0268"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70252"
FT                   /db_xref="GOA:A0A0H3M1P1"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1P1"
FT                   /protein_id="CAL70252.1"
FT                   /translation="MLLNPNHLTRKYPDRRSGEIMAATVDFFESRGKARLKHDDHERIW
FT                   YSDFLDFVGRERIFASLLTPASYGADDCRWDTYRISEFAEIMGFYGLSYWYPFQVTALG
FT                   LGPIWMSANEDAKRKAAAGLEAGEVFAFGLSEQTHGADVYQTDMILTPSDGGWTANGEK
FT                   YYIGNANVARMVSTFGKIAGTPESQEYVFFVADSQHERYDLIKNVVNSQNYVANYALRD
FT                   YPVTEADILHRGAEAFHAALNTVNVCKYNLGWGAIGMCTHALYESVTHAANRHLYGTVV
FT                   TDFSHVRRLLTDAYVRLIAMKLVASRASDYMRSASAADRRYLLYSPLTKAKVTSEGERV
FT                   ITALWDVIAAKGVEKDTFFETVAREIGLLPRLEGTVHINIGLLGKFMPNYLFAPDSTLP
FT                   VIPRRDDAADDAFLFAQGPTGGLGKVRFHDWRASFDTCAHLPNVALLREQVDVFAELLA
FT                   SATPDAAQQKDIDFAFGVGQLFANVPYAQLILEEARLSGVDEALIDEIFGVLVRDFNTH
FT                   AVELHGRSATTAEQARFAMRMVRRPVHDPARYDQIWKDHVLALNGAYQMAP"
FT   CDS_pept        305929..306618
FT                   /transl_table=11
FT                   /gene="BCG_0269"
FT                   /locus_tag="BCG_0269"
FT                   /product="Probable transcriptional regulatory protein
FT                   (probably tetR/acrR-family)"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0269"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70253"
FT                   /db_xref="GOA:A0A0H3M107"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M107"
FT                   /protein_id="CAL70253.1"
FT                   /translation="MPTVTWARVDPARRAAVVEAAEAEFGAHGFSRGSLNVIARRAGVA
FT                   KGSLFQYFADKRDLYAFIADIASQRVRSYMEDLIRELDPNRPFFEFLTDLLDGWVAYFA
FT                   EHPRERALHAAATLEVDTDARISVRSVLHRHYLDVLRPLVRDAHARGDLRADSDTGALM
FT                   SLLLLIFPHLALAPYMRGLDPILGLDEPTPEQPALAVRRLVAVLAAAFDAQHPATNSAQ
FT                   TRSEEIT"
FT   CDS_pept        306615..307559
FT                   /transl_table=11
FT                   /gene="nrdB"
FT                   /locus_tag="BCG_0270"
FT                   /product="Probable ribonucleoside-diphosphate reductase
FT                   (beta chain) nrdB"
FT                   /EC_number="1.17.4.1"
FT                   /note="Differs from Rv0233 by 1aa, D33H"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0270"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70254"
FT                   /db_xref="GOA:A1KF53"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR033908"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KF53"
FT                   /protein_id="CAL70254.1"
FT                   /translation="MTRTRSGSLAAGGLNWASLPLKLFAGGNAKFWDPADIDFTRDRAD
FT                   WEKLSDDERDYATRLCTQFIAGEEAVTEDIQPFMSAMRAEGRLADEMYLTQFAFEEAKH
FT                   TQVFRMWLDAVGISEDLHRYLDDLPAYRQIFYAELPECLNALSADPSPAAQVRASVTYN
FT                   HIVEGMLALTGYYAWHKICVERAILPGMQELVRRIGDDERRHMAWGTFTCRRHVAADDA
FT                   NWTVFETRMNELIPLALRLIEEGFALYGDQPPFDLSKDDFLQYSTDKGMRRFGTISNAR
FT                   GRPVAEIDVDYSPAQLEDTFADEDRRTLAAASA"
FT   CDS_pept        complement(307635..309170)
FT                   /transl_table=11
FT                   /gene="gabD1"
FT                   /locus_tag="BCG_0271c"
FT                   /standard_name="gabD2"
FT                   /product="Probable succinate-semialdehyde dehydrogenase
FT                   [nadp+] dependant (ssdh) gabD1"
FT                   /EC_number="1.2.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0271c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70255"
FT                   /db_xref="GOA:A1KF54"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KF54"
FT                   /protein_id="CAL70255.1"
FT                   /translation="MRSVTCSATLVLPVIEPTPADRRPRHLLLGSAGHVSGRLDTGRFV
FT                   QTHPAKDVSVPIATINPATGETVKTFTAATDDEVDAAIARAHRRFADYRQTSFAQRARW
FT                   ANATADLLEAEADQAAAMMTLEMGKTLAAAKAEALKCAKGFRYYAENAEALLADEPADA
FT                   AKVGASAAYGRYQPLGVILAVMPWNFPLWQAVRFAAPALMAGNVGLLKHASNVPQCALY
FT                   LADVIARGGFPDGCFQTLLVSSGAVEAILRDPRVAAATLTGSEPAGQSVGAIAGNEIKP
FT                   TVLELGGSDPFIVMPSADLDAAVSTAVTGRVQNNGQSCIAAKRFIVHADIYDDFVDKFV
FT                   ARMAALRVGDPTDPDTDVGPLATEQGRNEVAKQVEDAAAAGAVIRCGGKRLDRPGWFYP
FT                   PTVITDISKDMALYTEEVFGPVASVFRAANIDEAVEIANATTFGLGSNAWTRDETEQRR
FT                   FIDDIVAGQVFINGMTVSYPELPFGGVKRSGYGRELSAHGIREFCNIKTVWIA"
FT   CDS_pept        complement(309196..310644)
FT                   /transl_table=11
FT                   /gene="BCG_0272c"
FT                   /locus_tag="BCG_0272c"
FT                   /product="Probable conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0272c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70256"
FT                   /db_xref="GOA:A0A0H3M7K1"
FT                   /db_xref="InterPro:IPR009613"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7K1"
FT                   /protein_id="CAL70256.1"
FT                   /translation="MGWFSAPEYWLGRLALERGTAIIYLIAFVAAAQQFRPLIGEHGML
FT                   PVPRYLAGQSFWRTPSIFHFRYSDRVFAGVCWLGAVLSAAVVAGAASFVPLWATMLIWL
FT                   TLWVLYLSIVNVGQAWYSFGWESLLLETGFLMIFLGNERTAPPILTLLLARWLLFRVEF
FT                   GAGLIKMRGDSCWRSLTCLYYHHETQPMPGPLSWFFHHLPKPLHRIEVAGNHFAQLVVP
FT                   FGLFTPQPAASIAAAIIVVTQLWLVASGNFSWLNWLTILLACSAIDTSSAAALLPMPAQ
FT                   PALSAPPQWFAGLVVVFTAAVLLLSYWPARNLLSSHQRMNMSFNPFHLVNTYGAFGSIC
FT                   RTRREVVIEGTDESPITEQTVWKAYEFKGKPGDPRRLPRQWAPYHLRLDWLMWFAAISP
FT                   GYALPWMTPFLNRLLRNDPATLKLLRHNPFPQSPPRYVRAQLYQYRFTTVAELRRDRAW
FT                   WHRTLIGRYVPPMSLRKVASPPAD"
FT   CDS_pept        complement(310679..314881)
FT                   /transl_table=11
FT                   /gene="BCG_0273c"
FT                   /locus_tag="BCG_0273c"
FT                   /product="Probable conserved transmembrane protein"
FT                   /note="Differs from Rv0236c by 3aa, V412M, A990T, G1080S"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0273c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70257"
FT                   /db_xref="GOA:A0A0H3M2V0"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR021798"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2V0"
FT                   /protein_id="CAL70257.1"
FT                   /translation="MAPLSRKWLPVVGAVALALTFAQSPGQVSPDTKLDLTANPLRFLA
FT                   RATNLWNSDLPFGQAQNQAYGYLFPHGTFFVIGHLLGVPGWVTQRLWWAVLLTVGFWGL
FT                   LRVAEALGVGGPSSRVVGAVAFALSPRVLTTLGSISSETLPMMLAPWVLLPTILALRGT
FT                   SGRSVRALAAQAGLAVALMGAVNAIATLAGCLPAVIWWACHRPNRLWWRYTAWWLLAMA
FT                   LATLWWVMALTQLHGVSPPFLDFIESSGVTTQWSSLVEVLRGTDSWTPFVAPNATAGAP
FT                   LVTGSAAILGTCLVAAAGLAGLTSPAMPARGRLVTMLLVGVVLLAVGHRGGLASPVAHP
FT                   VQAFLDAAGTPLRNVHKVGPVIRLPLVLGLAQLLSRVPLPGSAPRPAWLRAFAHPERDK
FT                   RVAVAVVALTALVVSTSLAWTGRVAPPGTFGALPQYWQEAADWLRTHHAATPTPGRVLV
FT                   VPGAPFATQVWGTSHDEPLQVLGDGPWGVRDSIPLTPPQTIRALDSVQRLFAAGRPSAG
FT                   LADTLARQGISYVLVRNDLDPETSRSARPILLHRSIAGSPGLAKLAEFGAPVGPDPLAG
FT                   FVNDSGLRPRYPAIEIYRVSAPANPGAPYFAATDQLARVDGGPEVLLRLDERRRLQGQP
FT                   PLGPVLMTADARAAGLPVPQVAVTDTPVARETDYGRVDHHSSAIRAPGDARHTYNRVPD
FT                   YPVPGAEPVVGGWTGGRITVSSSSADATAMPDVAPASAPAAAVDGDPATAWVSNALQAA
FT                   VGQWLQVDFDRPVTNAVVTLTPSATAVGAQVRRILIETVNGSTTLRFDEAGKPLTAALP
FT                   YGETPWVRFTAAATDDGSAGVQFGITDLAITQYDASGFAHPVQLRHTVLVPGPPPGSAI
FT                   AGWDLGSELLGRPGCAPGPDGVRCAASMALAPEEPANLSRTLTVPRPVSVTPMVWVRPR
FT                   QGPKLADLIAAPSTTRASGDSDLVDILGSAYAAADGDPATAWTAPQRVVQHKTPPTLTL
FT                   ALPRPTVVTGLRLAASRSMLPAHPTVVAINLGDGPQVRQLQVGELTTLWLHPRVTDTVS
FT                   VSLLDWDDVIDRNALGFDQLKPPGLAEVVVLGAGGAPIAPADAARNRARALTVDCDHGP
FT                   VVAVAGRFVHTSIRTTVGALLDGEPVAALPCEREPIALPAGQQELLISPGAAFVVDGAQ
FT                   LSTPGAGLSSATVTSAETGAWGPTHREVRVPESATSRVLVVPESINSGWVARTSTGARL
FT                   TPIAVNGWQQAWVVPAGNPGTITLTFAPNSLYRASLAIGLALLPLLALLAFWRTGRRQL
FT                   ADRPTPPWRPGAWAAAGVLAAGAVIASIAGVMVMGTALGVRYALRRRERLRDRVTVGLA
FT                   AGGLILAGAALSRHPWRSVDGYAGNWASVQLLALISVSVVAASVVATSESRGQDRMQ"
FT   CDS_pept        complement(314928..315101)
FT                   /transl_table=11
FT                   /gene="BCG_0274c"
FT                   /locus_tag="BCG_0274c"
FT                   /product="Small secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0274c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70258"
FT                   /db_xref="GOA:A0A0H3MA35"
FT                   /db_xref="InterPro:IPR022566"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MA35"
FT                   /protein_id="CAL70258.1"
FT                   /translation="MNRIVAPAAASVVVGLLLGAAAIFGVTLMVQQDKKPPLPGGDPSS
FT                   SVLNRVEYGNRS"
FT   CDS_pept        315216..316382
FT                   /transl_table=11
FT                   /gene="lpqI"
FT                   /locus_tag="BCG_0275"
FT                   /product="Probable conserved lipoprotein lpqI"
FT                   /note="Differs from Rv0237 by 1aa, L129V"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0275"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70259"
FT                   /db_xref="GOA:A0A0H3M1P5"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0A0H3M1P5"
FT                   /protein_id="CAL70259.1"
FT                   /translation="MAFPRTLAILAAAAALVVACSHGGTPTGSSTTSGASPATPVAVPV
FT                   PRSCAEPAGIPALLSPRDKLAQLLVVGVRDAADAQAVVTNYHVGGILIGSDTDLTIFDG
FT                   ALAEIVAGGGPLPLAVSVDEEGGRLSRLRSLIGGTGPSARELAQTRTVQQVRDLARDRG
FT                   RQMRKLGITIDFAPVVDVTDAPDDTVIGDRSFGSDPATVTAYAGAYAQGLRDAGVLPVL
FT                   KHFPGHGRGSGDSHNGGVTTPPLDDLVGDDLVPYRTLVTQAPVGVMVGHLQVPGLTGSE
FT                   PASLSKAAVNLLRTGTGYGAPPFDGPVFSDDLSGMAAISDRFGVSEAVLRTLQAGADIA
FT                   LWVTTKEVPAVLDRLEQALRAGELPMSAVDRSVVRVATMKGPNPGCGR"
FT   CDS_pept        316458..317072
FT                   /transl_table=11
FT                   /gene="BCG_0276"
FT                   /locus_tag="BCG_0276"
FT                   /product="Possible transcriptional regulatory protein
FT                   (probably tetR-family)"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0276"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70260"
FT                   /db_xref="GOA:A0A0H3M110"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M110"
FT                   /protein_id="CAL70260.1"
FT                   /translation="MAGGTKRLPRAVREQQMLDAAVQMFSVNGYHETSMDAIAAEAQIS
FT                   KPMLYLYYGSKEDLFGACLNREMSRFIDALRSSINFDQSPKDLLRNTIVSFLRYIDANR
FT                   ASWIVMYTQATSSQAFAHTVREGREQIVQLVAELVRAGTRGPLTDAEIEMMAVALVGAG
FT                   EAVATRLGIGDTDVDEAAEMMINLFWLGLKGAPVDRLETGH"
FT   CDS_pept        317134..317367
FT                   /transl_table=11
FT                   /gene="BCG_0277"
FT                   /locus_tag="BCG_0277"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0277"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70261"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7K5"
FT                   /protein_id="CAL70261.1"
FT                   /translation="MIRTQVQLPDELYRDAKRVAHEHEMTLAEVVRRGLEHMVRIYPRR
FT                   DAASDTWQPPTPRRLGPFRASEETWRELANEA"
FT   CDS_pept        317375..317812
FT                   /transl_table=11
FT                   /gene="BCG_0278"
FT                   /locus_tag="BCG_0278"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Differs from Rv0240 by 1aa, S31A"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0278"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70262"
FT                   /db_xref="GOA:A0A0H3M2V6"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR006226"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2V6"
FT                   /protein_id="CAL70262.1"
FT                   /translation="MLSIDTNILLYAQNRDCPEHDAAAAFLVECSGRADVAVCELVLME
FT                   LYQLLRNPTVVTRPLEGPEAAEVCQTFRRNRRWALLENAPVMNEVWVLAATPRIARRRL
FT                   FDARLALTLRHHGVDEFATRNINGFTDFGFSRVWDPITSDG"
FT   CDS_pept        complement(317842..318684)
FT                   /transl_table=11
FT                   /gene="BCG_0279c"
FT                   /locus_tag="BCG_0279c"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0279c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70263"
FT                   /db_xref="GOA:A0A0H3MA39"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR003965"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MA39"
FT                   /protein_id="CAL70263.1"
FT                   /translation="MTQPSGLKNLLRAAAGALPVVPRTDQLPNRTVTVEELPIDPANVA
FT                   AYAAVTGLRYGNQVPLTYPFALTFPSVMSLVTGFDFPFAAMGAIHTENHITQYRPIAVT
FT                   DAVGVRVRAENLREHRRGLLVDLVTNVSVGNDVAWHQVTTFLHQQRTSLSGEPKPPPQK
FT                   KPKLPPPAAVLRITPAKIRRYAAVGGDHNPIHTNPIAAKLFGFPTVIAHGMFTAAAVLA
FT                   NIEARFPDAVRYSVRFAKPVLLPATAGLYVAEGDGGWDLTLRNMAKGYPHLTATVRGL"
FT   CDS_pept        complement(318695..320059)
FT                   /transl_table=11
FT                   /gene="fabG4"
FT                   /locus_tag="BCG_0280c"
FT                   /product="Probable 3-oxoacyl-[acyl-carrier protein]
FT                   reductase fabG4"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0280c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70264"
FT                   /db_xref="GOA:A0A0H3M1P9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1P9"
FT                   /protein_id="CAL70264.1"
FT                   /translation="MAPKRSSDLFSQVVNSGPGSFLARQLGVPQPETLRRYRAGEPPLT
FT                   GSLLIGGAGRVVEPLRAALEKDYDLVGNNLGGRWADSFGGLVFDATGITEPAGLKGLHE
FT                   FFTPVLRNLGRCGRVVVVGGTPEAAASTNERIAQRALEGFTRSLGKELRRGATTALVYL
FT                   SPDAKPAATGLESTMRFLLSAKSAYVDGQVFSVGADDSTPPADWEKPLDGKVAIVTGAA
FT                   RGIGATIAEVFARDGAHVVAIDVESAAENLAETASKVGGTALWLDVTADDAVDKISEHL
FT                   RDHHGGKADILVNNAGITRDKLLANMDDARWDAVLAVNLLAPLRLTEGLVGNGSIGEGG
FT                   RVIGLSSIAGIAGNRGQTNYATTKAGMIGITQALAPGLAAKGITINAVAPGFIETQMTA
FT                   AIPLATREVGRRLNSLLQGGQPVDVAEAIAYFASPASNAVTGNVIRVCGQAMIGA"
FT   CDS_pept        320201..321523
FT                   /transl_table=11
FT                   /gene="fadA2"
FT                   /locus_tag="BCG_0281"
FT                   /product="Probable acetyl-CoA acyltransferase fadA2"
FT                   /EC_number="2.3.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0281"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70265"
FT                   /db_xref="GOA:A0A0H3M116"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M116"
FT                   /protein_id="CAL70265.1"
FT                   /translation="MAPAAKNTSQTRRRVAVLGGNRIPFARSDGAYADASNQDMFTAAL
FT                   SGLVDRFGLAGERLDMVVGGAVLKHSRDFNLMRECVLGSELSPYTPAFDLQQACGTGLQ
FT                   AAIAAADGIAAGRYEVAAAGGVDTTSDPPIGLGDDLRRTLLKLRRSRSNVQRLKLVGTL
FT                   PASLGVEIPANSEPRTGLSMGEHAAVTAKQMGIKRVDQDELAAASHRNMADAYDRGFFD
FT                   DLVSPFLGLYRDDNLRPNSSVEKLATLRPVFGVKAGDATMTAGNSTPLTDGASVALLAS
FT                   EQWAEAHSLAPLAYLVDAETAAVDYVNGNDGLLMAPTYAVPRLLARNGLSLQDFDFYEI
FT                   HEAFASVVLAHLAAWESEEYCKRRLGLDAALGSIDRSKLNVNGSSLAAGHPFAATGGRI
FT                   LAQTAKQLAEKKAAKKGGGPLRGLISICAAGGQGVAAILEA"
FT   CDS_pept        complement(321829..323664)
FT                   /transl_table=11
FT                   /gene="fadE5"
FT                   /locus_tag="BCG_0282c"
FT                   /product="Probable acyl-CoA dehydrogenase fadE5"
FT                   /EC_number="1.3.99.-"
FT                   /note="Differs from Mb0250c by 1aa, N503D and from Rv0244c
FT                   by 3aa, R394K, A479E, N503D"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0282c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70266"
FT                   /db_xref="GOA:A0A0H3M7K8"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR034188"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7K8"
FT                   /protein_id="CAL70266.1"
FT                   /translation="MSHYRSNVRDQVFNLFEVLGVDKALGHGEFSDVDVDTARDMLAEV
FT                   SRLAEGPVAESFVEGDRNPPVFDPKTHSVMLPESFKKSVNAMLEAGWDKVGIDEALGGM
FT                   PMPKAVVWALHEHILGANPAVWMYAGGAGFAQILYHLGTEEQKKWAVLAAERGWGSTMV
FT                   LTEPDAGSDVGAARTKAVQQADGSWHIDGVKRFITSGDSGDLFENIFHLVLARPEGAGP
FT                   GTKGLSLYFVPKFLFDVETGEPGERNGVFVTNVEHKMGLKVSATCELAFGQHGVPAKGW
FT                   LVGEVHNGIAQMFEVIEQARMMVGTKAIATLSTGYLNALQYAKSRVQGADLTQMTDKTA
FT                   PRVTITHHPDVRRSLMTQKAYAEGLRALYLYTATFQDAAVAEVVHGVDAKLAVRVNDLM
FT                   LPVVKGVGSEQAYAKLTESLQTLGGSGFLQDYPIEQYIRDAKIDSLYEGTTAIQAQDFF
FT                   FRKIVRDKGVALAHVSGQIQAFVDSGAGNGRLKTERALLAKALTNVQGMAAALTGYLMA
FT                   AQQDVTSLYKVGLGSVRFLMSVGDLIIGWLLQRQAAVAVAALDAGATGDERSFYEGKVA
FT                   VASFFAKNFLPLLTSTREVIETLDNDIMELDEAAF"
FT   CDS_pept        324036..324524
FT                   /transl_table=11
FT                   /gene="BCG_0283"
FT                   /locus_tag="BCG_0283"
FT                   /product="Putative oxidoreductase"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0283"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70267"
FT                   /db_xref="GOA:A0A0H3M2W1"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2W1"
FT                   /protein_id="CAL70267.1"
FT                   /translation="MNSTNNLTPSSLREAFGHFPTGVVAIAAEVDGVRQGLAASTFVPV
FT                   SLEPPLVSFCVQNTSTTWPKLTGVPMLGISVLGEAHDAAVRTLAAKTGDRFAGLETVSN
FT                   DAGAVFIKGTSVWLESAIEQLVPAGDHTIVVLRVNQVKVDPNVAPIVFHRSVLRRLGV"
FT   CDS_pept        324840..326150
FT                   /transl_table=11
FT                   /gene="BCG_0284"
FT                   /locus_tag="BCG_0284"
FT                   /product="Probable conserved integral membrane protein"
FT                   /note="Differs from Rv0246 by 1aa, A129V"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0284"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70268"
FT                   /db_xref="GOA:A0A0H3MA41"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MA41"
FT                   /protein_id="CAL70268.1"
FT                   /translation="MAKTSHRVSSADGMSKRILRLIIAQSGFYSAALQLGNVSIVLPFV
FT                   VAELDAELWIAALIFPAFTAGGAIGNVVAPPAVAAVPRRHRLFIIVSCLAVLAGVNALC
FT                   ATIGKGSVAGILLVVNVTLIGVVSAISFVAFADLVAAMPSGTARARILLTEVGVGAALT
FT                   AVVAATLSFVPDQHPLSRNIHLLWTAAVAMAISAAICRALPHRIVPRVHAAPGLHKLVY
FT                   VGWTAIRTNGWYRRYLLVQVLFGSVVLGSSFHSIRVAAVPGDQPDEVVAVVLFVCVGLL
FT                   GGIALWNRVRERFGLVGLFVGSALVSIAAAVLSIAFDLAGAWPNVVAIGLVIALVSIAN
FT                   QSVFTAGQLWIARDAEPGLRTSLISFGQLVINAGLVGMGLALGLIAQDHDAVWPVMIVL
FT                   LLNLTAAYSATRFAPAKSVDVRGLPQVSRTSRPKTGG"
FT   CDS_pept        complement(326147..326893)
FT                   /transl_table=11
FT                   /gene="BCG_0285c"
FT                   /locus_tag="BCG_0285c"
FT                   /product="Probable succinate dehydrogenase [iron-sulfur
FT                   subunit]"
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0285c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70269"
FT                   /db_xref="GOA:A0A0H3M1Q4"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1Q4"
FT                   /protein_id="CAL70269.1"
FT                   /translation="MTYSASMRVWRGDESCGELREFTVEVNEGEVVLDVILRLQQTQTP
FT                   DLAVRWNCKAGKCGSCSAEINGKPRLMCMTRMSTFDEDEIVTVTPMRTFPVIRDLVTDV
FT                   SFNYQKAREIPSFAPPKELQPSEYRMAQVDVARSQEFRKCIECFLCQNVCHVVRDHEEN
FT                   KDAFAGPRFLMRIAELEMHPLDTRDRRSQAQEEHGLGYCNITKCCTEVCPENIKITDNA
FT                   LIPMKERVADRKYDPVVWLGSKLFRR"
FT   CDS_pept        complement(326894..328834)
FT                   /transl_table=11
FT                   /gene="BCG_0286c"
FT                   /locus_tag="BCG_0286c"
FT                   /product="Probable succinate dehydrogenase [iron-sulfur
FT                   subunit]"
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0286c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70270"
FT                   /db_xref="GOA:A0A0H3M121"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M121"
FT                   /protein_id="CAL70270.1"
FT                   /translation="MVEVERHSYDVVVIGAGGAGLRAVIEARERGLKVAVVCKSLFGKA
FT                   HTVMAEGGCAAAMGNANPKDNWKTHFGDTMRGGKFLNNWRMAELHAKEAPDRVWELETY
FT                   GALFDRTDDGRISQRNFGGHTYPRLAHVGDRTGLELIRTLQQKVVSLQQEDHAELGDYE
FT                   ARIKVFAECTITELLKDQGAIAGAFGYWRESGRFIVFEAPAVVLATGGIGKSFKVTSNS
FT                   WEYTGDGHALALRAGATLINMEFVQFHPTGMVWPPSVKGILVTEGVRGDGGVLKNSENS
FT                   RFMFDYIPPVFKGQYAETEEEADQWLKDNDSARRTPDLLPRDEVARAINSEVKAGRGTP
FT                   HGGVYLDIASRLTPAEIKRRLPSMYHQFKELAEVDITTQAMEVGPTCHYVMGGVEVDAD
FT                   TGAATVPGLFAAGECAGGMHGSNRLGGNSLSDLLVFGRRAGLGAADYVRALSSRPAVSA
FT                   EAIDAAAQQALSPFEGPKDGSAPENPYALHMDLQYVMNDLVGIIRNADEISRALTLLAE
FT                   LWSRYHNVLVEGHRQYNPGWNLSIDLRNMLLVSECVARAALQRTESRGGHTRDDHPGMD
FT                   PNWRRILLVCRATETMGTGGSGSGDSNCHINVTQQLQTPMRPDLLELFEISELEKYYTD
FT                   EELAEHPGRRG"
FT   CDS_pept        complement(328865..329686)
FT                   /transl_table=11
FT                   /gene="BCG_0287c"
FT                   /locus_tag="BCG_0287c"
FT                   /product="Putative succinate dehydrogenase [membrane anchor
FT                   subunit]"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0287c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70271"
FT                   /db_xref="GOA:A0A0H3M7L3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7L3"
FT                   /protein_id="CAL70271.1"
FT                   /translation="MSAPTANRPAIGVFTPTRAQIPERTLRTDLWWLPPLLTNLGLLAF
FT                   ICYATTRAFWGSQYWVEKYHYLTPFYSPCVSASCQPGASHLGVWFGHFPGWIPLGAMVL
FT                   PFLLGFRLTCYYYRKAYYRSVWQSPTSCAVPEPRAHYTGETRLPLIVQNTHRYFFYIAV
FT                   VVSLINTYDAIAAFHSPSGFGFGLGNVILTINVVLLWAYTISCHSCRHATGGRLKHFSK
FT                   HPVRYWIWTQVSKLNTRHMQFAWITLGTLALTDFYIMLVASGSITDLRFIG"
FT   CDS_pept        complement(329766..330059)
FT                   /transl_table=11
FT                   /gene="BCG_0288c"
FT                   /locus_tag="BCG_0288c"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0288c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70272"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2W6"
FT                   /protein_id="CAL70272.1"
FT                   /translation="MSTTAELAELHDLVGGLRRCVTALKARFGDNPATRRIVIDADRIL
FT                   TDIELLDTDVSELDLERAAVPQPSEKIAIPDTEYDREFWRDVDDEGVGGHRY"
FT   CDS_pept        complement(330204..330683)
FT                   /transl_table=11
FT                   /gene="hsp"
FT                   /locus_tag="BCG_0289c"
FT                   /standard_name="hsp 20; hrpA; acr2"
FT                   /product="Heat shock protein hsp"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0289c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70273"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MA45"
FT                   /protein_id="CAL70273.1"
FT                   /translation="MNNLALWSRPVWDVEPWDRWLRDFFGPAATTDWYRPVAGDFTPAA
FT                   EIVKDGDDAVVRLELPGIDVDKDVNVELDPGQPVSRLVIRGEHRDEHTQDAGDKDGRTL
FT                   REIRYGSFRRSFRLPAHVTSEAIAASYDAGVLTVRVAGAYKAPAETQAQRIAITK"
FT   CDS_pept        330897..333458
FT                   /transl_table=11
FT                   /gene="nirB"
FT                   /locus_tag="BCG_0290"
FT                   /product="Probable nitrite reductase [NAD(P)H] large
FT                   subunit [fad flavoprotein] nirB"
FT                   /EC_number="1.7.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0290"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70274"
FT                   /db_xref="GOA:A0A0H3M1Q9"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1Q9"
FT                   /protein_id="CAL70274.1"
FT                   /translation="MPTAGSSRAPAAAREIVVVGHGMVGHRLVEAVRARDADGSLRITV
FT                   LAEEGDAAYDRVGLTSYTESWDRALLALPGNDYAGDQRVRLLLNTRVTQIDRATKSVVT
FT                   AAGQRHRYDTLVLATGSYAFVPPVPGHDLPACHVYRTFDDLDAIRAGAQRTLDGGHTDG
FT                   GVVIGGGLLGLEAANALRQFGLQTHVVEMMPRLMAQQIDEAGGALLARMIADLGIAVHV
FT                   GTGTESIESVKHSDGSVWARVRLSDGEVIDAGVVIFAAGIRPRDELARAAGLAIGDRGG
FT                   VLTDLSCRTSDPDIYAVGEVAAIDGRCYGLVGPGYTSAEVVADRLLDGSAEFPEADLST
FT                   KLKLLGVDVASFGDAMGATENCLEVVINDAVKRTYAKLVLSDDATTLLGGVLVGDASSY
FT                   GVLRPMVGAELPGDPLALIAPAGSGAGAGALGVGALPDSAQICSCNNVTKGELKCAIAD
FT                   GCGDVPALKSCTAAGTSCGSCVPLLKQLLEAEGVEQSKALCEHFSQSRAELFEIITATE
FT                   VRTFSGLLDRFGRGKGCDICKPVVASILASTGSDHILDGEQASLQDSNDHFLANIQKNG
FT                   SYSVVPRVPGGDIKPEHLILIGQIAQDFGLYTKITGGQRIDLFGARVDQLPLIWQRLVD
FT                   GGMESGHAYGKAVRTVKSCVGSDWCRYGQQDSVQLAIDLELRYRGLRAPHKIKLGVSGC
FT                   ARECAEARGKDVGVIATEKGWNLYVAGNGGMTPKHAQLLASDLDKETLIRYIDRFLIYY
FT                   IRTADRLQRTAPWVESLGLDHVREVVCEDSLGLAEEFEAAMQRHVANYKCEWKGVLEDP
FT                   DKLSRFVSFVNAPDAVDSTVTFTERAGRKVPVSIGIPRVRS"
FT   CDS_pept        333484..333840
FT                   /transl_table=11
FT                   /gene="nirD"
FT                   /locus_tag="BCG_0291"
FT                   /product="Probable nitrite reductase [NAD(P)H] small
FT                   subunit nirD"
FT                   /EC_number="1.7.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0291"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70275"
FT                   /db_xref="GOA:A0A0H3M125"
FT                   /db_xref="InterPro:IPR012748"
FT                   /db_xref="InterPro:IPR017881"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M125"
FT                   /protein_id="CAL70275.1"
FT                   /translation="MTLLNDIQVWTTACAYDHLIPGRGVGVLLDDGSQVALFRLDDGSV
FT                   HAVGNVDPFSGAAVMSRGIVGDRGGRAMVQSPILKQAFALDDGSCLDDPRVSVPVYPAR
FT                   VTPEGRIQVARVAV"
FT   CDS_pept        complement(333856..334380)
FT                   /transl_table=11
FT                   /gene="cobU"
FT                   /locus_tag="BCG_0292c"
FT                   /product="Putative bifunctional cobalamin biosynthesis
FT                   protein cobU: cobinamide kinase + cobinamide phosphate
FT                   guanylyltransferase"
FT                   /EC_number="2.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0292c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70276"
FT                   /db_xref="GOA:A0A0H3M7L6"
FT                   /db_xref="InterPro:IPR003203"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7L6"
FT                   /protein_id="CAL70276.1"
FT                   /translation="MRILVTGGVRSGKSTHAEALLGDAADVVYVAPGRPAAGSDPDWDA
FT                   RVALHRARRPPTWLTVETADVATALSEARSPVLVDCLGTWLTAIMDGEALWSAATADVY
FT                   AVLEARLDGLCAALTGLPTAIVVTNEVGLGVVPSHSSGVLFRDLLGTINRRVAAVCDEV
FT                   HLVIAGRVLKL"
FT   CDS_pept        complement(334405..335889)
FT                   /transl_table=11
FT                   /gene="cobQ1"
FT                   /locus_tag="BCG_0293c"
FT                   /product="Putative cobyric acid synthase cobQ1"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0293c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70277"
FT                   /db_xref="GOA:A1KF76"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KF76"
FT                   /protein_id="CAL70277.1"
FT                   /translation="MSGLLVAGTTSDAGKSAVTAGLCRALARRGVRVAPFKAQNMSNNS
FT                   MVCRGPDGTGVEIGRAQWVQALAARTTPEAAMNPVLLKPASDHRSHVVLMGKPWGEVAS
FT                   SSWCAGRRALAEAACRAFDALAARYDVVVAEGAGSPAEINLRAGDYVNMGLARHAGLPT
FT                   IVVGDIDRGGVFAAFLGTVALLAAEDQALVAGFVVNKFRGDSDLLAPGLRDLERVTGRR
FT                   VYGTLPWHPDLWLDSEDALDLQGRRAAGTGARRVAVVRLPRISNFTDVDALGLEPDLDV
FT                   VFASDPRALDDADLIVLPGTRATIADLAWLRARDLDRALLVHVAAGKPLLGICGGFQML
FT                   GRVIRDPYGIEGPGGQVTEVEGLGLLDVETAFSPHKVLRLPRGEGLGVPASGYEIHHGR
FT                   ITRGDTAEEFLGGARDGPVFGTMWHGSLEGDALREAFLRETLGLAPSGSCFLAARERRL
FT                   DLLGDLVERHLDVDALLNLARHGCPPTLPFLAPGAP"
FT   CDS_pept        complement(335908..337578)
FT                   /transl_table=11
FT                   /gene="PPE2"
FT                   /locus_tag="BCG_0294c"
FT                   /product="PPE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0294c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70278"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2X1"
FT                   /protein_id="CAL70278.1"
FT                   /translation="MTAPIWMASPPEVHSALLSSGPGPGPLLVSAEGWHSLSIAYAETA
FT                   DELAALLAAVQAGTWDGPTAAVYVAAHTPYLAWLVQASANSAAMATRQETAATAYGTAL
FT                   AAMPTLAELGANHALHGVLMATNFFGINTIPIALNESDYARMWIQAATTMASYQAVSTA
FT                   AVAAAPQTTPAPQIVKANAPTAASDEPNQVQEWLQWLQKIGYTDFYNNVIQPFINWLTN
FT                   LPFLQAMFSGFDPWLPSLGNPLTFLSPANIAFALGYPMDIGSYVAFLSQTFAFIGADLA
FT                   AAFASGNPATIAFTLMFTTVEAIGTIITDTIALVKTLLEQTLALLPAALPLLAAPLAPL
FT                   TLAPASAAGGFAGLSGLAGLVGIPPSAPPVIPPVAAIAPSIPTPTPTPAPAPAPTAVTA
FT                   PTPPPGPPPPPVTAPPPVTGAGIQSFGYLVGDLNSAAQARKAVGTGVRKKTPEPDSAEA
FT                   PAAAAAPEEQVQPQRRRRPKIKQLGRGYEYLDLDPETGHDPTGSPQGAGTLGFAGTTHK
FT                   ASPGQVAGLITLPNDAFGGSPRTPMMPGTWDTDSATRVE"
FT   CDS_pept        337886..338104
FT                   /transl_table=11
FT                   /gene="BCG_0295"
FT                   /locus_tag="BCG_0295"
FT                   /product="Conserved hypothetical protein"
FT                   /note="In Mycobacterium bovis BCG Pasteur, and
FT                   Mycobacterium bovis, a single base transition (c-t) leads
FT                   to a truncated product in the 5' direction compared to
FT                   Mycobacterium tuberculosis strain H37Rv (72 aa versus 124
FT                   aa)"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0295"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70279"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MA50"
FT                   /protein_id="CAL70279.1"
FT                   /translation="MQSVDLHVERHLPSRGRSHRTVATVTCVTALGDIRSAQLSATGAW
FT                   PAVLFPSWSWLCGIGGGVDLQKPSCRA"
FT   CDS_pept        complement(338325..338780)
FT                   /transl_table=11
FT                   /gene="BCG_0296c"
FT                   /locus_tag="BCG_0296c"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0296c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70280"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041678"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1R6"
FT                   /protein_id="CAL70280.1"
FT                   /translation="MARSQEPSRGLLDPVAKMLRLPFGTPDFIEKIVTGSVNQVGRRTL
FT                   YVLITTWDAAGGGPFAASAIATTGLAKTAEIVQSMFIGPVFNPLLKMLGADKIAIRASL
FT                   CAAQLVGLGIMRYGVRSEPLHSMSVEMLVDAIGPTMQRYLVGDIGRG"
FT   CDS_pept        complement(338805..339548)
FT                   /transl_table=11
FT                   /gene="BCG_0297c"
FT                   /locus_tag="BCG_0297c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Differs from Rv0259c by 1aa, V182A"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0297c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70281"
FT                   /db_xref="GOA:A0A0H3M130"
FT                   /db_xref="InterPro:IPR002762"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M130"
FT                   /protein_id="CAL70281.1"
FT                   /translation="MNLILTAHGTRRPSGVAMIADIAAQVSALVDRTVQVAFVDVLGPS
FT                   PSEVLSALSCRPAIVVPAFLSRGYHVRTDLPAHVAASAHPHVTVTPALGPCREIAQIVT
FT                   QQLVESGWRPGDSVILAAAGASDRRARADLHTTRTLVSELTGSWVDMGFAGTGGPDVRT
FT                   AVQRARDRAEANRGARRVVVASFLLAEGLFQERLRASGADVVTRPLGTHPGLAQLVANR
FT                   FRSAVARQQRLHRWHGTPTPVTLDL"
FT   CDS_pept        complement(339545..340690)
FT                   /transl_table=11
FT                   /gene="BCG_0298c"
FT                   /locus_tag="BCG_0298c"
FT                   /product="Posible transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0298c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70282"
FT                   /db_xref="GOA:A0A0H3M7M0"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7M0"
FT                   /protein_id="CAL70282.1"
FT                   /translation="MAQAHSAPLTGYRIAVTSARRAEELCALLRRQGAEVCSAPAIKMI
FT                   ALPDDDELQNNTEALIADPPDILVAHTGIGFRGWLAAAEGWGLANELLESLSSARIISR
FT                   GPKATGALRAAGLREEWSPDSESSHEVLEYLLESGVSRTRIAVQLHGAADSWDPFPEFL
FT                   GGLRFAGAQVVPIRVYRWKPAPLGGVFDHLVTGIARRQFDAVTFTSAPAAAAVLERSRE
FT                   LDIEDQLLAALRTDVHAMCVGPVTSRPLIRKGVPTSAPERMRLGALARHIAEELPLLGS
FT                   CTFKAAGHVIEIRGTSVLVDDSVKPLSPSGMAILRALVHRPGGVVSRGDLLRVLPGDGS
FT                   DTHAVDTAVLRLRTALGDKNIVATVVKRGYRLAVDSRHDDV"
FT   CDS_pept        complement(340790..342199)
FT                   /transl_table=11
FT                   /gene="narK3"
FT                   /locus_tag="BCG_0299c"
FT                   /product="Probable integral membrane nitrite extrusion
FT                   protein narK3"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0299c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70283"
FT                   /db_xref="GOA:A0A0H3M2X6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2X6"
FT                   /protein_id="CAL70283.1"
FT                   /translation="MGRSHQISDWDPEDSVAWEAGNKFIARRNLIWSVAAEHVGFSVWS
FT                   LWSVMVLFMPTSVYGFSAGDKFLLGATATLVGACLRFPYTFATAKFGGRNWTIFSALVL
FT                   LIPTVGSILLLANPGLPLWPYLVCGALAGLGGGNFAASMTNINAFFPQRLKGAALALNA
FT                   GGGNLGVPMVQLVGLLVIATAGDREPYWVCAIYLVLLAVAGLGAALYMDNLTEYRIELN
FT                   TMRAVVSEPHTWVISLLYIGTFGSFIGFSFAFGQVLQINFIASGQSTAQASLHAAQIAF
FT                   LGPLLGSLSRIYGGKLADRIGGGRVTLAAFCAMLLATGILISASTFGDHLAGPMPTATM
FT                   VGYVIGFTALFILSGIGNGSVYKMIPSIFEARSHSLQISEAERRQWSRSMSGALIGLAG
FT                   AVGALGGVGVNLALRESYLTSGTATSAFWAFGVFYLVASVLTWAIYVRRGLKSAGELVP
FT                   ATTAPAGLAYV"
FT   CDS_pept        complement(342340..342885)
FT                   /transl_table=11
FT                   /gene="aac"
FT                   /locus_tag="BCG_0300c"
FT                   /standard_name="aac(2')-IC"
FT                   /product="Aminoglycoside 2'-n-acetyltransferase aac"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0300c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70284"
FT                   /db_xref="GOA:A0A0H3MA55"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MA55"
FT                   /protein_id="CAL70284.1"
FT                   /translation="MHTQVHTARLVHTADLDSETRQDIRQMVTGAFAGDFTETDWEHTL
FT                   GGMHALIWHHGAIIAHAAVIQRRLIYRGNALRCGYVEGVAVRADWRGQRLVSALLDAVE
FT                   QVMRGAYQLGALSSSARARRLYASRGWLPWHGPTSVLAPTGPVRTPDDDGTVFVLPIDI
FT                   SLDTSAELMCDWRAGDVW"
FT   CDS_pept        complement(342895..343797)
FT                   /transl_table=11
FT                   /gene="BCG_0301c"
FT                   /locus_tag="BCG_0301c"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0301c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70285"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1S1"
FT                   /protein_id="CAL70285.1"
FT                   /translation="MTTLEILRSGPLALVEDLGRAGLAHLGVGRSGAADRRSHTLANRL
FT                   VANPDDWATVEVTFGGFSARVRGGDVDIAVTGADTDPTVNGIMVGTNSIHHVRDGQVIS
FT                   LGTPRAGLRTYLAVRGGVCVEPVLGSRSYDVMSAIGPSPLRAGDVLPVGEHTDDYPELD
FT                   QAPVAAIEEHLVELRVVPGPRDDWLVDPDALVHTIWMASNRSDRVGMRLQGRPLQHRWP
FT                   DRQLPGEGVTRGAIQVPPNGLPVILGPDHPITGSYPVVGVITDEDIDKVAQIRPGQYVR
FT                   LHWARPRSRLPGQGVTQAW"
FT   CDS_pept        complement(343814..344446)
FT                   /transl_table=11
FT                   /gene="BCG_0302c"
FT                   /locus_tag="BCG_0302c"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0302c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70286"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M134"
FT                   /protein_id="CAL70286.1"
FT                   /translation="MDAALACTVLDYGDHALMLQCDSTADAMAWTDALRAAALPGVVDI
FT                   VAASRTVLVKLDAPRYQGVTRQRLRRLRVTPEAVAAADHRCDLVIDVVYDGPDLAEVAR
FT                   CTGLTTAAVINAHTATGWRAGFSGSAPGFAYLIDGDPSLRVPRRPERRTSMPPGSVALA
FT                   DGFSAIYPSQAPSDWQIIGHTDAVLWDVDRPQPALLTPGMWVQFRAA"
FT   CDS_pept        complement(344542..345534)
FT                   /transl_table=11
FT                   /gene="BCG_0303c"
FT                   /locus_tag="BCG_0303c"
FT                   /product="Probable periplasmic iron-transport lipoprotein"
FT                   /note="Differs from Rv0265c and Mb0271c by 1aa, C313Y"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0303c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70287"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7M5"
FT                   /protein_id="CAL70287.1"
FT                   /translation="MRQGCSRRGFLQVAEAAAATGLFAGCSSPKPPPGTPGGAAVTITH
FT                   LFGQTVIKEPPKRVVSAGYTEQDDLLAVDVVPIAVTDWFGDQPFAVWPWAAPKLGGARP
FT                   AVLNLDNGIQIDRIAALKPDLIVAINAGVDADTYQQLSAIAPTVAQSGGDAFFEPWKDQ
FT                   ARSIGQAVFAADRMRSLIEAVDQKFAAVAQRHPRWRGKKALLLQGRLWQGNVVATLAGW
FT                   RTDFLNDMGLVIADSIKPFAVDQRGVIPRDHIKAVLDAADVLIWMTESPEDEKALLADP
FT                   EIAASQATAQRRHIFTSKEQAGAIAFSSVLSCPVVAEQLPPQISQILGA"
FT   CDS_pept        complement(345556..349185)
FT                   /transl_table=11
FT                   /gene="oplA"
FT                   /locus_tag="BCG_0304c"
FT                   /product="Probable 5-oxoprolinase oplA"
FT                   /EC_number="3.5.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0304c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70288"
FT                   /db_xref="GOA:A0A0H3M2Y2"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2Y2"
FT                   /protein_id="CAL70288.1"
FT                   /translation="MVGAGWHFWVDRGGTFTDVVARRPDGRLLTHKLLSDNPARYRDAA
FT                   VAGIRALLANGEAGTRVDAVRMGTTVATNALLERTGERTLLVITRGFGDALRIAYQNRP
FT                   RIFDRRIVLPEMLYERVVEVDERVTADGRVLRAPDLEALGEKMRQAHADGIRAVAVVCL
FT                   HSYLYPGHEREIGTLAQRIGFAQISLSSEVSPLMKLVPRGDTTVVDAYLSPVLRRYINQ
FT                   VADQMRGVRLMFMQSNGGLAQAGHFRGKDAILSGPAGGIVGMVRMSALAGFDHVIGFDM
FT                   GGTSTDVSHYAGEYERVFTTQVAGVRLRAPMLDIHTVAAGGGSILHFDGSRYRVGPDSA
FT                   GADPGPACYRGGGPLCVTDANVMLGRIQPTHFPSVFGPSGDQPLDAGTVRRGFTDLAAD
FT                   IAARTGDDRSPEQVAEGYLRIAVANMANAVKKISVQKGHDVTRYALTTFGGAGGQHACA
FT                   VADALGIRTVLIPPMAGVLSALGIGLADTTAMREQSVEIPLGPAAPQRLASVAESLERA
FT                   ARAELLDEGVPGERIRVVRRVHLRYEGTDTAIPVQLAEIETMATAFESSHRALYTFLLD
FT                   RPLIAEAISVEATGLTDQPDLSQLGDQANDTTGSSETVRIYSNGLWRDAPLRRREAMRP
FT                   GDVLTGPAIIAEANATTVVDDGWQATMTETGHLLAQRVVTPPRPDAATRAGFEAGFEAD
FT                   PVLLEIFNNLFMSIAEQMGFRLEATAQSVNIRERLDFSCALFDPDGNLVANAPHIPVHL
FT                   GSMGTTVKEVIRRRLSGMKPGDVYAVNDPYHGGTHLPDITVITPVFNTGGEDVLFFVAS
FT                   RGHHAEIGGITPGSMPADSREIHEEGVLFDNWLLAENGRFREAETRRLLTEAPFGSRNP
FT                   DTNLADLRAQIAANQKGVDEVGKMIDHFGRDVVAAYMRHVQDNAEEAVRRVIDRLDNGA
FT                   YRYRMDSGATIAVRITVDRAARSATIDFTGTSAQLDTNFNAPTSVVNAAVLYVFRTLVA
FT                   DDIPLNDGCLRPLRIVVPEGSMLAPTHPAAVVAGNVETSQAITGALFAALGVQAEGSGT
FT                   MNNVTFGNERHQYYETVGSGSGAGDGYHGASVVQTHMTNSRLTDPEVLEWRYPVLLREF
FT                   AVRQGSGGAGRWRGGDGAVRRLEFTEPMTVSTLSGHRRVRPYGMAGGSPGELGRNRVER
FT                   ADGSTVELAGCGSTHVEPGDTLVIETPGGGGYGPASTSARRRR"
FT   CDS_pept        349362..350753
FT                   /transl_table=11
FT                   /gene="narU"
FT                   /locus_tag="BCG_0305"
FT                   /product="Putative integral membrane nitrite extrusion
FT                   protein narU"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0305"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70289"
FT                   /db_xref="GOA:A0A0H3MA60"
FT                   /db_xref="InterPro:IPR004737"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MA60"
FT                   /protein_id="CAL70289.1"
FT                   /translation="MALTTAPAIDYALPRQQDEGDHWIDDWRPEDPVFWETIGRPIARR
FT                   NLIFSIFAEHVGFSVWMLWSIVVVQMTAAAPGHPAASGWALSASQALCLVAVPSGVGAF
FT                   LRLPYTFAIPIFGGRNWTTVSAALLVIPCLLLAWAVSHPSLPFAVLVVIAATAGFGGGN
FT                   FASSMANISFFYPEKDKGWALGLNAAGGNIGVAVVQKIIPPIVVAGSGVALSRAGLFFV
FT                   PLAVAAAVCAFLFMNNLTEAKADVKPVWQSLRHADTWIMSLLYIGTFGSFIGYSAAFPT
FT                   LLKTVFGRGDIALGWAFLGAGIGSLVRPLGGKLADRIGGARITAASFVMLAAGAAAALW
FT                   SVQSVNLPVFFVSFMFLFVATGIGNGSSYRMISRIFQVKGEVAGGDPETMVNMRRQAAG
FT                   ALGIISSIGAFGGFVVPLAYAWSKVHFGNIEPALHFYVAFFLALLVVTWYCYLRRTTPM
FT                   GQVGV"
FT   CDS_pept        complement(350795..351304)
FT                   /transl_table=11
FT                   /gene="BCG_0306c"
FT                   /locus_tag="BCG_0306c"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0306c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70290"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1S6"
FT                   /protein_id="CAL70290.1"
FT                   /translation="MGTRSKSRTRQLKQSNGCTATTSGASDRRRRARRRTAPAWLREDE
FT                   WLRHHLPHPPRQLSRCLHRRRRSACHHRYSRRTPKGGLPMTSSLVPISEARAHLSRLVR
FT                   ESADDDVVLMNHGRPAAILISAERYESLMEELEDLRDRLSVHEREHVTMPLDKLGAELG
FT                   VDIGRV"
FT   CDS_pept        complement(351369..352562)
FT                   /transl_table=11
FT                   /gene="BCG_0307c"
FT                   /locus_tag="BCG_0307c"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0307c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M140"
FT                   /protein_id="CAL70291.1"
FT                   /translation="MSRMAAPVSLDVHGRQVIVTHPGRVVFPAHNDRKGYTKFDLVRYY
FT                   LAVAEGAMRGVAGRPMILKRFVKGISAEAVFQKRAPANRPDWVDVAELHYASGRSAAEA
FT                   VIHDAAGLAWVINLGCVDLNPHPVLAGDLDHPDELRVDLDPMPGVAWQRVVEVALVVRE
FT                   VLEDYGLTAWPKTSGSRGFHVYARIAPCWSFPQVRLAAQTVAREVERRLPDAATSRWWK
FT                   EEREGVFVDFNQNAKDRTVASAYSVRATPDARVSTPLHWEEVPGCDPAVFTMATVPSRL
FT                   ADIGDPWAGMDDAVGRLDRLLMLAEELGPPQKAQSAKPLIEIARAKTRAEAMAALDIWR
FT                   DRYPGAAALLRPADVLVDGMRGPSSIWYRIRINLQHVPADQRPPQEELIADYSPWPR"
FT   CDS_pept        352598..354280
FT                   /transl_table=11
FT                   /gene="fadD2"
FT                   /locus_tag="BCG_0308"
FT                   /product="Probable fatty-acid-CoA ligase fadD2"
FT                   /EC_number="6.2.1.-"
FT                   /note="Differs from Rv0270 and Mb0276 by 1aa, E112D"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0308"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70292"
FT                   /db_xref="GOA:A0A0H3M7N1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7N1"
FT                   /protein_id="CAL70292.1"
FT                   /translation="MPNLTDLPGQAVSKLQKSIGQYVARGTAELHYLRKIIESGAIGLE
FT                   PPLNYAALAADIRKWGEVGMLPSHNARRAPNRAAVIDEEGTLTFSELDEAAHAVANGLL
FT                   AKGVRAGEGVAILARNHRWFVIANYGAARVGARIILLNSEFSGPQIKEVSDREGAKVII
FT                   YDDEYTKAVSLAQPPLGKLRALGVNPDDDKPSGSSDETLAELIAHSSTAPAPKASRRAS
FT                   IIILTSGTTGTPKGANRNTPPTLAPIGGILSHVPFKAGEVTLLPSPMFHALGYMHAALA
FT                   MFLGSTLVLRRRFKPALVLEDIEKHKATSMVVVPVMLSRILDQLEKTEPKPDLSSLKIV
FT                   FVSGSQLGAELATRALGDLGPVIYNMYGSTEVAFATIAGPKDLQFNPSTVGPVVKGVTV
FT                   KILDENGNEVPQGAVGRIFVGNAFPFEGYTGGGGKQIIDGLLSSGDVGYFDERGLLYVS
FT                   GRDDEMIVSGGENVFPAEVEDLISGHPDVVEAAAIGVDDKEFGARLRAFVVKKPGADLD
FT                   EDTIKQYVRDHLARYKVPREVIFLDELPRNPTGKVLKRELRKL"
FT   CDS_pept        complement(354297..356492)
FT                   /transl_table=11
FT                   /gene="fadE6"
FT                   /locus_tag="BCG_0309c"
FT                   /product="Probable acyl-CoA dehydrogenase fadE6"
FT                   /EC_number="1.3.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0309c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70293"
FT                   /db_xref="GOA:A0A0H3M2Y8"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2Y8"
FT                   /protein_id="CAL70293.1"
FT                   /translation="MSIAITPEHYELADSVRSLVARVAPSEVLHAALESPVENPPPYWQ
FT                   AAAEQGLQGVHLAESVGGQGFGILELAVVLAEFGYGAVPGPFVPSAIASALIAAHDPQA
FT                   KVLAELATGAAIAAYALDSGLTATRHGDVLVIRGEVRAVPAAAQASVLVLPVAIESRDE
FT                   WVVLRNDQLEIEAVKSLDPLRPIAHVRANAVDVSDDALLSNLTMTTAHALMSTLLSAEA
FT                   VGVARWATDTASAYAKIREQFGRPIGQFQAIKHKCAEMIADTERATAAVWDAARALDDA
FT                   GESSSDVEFAAAVAATLAPATAQRCTQDCIQVHGGIGFTWEHDTNVYYRRALMLAACFG
FT                   RGSEYPQRVVDTATTAGMRPVDIDLDPSTEKLRAQIRAEVAALKAMPREPRTVAIAEGG
FT                   WVLPYLPKPWGRAASPVEQIIIAQEFTAGRVKRPQIAIATWIVPSIVAFGTDNQKQRLL
FT                   PPTFRGDIFWCQLFSEPGAGSDLASLATKATRVDGGWRITGQKIWTTGAQYSQWGALLA
FT                   RTDPSAPKHNGITYFLLDMKSEGVQVKPLRELTGKEFFNTVYLDDVFVPDELVLGEVNR
FT                   GWEVSRNTLTAERVSIGGSDSTFLPTLGEFVDFVRDYRFEGQFDQVARHRAGQLIAEGH
FT                   ATKLLNLRSTLLTLAGGDPMAPAAISKLLSMRTGQGYAEFAVSSFGTDAVIGDTERLPG
FT                   KWGEYLLASRATTIYGGTSEVQLNIIAERLLGLPRDP"
FT   CDS_pept        complement(356606..357739)
FT                   /transl_table=11
FT                   /gene="BCG_0310c"
FT                   /locus_tag="BCG_0310c"
FT                   /product="Hypothetical protein"
FT                   /note="Differs from Mb0278c by 1aa, P164L"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0310c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70294"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MA63"
FT                   /protein_id="CAL70294.1"
FT                   /translation="MTGRAATPGVIREFVGLPSRTAGRAAAGGHPCQGLYHHSVGRKPK
FT                   VALIAAHYQIDFSEHYLAEYMAIRGIGFLGWNTRFRGFESSFLLDHALVDIGVGVRWLR
FT                   EVQGVETVVLLGNSGGGSLMAAYQSQAVDPNVTPLDGMRPAAGVTELPAADAYVAAAAH
FT                   PGRPDVLTAWMDAAVIDENDPVATDPELDLFDERNGPPYSPEFISRYRSAQVKRNHTIT
FT                   DWAESELKRVRAAGFSDRPFSVMRTWADPRMVDPSIEPTKRRPNQCYAGTPVKANRSAH
FT                   GIAAACTLRGWLGMWSLRVAQTRAAPHLARITCPALVLNAEADTGIFPSDAQQIYDGLA
FT                   SSDKTQVSIDTDHYFTTPGARSEQADTIAKWIAKRWR"
FT   CDS_pept        complement(357736..358356)
FT                   /transl_table=11
FT                   /gene="BCG_0311c"
FT                   /locus_tag="BCG_0311c"
FT                   /product="Possible transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0311c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70295"
FT                   /db_xref="GOA:A0A0H3M1T3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1T3"
FT                   /protein_id="CAL70295.1"
FT                   /translation="MPDFPTQRGRRTQAAIDAAARTVVVRNGILATTVADITAEAGRSA
FT                   ASFYNYYDSKEAMVRQWALRFRDDANQRALSVIRHGLSDRERAYEAAAAHWYTYRNRLA
FT                   EAISVSQLAMVSDDFAQYWSEICQIPISFITETVKRAQAHGYCVGDDPQLMAEAIVAMF
FT                   NQFCYLQLSGKRSRRGQPDDQACIQTLANIYYRAIYSKEDSSN"
FT   CDS_pept        358453..359034
FT                   /transl_table=11
FT                   /gene="BCG_0312"
FT                   /locus_tag="BCG_0312"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0312"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70296"
FT                   /db_xref="GOA:A0A0H3M144"
FT                   /db_xref="InterPro:IPR000486"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M144"
FT                   /protein_id="CAL70296.1"
FT                   /translation="MIKPHNTNTEFELGGINHVALVCSDMARTVDFYSNILGMPLIKAL
FT                   DLPGGQGQHFFFDAGNGDCVAFFWFADAPDRVPGLSSPVAIPGIGDITSAVSTMNHLAF
FT                   HVPAERFDAYRQRLKDKGVRVGPVLNHDDSETQVSAVVHPGVYVRSFYFQDPDGITLEF
FT                   ACWTKEFTTSDAQAVPKTAADRRPPVAADR"
FT   CDS_pept        complement(358964..359689)
FT                   /transl_table=11
FT                   /gene="BCG_0313c"
FT                   /locus_tag="BCG_0313c"
FT                   /product="Possible transcriptional regulatory protein
FT                   (possibly tetr-family)"
FT                   /note="Differs from Rv0275c by 1aa, L24S"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0313c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70297"
FT                   /db_xref="GOA:A0A0H3M7N5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7N5"
FT                   /protein_id="CAL70297.1"
FT                   /translation="MTRSDRPYRGVEAAERLATRRRQLLSAGLDLLGSDQHDIAELTIR
FT                   TICRRAGLSVRYFYESFTDKDEFVGRVFDWVVAELVATTQAAVTAVPAREQTRAGMANI
FT                   VRTITADARVGRLLFSTQLANAVITRKRAESSALFAMLSGQHAVDTLHAPANDHVKAVA
FT                   HFAVGGVGQTISAWLAGDVRLDPDQLVDQLAALLDELTDPNLSRPRVAATAAKSGANDP
FT                   QPPEVAGQPPSSARPARRS"
FT   CDS_pept        359779..360699
FT                   /transl_table=11
FT                   /gene="BCG_0314"
FT                   /locus_tag="BCG_0314"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0314"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70298"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2Z4"
FT                   /protein_id="CAL70298.1"
FT                   /translation="MAISLVAHQPIPHVERPMADPPRLQLARRRRSAAGPGGNEDSLMG
FT                   VALLAGPANVIMELAMPGVGYGVLESRVESGRLDRHPIKRARTTFTYVAVAVAGSDDQK
FT                   AAFRRAVNKVHAQVYSTPESPVSYHAFDPELQLWVAACLYKGGVDVYRTFVGEMDDEEA
FT                   DHHYRAGMAMGTTLQVPPQMWPPDRAAFDRYWRQSLDRVHIDDVVRDYLYPIVALRIRG
FT                   IALPGPLRRLSEGIALLITTGFLPQRFRDEMRLPWDATKQRRFDALMAVLRTVNRLMPR
FT                   FVREFPFNLMLWDLDRRMRRGRPLV"
FT   CDS_pept        complement(360739..361167)
FT                   /transl_table=11
FT                   /gene="BCG_0315c"
FT                   /locus_tag="BCG_0315c"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0315c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70299"
FT                   /db_xref="GOA:A0A0H3MA80"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR006226"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MA80"
FT                   /protein_id="CAL70299.1"
FT                   /translation="MFLIDVNVLLAAHRGDHPNHRTVRPWFDRLLAADDPFTVPNLVWA
FT                   SFLRLTTNRRIFEIPSPRADAFAFVEAVNAQPHHLPTSPGPRHLVLLRKLCDEADASGD
FT                   LIPDAVLGAIAVEHHCAVVSLDRDFARFASVRHIRPPI"
FT   CDS_pept        complement(361191..361448)
FT                   /transl_table=11
FT                   /gene="BCG_0315A"
FT                   /locus_tag="BCG_0315A"
FT                   /product="Conserved hypothetical protein, antitoxin"
FT                   /note="Differs by 1 aa, Q24* from Rv0227A and Mb0351A"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0315A"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70300"
FT                   /db_xref="GOA:A0A0H3M1U5"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1U5"
FT                   /protein_id="CAL70300.1"
FT                   /translation="MRTTVSISDELLATAKRRARERGQSLGAVIEDALRRELAAARTGG
FT                   ARPTVPVFDAGTGPRPGIDLTSNRVLSEVLDEGLELNSRK"
FT   CDS_pept        complement(361468..361710)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="PE_PGRS3b"
FT                   /locus_tag="BCG_0316c"
FT                   /product="PE-PGRS family protein [second part]"
FT                   /note="In Mycobacterium tuberculosis strain H37Rv, PE_PGRS3
FT                   exists as a single gene. In Mycobacterium bovis, a 2780 bp
FT                   insertion leads to an extra copy of PE_PGRS3. Also, a
FT                   frameshift due to single base deletion (t-*), splits this
FT                   extra copy of PE_PGRS3 into 2 parts, PE_PGRS3a and
FT                   PE_PGRS3b"
FT   CDS_pept        complement(361533..364283)
FT                   /transl_table=11
FT                   /gene="PE_PGRS3a"
FT                   /locus_tag="BCG_0317c"
FT                   /product="PE-PGRS family protein [first part]"
FT                   /note="In Mycobacterium tuberculosis strain H37Rv, PE_PGRS3
FT                   exists as a single gene. In Mycobacterium bovis and
FT                   Mycobacterium bovs BCG Pasteur, a large insertion leads to
FT                   an extra copy of PE_PGRS3. Also, a frameshift due to single
FT                   base deletion (t-*), splits this extra copy of PE_PGRS3
FT                   into 2 parts, PE_PGRS3a and PE_PGRS3b. Also differs from
FT                   Mb0285c by an insertion of 144bp"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0317c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70302"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M150"
FT                   /protein_id="CAL70302.1"
FT                   /translation="MSFVIAAPEVIAAAATDLASLESSIAAANAAAAANTTALLAAGAD
FT                   EVSTAVAALFGAHGQAYQALSAQAQAFHAQFTQALTSGGGAYAAAEAAATSPLLAPINE
FT                   FFLANTGRPLIGNGANGAPGTGADGAPGGWLIGNGGAGGSGAANNAVGGTGGTGGAGGA
FT                   SGLLGSGGAGGAGGVATNTGGIGGAGGTGGNAVLFGAGGAGGASTNTTGGAGGAGGDGG
FT                   NAGLLFGAAGVGGAGGFALATTASGGAGGAGGAGGMFTDGGVGGVGGKGGFGGAGGAGG
FT                   NGGLFGAGGTGGAGGTIGAGVAGMGGAGGAGGAGGLFGAGGTGGSGGGGATTGGDGGAG
FT                   GNAGTLSLGAAGGAGGAGGEGLASAGGDGGAGGDGGNAGMFFGSGGAGGAGGFGRTTGG
FT                   IGGTGGNAGLLNGSGGAGGAGGAAITGPGGTGGAGGIPGLIGNGGNGGDGGASVTGTGG
FT                   NGGAGGNGVQIGNGGNGGSGGTGAAAGKAGLGGLGGQLIGLDGSNAPVSTSVHTLQQAA
FT                   LNVVNEPFQTLTGRPLIGNGANGTPGTGAAGGAGGWLFGNGGNGGHGATNTAATATGGA
FT                   GGAGGILFGTGGNGGTGGIATGAGGIGGAGGAGGVSLLIGSGGTGGNGGNSIGVAGIGG
FT                   AGGRGGDAGLLFGAAGTGGHGAAGGVPAGVGGAGGNGGLFANGGAGGAGGFNAAGGNGG
FT                   NGGLFGTGGTGGAGTNFGAGGNGGNGGLFGAGGTGGAAGSGGSGITTGGGGHGGNAGLL
FT                   SLGASGGAGGSGGASSLAGGAGGTGGNGALLFGFGGAGGAGGHGGAALTSIQQGGAGGA
FT                   GGNGGLLFGSAGAGGAGGSGANALGAGTGGTGGDGGHAGVFGNGGDGGAGGFGAGTGGS
FT                   GGVGGNAVLIGNGGNGGNAGKAGATPGAGGTGGLLLGENGLNGLP"
FT   misc_feature    362672..365595
FT                   /note="I-RD01, 2924 bp. Region of Difference I-RDXXXX,
FT                   inserted region in Mycobacterium bovis BCG Pasteur
FT                   (position 362672..365595, 2924bp) and Mycobacterium bovis
FT                   AF2122/97 (position 332966..335745, 2780 bp) compared to
FT                   Mycobacterium tuberculosis H37Rv2 (position:
FT                   334641..334642). Duplicates PE_PGRS3"
FT   CDS_pept        complement(364547..367246)
FT                   /transl_table=11
FT                   /gene="PE_PGRS3"
FT                   /locus_tag="BCG_0318c"
FT                   /product="PE-PGRS family protein"
FT                   /note="In Mycobacterium bovis BCG Pasteur, a insertion of
FT                   66 bp lead to a longer product than to the homolog
FT                   Mycobacterium bovis (899 aa versus 877 aa). In
FT                   Mycobacterium bovis, 2 deletions, one of 18 bp and the
FT                   other of 66 bp, and part of a 2780 bp insertion , leads to
FT                   a shorter product with a different 3' end compared to its
FT                   homolog in Mycobacterium tuberculosis strain H37Rv (877 aa
FT                   versus 957 aa)"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0318c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70303"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7N8"
FT                   /protein_id="CAL70303.1"
FT                   /translation="MSFVIAAPEVIAAAATDLASLGSSISAANAAAAANTTALMAAGAD
FT                   EVSTAIAALFGAHGQAYQALSAQAQAFHAQFVQALTSGGGAYAAAEAAAVSPLLDPINE
FT                   FFLANTGRPLIGNGANGAPGTGANGGDGGWLIGNGGAGGSGAAGVNGGAGGNGGAGGLI
FT                   GNGGAGGAGGVASSGIGGSGGAGGNAMLFGAGGAGGAGGGVVALTGGAGGAGGAGGNAG
FT                   LLFGAAGVGGAGGFTNGSALGGAGGAGGAGGLFATGGVGGSGGAGSSGGAGGAGGAGGL
FT                   FGAGGTGGHGGFADSSFGGVGGAGGAGGLFGAGGEGGSGGHSLVAGGDGGAGGNAGMLA
FT                   LGAAGGAGGIGGDGGTLTAGGIGGAGGAGGNAGLLFGSGGSGGAGGFGFADGGQGGPGG
FT                   NAGTVFGSGGAGGNGGVGQGFAGGIGGAGGTPGLIGNGGNGGNGGASAVTGGNGGIGGT
FT                   GVLIGNGGNGGSGGIGAGKAGVGGVSGLLLGLDGFNAPASTSPLHTLQQNVLNVVNEPF
FT                   QTLTGRPLIGNGANGTPGTGADGGAGGWLFGNGGNGGSGATGTNGGDGGDGGAGGIFFG
FT                   TGGTGGAGGVGTTGTGGDGGAGGAAFLVGSGGNGGSGGAGLTAGGDGGDGGNAGSFFGA
FT                   AGTGGAGASTKAGGTGGTGGNGGLFANGGAGGSGGLGGDAGTGGAGGNGGLFGAGGTGG
FT                   AGGSLGPGAGGAGGNGGLFGAGGTGGSGGHGTPAAVPGGAGGAGGNAGLFSLGASGGAG
FT                   GSGGSSLTDSGGIGGVGGAGGLLFGYGGAGGAGGYSNIGAGGAGGAGGNAGMLSGSGGS
FT                   GGTGGASGAAKGGVGGNGGTAGVFGNGGDGGAGGFGAGTGGNGGVGGNAVLIGNGGNGG
FT                   NGGKAGGTPGAGGTSGLLIGENGLNGLP"
FT   CDS_pept        complement(367496..370000)
FT                   /transl_table=11
FT                   /gene="PE_PGRS4"
FT                   /locus_tag="BCG_0319c"
FT                   /product="PE-PGRS family protein"
FT                   /note="In Mycobacterium bovis BCG Pasteur, 2 insertions
FT                   each of 9 bp and a deletion of 9bp, lead to a longer
FT                   product compared to its homolog in Mycobacterium bovis (834
FT                   aa versus 831 aa). In Mycobacterium bovis, 2 deletions each
FT                   of 9 bp (ccgccggcg-* and cccgccggc-*), leads to a shorter
FT                   product compared to its homolog in Mycobacterium
FT                   tuberculosis strain H37Rv (831 aa versus 837 aa)"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0319c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70304"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2Z7"
FT                   /protein_id="CAL70304.1"
FT                   /translation="MSFVIAAPEVIAAAATDLASLESSIAAANAAAAANTTALLAAGAD
FT                   EVSTAVAALFGAHGQAYQALSAQAQAFHAQFVQALTSGGGAYAAAEAAATSPLLAPINE
FT                   FFLANTGRPLIGNGANGAPGTGADGAPGGWLIGNGGAGGSGAAGVNGGAGGNGGAGGLI
FT                   GNGGAGGAGGRASTGTGGAGGAGGAAGMLFGAAGVGGPGGFAAAFGATGGAGGAGGNGG
FT                   LFADGGVGGAGGATDAGTGGAGGSGGNGGLFGAGGTGGPGGFGIFGGGAGGDGGSGGLF
FT                   GAGGTGGSGGTSIINVGGNGGAGGDAGMLSLGAAGGAGGSGGSSPDGGGGAGGIGGDGG
FT                   TLFGSGGVGGLGFDAGGAGGAGGKAGLLSGAGGAGGAGGGSFAGAGGTGGAGGAPGLVG
FT                   NAGNGGNGGASANGAGAAGGAGGSGVLIGNGGNGGSGGTGAPAGTAGAGGLGGQLLGRD
FT                   GFNAPASTPLHTLQQQILNAINEPTQALTGRPLIGNGANGTPGTGADGGAGGWLFGNGG
FT                   NGGHGATGADGGDGGSGGAGGILSGIGGTGGSGGIGTTGQGGTGGTGGAALLIGSGGTG
FT                   GSGGFGLDTGGAGGRGGDAGLFLGAAGTGGQAALSQNFIGAGGTAGAGGTGGLFANGGA
FT                   GGAGGFGANGGTGGNGLLFGAGGTGGAGTLGADGGAGGHGGLFGAGGTGGAGGSSGGTF
FT                   GGNGGSGGNAGLLALGASGGAGGSGGSALNVGGTGGVGGNGGSGGSLFGFGGAGGTGGS
FT                   SGIGSSGGTGGDGGTAGVFGNGGDGGAGGFGTGAGGTGGTGGNAVLIGNGGNGGNGGKA
FT                   GGTPGAGGTSGLIIGENGLNGL"
FT   CDS_pept        370291..371901
FT                   /transl_table=11
FT                   /gene="PPE3"
FT                   /locus_tag="BCG_0320"
FT                   /product="PPE family protein"
FT                   /note="Differs from Rv0280 by 1 aa P337S"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0320"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70305"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MA84"
FT                   /protein_id="CAL70305.1"
FT                   /translation="MTLWMASPPEVHSALLSSGPGPGSVLSAAGVWSSLSAEYAAVADE
FT                   LIGLLGAVQTGAWQGPSAAAYVAAHAPYLAWLMRASETSAEAAARHETVAAAYTTAVAA
FT                   MPTLVELAANHTLHGVLVATNFFGINTIPIALNEADYARMWTQAASTMATYQAVAEAAV
FT                   ASAPQTTPAPPILAAEAADDDHDHDHDHGGEPTPLDYLVAEILRIISGGRLIWDPAEGT
FT                   MNGIPFEDYTDAAQPIWWVVRAIEFSKDFETFVQELFVNPVEAFQFYFELLLFDYPTHI
FT                   VQIVEALSQSPQLLAVALGSVISNLGAVTGFAGLSGLAGMQPAAIPALAPVAAAPPTLP
FT                   AVAMAPTMAAPGAAVASAAAPASAPAASTVASATPAPPPAPGAAGFGYPYAIAPPGIGF
FT                   GSGMSASASAQRKAPQPDSAAAAAAAAAVRDQARARRRRRVTRRGYGDEFMDMNIDVDP
FT                   DWGPPPGEDPVTSTVASDRGAGHLGFAGTARREAVADAAGMTTLAGDDFGDGPTTPMVP
FT                   GSWDPDRDAPGSAEPGDRG"
FT   CDS_pept        371925..372833
FT                   /transl_table=11
FT                   /gene="BCG_0321"
FT                   /locus_tag="BCG_0321"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0321"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70306"
FT                   /db_xref="GOA:A1KFA4"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KFA4"
FT                   /protein_id="CAL70306.1"
FT                   /translation="MRTEGDSWDITTSVGSTALFVATARALEAQKSDPLVVDPYAEAFC
FT                   RAVGGSWADVLDGKLPDHKLKSTDFGEHFVNFQGARTKYFDEYFRRAAAAGARQVVILA
FT                   AGLDSRAYRLPWPDGTTVFELDRPQVLDFKREVLASHGAQPRALRREIAVDLRDDWPQA
FT                   LRDSGFDAAAPSAWIAEGLLIYLPATAQERLFTGIDALAGRRSHVAVEDGAPMGPDEYA
FT                   AKVEEERAAIAEGAEEHPFFQLVYNERCAPAAEWFGERGWTAVATLLNDYLEAVGRPVP
FT                   GPESEAGPMFARNTLVSAARV"
FT   CDS_pept        373058..374953
FT                   /transl_table=11
FT                   /gene="BCG_0322"
FT                   /locus_tag="BCG_0322"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Differs from Rv0282 by 1aa, A6E"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0322"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70307"
FT                   /db_xref="GOA:A0A0H3M1V9"
FT                   /db_xref="InterPro:IPR000641"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR023835"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041627"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1V9"
FT                   /protein_id="CAL70307.1"
FT                   /translation="MAGVGAGDSGGVERDDIGMVAASPVASRVNGKVDADVVGRFATCC
FT                   RALGIAVYQRKRPPDLAAARSGFAALTRVAHDQCDAWTGLAAAGDQSIGVLEAASRTAT
FT                   TAGVLQRQVELADNALGFLYDTGLYLRFRATGPDDFHLAYAAALASTGGPEEFAKANHV
FT                   VSGITERRAGWRAARWLAVVINYRAERWSDVVKLLTPMVNDPDLDEAFSHAAKITLGTA
FT                   LARLGMFAPALSYLEEPDGPVAVAAVDGALAKALVLRAHVDEESASEVLQDLYAAHPEN
FT                   EQVEQALSDTSFGIVTTTAGRIEARTDPWDPATEPGAEDFVDPAAHERKAALLHEAELQ
FT                   LAEFIGLDEVKRQVSRLKSSVAMELVRKQRGLTVAQRTHHLVFAGPPGTGKTTIARVVA
FT                   KIYCGLGLLKRENIREVHRADLIGQHIGETEAKTNAIIDSALDGVLFLDEAYALVATGA
FT                   KNDFGLVAIDTLLARMENDRDRLVVIIAGYRADLDKFLDTNEGLRSRFTRNIDFPSYTS
FT                   HELVEIAHKMAEQRDSVFEQSALHDLEALFAKLAAESTPDTNGISRRSLDIAGNGRFVR
FT                   NIVERSEEEREFRLDHSEHAGSGEFSDEELMTITADDVGRSVEPLLRGLGLSVRA"
FT   CDS_pept        374950..376566
FT                   /transl_table=11
FT                   /gene="BCG_0323"
FT                   /locus_tag="BCG_0323"
FT                   /product="Possible conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0323"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70308"
FT                   /db_xref="GOA:A0A0H3M155"
FT                   /db_xref="InterPro:IPR007795"
FT                   /db_xref="InterPro:IPR042485"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M155"
FT                   /protein_id="CAL70308.1"
FT                   /translation="MTNQQHDHDFDHDRRSFASRTPVNNNPDKVVYRRGFVTRHQVTGW
FT                   RFVMRRIAAGIALHDTRMLVDPLRTQSRAVLMGVLIVITGLIGSFVFSLIRPNGQAGSN
FT                   AVLADRSTAALYVRVGEQLHPVLNLTSARLIVGRPVSPTTVKSTELDQFPRGNLIGIPG
FT                   APERMVQNTSTDANWTVCDGLNAPSRGGADGVGVTVIAGPLEDTGARAAALGPGQAVLV
FT                   DSGAGTWLLWDGKRSPIDLADHAVTSGLGLGADVPAPRIIASGLFNAIPEAPPLTAPII
FT                   PDAGNPASFGVPAPIGAVVSSYALKDSGKTISDTVQYYAVLPDGLQQISPVLAAILRNN
FT                   NSYGLQQPPRLGADEVAKLPVSRVLDTRRYPSEPVSLVDVTRDPVTCAYWSKPVGAATS
FT                   SLTLLAGSALPVPDAVHTVELVGAGNGGVATRVALAAGTGYFTQTVGGGPDAPGAGSLF
FT                   WVSDTGVRYGIDNEPQGVAGGGKAVEALGLNPPPVPIPWSVLSLFVPGPTLSRADALLA
FT                   HDTLVPDSRPARPVSAEGGYR"
FT   CDS_pept        376563..380555
FT                   /transl_table=11
FT                   /gene="BCG_0324"
FT                   /locus_tag="BCG_0324"
FT                   /product="Possible conserved membrane protein"
FT                   /note="Differs from Mb0292 by 1aa, A134T, and from Rv0284
FT                   by 2aa, A134T, R214P"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0324"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70309"
FT                   /db_xref="GOA:A0A0H3M7P2"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR023836"
FT                   /db_xref="InterPro:IPR023837"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7P2"
FT                   /protein_id="CAL70309.1"
FT                   /translation="MSRLIFEARRRLAPPSSHQGTIIIEAPPELPRVIPPSLLRRALPY
FT                   LIGILIVGMIVALVATGMRVISPQTLFFPFVLLLAATALYRGNDKKMRTEEVDAERADY
FT                   LRYLSVVRDNIRAQAAEQRASALWSHPDPAALASVPGSRRQWERDPHDPDFLVLRAGRH
FT                   TVPLATTLRVNDTADEIDLEPVSHSALRSLLDTQRSIGDVPTGIDLTKVSRITVLGERA
FT                   QVRAVLRAWIAQAVTWHDPTVLGVALAARDLEGRDWNWLKWLPHVDIPGRLDALGPARN
FT                   LSTDPDELIALLGPVLADRPAFTGQPTDALRHLLIVVDDPDYDLGASPLAVGRAGVTVV
FT                   HCSASAPHREQYSDPEKPILRVAHGAIERWQTGGWQPYIDAADQFSADEAAHLARRLSR
FT                   WDSNPTHAGLRSAATRGASFTTLLGIEDASRLDVPALWAPRRRDEELRVPIGVTGTGEP
FT                   LMFDLKDEAEGGMGPHGLMIGMTGSGKSQTLMSILLSLLTTHSAERLIVIYADFKGEAG
FT                   ADSFRDFPQVVAVISNMAEKKSLADRFADTLRGEVARREMLLREAGRKVQGSAFNSVLE
FT                   YENAIAAGHSLPPIPTLFVVADEFTLMLADHPEYAELFDYVARKGRSFRIHILFASQTL
FT                   DVGKIKDIDKNTAYRIGLKVASPSVSRQIIGVEDAYHIESGKEHKGVGFLVPAPGATPI
FT                   RFRSTYVDGIYEPPQTAKAVVVQSVPEPKLFTAAAVEPDPGTVIADTDEQEPADPPRKL
FT                   IATIGEQLARYGPRAPQLWLPPLDETIPLSAALARAGVGPRQWRWPLGEIDRPFEMRRD
FT                   PLVFDARSSAGNMVIHGGPKSGKSTALQTFILSAASLHSPHEVSFYCLDYGGGQLRALQ
FT                   DLAHVGSVASALEPERIRRTFGELEQLLLSRQQREVFRDRGANGSTPDDGFGEVFLVID
FT                   NLYGFGRDNTDQFNTRNPLLARVTELVNVGLAYGIHVIITTPSWLEVPLAMRDGLGLRL
FT                   ELRLHDARDSNVRVVGALRRPADAVPHDQPGRGLTMAAEHFLFAAPELDAQTNPVAAIN
FT                   ARYPGMAAPPVRLLPTNLAPHAVGELYRGPDQLVIGQREEDLAPVILDLAANPLLMVFG
FT                   DARSGKTTLLRHIIRTVREHSTADRVAFTVLDRRLHLVDEPLFPDNEYTANIDRIIPAM
FT                   LGLANLIEARRPPAGMSAAELSRWTFAGHTHYLIIDDVDQVPDSPAMTGPYIGQRPWTP
FT                   LIGLLAQAGDLGLRVIVTGRATGSAHLLMTSPLLRRFNDLQATTLMLAGNPADSGKIRG
FT                   ERFARLPAGRAILLTDSDSPTYVQLINPLVDAAAVSGETQQKGSQS"
FT   CDS_pept        380552..380860
FT                   /transl_table=11
FT                   /gene="PE5"
FT                   /locus_tag="BCG_0325"
FT                   /product="PE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0325"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70310"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M302"
FT                   /protein_id="CAL70310.1"
FT                   /translation="MTLRVVPEGLAAASAAVEALTARLAAAHASAAPVITAVVPPAADP
FT                   VSLQTAAGFSAQGVEHAVVTAEGVEELGRAGVGVGESGASYLAGDAAAAATYGVVGG"
FT   CDS_pept        380863..382404
FT                   /transl_table=11
FT                   /gene="PPE4"
FT                   /locus_tag="BCG_0326"
FT                   /product="PPE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0326"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70311"
FT                   /db_xref="GOA:A0A0H3MA86"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MA86"
FT                   /protein_id="CAL70311.1"
FT                   /translation="MAAPIWMASPPEVHSALLSNGPGPGSLVAAATAWSQLSAEYASTA
FT                   AELSGLLGAVPGWAWQGPSAEWYVAAHLPYVAWLTQASADAAGAAAQHEAAAAAYTTAL
FT                   AAMPTLAELAANHVIHTVLVATNFFGINTIPITLNEADYVRMWLQAAAVMGLYQAASGA
FT                   ALASAPRTVPAPTVMNPGGGAASTVGAVNPWQWLLALLQQLWNAYTGFYGWMLQLIWQF
FT                   LQDPIGNSIKIIIAFLTNPIQALITYGPLLFALGYQIFFNLVGWPTWGMILSSPFLLPA
FT                   GLGLGLAAIAFLPIVLAPAVIPPASTPLAAAAVAAGSVWPAVSMAVTGAGTAGAATPAA
FT                   GAAPSAGAAPAPAAPATASFAYAVGGSGDWGPSLGPTVGGRGGIKAPAATVPAAAAAAA
FT                   TRGQSRARRRRRSELRDYGDEFLDMDSDSGFGPSTGDHGAQASERGAGTLGFAGTATKE
FT                   RRVRAVGLTALAGDEFGNGPRMPMVPGTWEQGSNEPEAPDGSGRGGGDGLPHDSK"
FT   CDS_pept        382453..382746
FT                   /transl_table=11
FT                   /gene="esxG"
FT                   /locus_tag="BCG_0327"
FT                   /standard_name="TB9.8"
FT                   /product="Conserved hypothetical protein TB9.8"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0327"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70312"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1W4"
FT                   /protein_id="CAL70312.1"
FT                   /translation="MSLLDAHIPQLVASQSAFAAKAGLMRHTIGQAEQAAMSAQAFHQG
FT                   ESSAAFQAAHARFVAAAAKVNTLLDVAQANLGEAAGTYVAADAAAASTYTGF"
FT   CDS_pept        382776..383066
FT                   /transl_table=11
FT                   /gene="esxH"
FT                   /locus_tag="BCG_0328"
FT                   /standard_name="cfp7; TB10.4"
FT                   /product="Low molecular weight protein antigen 7 cfp7"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0328"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70313"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M160"
FT                   /protein_id="CAL70313.1"
FT                   /translation="MSQIMYNYPAMLGHAGDMAGYAGTLQSLGAEIAVEQAALQSAWQG
FT                   DTGITYQAWQAQWNQAMEDLVRAYHAMSSTHEANTMAMMARDTAEAAKWGG"
FT   CDS_pept        383077..383964
FT                   /transl_table=11
FT                   /gene="BCG_0329"
FT                   /locus_tag="BCG_0329"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0329"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70314"
FT                   /db_xref="InterPro:IPR025734"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7P5"
FT                   /protein_id="CAL70314.1"
FT                   /translation="MDATPNAVELTVDNAWFIAETIGAGTFPWVLAITMPYSDAAQRGA
FT                   FVDRQRDELTRMGLLSPQGVINPAVADWIKVVCFPDRWLDLRYVGPASADGACELLRGI
FT                   VALRTGTGKTSNKTGNGVVALRNAQLVTFTAMDIDDPRALVPILGVGLAHRPPARFDEF
FT                   SLPTRVGARADERLRSGVPLGEVVDYLGIPASARPVVESVFSGPRSYVEIVAGCNRDGR
FT                   HTTTEVGLSIVDTSAGRVLVSPSRAFDGEWVSTFSPGTPFAIAVAIQTLTACLPDGQWF
FT                   PGQRVSRDFSTQSS"
FT   CDS_pept        384011..385429
FT                   /transl_table=11
FT                   /gene="BCG_0330"
FT                   /locus_tag="BCG_0330"
FT                   /product="Probable conserved transmembrane protein"
FT                   /note="Differs from Rv0290 by 1aa, T400A"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0330"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70315"
FT                   /db_xref="GOA:A0A0H3M310"
FT                   /db_xref="InterPro:IPR006707"
FT                   /db_xref="InterPro:IPR024962"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M310"
FT                   /protein_id="CAL70315.1"
FT                   /translation="MSGTVMQIVRVAILADSRLTEMALPAELPLREILPAVQRLVVPSA
FT                   QNGDGGQADSGAAVQLSLAPVGGQPFSLDASLDTVGVVDGDLLVLQPVPAGPAAPGIVE
FT                   DIADAAMIFSTSRLKPWGIAHIQRGALAAVIAVALLATGLTVTYRVATGVLAGLLAVAG
FT                   IAVASALAGLLITIRSPRSGIALSIAALVPIGAALALAVPGKFGPAQVLLGAAGVAAWS
FT                   LIALMIPSAERERVVAFFTAAAVVGASVALAAGAQLLWQLPLLSIGCGLIVAALLVTIQ
FT                   AAQLSALWARFPLPVIPAPGDPTPSAPPLRLLEDLPRRVRVSDAHQSGFIAAAVLLSVL
FT                   GSVAIAVRPEALSVVGWYLVAATAAAATLRARVWDSAACKAWLLAQPYLVAGVLLVFYT
FT                   TTGRYVAAFGAVLVLAVLMLAWVVVALNPGIASPESYSLPLRRLLGLVAAGLDVSLIPV
FT                   MAYLVGLFAWVLNR"
FT   CDS_pept        385426..386811
FT                   /transl_table=11
FT                   /gene="BCG_0331"
FT                   /locus_tag="BCG_0331"
FT                   /product="Probable protease precursor"
FT                   /EC_number="3.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0331"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70316"
FT                   /db_xref="GOA:A0A0H3MA90"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023834"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MA90"
FT                   /protein_id="CAL70316.1"
FT                   /translation="MIRAAFACLAATVVVAGWWTPPAWAIGPPVVDAAAQPPSGDPGPV
FT                   APMEQRGACSVSGVIPGTDPGVPTPSQTMLNLPAAWQFSRGEGQLVAIIDTGVQPGPRL
FT                   PNVDAGGDFVESTDGLTDCDGHGTLVAGIVAGQPGNDGFSGVAPAARLLSIRAMSTKFS
FT                   PRTSGGDPQLAQATLDVAVLAGAIVHAADLGAKVINVSTITCLPADRMVDQAALGAAIR
FT                   YAAVDKDAVIVAAAGNTGASGSVSASCDSNPLTDLSRPDDPRNWAGVTSVSIPSWWQPY
FT                   VLSVASLTSAGQPSKFSMPGPWVGIAAPGENIASVSNSGDGALANGLPDAHQKLVALSG
FT                   TSYAAGYVSGVAALVRSRYPGLNATEVVRRLTATAHRGARESSNIVGAGNLDAVAALTW
FT                   QLPAEPGGGAAPAKPVADPPVPAPKDTTPRNVAFAGAAALSVLVGLTAATVAIARRRRE
FT                   PTE"
FT   CDS_pept        386808..387803
FT                   /transl_table=11
FT                   /gene="BCG_0332"
FT                   /locus_tag="BCG_0332"
FT                   /product="Probable conserved transmembrane protein"
FT                   /note="Differs from Rv0292 by 1aa, D217N"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0332"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70317"
FT                   /db_xref="GOA:A0A0H3M1W7"
FT                   /db_xref="InterPro:IPR021368"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1W7"
FT                   /protein_id="CAL70317.1"
FT                   /translation="MNPIPSWPGRGRVTLVLLAVVPVALAYPWQSTRDYVLLGVAAAVV
FT                   IGLFGFWRGLYFTTIARRGLAILRRRRRIAEPATCTRTTVLVWVGPPASDTNVLPLTLI
FT                   ARYLDRYGIRADTIRITSRVTASGDCRTWVGLTVVADDNLAALQARSARIPLQETAQVA
FT                   ARRLADHLREIGWEAGTAAPDEIPALVAADSRETWRGMRHTDSDYVAAYRVSADAELPD
FT                   TLPAIRSRPAQETWIALEIAYAAGSSTRYTVAAACALRTDWRPGGTAPVAGLLPQHGNH
FT                   VPALTALDPRSTRRLDGHTDAPADLLTRLHWPTPTAGAHRAPLTNAVSRT"
FT   CDS_pept        complement(387790..388992)
FT                   /transl_table=11
FT                   /gene="BCG_0333c"
FT                   /locus_tag="BCG_0333c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Differs from Rv0293c and Mb0301c by 1aa, S263G"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0333c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70318"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M167"
FT                   /protein_id="CAL70318.1"
FT                   /translation="MSGTFTADAIGPPVPIPDVPGADAGAEGLPSRSVLSARQRILVES
FT                   SAIADVALRTAVASVLSATVTPAVVANALRHVNEGSERSNLNFYAELAAAHDPAKSFPA
FT                   PTELPKVTSRPASPLTEWVARGTVDNIAFASGFRAINPTMRQRWSALTANNIVHAQHWR
FT                   HRDGPRPTLCVIHGFMGSSYLLNGLFFSLPWYYRSGYDVLLYTLPFHGQRAEKFSPFSG
FT                   FGYFTSGLSGFAEAMAQAVYDFRSIVDYLRHIGVDRIALTSISLGGYTSALLASVESRL
FT                   EAVIPNCPVVMPAKLFDEWFPANKLVKLGLRLTNISRDELIAGLAYHGPLNYRPLLPKD
FT                   RRMIITGLGDRMAPPEHAVTLWKQWDRCALHWFPGSHLLHVSQLDYLRRMTVFLQGLMF
FT                   D"
FT   CDS_pept        389099..389884
FT                   /transl_table=11
FT                   /gene="tam"
FT                   /locus_tag="BCG_0334"
FT                   /product="Probable trans-aconitate methyltransferase tam"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0334"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70319"
FT                   /db_xref="GOA:A1KFB7"
FT                   /db_xref="InterPro:IPR023149"
FT                   /db_xref="InterPro:IPR023506"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KFB7"
FT                   /protein_id="CAL70319.1"
FT                   /translation="MWDPDVYLAFSGHRNRPFYELVSRVGLERARRVVDLGCGPGHLTR
FT                   YLARRWPGAVIEALDSSPEMVAAAAERGIDATTGDLRDWKPKPDTDVVVSNAALHWVPE
FT                   HSDLLVRWVDELAPGSWIAVQIPGNFETPSHAAVRALARREPYAKLMRDIPFRVGAVVQ
FT                   SPAYYAELLMDTGCKVDVWETTYLHQLTGEHPVLDWITGSALVPVRERLSDESWQQFRQ
FT                   ELIPLLNDAYPPRADGSTIFPFRRLFMVAEVGGARRSGG"
FT   CDS_pept        complement(389873..390676)
FT                   /transl_table=11
FT                   /gene="BCG_0335c"
FT                   /locus_tag="BCG_0335c"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0335c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70320"
FT                   /db_xref="GOA:A0A0H3M7Q0"
FT                   /db_xref="InterPro:IPR015124"
FT                   /db_xref="InterPro:IPR024628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7Q0"
FT                   /protein_id="CAL70320.1"
FT                   /translation="MSRAVRPYLVLATQRSGSTLLVESLRATGCAGEPQEFFQYLPSTG
FT                   MAPQPREWFAGVDDDTILQLLDPLDPGTPDTATPVAWREHVRTSGRTPNGVWGGKLMWN
FT                   QTALLQQRAAQLPDRSGDGLRAAIRDVIGNEPVFVHVHRPDVVSQAVSFWRAVQTQVWR
FT                   GHPDPKRDSQAVYHAGAIAHIIRNLRDQENGWRAWFAEEGIDPIDIAYPVLWRNLTAIV
FT                   ASVLDAIGQDPKLAPAPMLERQANQRSDEWVDRYRAEAPRLGLPT"
FT   CDS_pept        complement(390686..392083)
FT                   /transl_table=11
FT                   /gene="BCG_0336c"
FT                   /locus_tag="BCG_0336c"
FT                   /product="Probable sulfatase"
FT                   /EC_number="3.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0336c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70321"
FT                   /db_xref="GOA:A0A0H3M314"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M314"
FT                   /protein_id="CAL70321.1"
FT                   /translation="MTSERATGQRENLLIVHWHDLGRYLGVYHHPDVYSPRLDRLAAEG
FT                   ILFTRAHATAPLCTPSRGSLFTGRYPQSNGLVGLAHHGWEYRTGVQTLPQLLSESGWYS
FT                   ALFGMQHETSYPKRLGFDEFDVSNSYCEYVVAKAQDWLHNRVPALDGQRFLLTAGFFET
FT                   HRPYPHERYRPADSAAVELPDYLPDTPEVRQDVAEFYGSIATADEAVGRLLDTLADTGL
FT                   DASTWVVFVTDHGPAFPRAKSTLYDAGTGIALIIRPPTRRAMAPRVYDELFSGVDLVPT
FT                   LLDLLRLEVPADVEGVSHAPALLAPDTENAAVRDHVYTAKTYHDSFDPIRAIRTKEYSY
FT                   IENYAPRPLLDLPWDIQESPAGMAVAPLVKAPRPQRELYDLRADPTETNNLLAGDDSTQ
FT                   GVAAIAADLAVRLHDWRQRTADVIPSDFAGSRIAERYTETYLRIHRKTPTGRSAIAADR
FT                   GIDEHCS"
FT   CDS_pept        392262..394082
FT                   /transl_table=11
FT                   /gene="PE_PGRS5"
FT                   /locus_tag="BCG_0337"
FT                   /product="PE-PGRS family protein"
FT                   /note="In Mycobacterium bovis BCG Pasteur, and
FT                   Mycobacterium bovis, a 45 bp in-frame insertion leads to a
FT                   longer product compared to its homolog in Mycobacterium
FT                   tuberculosis strain H37Rv (606 aa versus 591 aa)"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0337"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70322"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MA95"
FT                   /protein_id="CAL70322.1"
FT                   /translation="MSFVIAQPEMIAAAAGELASIRSAINAANAAAAAQTTGVMSAAAD
FT                   EVSTAVAALFSSHAQAYQAASAQAAAFHAQVVRTLTVDAGAYASAEAANAGPNMLAAVN
FT                   APAQALLGRPLIGNGANGAPGTGQAGGDGGLLFGNGGNGGSGAPGQAGGAGGAAGFFGN
FT                   GGNGGDGGAGANGGAGGTAGWFFGFGGNGGAGGIGVAGINGGLGGAGGDGGNAGFFGNG
FT                   GNGGMGGAGAAGVNAVNPGLATPVTPAANGGNGLNLVGVPGTAGGGADGANGSAIGQAG
FT                   GAGGDGGNASTSGGIGIAQTGGAGGAGGAGGDGAPGGNGGNGGSVEHTGATGSSASGGN
FT                   GATGGNGGVGAPGGAGGNGGHVSGGSVNTAGAGGKGGNGGTGGAGGPGGHGGSVLSGPV
FT                   GDSGNGGAGGDGGAGVSATDIAGTGGRGGNGGHGGLWIGNGGDGGAGGVGGVGGAGAAG
FT                   AIGGHGGDGGSVNTPIGGSEAGDGGKGGLGGDGGDGAAGGDGGAGGDGGGRGIFGQFGA
FT                   GGAGGAGGVGGAGGAGGTGGGGGNGGAIFNAGTPGAAGTGGDGGVGGTGAAGGKGGAGG
FT                   SGGVNGATGADGAKGLDGATGGKGNNGNPG"
FT   CDS_pept        394225..394452
FT                   /transl_table=11
FT                   /gene="BCG_0338"
FT                   /locus_tag="BCG_0338"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0338"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70323"
FT                   /db_xref="GOA:A0A0H3M1X1"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1X1"
FT                   /protein_id="CAL70323.1"
FT                   /translation="MTKEKISVTVDAAVLAAIDADARAAGLNRSEMIEQALRNEHLRVA
FT                   LRDYTAKTVPALDIDAYAQRVYQANRAAGS"
FT   CDS_pept        394449..394751
FT                   /transl_table=11
FT                   /gene="BCG_0339"
FT                   /locus_tag="BCG_0339"
FT                   /product="Hypothetical protein"
FT                   /note="Differs from Mb0307 by 1aa, S13N"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0339"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70324"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M174"
FT                   /protein_id="CAL70324.1"
FT                   /translation="MIAPGDIAPRRDSEHELYVAVLSNALHRAADTGRVITCPFIPGRV
FT                   PEDLLAMVVAVEQPNGTLLPELVQWLHVAALGAPLGNAGVAALREAASVVTALLC"
FT   CDS_pept        394799..395020
FT                   /transl_table=11
FT                   /gene="BCG_0340"
FT                   /locus_tag="BCG_0340"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0340"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70325"
FT                   /db_xref="GOA:A0A0H3M7Q1"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7Q1"
FT                   /protein_id="CAL70325.1"
FT                   /translation="MSDVLIRDIPDDVLASLDAIAARLGLSRTEYIRRRLAQDAQTARV
FT                   TVTAADLRRLRGAVAGLGDPELMRQAWR"
FT   CDS_pept        395017..395442
FT                   /transl_table=11
FT                   /gene="BCG_0341"
FT                   /locus_tag="BCG_0341"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0341"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70326"
FT                   /db_xref="GOA:A0A0H3M320"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M320"
FT                   /protein_id="CAL70326.1"
FT                   /translation="MTDQRWLIDKSALVRLTDSPDMEIWSNRIERGLVHITGVTRLEVG
FT                   FSAECGEIARREFREPPLSAMPVEYLTPRIEDRALEVQTLLADRGHHRGPSIPDLLIAA
FT                   TAELSGLTVLHVDKDFDAIAALTGQKTERLTHRPPSA"
FT   CDS_pept        395579..396211
FT                   /transl_table=11
FT                   /gene="BCG_0342"
FT                   /locus_tag="BCG_0342"
FT                   /product="Probable transcriptional regulatory protein
FT                   (probably tetR/acrR-family)"
FT                   /note="Differs from Mb0310 by 1aa A124V"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0342"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70327"
FT                   /db_xref="GOA:A0A0H3MA99"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MA99"
FT                   /protein_id="CAL70327.1"
FT                   /translation="MGVPAKKKQQQGERSRESILDATERLMATKGYAATSISDIRDACG
FT                   LAPSSIYWHFGSKEGVLAAMMERGAQRFFAAIPTWDEAHGPVEQRSERQLTELVSLQSQ
FT                   HPDFLRLFYLLSMERSQDPAVAAVVRRVRNTAIARFRDSITHLLPSDIPPGKADLVVAE
FT                   LTAFAVALSDGVYFAGHLEPDTTDVERMYRRLRQALEALIPVLLEET"
FT   CDS_pept        396208..397116
FT                   /transl_table=11
FT                   /gene="BCG_0343"
FT                   /locus_tag="BCG_0343"
FT                   /product="Probable dehydrogenase/reductase"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0343"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70328"
FT                   /db_xref="GOA:A0A0H3M1X4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1X4"
FT                   /protein_id="CAL70328.1"
FT                   /translation="MNTGTAVITGASSGLGLQCARALLRRDASWHVVLAVRDPARGRAA
FT                   MEELGEPNRCSVLEVDLASVRSVRSFVETVRTTPLPPIRALVCNAGLQVVSGIAFTDDG
FT                   VEMTFGVNHLGHFALVTGILDWLARPARIVVVSSGTHDPSKHTGMPDPRYTCAADLAHP
FT                   PTDQNTPAEGRRRYTTSKLCNVLFTYELDRRLDHGEQGVMVNAFDPGLMPGSGLARDYP
FT                   PILRLAYRLLSPMLRVLPFVHSTRVSGEHLAALAVDPRFAGVTGQYFAGAKAIRSSAES
FT                   YDRAKALDLWETSERLLAQVT"
FT   CDS_pept        complement(397124..400567)
FT                   /transl_table=11
FT                   /gene="PPE5"
FT                   /locus_tag="BCG_0344c"
FT                   /product="PPE family protein"
FT                   /note="In Mycobacterium tuberculosis strain H37Rv, PPE5 and
FT                   PPE6 exist as separate genes. In Mycobacterium bovis BCG
FT                   Pasteur, and Mycobacterium bovis, a frameshift due to a
FT                   single base deletion (g-*) leads to a shorter CDS (Mb0312c
FT                   and BCG_0344c) equivalent to the 3' end of Rv0304c/PPE5.
FT                   Differs from Rv0304c by 3aa, S481G, F708S, A955T, and 5
FT                   codon in-frame deletion at position 503"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0344c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70329"
FT                   /db_xref="InterPro:IPR002989"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M177"
FT                   /protein_id="CAL70329.1"
FT                   /translation="MFNSGDGNIGFFNSGTGNFGIGNTGTGNFGIGNSGSTSTGLFNSG
FT                   DGNTGGFNPGNFNTGNFNTGSFNTGGFNAGNTNTGHFNTGNYNTGIANTGDVSTGAFIS
FT                   GNYSNGILWRGDYQGLIGYSYALTIPEIPAHLDVNIPIDIPITGSFTDLVVDNFTIPII
FT                   GFESFAFSFHIHTEPDIGPIIVPSFVLSVPTFAIAVGGPTTAINISATAGLGPITIPII
FT                   DIPAAPGIGNSTTSPSSGFFNTGAGTASGFGNVGGNTSGLWNLASAASGVSGLLNVGAL
FT                   GSGVANVGNTISGIYNTSPLDLGTPAFGSGLANIAGLLQGGAGTTILDLAGLGNLNVGL
FT                   ANLGGSNFGIGNTGIFNVGFANVGNHNIGLANLGNYSVGFANSGNYHIGIANTGSANIG
FT                   FANTGSGNIGIGLTGTGQIGFGSFNSGSHNIGLFNSGDGNVGFFNSGTGNVGIGNTGTA
FT                   NFGIANSGSFNTGLGNTGSTNTSLFNPGNVNTGVGNTGSINTGSFNTGSTNTGSFNLGD
FT                   HNTGSFNSGDYNTGYFNAGDYNTGVANTGNVNTGAFISGNYSNGFFWRGDYQGLIGLST
FT                   TITIPEIPYRYDLSVPIDIPITGTVVATTPNSFTIPGFQIRVLLGPAAVLVNEMIGPIT
FT                   IDVNQVIAIDSPIQQTISMVGTGGFGPIPIGISIGGTPGFGNSTTGPSSGFFHTGAGHV
FT                   SGFGNFGAGNMSGFGNFGAGNSGFFNAGGLGNSGLLNFGALQSGLANLGNTISGVYNTS
FT                   TLDLATPAFGSGIANIGANLAGLFLDNTGNLTLNFGVANQGGLNAGIGNLGSVNIGFVN
FT                   TGDSNLGIGNLGDLNFGGVNIGGNNIGIANTGIFDIGLANLGSYNIGLANLGDDNLGFG
FT                   NAGSYNIGFANFGSDNLGFANTGSYNIGFANTGNNNIGVGLTGNGQIGIGSLNSGSNNI
FT                   GLFNSGSGNIGFFNSGTGNVGIFNAGTGNFGLANSGGFNTGIGNAGSTNTGVFNPGDLN
FT                   TGSFNPGSFNTGGFNPGSGNTGYLNTGDYNTGVANTGDVDTGAFITGSYSNGFLVSGDY
FT                   QGLIGLPLLGIPVTPGYFNLTGGPSSGFFNSGAGSVSGFVNSGAGLSGYLNTGALGSGV
FT                   ANVGNTISGWLNASALDLATPGFLSGIGNFGTNLAGFFRG"
FT   CDS_pept        complement(400711..406638)
FT                   /transl_table=11
FT                   /gene="PPE6"
FT                   /locus_tag="BCG_0345c"
FT                   /product="PPE family protein"
FT                   /note="In Mycobacterium tuberculosis strain H37Rv, PPE5 and
FT                   PPE6 exist as separate genes. In Mycobacterium bovis BCG
FT                   Pasteur, and Mycobacterium bovis, a single base deletion
FT                   (t-*) resulting in the absence of a stop codon leads to a
FT                   longer product. The second part of this CDS shares homology
FT                   with the 5' end of Rv0304c/PPE5. Differs from Mb0313c by
FT                   in-frame deletion of 10 codons"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0345c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70330"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR002989"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7Q4"
FT                   /protein_id="CAL70330.1"
FT                   /translation="MDFVVSAPEVNSLRMYLGAGSGPMLAAAAAWDGLADELAVAASWF
FT                   GSVTSGLADAAWRGPAAVAMARAVAPYLGWLISATAQAEQAAAQARVAVATFEAARAAT
FT                   VHPAIVAANRAVLVSLVSSNLLGFNAPAIAATEAAYERMWAQDVAAMVGYHAGASAAVS
FT                   ALMPFTQQLKKLAGLSERLTSAAAAAAGPPSAAGFNLGLANVGANNVGNGNVGVFNVGF
FT                   GNLGSYNLGFANLGSDNLGLANLGGHNIGFANTGSNNVGFGNTGSNNVGIGLTGNGQIG
FT                   FGSFNSGSHNIGLFNSGSGNVGLFNSGTGNFGIGNSGTGNFGLGNTGSTNTGWFNTGDV
FT                   NTGNFNTGNYNTGSFNAGNYNTGYFNTGDYNTGVANTGNVNTGAFIAGNYSNGVLWRGD
FT                   YQGLIGADIALEIPAIPINAQLFSMPIHQVMVMPGSVMTIPGMRLPFTSIVPFVVYYGP
FT                   VELPQSTLTLPTVTITVGGPTTTIDGNLTGMVGGVSIPLIKIPAAPGFGNSTTSPSSGF
FT                   FNAGAGTASGFGNFGGGASGFWNLASATSGLSGFGNVGALGSGVANVGNTISGLYNTST
FT                   SNLATPAFNSGLLHHSVGTMTLNFGLANVGGNNVGGANAGIFNVGLANLGDYNIGFGNL
FT                   GGDNLGFAHAGSYNIGFANTGSNNLGFANTGDNNIGFANIGSNNIGIGLTGSGQIGFGS
FT                   LNSGSHNIGLFNSGDGNIGLFNSGSGNFGIGNAGTGNWGIGNSGAGNFGIGNAGSTNTG
FT                   LFNSGDLNTGSLNPGSYNTGSVNTGSVNTGGFNAGNYNTGYFNTGDYNTGMANTGNINT
FT                   GAFISGNHSNGLLWRGDNQGLIDLAIGVDIPEIPIVSVDVNIPIHIPITASFTDIVYSG
FT                   LDLPPNTAVTVIFFGPVDIDPFTVPVIRITGPTPVVMVGGPTTAINIGATVGVDAINIP
FT                   IIHIPATPGFGNSTGGLSSGFFNSGAGSASGFGNFGGAASGFMNLVSTTSGMSGFLNVG
FT                   ALGSGVANVGNTISGIYNVGTSDLSTPAVNSGLANIGTNIAGLLRDGAGTAAINLGLAN
FT                   HGNLNVGFASLGGFNFGGATIGHNNVGIGNTGIFDVGLANLGSYNIGFGNLGDDNLGFG
FT                   NFGSYNIGFGNVGNDNLGFANAGGGNIGFANTGSNNVGFGNTGSNNVGIGLTGNGQIGF
FT                   GSFNSGSGNIGLFNSGSNNIGFFNSGSGNFGIANSGSFNTGIGNTGNTNTGLFNSGDVN
FT                   TGAFNPGSFNTGSFNTGSFNTGGFNPGNTNTGYLNIGNYNTGIANTGDVDTGAFITGNY
FT                   SNGLFLSGDYQGLVGLNLVIDMPLPISLGVNIPIDIPITASAGNITLMGVTIPPTGDIV
FT                   LSSIAGQRAHFGPITIPNITVVGPTTTVAIGGPNTAITITGGGAIRIPLISIPAAPGFG
FT                   NSTTNPSSGFFNTGAGGASGFGNFGGANSGFWNLASATSGASGLLNVGALGSGLANVGT
FT                   TVSGFYNTSTSDLATPAFNSGLANISTSIAGLLRDSTGTMVLNLGLANHGTLNVGIANL
FT                   GDYNIGFANLGSANFGSANIGGNNIGGANTGIFDIGLANLGSYNIGFGNFGDDNLGFGN
FT                   LGSYNVGFGNLGNDNLGFANTGSNNIGFANTGSNNIGIGLTGDGQIGFGSLNSGSGNIG
FT                   LFNSGSGNIGFFNSGNGNVGIGNTGTANFGLGNTGSTNTGFFNSGDVNTGIGNTGSFNT
FT                   GSFNPGDSNTGDFNPGSYNTGLGNTGDVDTGAFISGSYSNGFLWSGNYQGLIGLHAALA
FT                   IPEIALTFGVDIPIHIPINIDAGVVTLQGFSIVAAENNIDFTPIIIPTINITLPTAAIT
FT                   VGGPTTSIGITASAGIGSITIPIIDIPATSGFGNSTTSPSSGFFNSGAGSASGFLNVVA
FT                   GASGISGYLNVGALGSGVTNVGHTVSGFYNASALDLVTPAFASGLMRDGMGTMTLNLGL
FT                   ANLGSNNAGFGNTGIFDVGVANLGNYNIGFGNFGDDNLALPT"
FT   CDS_pept        406841..407512
FT                   /transl_table=11
FT                   /gene="BCG_0346"
FT                   /locus_tag="BCG_0346"
FT                   /product="Putative oxidoreductase"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0346"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70331"
FT                   /db_xref="GOA:A0A0H3M326"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR012825"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M326"
FT                   /protein_id="CAL70331.1"
FT                   /translation="MFSAPERRAVYRVIAERRDMRRFVPGGVVSEDVLARLLHAAHAAP
FT                   SVGLMQPWRFIRITDETLKRRIHALVDDERLLTAEALGAREEEFLALKVEGILDCAELL
FT                   VVALCDRRGSYIFGRRTLPQMDLASVSCAIQNLWLAARSEGLGMGWVSLFDPQRLAALL
FT                   AMPADAEPVAILCLGPVPEFPDRPALELDGWAYARPLAEFVSENRWSYPSALATDHHHG
FT                   E"
FT   CDS_pept        complement(407500..407982)
FT                   /transl_table=11
FT                   /gene="BCG_0347c"
FT                   /locus_tag="BCG_0347c"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0347c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70332"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAA4"
FT                   /protein_id="CAL70332.1"
FT                   /translation="MAVIVRKWFGLGRLPADLRCQVEAEGLIYLAEYVAVTRRFTGVIP
FT                   GLRASHSIASYVGALAFTEQRVLGTLSMVPKLAGRVVDARWDGPQAGAATAEISPTGLQ
FT                   LDLDVADVDPKFSGQLALHFKATIGEDVLSRLPRRSLAFDVPAEYVNLAVGVTYSP"
FT   CDS_pept        408040..408756
FT                   /transl_table=11
FT                   /gene="BCG_0348"
FT                   /locus_tag="BCG_0348"
FT                   /product="Probable conserved integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0348"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70333"
FT                   /db_xref="GOA:A0A0H3M1X8"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1X8"
FT                   /protein_id="CAL70333.1"
FT                   /translation="MTRPQALLAVSLAFVATAVYAVMWVGHSQDWGWLHSFDWSLLNAA
FT                   HDIGIKNPAWVRFWDGVSLILGPVVLRPLGLLAAMVALAKRKIRIALLLLACLPLNAIM
FT                   TIAAKSVAHRPRPATALVSAHSTSFPSGHALEATASVLALLTVLLPMLHSRFTRHIAIT
FT                   VGALCVLTVGVARVALNVHHPTDVVAGWALGYLYFLVCLCVFRPPSIFGAQRASHALSP
FT                   PVEVSRQPEPEVDTAR"
FT   CDS_pept        408858..409514
FT                   /transl_table=11
FT                   /gene="BCG_0349"
FT                   /locus_tag="BCG_0349"
FT                   /product="Possible conserved exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0349"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70334"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M181"
FT                   /protein_id="CAL70334.1"
FT                   /translation="MSRLLALLCAAVCTGCVAVVLAPVSLAVVNPWFANSVGNATQVVS
FT                   VVGTGGSTAKMDVYQRTAAGWQPLKTGITTHIGSAGMAPEAKSGYPATPMGVYSLDSAF
FT                   GTAPNPGGGLPYTQVGPNHWWSGDDNSPTFNSMQVCQKSQCPFSTADSENLQIPQYKHS
FT                   VVMGVNKAKVPGKGSAFFFHTTDGGPTAGCVAIDDATLVQIIRWLRPGAVIAIAK"
FT   CDS_pept        complement(409584..410075)
FT                   /transl_table=11
FT                   /gene="BCG_0350c"
FT                   /locus_tag="BCG_0350c"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0350c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70335"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7Q8"
FT                   /protein_id="CAL70335.1"
FT                   /translation="MCCNGVVTPGDPADIAAIKQLKYRYLRALDTKHWDDFTDTLAEDV
FT                   TGDYGSSVGTELHFTNRADLVDYLRQALGPGVITEHRVTHPEITVTGDTATGIWYLQDR
FT                   VIVAEFNFMLIGAAFYHDQYRRTTDGWRISATGYDRTYEATMSLAGLNFNIRPGRALAD
FT                   "
FT   CDS_pept        410099..411328
FT                   /transl_table=11
FT                   /gene="BCG_0351"
FT                   /locus_tag="BCG_0351"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0351"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70336"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M331"
FT                   /protein_id="CAL70336.1"
FT                   /translation="MSQSRYAGLSRSELAVLLPELLLIGQLIDRSGMAWCIQAFGRQEM
FT                   LQIAIEEWAGASPIYTKRMQKALNFEGDDVPTIFKGLQLDIGAPPQFMDFRFTLHDRWH
FT                   GEFHLDHCGALLDVEPMGDDYVVGMCHTIEDPTFDATAIATNPRAQVRPIHRPPRKPAD
FT                   RHPHCAWTVIIDESYPEAEGIPALDAVRETKAATWELDNVDASDDGLVDYSGPLVSDLD
FT                   FGAFSHSALVRMADEVCLQMHLLNLSFAIAVRKRAKADAQLAISVNTRQLIGVAGLGAE
FT                   RIHRAMALPGGIEGALGVLELHPLLNPAGYVLAETSPDRLVVHNSPAHADGAWISLCTP
FT                   ASVQPLQAIATAVDPHLKVRISGTDTDWTAELIEADAPASELPEVLVAKVSRGSVFQFE
FT                   PRRSLPLTVK"
FT   CDS_pept        411483..413345
FT                   /transl_table=11
FT                   /gene="BCG_0352"
FT                   /locus_tag="BCG_0352"
FT                   /product="Conserved hypothetical proline and threonine rich
FT                   protein"
FT                   /note="Differs from Rv0312 by 2aa, G159S, L563P"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0352"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70337"
FT                   /db_xref="GOA:A0A0H3MAA7"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAA7"
FT                   /protein_id="CAL70337.1"
FT                   /translation="MYDPLGLSIGTTNLVAAGNGGPPVTRRAVLTLYPHCAPKIGVPSQ
FT                   NPNLIEPGALMSGFVERIGDAVALVSPDGSVHDPDLLLVEALDAMVLTAGADASSSEIA
FT                   IAVPAHWKPGAVHALRNGLRTHVGFVRSGMAPRLVSDAIAALTAVNSELGLPHGGVVGL
FT                   LDFGGSATYVTLVETKSDSRTSDFQPVSATARYQDFSGSQIDQALLLRVIDQFGYGDDV
FT                   DPASTAAVGQLGQLREQCRAAKERLSTDVATELFAELAGCSSSIEMTREQLEDLIQDPL
FT                   TGFIYAFDDMLARHNASWADLAAVVTVGGGANIPLVTQRLSFHTRRPVLTASQPGCAAA
FT                   MGALLLANRGGERDSRTRTSIGLATAAAAGTSVIELPAGDVMVIDHEALTDRELAWSQT
FT                   DFPSEAPARFEGDSYNEGGPCWSMRLNAVEPPKGPAWRRIRVSQLLIGVSAVVAMTAIG
FT                   GVALTLTAIERRPSPLPTPIVPGLAPMPPGSVVPSSRAPTPPPPPSTVAPLPSAAPAPT
FT                   TVAPAPPPPTQVVTTTTAPPVTTTPRPSPTTTTTTAPPSTTTTTELPVTTTSTIPTIPT
FT                   TTTTVKMTTEWLHVPFLPVPIPVPIPQNPGAGEPQNPFGSLGSG"
FT   CDS_pept        413417..413803
FT                   /transl_table=11
FT                   /gene="BCG_0353"
FT                   /locus_tag="BCG_0353"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0353"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70338"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1Y1"
FT                   /protein_id="CAL70338.1"
FT                   /translation="MGDYGPFGFDPDEFDRVIREGSEGLRDAFERIGRFLSSSGAGTGW
FT                   SAIFEDLSRRSRPAPETAGEAGDGVWAIYTVDADGGARVEQVYATELDALRANKDNTDP
FT                   KRKVRFLPYGIAVSVLDDPVDEAQ"
FT   CDS_pept        complement(413806..414468)
FT                   /transl_table=11
FT                   /gene="BCG_0354c"
FT                   /locus_tag="BCG_0354c"
FT                   /product="Possible conserved membrane protein"
FT                   /note="Differs from Rv0314c by 1aa, A184V"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0354c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70339"
FT                   /db_xref="GOA:A0A0H3M185"
FT                   /db_xref="InterPro:IPR021417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M185"
FT                   /protein_id="CAL70339.1"
FT                   /translation="MIVVWEHLCMNPEDDPEARIRELERPLADVARASELGGSQSGGYT
FT                   YPPGPPPPPYSYGGPFGGPSPRSSSGNRAWWILAAVVVVGVLVLVGGIAAFSAQRLSQG
FT                   NFVVLSPTPSVSRAVPTPTAQPATTLPPAGASLSVSGVNVNRTIACNDSIVSVSGMSNT
FT                   VVITGHCTSLTVSGMRNSVTADSVDTIEAAGFNNEVTYHSGSPKISNAGGSNSVQQG"
FT   CDS_pept        414529..415413
FT                   /transl_table=11
FT                   /gene="BCG_0355"
FT                   /locus_tag="BCG_0355"
FT                   /product="Possible beta-1,3-glucanase precursor"
FT                   /EC_number="3.2.1.-"
FT                   /note="Differs from Rv0315 by 1aa, T260K"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0355"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70340"
FT                   /db_xref="GOA:A0A0H3M7R0"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7R0"
FT                   /protein_id="CAL70340.1"
FT                   /translation="MLMPEMDRRRMMMMAGFGALAAALPAPTAWADPSRPAAPAGPTPA
FT                   PAAPAAATGGLLFHDEFDGPAGSVPDPSKWQVSNHRTPIKNPVGFDRPQFFGQYRDSRQ
FT                   NVFLDGNSNLVLRATREGNRYFGGLVHGLWRGGIGTTWEARIKFNCLAPGMWPAWWLSN
FT                   DDPGRSGEIDLIEWYGNGTWPSGTTVHANPDGTAFETCPIGVDGGWHNWRVTWNPSGMY
FT                   FWLDYADGIEPYFSVPATGIEDLNEPIREWPFNDPGYTVFPVLNLAVGGSGGGDPATGS
FT                   YPQEMLVDWVRVF"
FT   CDS_pept        415462..416076
FT                   /transl_table=11
FT                   /gene="BCG_0356"
FT                   /locus_tag="BCG_0356"
FT                   /product="Possible muconolactone isomerase"
FT                   /EC_number="5.3.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0356"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70341"
FT                   /db_xref="GOA:A0A0H3M337"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR026029"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M337"
FT                   /protein_id="CAL70341.1"
FT                   /translation="MEFLVTMTTRVPDSMPADAVERVRAREAARSRELAAQGKLLRLWR
FT                   PPLRPGEWRTLGLFAADDNGELEQLLASMPPRSWRTDDVTPLGAHPNDPVGQGITIAPG
FT                   KGPEFLIATTIMVPPGTPAQVVDDTVAREARRAPELAGRGHLVRLWALPDGPDGQRTLG
FT                   LWRARDPGELMAILESLPLAGWMTIETTPLSPHPDDPIRMP"
FT   CDS_pept        complement(416100..416870)
FT                   /transl_table=11
FT                   /gene="glpQ2"
FT                   /locus_tag="BCG_0357c"
FT                   /product="Putative glycerophosphoryl diester
FT                   phosphodiesterase glpQ2"
FT                   /EC_number="3.1.4.46"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0357c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70342"
FT                   /db_xref="GOA:A0A0H3MAB0"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAB0"
FT                   /protein_id="CAL70342.1"
FT                   /translation="MEFLRHGGRIAMAHRGFTSFRLPMNSMGAFQEAAKLGFRYIETDV
FT                   RATRDGVAVILHDRRLAPGVGLSGAVDRLDWRDVRKAQLGAGQSIPTLEDLLTALPDMR
FT                   VNIDIKAASAIEPTVNVIERCNAHNRVLIGSFSERRRRRALRLLTKRVASSAGTGALLA
FT                   WLTARPLGSRAYAWRMMRDIDCVQLPSRLGGVPVITPARVRGFHAAGRQVHAWTVDEPD
FT                   VMHTLLDMDVDGIITDRADLLRDVLIARGEWDGA"
FT   tRNA            complement(417131..417201)
FT                   /gene="tRNA-Gly"
FT                   /locus_tag="glyU"
FT                   /product="transfer RNA-Gly"
FT                   /anticodon="(pos:417167..417169,aa:Gly)"
FT                   /note="glyU, len: 71 nt. Equivalent to glyU, len: 71 nt,
FT                   from Mycobacterium tuberculosis strain H37Rv, (100.0%
FT                   identity in 71 nt overlap). tRNA-Gly, anticodon ccc"
FT   CDS_pept        complement(417232..418026)
FT                   /transl_table=11
FT                   /gene="BCG_0358c"
FT                   /locus_tag="BCG_0358c"
FT                   /product="Probable conserved integral membrane protein"
FT                   /note="Differs from Rv0318c by 1aa, A223G"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0358c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70343"
FT                   /db_xref="GOA:A0A0H3M1Y3"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1Y3"
FT                   /protein_id="CAL70343.1"
FT                   /translation="MSLAVTMFKRARAEIFDRNREVGISNVTTAASLVTFPVLAGILGG
FT                   VVPSVRTPSAAMVSGVQHFAAGIVMAAVAGEVLPDLRSRGPLWLIVVGFSAGVAVLVAL
FT                   RRFDGHGEHQDGDDVGELPVGFLTVVAVDLFIDGLLVATGATVSSRTAIIITIALTVEV
FT                   LFLGLAVALRLAGSGMPRIRAAATTSALSLVIAVGGVSGAVALGRAGNTVLTLVLAFAA
FT                   AALLWLVVEELLVEAHETPERPWMAVMFFAGFLILYGLGVME"
FT   CDS_pept        418075..418743
FT                   /transl_table=11
FT                   /gene="pcp"
FT                   /locus_tag="BCG_0359"
FT                   /product="Probable pyrrolidone-carboxylate peptidase pcp"
FT                   /EC_number="3.4.19.3"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0359"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70344"
FT                   /db_xref="GOA:A1KFE2"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="InterPro:IPR016125"
FT                   /db_xref="InterPro:IPR029762"
FT                   /db_xref="InterPro:IPR033693"
FT                   /db_xref="InterPro:IPR033694"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KFE2"
FT                   /protein_id="CAL70344.1"
FT                   /translation="MSKVLVTGFGPYGVTPVNPAQLTAEELDGRTIAGATVISRIVPNT
FT                   FFESIAAAQQAIAEIEPALVIMLGEYPGRSMITVERLAQNVNDCGRYGLADCAGRVLVG
FT                   EPTDPAGPVAYHATVPVRAMVLAMRKAGVPADVSDAAGTFVCNHLMYGVLHHLAQKGLP
FT                   VRAGWIHLPCLPSVAALDHNLGVPSMSVQTAVAGVTAGIEAAIRQSADIREPIPSRLQI
FT                   "
FT   CDS_pept        418815..419477
FT                   /transl_table=11
FT                   /gene="BCG_0360"
FT                   /locus_tag="BCG_0360"
FT                   /product="Possible conserved exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0360"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70345"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M189"
FT                   /protein_id="CAL70345.1"
FT                   /translation="MGRHELARDRRKSSAVLAAVLAPAAVFFATGGDVSTLAARADANP
FT                   VLGDDAPCCVQIVPVAPLAFSSQISGGEIGTGLAASQFASASRWRIVSRYLPVGVAPEQ
FT                   GLQVKTVLTARSISAAFPEIREIGGVRPDALRWHPNGLALDVMVPNPGTAEGIALGNEI
FT                   VAFVLKNATRFGMQDVIWRGAYYTPNGARTTGAGHYDHIHITTVGGGYPTGEELYIR"
FT   CDS_pept        419509..420081
FT                   /transl_table=11
FT                   /gene="dcd"
FT                   /locus_tag="BCG_0361"
FT                   /product="Probable deoxycytidine triphosphate deaminase
FT                   dcd"
FT                   /EC_number="3.5.4.13"
FT                   /note="Differs from Rv0321 by 1aa, C183Y"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0361"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70346"
FT                   /db_xref="GOA:A1KFE4"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KFE4"
FT                   /protein_id="CAL70346.1"
FT                   /translation="MLLSDRDLRAEISSGRLGIDPFDDTLVQPSSIDVRLDCLFRVFNN
FT                   TRYTHIDPAKQQDELTSLVQPVDGEPFVLHPGEFVLGSTLELFTLPDNLAGRLEGKSSL
FT                   GRLGLLTHSTAGFIDPGFSGHITLELSNVANLPITLWPGMKIGQLCMLRLTSPSEHPYG
FT                   SSRAGSKYQGQRGPTPSRSCQNFIRST"
FT   CDS_pept        420187..421518
FT                   /transl_table=11
FT                   /gene="udgA"
FT                   /locus_tag="BCG_0362"
FT                   /product="Probable udp-glucose 6-dehydrogenase udgA"
FT                   /EC_number="1.1.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0362"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70347"
FT                   /db_xref="GOA:A0A0H3M7R5"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7R5"
FT                   /protein_id="CAL70347.1"
FT                   /translation="MRCSVFGTGYLGATHAVGMAQLGHEVVGVDIDPGKVAKLAGGDIP
FT                   FYEPGLRKLLTDNLAAGRLRFTTDYDMAADFADVHFLGVGTPQKIGEYGADLRHVHAVI
FT                   DALVPRLVRASILVGKSTVPVGTAAELGHRAGALAPRGVDVEIAWNPEFLREGFAVHDT
FT                   LNPDRIVLGVQDDSTRAEVAVRELYAPLLAAGVPFLVTDLQTAELVKVSANAFLATKIS
FT                   FINAISEVCEAAGADVSQLADALGYDPRIGRQCLNAGLGFGGGCLPKDIRAFMARAGEL
FT                   GADQALTFLREVDSINMRRRTKMVELATTACGGSLLGANIAVLGAAFKPESDDVRDSPA
FT                   LNVAGQLQLNGATVHVYDPKALDNAHRLFPTLNYAVSVAEACERADAVLVLTEWREFID
FT                   LEPADLANRVRARVIVDGRNCLDVTRWRRAGWRVFRLGVPRLGH"
FT   CDS_pept        complement(421507..422178)
FT                   /transl_table=11
FT                   /gene="BCG_0363c"
FT                   /locus_tag="BCG_0363c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Differs from Rv0323c by 1aa, G142S"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0363c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70348"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M344"
FT                   /protein_id="CAL70348.1"
FT                   /translation="MNSCNRLPCAHEVLAVFAHPDDESFGLGAVLGDFTAQGTRLRGLC
FT                   FTHGEASTLGRTDRNLGEVRREELAAAAQVLGVDHVQLLAYPDNGLAQIPLNELTQRVV
FT                   DALAGADLLLVFDDNGVTGHPDHRRATEAALAAASTPGIPVLAWALPQPIADRLNAEFS
FT                   ASFGGRGHGHLDIMIEVDRSRQLAAIGCHFTQSADNPVLWRRLELLGDREYLRWLRRSV
FT                   P"
FT   CDS_pept        422279..422959
FT                   /transl_table=11
FT                   /gene="BCG_0364"
FT                   /locus_tag="BCG_0364"
FT                   /product="Possible transcriptional regulatory protein
FT                   (possibly arsR-family)"
FT                   /note="Differs from Rv0324 by 1aa, A168T"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0364"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70349"
FT                   /db_xref="GOA:A0A0H3MAB3"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAB3"
FT                   /protein_id="CAL70349.1"
FT                   /translation="MAGQSDRKAALLDQVARVGKALANGRRLQILDLLAQGERAVEAIA
FT                   TATGMNLTTASANLQALKSGGLVEARREGTRQYYRIAGEDVARLFALVQVVADEHLADV
FT                   AVAAADVLGSPEDAITRAELLRRREAGEVTLVDVRPHEEYQAGHIPGAINIPIAELADR
FT                   LAELAGDRDIVAYCRGAYCVMAPDAVRIARDAGREVKRLDDGMLEWRLAGLPVDEGAPV
FT                   GHGD"
FT   CDS_pept        422966..423655
FT                   /transl_table=11
FT                   /gene="BCG_0365"
FT                   /locus_tag="BCG_0365"
FT                   /product="Hypothetical protein"
FT                   /note="In Mycobacterium tuberculosis strain H37Rv, Rv0325
FT                   and Rv0326 exist as 2 genes. In Mycobacterium bovis BCG
FT                   Pasteur, and Mycobacterium bovis, the absence of a stop
FT                   codon between Rv0325 and Rv0326 due to a single base
FT                   transition (t-c) leads to single product"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0365"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70350"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1Y9"
FT                   /protein_id="CAL70350.1"
FT                   /translation="MGPKGSLRLVKRQPELLVAQHEHWQDTYRAHPVLYGTRPSEPGVY
FT                   AAEVFNADGVQRVLELAAGHGRDTLYFAGQGFTVVATDFSDVAVAQLRRSAQARGVSAR
FT                   VQPIVHDLRQPLPVKTGSIDGAFAHMALCMALSTSEIHAVVAEVGRVLRPGGKFIYTVR
FT                   HTGDAHYGAGQAHGDDIFECAGFAVHFFRRELVARLATGWVLEEVHDFEEGELPRRLWR
FT                   VTVTKPA"
FT   CDS_pept        complement(423623..424972)
FT                   /transl_table=11
FT                   /gene="cyp135A1"
FT                   /locus_tag="BCG_0366c"
FT                   /product="Possible cytochrome P450 135A1 cyp135A1"
FT                   /EC_number="1.14.-.-"
FT                   /note="Differs from Rv0327c by 1aa, Y100H"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0366c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70351"
FT                   /db_xref="GOA:A0A0H3M194"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M194"
FT                   /protein_id="CAL70351.1"
FT                   /translation="MASTLTTGLPPGPRLPRYLQSVLYLRFREWFLPAMHRKYGDVFSL
FT                   RVPPYADNLVVYTRPEHIKEIFAADPRSLHAGEGNHILGFVMGEHSVLMTDEAEYARMR
FT                   SLLMPAFTRAALRGYRDMIASVAREHITRWRPHATINSLDHMNALTLDIILRVVFGVTD
FT                   PKVKAELTSRLQQIINIHPAILAGVPYPSLKRMNPWKRFFHNQTKIDEILYREIASRRI
FT                   DSDLTARTDVLSRLLQTKDTPTKPLTDAELRDQLITLLLAGHETTAAALSWTLWELAHA
FT                   PEIQSQVVWAAVGGDDGFLEAVLKEGMRRHTVIASTARKVTAPAEIGGWRLPAGTVVNT
FT                   SILLAHASEVSHPKPTEFRPSRFLDGSVAPNTWLPFGGGVRRCLGFGFALTEGAVILQE
FT                   IFRRFTITAAGPSKGETPLVRNITTVPKHGAHLRLIPQRRLGGLGDSDPP"
FT   CDS_pept        425038..425640
FT                   /transl_table=11
FT                   /gene="BCG_0367"
FT                   /locus_tag="BCG_0367"
FT                   /product="Possible transcriptional regulatory protein
FT                   (possibly tetR/acrR-family)"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0367"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70352"
FT                   /db_xref="GOA:A0A0H3M7R7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7R7"
FT                   /protein_id="CAL70352.1"
FT                   /translation="MQQQRTNRDKLLDGALACLRERGYGNTSSRDIARAAGVNIASINY
FT                   HFGSKDALLDDALGRCFSTWNQRVQEAFDHSRAAGPAGQILAVLEATVDSFEQIRPAVY
FT                   ACVESYAPALRSEALRERLAAGYADVRQHSVDLAGAALAGTDIAPPENLSTIVSVLMAV
FT                   IDGLMIQWIADPSATPRSTEVIRALASIGAVVTSQLR"
FT   CDS_pept        complement(425621..426247)
FT                   /transl_table=11
FT                   /gene="BCG_0368c"
FT                   /locus_tag="BCG_0368c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Differs from Rv0329c by 1aa, S129W"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0368c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70353"
FT                   /db_xref="GOA:A0A0H3M351"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M351"
FT                   /protein_id="CAL70353.1"
FT                   /translation="MRLTHPARRYLSSQAARPTGAFGRLLGRIWRAETADVNRIAVELL
FT                   APGPGERVCEIGFGPGRTLGLLAAAGAQVSGVEVSTTMIAIAAHHNAKAIAAGLISLYH
FT                   GDGVTLPVADHSLDKVLGVHNFYFSPDPRASLCDIARALRPGGRLVLTSISDDQPLAAR
FT                   FDPAIYRVPPTLDTAAWLGAAGFIDVGIKRSADHPATVWFTATAT"
FT   CDS_pept        complement(426274..427014)
FT                   /transl_table=11
FT                   /gene="BCG_0369c"
FT                   /locus_tag="BCG_0369c"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0369c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70354"
FT                   /db_xref="GOA:A0A0H3MAB6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAB6"
FT                   /protein_id="CAL70354.1"
FT                   /translation="MARSIPADRFSAIVAASARVFIAHGYQRTQVQDVADALALAKGTL
FT                   YGYAQGKAALFAAAVRYGDAQEALPLASELPVAAPVAGEIAAVVSARLAGEVTDMRLTH
FT                   ALRATLPPGATTGDARAELAGIVTDLYSRLARHRIALKLVDRCAPELPDLAEVWFGTGR
FT                   NAQVDAVQAYLVHRERAGLLILPGPAPMVARTIVELCALWAVHLHFDPSPEPWSIVQPG
FT                   VIDDDAIAATLAEFVVRATTASSD"
FT   CDS_pept        427128..428294
FT                   /transl_table=11
FT                   /gene="BCG_0370"
FT                   /locus_tag="BCG_0370"
FT                   /product="Possible dehydrogenase/reductase"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0370"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70355"
FT                   /db_xref="GOA:A0A0H3M1Z1"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1Z1"
FT                   /protein_id="CAL70355.1"
FT                   /translation="MSKTVLILGAGVGGLTTADTLRQLLPPEDRIILVDRSFDGTLGLS
FT                   LLWVLRGWRRPDDVRVRPTAASLPGVEMVTATVAHIDIAAQVVHTDNSVIGYDALVIAL
FT                   GAALNTDAVPGLSDALDADVAGQFYTLDGAAELRAKVEALEHGRIAVAIAGVPFKCPAA
FT                   PFEAAFLIAAQLGDRYATGTVQIDTFTPDPLPMPVAGPEVGEALVSMLKDHGVGFHPRK
FT                   ALARVDEAARTMHFGDGTSEPFDLLAVVPPHVPSAAARSAGLSESGWIPVDPRTLSTSA
FT                   DNVWAIGDATVLTLPNGKPLPKAAVFAEAQAAVVAHGVARHLGYDVAERHFTGTGACYV
FT                   ETGDHQAAKGDGDFFAPSAPSVTLYPPSREFHEEKVAQELAWLTRWKT"
FT   CDS_pept        428369..429154
FT                   /transl_table=11
FT                   /gene="BCG_0371"
FT                   /locus_tag="BCG_0371"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Differs from Rv0332 by 1aa, G198E"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0371"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70356"
FT                   /db_xref="GOA:A0A0H3M1A0"
FT                   /db_xref="InterPro:IPR010872"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1A0"
FT                   /protein_id="CAL70356.1"
FT                   /translation="MRKPASSLAKVDYSSAYLEQTHAFGELIRNVDQSTPVPTCPGWSL
FT                   GQLFRHVGRGDRWAAQIVRDRLDHFLDPRSVEGGKPPPDPDDAISWLYGGARLLVDAVE
FT                   QTGVETPVWTFLGPRPAGWWVRRRLHEVAVHRADVAITVGGEFTLEPNVAADGISEFLE
FT                   RIAVQAGSGGTPLPLEDDDTLHLHATDPGLLEAGGWTVRRDERGVTWSHRHGKGAVALR
FT                   GGATELLLAMVRRLSVADTGIELLGDAGVWQKWLDRTPL"
FT   CDS_pept        429181..429555
FT                   /transl_table=11
FT                   /gene="BCG_0372"
FT                   /locus_tag="BCG_0372"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0372"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70357"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7S1"
FT                   /protein_id="CAL70357.1"
FT                   /translation="MTTSEIATVLAWHDALNAADIETLVALSTDDIDIGDAHGAVQGHD
FT                   ALRGWASSLTTTAELGRMYVHHGVVVVEQKITSGEDPGIARTGAAAFRVVQDHVASVFR
FT                   HEDLASALAATELTEDDLVD"
FT   CDS_pept        429585..430451
FT                   /transl_table=11
FT                   /gene="rmlA"
FT                   /locus_tag="BCG_0373"
FT                   /product="Probable glucose-1-phosphate
FT                   thymidylyltransferase rmlA"
FT                   /EC_number="2.7.7.24"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0373"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70358"
FT                   /db_xref="GOA:A0A0H3M357"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M357"
FT                   /protein_id="CAL70358.1"
FT                   /translation="MRGIILAGGSGTRLYPITMGISKQLLPVYDKPMIYYPLTTLMMAG
FT                   IRDIQLITTPHDAPGFHRLLGDGAHLGVNISYATQDQPDGLAQAFVIGANHIGADSVAL
FT                   VLGDNIFYGPGLGTSLKRFQSISGGAIFAYWVANPSAYGVVEFGAEGMALSLEEKPVTP
FT                   KSNYAVPGLYFYDNDVIEIARGLKKSARGEYEITEVNQVYLNQGRLAVEVLARGTAWLD
FT                   TGTFDSLLDAADFVRTLERRQGLKVSIPEEVAWRMGWIDDEQLVQRARALVKSGYGNYL
FT                   LELLERN"
FT   CDS_pept        complement(430462..430977)
FT                   /transl_table=11
FT                   /gene="PE6"
FT                   /locus_tag="BCG_0374c"
FT                   /product="PE family protein"
FT                   /note="Differs from Rv0335c and Mb0340 by 1aa P131T"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0374c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70359"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAB9"
FT                   /protein_id="CAL70359.1"
FT                   /translation="MRSMGFLHRACRAPSSLPAPLMARPGRSVLARPAATPPGPLCATT
FT                   RPRPPQGNQPPASRISNFPPKRHKTRVLAAAEDEVSAAVAALISAHGRRHHSLNNQAAA
FT                   FHGQFAQNLNVGAGSCASAETTADAPPQALLGPADRQRRQRRAVRQWLVRWAAHPGRAT
FT                   RGFHNHRQ"
FT   CDS_pept        431119..432630
FT                   /transl_table=11
FT                   /gene="BCG_0375"
FT                   /locus_tag="BCG_0375"
FT                   /product="Conserved 13E12 repeat family protein"
FT                   /note="Differs from Rv0336 by 1aa, H496P"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0375"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70360"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2Q9G6"
FT                   /protein_id="CAL70360.1"
FT                   /translation="MPSPEAIAHFDERFECHAPRTTRVSAAFIDRICSATRAENRAAAA
FT                   QLVALGELFAYRWSRCGGREEWVMDTMAAVAAEVAAALRISQGLAASRLRYARAMRERL
FT                   PKTAEVFSAGDIGYLMFATIVYRTDLIVDPDVLAAVDAQLAANVARWPSMTKARLAGQV
FT                   DKIVARADADAVRRRKEYQAQRQFWVGESQDGVCQIGGSLLAVDAHALDARLSALAGTV
FT                   CEHDPRSREQRRADALGALAGGADRLGCGCGRADCAAGKRPAAPPVVIHLIAEAATING
FT                   TGSAPASQMNADGLITAELVAELAKTATLVPLVHPGDAPPEPGYAPSKALADFVRCRDL
FT                   TCRWPGCDEPATNCDLDHTIPYAAGGPTHASNLKCYCRTHHLVKTFWGWRDQQLPDGTL
FT                   ILTSPSGHTYVSTPGSALLFPSLCHFSGGIPAPEADPPYDHCDQRTAMMPKRRRTRAQD
FT                   RAYRIATERRQNHAARQRAQVLTQTAAATDTHGPPPDHNDDPPPF"
FT   CDS_pept        complement(432800..434089)
FT                   /transl_table=11
FT                   /gene="aspC"
FT                   /locus_tag="BCG_0376c"
FT                   /product="Probable aspartate aminotransferase aspC"
FT                   /EC_number="2.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0376c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70361"
FT                   /db_xref="GOA:A0A0H3M1Z4"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1Z4"
FT                   /protein_id="CAL70361.1"
FT                   /translation="MDNDGTIVDVTTHQLPWHTASHQRQRAFAQSAKLQDVLYEIRGPV
FT                   HQHAARLEAEGHRILKLNIGNPAPFGFEAPDVIMRDIIQALPYAQGYSDSQGILSARRA
FT                   VVTRYELVPGFPRFDVDDVYLGNGVSELITMTLQALLDNGDQVLIPSPDYPLWTASTSL
FT                   AGGTPVHYLCDETQGWQPDIADLESKITERTKALVVINPNNPTGAVYSCEILTQMVDLA
FT                   RKHQLLLLADEIYDKILYDDAKHISLASIAPDMLCLTFNGLSKAYRVAGYRAGWLAITG
FT                   PKEHASSFIEGIGLLANMRLCPNVPAQHAIQVALGGHQSIEDLVLPGGRLLEQRDIAWT
FT                   KLNEIPGVSCVKPAGALYAFPRLDPEVYDIDDDEQLVLDLLLSEKILVTQGTGFNWPAP
FT                   DHLRLVTLPWSRDLAAAIERLGNFLVSYRQ"
FT   CDS_pept        complement(434120..436768)
FT                   /transl_table=11
FT                   /gene="BCG_0377c"
FT                   /locus_tag="BCG_0377c"
FT                   /product="Putative iron-sulfur-binding reductase"
FT                   /EC_number="1.-.-.-"
FT                   /note="Differs from Rv0338c by 2aa, G506R, V621A"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0377c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70362"
FT                   /db_xref="GOA:A0A0H3M1A4"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1A4"
FT                   /protein_id="CAL70362.1"
FT                   /translation="MTTQTLIRLILGMSMTAVVGVFALRRVWWLYKLVMSGQPASGRTD
FT                   NLGTRIWTQISEVLGQRRLLKWSIPGLAHFFTMWGFFILLTVYIEAYGLLFEERFHIPV
FT                   IGRWDALGFLQDFFATAVFLGITTFAIIRILRNPREIGRSSRFYGSHNGGAWLVLLMIF
FT                   NVIWTYVLVRGSAVNNGTLPYGNGAFLSQLFGAILRPLGQPANEIIETTALLLHIGVML
FT                   AFLILVLHSKHLHIFLAPINVTFKRLPDGLGPLLPLEADGKPIDFENPSEDAVFGRGKI
FT                   EDFTWKGMLDFATCTECGRCQSQCPAWNTGKPLSPKLVIMDLRDHWMAKAPYILGQKDA
FT                   SAGGEAGHQEHHHVPESGFGRVPGHGPEQATRPLVGTEEQGGVIDPDVLWSCVTCGACV
FT                   EQCPVDIEHVDHIVDMRRYQVMMESEFPSELSVLFKNLETKGNPWGQNASDRTNWIDEV
FT                   DFDVPVYGQDVDSFDGYEYLFWVGCAGAYDDKAKKTTKAVAELLAVAGVKYLVLGAGET
FT                   CNGDSARRSGNEFLFQQLAQQAVETLDGLFEGVETVDRKIVVTCPHCFNTIGKEYRQLG
FT                   ANYTVLHHTQLLNRLVRDKRLVPVTPVSQDITYHDPCYLGRHNKVYEAPRELIGAAGAS
FT                   LTEMPRHADRSFCCGAGGARMWMEEHIGKRINHERVDEALATDATAIATACPFCRVMVT
FT                   DGVNDRQEEAGRSGVEVLDVAQVLLGSLDHDKAQLPAKGTAAKQAQERAPKAAPKAAAP
FT                   VTPVEAPAEAPQAPAPAAPAAPVKGLGMAAGAKRPGAKKAAPTPAAPAAPAAPVKGLGI
FT                   AAGAKRPGAKKTPPPAPGLAEPAAQPQPEAKPQPEPAAPPKPQTDGDPAAPAAPVKGLG
FT                   IARGARPPGKR"
FT   CDS_pept        complement(436877..439375)
FT                   /transl_table=11
FT                   /gene="BCG_0378c"
FT                   /locus_tag="BCG_0378c"
FT                   /product="Possible transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0378c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70363"
FT                   /db_xref="GOA:A0A0H3M7S4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7S4"
FT                   /protein_id="CAL70363.1"
FT                   /translation="MQHRGCKNRGQAYDASVTDSLTEVPPAARRALLELANAPTVPVKV
FT                   LITGGIGTGKTTVLAAARDTLRRSGLTVLACPPPDGEPPETALVIDDAQLLTDTELLRL
FT                   TERVADSRLTVVAAAEAREHHRALRALTMALERDRPRISLGPLPVAEHLRDCTAGLPFL
FT                   IHAVSARAQAPAQAAKVALIERLRRLDEPTLDTLLMMSLTHELGVSDVAAALGISVTDA
FT                   RGLVDRAHASGLIESSHTAAFLQSVHDAIAQIVGNAHHHEVETSLLRSQLDISPVSAEL
FT                   ALRLAEHGLRDERLADILTRYAADTRDASVRCARLYRAAVHAGAKGLTVRLADALARTG
FT                   DCTAAATLADDLLSSPDATERAAAVRVAASVAVHDGNTGHAAELFGWLGPHPDTMVSSA
FT                   ATIVFAANGDLATARATLRLKDAGPPTMAARCARNLAEGLLLTMDQPYPVAMAKLGQAI
FT                   ATEQSLSQVIPDSPAALVTLAAIHAGDPVRARSVIGRAVRAGADPLFQRRHLLLSGWIK
FT                   MQEGQLPSASADVAAASAGTHLHRRDALWAAALQTAISRRTGDIGALQQHWYAAMEALA
FT                   EYSLDLFALLPLGELWVAAARMRQVDQLQHTLDQALTLLDSLGNPALWSNSLHWAGVHA
FT                   GILANSPESVAPHGQALGAMVAHSTLAQALSDAGRTWLRVLAENVDADEVTAAARSLSH
FT                   VGLTSDATRLAGQAALQTSDARVSGAMLQLARDLKLGNDFGEPPSGAGDTEPASGTPPA
FT                   PRQPPAGSPLSDREREVAELLLLGMPYRDIGARLFISAKTVEHHVARIRQRLGAGSRSE
FT                   MLSMLRAMLAPESLTADERR"
FT   CDS_pept        439561..440100
FT                   /transl_table=11
FT                   /gene="BCG_0379"
FT                   /locus_tag="BCG_0379"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0379"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70364"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M365"
FT                   /protein_id="CAL70364.1"
FT                   /translation="MANSLLDFVISLVRDPEAAARYAANPERSIAEAHLTDVTRADVNS
FT                   LIPVVSDSLSMSEPIGAAGGAHAGDRGNVWASGAATAALDAFAPHADAGVVQQHGAVGS
FT                   VLNQPTPPGPGVTPTDPRPFRAGPHETSALLTSAEIPDTTSEDGGLPTDHPAVWNHPVV
FT                   DPHTVEPDHHGYDIHG"
FT   CDS_pept        440289..441728
FT                   /transl_table=11
FT                   /gene="iniB"
FT                   /locus_tag="BCG_0380"
FT                   /product="Isoniazid inductible gene protein iniB"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0380"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70365"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAC3"
FT                   /protein_id="CAL70365.1"
FT                   /translation="MTSLIDYILSLFRSEDAARSFVAAPGRAMTSAGLIDIAPHQISSV
FT                   AANVVPGLNLGAGDPMSGLRQAVAARHGFAQDVANVGFAGDAGAGVASVITTDVGAGLA
FT                   SGLGAGFLGQGGLALAASSGGFGGQVGLAAQVGLGFTAVIEAEVGAQVGAGLGIGTGLG
FT                   AQAGMGFGGGVGLGLGGQAGGVIGGSAAGAIGAGVGGRLGGNGQIGVAGQGAVGAGVGA
FT                   GVGGQAGIASQIGVSAGGGLGGVGNVSGLTGVSSNAVLASNASGQAGLIASEGAALNGA
FT                   AMPHLSGPLAGVGVGGQAGAAGGAGLGFGAVGHPTPQPAALGAAGVVAKTEAAAGVVGG
FT                   VGGATAAGVGGAHGDILGHEGAALGSVDTVNAGVTPVEHGLVLPSGPLIHGGTGGYGGM
FT                   NPPVTDAPAPQVPARAQPMTTAAEHTPAVTQPQHTPVEPPVHDKPPSHSVFDVGHEPPV
FT                   THTPPAPIELPSYGLFGLPGF"
FT   CDS_pept        441765..443687
FT                   /transl_table=11
FT                   /gene="iniA"
FT                   /locus_tag="BCG_0381"
FT                   /product="Isoniazid inductible gene protein iniA"
FT                   /note="Differs from by 2aa, S88N, Q481H"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0381"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70366"
FT                   /db_xref="GOA:A0A0H3M1Z8"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1Z8"
FT                   /protein_id="CAL70366.1"
FT                   /translation="MVPAGLCAYRDLRRKRARKWGDTVTQPDDPRRVGVIVELIDHTIA
FT                   IAKLNERGDLVQRLTRARQRITDPQVRVVIAGLLKQGKSQLLSSLLNLPAARVGDDEAT
FT                   VVITVVSYSAQPSARLVLAAGPDGTTAAVDIPVDDISTDVRRAPHAGGREVLRVEVGAP
FT                   SPLLRGGLAFIDTPGVGGLGQPHLSATLGLLPEADAVLVVSDTSQEFTEPEMWFVRQAH
FT                   QICPVGAVVATKTDLYPRWREIVNANAAHLQRARVPMPIIAVSSLLRSHAVTLNDKELN
FT                   EESNFPAIVKFLSEQVLSRATERVRAGVLGEIRSATEQLAVSLGSELSVVNDPNLRDRL
FT                   ASDLERRKREAQQAVQQTALWQQVLGDGFNDLTADVDHDLRTRFRTVTEDAERQIDSCD
FT                   PTAHWAEIGNDVENAIATAVGDNFVWAYQRSEALADDVARSFADAGLDSVLSAELSPHV
FT                   MGTDFGRLKALGRMESKPLRRGQKMIIGMRGSYGGVVMIGMLSSVVGLGLFNPLSVGAG
FT                   LILGRMAYKEDKQNRLLRVRSEAKANVRRFVDDISFVVSKQSRDRLKMIQRLLRDHYRE
FT                   IAEEITRSLTESLQATIAAAQVAETERDNRIRELQRQLGILSQVNDNLAGLEPTLTPRA
FT                   SLGRA"
FT   CDS_pept        443684..445165
FT                   /transl_table=11
FT                   /gene="iniC"
FT                   /locus_tag="BCG_0382"
FT                   /product="Isoniazid inductible gene protein iniC"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0382"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70367"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1A8"
FT                   /protein_id="CAL70367.1"
FT                   /translation="MSTSDRVRAILHATIQAYRGAPAYRQRGDVFCQLDRIGARLAEPL
FT                   RIALAGTLKAGKSTLVNALVGDDIAPTDATEATRIVTWFRHGPTPRVTANHRGGRRANV
FT                   PITRRGGLSFDLRRINPAELIDLEVEWPAEELIDATIVDTPGTSSLACDASERTLRLLV
FT                   PADGVPRVDAVVFLLRTLNAADVALLKQIGGLVGGSVGALGIIGVASRADEIGAGRIDA
FT                   MLSANDVAKRFTRELNQMGICQAVVPVSGLLALTARTLRQTEFIALRKLAGAERTELNR
FT                   ALLSVDRFVRRDSPLPVDAGIRAQLLERFGMFGIRMSIAVLAAGVTDSTGLAAELLERS
FT                   GLVALRNVIDQQFAQRSDMLKAHTALVSLRRFVQTHPVPATPYVIADIDPLLADTHAFE
FT                   ELRMLSLLPSRATTLNDDEIASLRRIIGGSGTSAAARLGLDPANSREAPRAALAAAQHW
FT                   RRRAAHPLNDPFTTRACRAAVRSAEAMVAEFSARR"
FT   CDS_pept        complement(445308..445868)
FT                   /transl_table=11
FT                   /gene="lpqJ"
FT                   /locus_tag="BCG_0383c"
FT                   /product="Probable lipoprotein lpqJ"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0383c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70368"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7S8"
FT                   /protein_id="CAL70368.1"
FT                   /translation="MRLSLIARGMAALLAATALVAGCNTTIDGRPVASPGSGPTEPTFP
FT                   TPRPTTAPPGTTAPTLPTTPVSPTAPAGAIPLPPDSNGYVFIETKSGMTRCQINRDSVG
FT                   CEAPFTNSPLRDGEHANGIHITAGGSVQWVLGNLGAIPTVSIDYRTYEAQGWTIDATTD
FT                   GTRFTNNRTGHGMFVSIEKVDTF"
FT   CDS_pept        445977..446387
FT                   /transl_table=11
FT                   /gene="BCG_0384"
FT                   /locus_tag="BCG_0384"
FT                   /product="Conserved hypothetical protein"
FT                   /note="In Mycobacterium bovis, a frameshift due to a single
FT                   base deletion (a-*) leads to a shorter product with a
FT                   different NH2 part compared to its homolog in Mycobacterium
FT                   tuberculosis strain H37Rv in Mycobacterium bovis BCG
FT                   Pasteur"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0384"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70369"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M371"
FT                   /protein_id="CAL70369.1"
FT                   /translation="MLPSTVVGVLLAAGAGRWYGKPKVLVDGWLDTAVGALRDGGCNDV
FT                   ILVLGAVEVSAPAGVTAITAPDWQQGLSASVRAGLAQADREHADYAVLHVIDTPDVNAK
FT                   VVARVLGRALVSRSGLAGRGRIPAHSARRRGC"
FT   CDS_pept        complement(446429..447892)
FT                   /transl_table=11
FT                   /gene="ansP2"
FT                   /locus_tag="BCG_0385c"
FT                   /standard_name="aroP2"
FT                   /product="Possible l-asparagine permease ansP2"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0385c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70370"
FT                   /db_xref="GOA:A0A0H3MAC6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAC6"
FT                   /protein_id="CAL70370.1"
FT                   /translation="MPPLDITDERLTREDTGYHKGLHSRQLQMIALGGAIGTGLFLGAG
FT                   GRLASAGPGLFLVYGICGIFVFLILRALGELVLHRPSSGSFVSYAREFYGEKVAFVAGW
FT                   MYFLNWAMTGIVDTTAIAHYCHYWRAFQPIPQWTLALIALLVVLSMNLISVRLFGELEF
FT                   WASLIKVIALVTFLIVGTVFLAGRYKIDGQETGVSLWSSHGGIVPTGLLPIVLVTSGVV
FT                   FAYAAIELVGIAAGETAEPAKIMPRAINSVVLRIACFYVGSTVLLALLLPYTAYKEHVS
FT                   PFVTFFSKIGIDAAGSVMNLVVLTAALSSLNAGLYSTGRILRSMAINGSGPRFTAPMSK
FT                   TGVPYGGILLTAGIGLLGIILNAIKPSQAFEIVLHIAATGVIAAWATIVACQLRLHRMA
FT                   NAGQLQRPKFRMPLSPFSGYLTLAFLAGVLILMYFDEQHGPWMIAATVIGVPALIGGWY
FT                   LVRNRVTAVAHHAIDHTKSVAVVHSADPI"
FT   CDS_pept        448231..449217
FT                   /transl_table=11
FT                   /gene="BCG_0386"
FT                   /locus_tag="BCG_0386"
FT                   /product="Probable conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0386"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70371"
FT                   /db_xref="GOA:A0A0H3M204"
FT                   /db_xref="InterPro:IPR026349"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M204"
FT                   /protein_id="CAL70371.1"
FT                   /translation="MPGARELTLRVERGALFRRRWAASAASSARAAIRRDPRRCALGTR
FT                   PRWVSFLVIVLVIMNVVTAHPKYPNDPLALVLIELRHPRTEPPVPSAISILKEELARWT
FT                   PILEQEEVRQVNLETGEHTAHSQKKLVARDRRTAITFRPDAMTLEVTDYPGWEEFRSIV
FT                   HAMVTARQDVAPVDGCIRIGLRYINEIRASLAEPSGWAYWVAESLLGPGTQLADLKLTT
FT                   TAQRHVIQCEGPEPGDSLTLRYAGARGAVIQSTPFLQRLKEPPAEGDFFLIDIDSAWSD
FT                   PCKGIPALDAHLVDEVAERLHTPIGPLFESLITSELRTKVLQQPGQE"
FT   CDS_pept        449220..449873
FT                   /transl_table=11
FT                   /gene="BCG_0387"
FT                   /locus_tag="BCG_0387"
FT                   /product="Possible transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0387"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70372"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1B5"
FT                   /protein_id="CAL70372.1"
FT                   /translation="MTISFSSSNLRDDATSGNGDYRLDKLPETTPSTSVFDRADVTYRQ
FT                   FTELHGQARDTRREAHVVELESKTGERARCAPMHALEQLADYGFAWRDIARVVGVSVPA
FT                   ITKWRKGAGVTGENRLKIARLLALIDMLSDRFIGEPASWLEMPIQAGVGITRMDLLERG
FT                   RYDLVLALASTHTGDGTVEYVLNETDKDWRETVVDNAFESYTAEDGVISIRPKR"
FT   CDS_pept        449876..450535
FT                   /transl_table=11
FT                   /gene="BCG_0388"
FT                   /locus_tag="BCG_0388"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0388"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70373"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7T3"
FT                   /protein_id="CAL70373.1"
FT                   /translation="MPELETPDDPESIYLARLEDVGEHRPTFTGDIYRLGDGRMVMILQ
FT                   HPCALRHGVDLHPRLLVAPVRPDSLRSNWARAPFGTMPLPKLIDGQDHSADFINLELID
FT                   SPTLPTCERIAVLSQSGVNLVMQRWVYHSTRLAVPTHTYSDSTVGPFDEADLIEEWVTD
FT                   RVDDGADPQAAEHECASWLDERISGRTRRALLSDRQHASSIRREARSHRKSVKLAD"
FT   CDS_pept        450762..452639
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="BCG_0389"
FT                   /standard_name="hsp70"
FT                   /product="Probable chaperone protein dnaK"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0389"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70374"
FT                   /db_xref="GOA:A1KFH2"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KFH2"
FT                   /protein_id="CAL70374.1"
FT                   /translation="MARAVGIDLGTTNSVVSVLEGGDPVVVANSEGSRTTPSIVAFARN
FT                   GEVLVGQPAKNQAVTNVDRTVRSVKRHMGSDWSIEIDGKKYTAPEISARILMKLKRDAE
FT                   AYLGEDITDAVITTPAYFNDAQRQATKDAGQIAGLNVLRIVNEPTAAALAYGLDKGEKE
FT                   QRILVFDLGGGTFDVSLLEIGEGVVEVRATSGDNHLGGDDWDQRVVDWLVDKFKGTSGI
FT                   DLTKDKMAMQRLREAAEKAKIELSSSQSTSINLPYITVDADKNPLFLDEQLTRAEFQRI
FT                   TQDLLDRTRKPFQSVIADTGISVSEIDHVVLVGGSTRMPAVTDLVKELTGGKEPNKGVN
FT                   PDEVVAVGAALQAGVLKGEVKDVLLLDVTPLSLGIETKGGVMTRLIERNTTIPTKRSET
FT                   FTTADDNQPSVQIQVYQGEREIAAHNKLLGSFELTGIPPAPRGIPQIEVTFDIDANGIV
FT                   HVTAKDKGTGKENTIRIQEGSGLSKEDIDRMIKDAEAHAEEDRKRREEADVRNQAETLV
FT                   YQTEKFVKEQREAEGGSKVPEDTLNKVDAAVAEAKAALGGSDISAIKSAMEKLGQESQA
FT                   LGQAIYEAAQAASQATGAAHPGGEPGGAHPGSADDVVDAEVVDDGREAK"
FT   CDS_pept        452636..453343
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="BCG_0390"
FT                   /product="Probable grpE protein (hsp-70 cofactor)"
FT                   /note="Differs from Rv0351 by 1aa, L224S"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0390"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70375"
FT                   /db_xref="GOA:A1KFH3"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KFH3"
FT                   /protein_id="CAL70375.1"
FT                   /translation="MTDGNQKPDGNSGEQVTVTDKRRIDPETGEVRHVPPGDMPGGTAA
FT                   ADAAHTEDKVAELTADLQRVQADFANYRKRALRDQQAAADRAKASVVSQLLGVLDDLER
FT                   ARKHGDLESGPLKSVADKLDSALTGLGLVAFGAEGEDFDPVLHEAVQHEGDGGQGSKPV
FT                   IGTVMRQGYQLGEQVLRHALVGVVDTVVVDAAELESVDDGTAVADTAENDQADQGNSAD
FT                   TLGEQAESEPSGS"
FT   CDS_pept        453379..454566
FT                   /transl_table=11
FT                   /gene="dnaJ1"
FT                   /locus_tag="BCG_0391"
FT                   /standard_name="dnaJ"
FT                   /product="Probable chaperone protein dnaJ1"
FT                   /note="Differs from Rv0352 and Mb0360 by 1aa, A280T"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0391"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70376"
FT                   /db_xref="GOA:A0A0H3M380"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M380"
FT                   /protein_id="CAL70376.1"
FT                   /translation="MAQREWVEKDFYQELGVSSDASPEEIKRAYRKLARDLHPDANPGN
FT                   PAAGERFKAVSEAHNVLSDPAKRKEYDETRRLFAGGGFGGRRFDSGFGGGFGGFGVGGD
FT                   GAEFNLNDLFDAASRTGGTTIGDLFGGLFGRGGSARPSRPRRGNDLETETELDFVEAAK
FT                   GVAMPLRLTSPAPCTNCHGSGARPGTSPKVCPTCNGSGVINRNQGAFGFSEPCTDCRGS
FT                   GSIIEHPCEECKGTGVTTRTRTINVRIPPGVEDGQRIRLAGQGEAGLRGAPSGDLYVAV
FT                   HVRPDKIFGRDGDDLTVTVPVSFTELALGSTLSVPTLDGTVGVRVPKGTADGRILRVRG
FT                   RGVPKRSGGSGDLLVTVKVAVPPNLAGAAQEALEAYAAAERSSGFNPRAGWAGNR"
FT   CDS_pept        454566..454946
FT                   /transl_table=11
FT                   /gene="hspR"
FT                   /locus_tag="BCG_0392"
FT                   /product="Probable heat shock protein transcriptional
FT                   regulator hspR (merR family)"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0392"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70377"
FT                   /db_xref="GOA:A0A0H3MAC9"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAC9"
FT                   /protein_id="CAL70377.1"
FT                   /translation="MAKNPKDGESRTFLISVAAELAGMHAQTLRTYDRLGLVSPRRTSG
FT                   GGRRYSLHDVELLRQVQHLSQDEGVNLAGIKRIIELTSQVEALQSRLQEMAEELAVLRA
FT                   NQRREVAVVPKSTALVVWKPRR"
FT   CDS_pept        complement(454969..465492)
FT                   /transl_table=11
FT                   /gene="PPE8"
FT                   /locus_tag="BCG_0393c"
FT                   /product="PPE family protein"
FT                   /note="In Mycobacterium tuberculosis strain H37Rv, PPE7 and
FT                   PPE8 exist as 2 genes. In Mycobacterium bovis BCG Pasteur,
FT                   and Mycobacterium bovis, a 2 bp insertion (*-ta) resulting
FT                   in the absence of a stop codon between the 2 genes, leads
FT                   to a single product, and an altered C-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0393c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70378"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR002989"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M207"
FT                   /protein_id="CAL70378.1"
FT                   /translation="MSFAVLPPEINSARLYVGAGLAPMLDAAAAWDGLADELGSAAASF
FT                   SAVTAGLAGSSWLGAASTAMTGAAAPYLGWLSAAAAQAQQAATQTRLAAAAFEAALAAT
FT                   VHPAIISANRALFVSLVVSNLLGQNAPAIAATEAAYEQMWAQDVAAMFGYHAGASAAVS
FT                   ALTPFGQALPTVAGGGALVSAAAAQVTTRVFRNLGLANVGEGNVGNGNVGNFNLGSANI
FT                   GNGNIGSGNIGSSNIGFGNVGPGLTAALNNIGFGNTGSNNIGFGNTGSNNIGFGNTGDG
FT                   NRGIGLTGSGLLGFGGLNSGTGNIGLFNSGTGNVGIGNSGTGNWGIGNSGNSYNTGFGN
FT                   SGDANTGFFNSGIANTGVGNAGNYNTGSYNPGNSNTGGFNMGQYNTGYLNSGNYNTGLA
FT                   NSGNVNTGAFITGNFNNGFLWRGDHQGLIFGSPGFFNSTSAPSSGFFNSGAGSASGFLN
FT                   SGANNSGFFNSSSGAIGNSGLANAGVLVSGVINSGNTVSGLFNMSLVAITTPALISGFF
FT                   NTGSNMSGFFGGPPVFNLGLANRGVVNILGNANIGNYNILGSGNVGDFNILGSGNLGSQ
FT                   NILGSGNVGSFNIGSGNIGVFNVGSGSLGNYNIGSGNLGIYNIGFGNVGDYNVGFGNAG
FT                   DFNQGFANTGNNNIGFANTGNNNIGIGLSGDNQQGFNIASGWNSGTGNSGLFNSGTNNV
FT                   GIFNAGTGNVGIANSGTGNWGIGNPGTDNTGILNAGSYNTGILNAGDFNTGFYNTGSYN
FT                   TGGFNVGNTNTGNFNVGDTNTGSYNPGDTNTGFFNPGNVNTGAFDTGDFNNGFLVAGDN
FT                   QGQIAIDLSVTTPFIPINEQMVIDVHNVMTFGGNMITVTEASTVFPQTFYLSGLFFFGP
FT                   VNLSASTLTVPTITLTIGGPTVTVPISIVGALESRTITFLKIDPAPGIGNSTTNPSSGF
FT                   FNSGTGGTSGFQNVGGGSSGVWNSGLSSAIGNSGFQNLGSLQSGWANLGNSVSGFFNTS
FT                   TVNLSTPANVSGLNNIGTNLSGVFRGPTGTIFNAGLANLGQLNIGSANLGDFNLGSGNV
FT                   GSFNVFSGNQGSYNIGPANLGNYNIGFANLGNYNIGFGNAGDFNQGFANTGNNNIGFAN
FT                   TGNNNIGIGLSGDNQQGFNFAGGWNSGTANIGLFNSGTNNVGIGNSGTGNWGIGNSGSG
FT                   NTGIGNTGSTNTGFFNTGIVNTGVANAGSYNTGWYNTGDTNTGIANLGDFNTGFYNTGN
FT                   FSTGFANQGDIATGAFITGDMGNGAFWRGDQQGLFSAGYRVHVPEIPAHVTVEVPVNIP
FT                   ITASFTNTVYSGITLEQINFGFTIDIAGIPLLAGAISKAVLPPITGTGPAITVNIGDPG
FT                   GSTAIRIPATASVGPFDVTFVNIAATTGFFNATTDPSSGFFNGGPGTVSGIANIGANIS
FT                   GFQNVANSATSGFNNYGSLQSGLANLGDTVSGVFNTGIGAPANVSGMFNIGSNLAGFFH
FT                   DQATGMSMFNLGLGNIGQFNVGFSNVGDSNAGLANIGSFNLGSGNLGSFNVFGGNQGSY
FT                   NIGPANLGNYNIGLGNLGSYNFGFGNAGDFNLGFANTGNNNIGFANTGNNNIGIGLSGD
FT                   NQQGFNFAGGWNSGSGNSGLFNSGTNNIGLFNSGTGNIGIGNSGTGNWGIANTGDTNTG
FT                   IFNTGDVNTGLLNAGNVNTGIFNTGHYNTGSFNAGSFNTAGFNPGSYNTGYLNTGSYNT
FT                   GLANSGDVNTGGFITGNYSNGFWWRGDYQGLAGISQTITVPDTAVPVKLHVPIFLDIPV
FT                   TGTLGTFTVHGFRFPEITGDIFLIGIPFNAATLDAFSFPNISIVLPNIGINLGSGPDPL
FT                   IDIAGTGGLLPIKIPLIDIPAAPGFGNSTTTPSSGFFNAGTGTVSGVGNVGSNSSGFFN
FT                   LTSGSSGISGVQNFGELISGGFNFGNTVSGLVNASTLGLSMPANLSGGGNVGATVAGFV
FT                   NNTQILNLGFGNVGSGNVGHGNIGDSNVGLGNLGNANVGHGNIGSFNVFSGNRGSYNIG
FT                   PANLGNYNIGLGNLGSYNFGFGNAGDFNLGFANSGSNNIGFANTGNNNIGIGLSGHNQQ
FT                   GFGSWNSGTANTGLFNSGTNNIGLFNSGTGNIGIGNSGIGNTGIGNPGVGNTGLGNSGT
FT                   GNWGLWNPGTGNMGVANVGTYNTGGYNVGSTNTGIANVGIANTGSYNTGSTNTGSFNDG
FT                   DFNTGFYNTGDYNTGFYNTGDVNTGAFIGGNFSNGAFWQSDHQGQWGAHYAITVPQIPL
FT                   LNFSLNIPVNIPIHLDFGTLAVNGFQIPAITLRALGVTHFSVGPIIVPRIAGTLPVIDI
FT                   NIGDPGGSSSIPITITSGAGPVVIPLLDIPPAPGFGNSTTGPSSGFFNSGTGSSSGFGN
FT                   VGANNSGFWNTAFAGIGNSGLQNFGSLQSGWANLGNTVSGFYNTSAADFATPANLSGLS
FT                   NVGADLTGVLRGPNGSTFNAGLANLGQFNVGSANLGSANLGSANLGNSNVGFGNIGNAN
FT                   IGGANIGDFNVGIANTGPGLTAAVNNIGIGNTGNYNIGVGNTGNYNIGFGNTGNNNIGI
FT                   GLSGDNQIGFGPLNAGIANMGLFNLGDNNFGMANAGNFNQGIANTGNNNIGLFNTGNNN
FT                   VGIGLTGDGLSGFSSLNSGAGNTGFFNSGTANTGLFNSGTGNTGLFNSGTGNVGIGNMG
FT                   TGGFGVGLSGDSQVGIGGTNSGSFNIGLFNSGTGNVGIGNSGTGNVGIGNTGTGNTGIG
FT                   NSGNYNTGLLNAGLVNTGIANPGNHNTGLFNIGTFNTGIANPGHYNTGSYNTGSYNTGM
FT                   ANAGDYGTGAFITGSMNNGLLWRADRQGLLAANYTITIERPAAFLNVDIPVNIPITGDI
FT                   TNVSIPAITFPRIDASGSVDIGILSGTVLAPVGPITLHGGDASAPLDTPIEIDFGPSPA
FT                   INLNIGKPDGSTVINIVGGAGAGPISIPIIDLRPAPGFFNATTGPSSGFLNWGAGSASG
FT                   LLNFGNNSGLYNFATSSMGNSGFQNYGSLQSGWANLGNSISGIYNTGLGAPANVSGLLN
FT                   IGTNLAGWLQNGPTETTFSVGLANLGFWNLGSANIGNYNLGSANIGVYNLGSANIGDFN
FT                   LGSANIGDFNLGSANIGSSNIGFGNVGPGLTAAIGNIGFGNTGNGNIGIGNTGTGNIGF
FT                   GNTGNGNIGIGLTGDTMTGFGGWNSGTGNIGLFNSGTGNIGFGNSGTGNWGIGNSGDYN
FT                   TGIGNTGSTNSGFFNTGLVNTGIGNSGDYNTGLFNAGNTNTGSFNPGDYNTGGFNPGNY
FT                   NTGYFNPGNSNTGFANSGDVNTGAFNSGNYSNGFFWRGDYQGLGGFAYQSAVSEIPWSY
FT                   DIGSNIEIPIEGDINAITQDAFTIDEFEIPIKLRVSVCVIYIPFKGCVKHVSVTIPITT
FT                   EHLGPYEIDASTINPDQPIDTAFTQTLDFAGSGTVGAFPFGFGWQQSPGFFNSTTTPSS
FT                   GFFNSGAGGASGFLNDAAAAVSGLGNVFTETSGFFNAGGVGNSGFQNFGNLLSGWANLG
FT                   NTVSGFYNTSMLDLATQALISGFGNHGARLSGILNNGSGP"
FT   CDS_pept        complement(465643..466287)
FT                   /transl_table=11
FT                   /gene="BCG_0394c"
FT                   /locus_tag="BCG_0394c"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0394c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70379"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1C0"
FT                   /protein_id="CAL70379.1"
FT                   /translation="MTDASVHPDELDPEYHHHGGFPEYGPASPGAGFGQFVATMRRLQD
FT                   LAVAADPGDAVWDEAAERAAALVELLSPFEADEGKAPAGRTPGLPGMGSLLLPPWTVTR
FT                   YGTDGVEMRGSFSRFHVGGNSAVHGGVLPLLFDHMFGMISHAAGRPISRTAFLHVDYRR
FT                   ITPIDVPLIVRGRVTNTEGRKAFVCAELFDSDETLLAEGNGLMVRLLPGQP"
FT   CDS_pept        complement(466284..467582)
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="BCG_0395c"
FT                   /product="Probable adenylosuccinate synthetase purA"
FT                   /EC_number="6.3.4.4"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0395c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70380"
FT                   /db_xref="GOA:A1KFH8"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KFH8"
FT                   /protein_id="CAL70380.1"
FT                   /translation="MPAIVLIGAQWGDEGKGKATDLLGGRVQWVVRYQGGNNAGHTVVL
FT                   PTGENFALHLIPSGVLTPGVTNVIGNGVVIDPGVLLNELRGLQDRGVDTAKLLISADAH
FT                   LLMPYHIAIDKVTERYMGSKKIGTTGRGIGPCYQDKIARIGIRVADVLDPEQLTHKVEA
FT                   ACEFKNQVLVKIYNRKALDPAQVVDALLEQAEGFKHRIADTRLLLNAALEAGETVLLEG
FT                   SQGTLLDVDHGTYPYVTSSNPTAGGAAVGSGIGPTRIGTVLGILKAYTTRVGSGPFPTE
FT                   LFDEHGEYLSKTGREFGVTTGRRRRCGWFDAVIARYAARVNGITDYFLTKLDVLSSLES
FT                   VPVCVGYEIDGRRTRDMPMTQRDLCRAKPVYEELPGWWEDISGAREFDDLPAKARDYVL
FT                   RLEQLAGAPVSCIGVGPGREQTIVRRDVLQDRP"
FT   CDS_pept        467673..468320
FT                   /transl_table=11
FT                   /gene="BCG_0396"
FT                   /locus_tag="BCG_0396"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0396"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70381"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7T5"
FT                   /protein_id="CAL70381.1"
FT                   /translation="MYTAENAPGVAVLLSGDADVPGPLTGLPTHQDNLDTVIGRYSRLI
FT                   VVGADADLGAVLTRLLRTDRLDVEVGYVPRRRSPATRAYRLPAGRRAARRARCGVARRV
FT                   PLIRDETGSVIVGRAQWLPAEEQALIHGEAVVDDTVLFDGDVAGVCIEPTLTLPGLRAA
FT                   VDGAGKWRRWIGGRAAQLGTTGAAVLRDGVAAPRPVRRSTFYRNVEGWLLVR"
FT   CDS_pept        468331..469110
FT                   /transl_table=11
FT                   /gene="BCG_0397"
FT                   /locus_tag="BCG_0397"
FT                   /product="Probable conserved integral membrane protein"
FT                   /note="Differs from Rv0359 by 1aa, T252A"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0397"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70382"
FT                   /db_xref="GOA:A0A0H3M387"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M387"
FT                   /protein_id="CAL70382.1"
FT                   /translation="MSETGQRESVRPSPIFLGLLGLTAVGGALAWLAGETVQPLAYAGV
FT                   FVMVIAGWLVSLCLHEFGHAFTAWRFGDHDVAVRGYLTLDPRRYSHPMLSLGLPMLFIA
FT                   LGGIGLPGAAVYVHTWFMTTARRTLVSLAGPTVNLALAMLLLAATRLLFDPIHAVLWAG
FT                   VAFLAFLQLTALVLNLLPIPGLDGYAALEPHLRPETQRALAPAKQFALVFLLVLFLAPT
FT                   LNGWFFGVVYWLFDLSGVSHRLAAAGSVLTRFWSIWF"
FT   CDS_pept        complement(469115..469552)
FT                   /transl_table=11
FT                   /gene="BCG_0398c"
FT                   /locus_tag="BCG_0398c"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0398c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70383"
FT                   /db_xref="InterPro:IPR014487"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAD2"
FT                   /protein_id="CAL70383.1"
FT                   /translation="MTKRTITPMTSMGDLLGPEPILLPGDSDAEAELLANESPSIVAAA
FT                   HPSASVAWAVLAEGALADDKTVTAYAYARTGYHRGLDQLRRHGWKGFGPVPYSHQPNRG
FT                   FLRCVAALARAAAAIGETDEYGRCLDLLDDCDPAARPALGL"
FT   CDS_pept        469635..470462
FT                   /transl_table=11
FT                   /gene="BCG_0399"
FT                   /locus_tag="BCG_0399"
FT                   /product="Probable conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0399"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70384"
FT                   /db_xref="GOA:A0A0H3M210"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M210"
FT                   /protein_id="CAL70384.1"
FT                   /translation="MSNAPEPDRSAGESGSEPAGERSADPGEERTESYPLVPHDAETET
FT                   VVITTSDNDAAVTQPEAQRERRFTAPGFDAKETQVIVTAHEAATEVFQTNQAPTTPPRM
FT                   PTGMPPKTAVPQSIPPRTEATSVRQRTWGWALAVVVIVLALAAIAILGTVLLTRGKHSK
FT                   MSQEDQVRQAIQSLDIAIQTGDLTALRSLTCGSTRDGYVDYDERDWAETYRRVSAAKQY
FT                   PVIASIDQVVVNGAHAEANVTTFMAFDPQVRSTRSLDLQFRDDQWKICQSSSN"
FT   CDS_pept        470684..472066
FT                   /transl_table=11
FT                   /gene="mgtE"
FT                   /locus_tag="BCG_0400"
FT                   /product="Possible Mg2+ transport transmembrane protein
FT                   mgtE"
FT                   /note="Differs from Rv0362 by 1aa, V292A"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0400"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70385"
FT                   /db_xref="GOA:A0A0H3M1C4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1C4"
FT                   /protein_id="CAL70385.1"
FT                   /translation="MSIRPAENSTLDIRHVIGIGTPKAVDLWLDVVTELPDRARELGSL
FT                   SKAELGKLGPLLDGTNAVELFESIDDKLAAEALHAMDPSLAATFLEALDSDHAANILRE
FT                   FKEPKREALLTLLPLERAMVLRGLLSWPEDCAAAHMVPETLTVRPNMTVSQAVASVRER
FT                   ASGLRSDARTTAYVYVTDADSHLLGVIAFRALVLANPEQRVRELMGDDLIVVSPLTDKE
FT                   LAAQTIMGHNLMAVPVVDADNRLLGIIAEDEAIDIAEEEATEDAERQGGSAPLEVPYLR
FT                   ASPWLLWRKRVVWLLVLFAAEAYTGSVLRAFSDEMEAVIALAFFIPLLIGTGGNTGTQI
FT                   ATTLVRAMATGQVRFRDVPAVLAKELSTGVLVGLTMAAAAVVRAWTLGVGPQVTLTVAL
FT                   TVAAIVVWSSLVAAVLPPLLKKLRIDPAIVSGPMIATIVDGTGLLIYFLVAHLTLTELH
FT                   GL"
FT   CDS_pept        complement(472078..473112)
FT                   /transl_table=11
FT                   /gene="fba"
FT                   /locus_tag="BCG_0401c"
FT                   /standard_name="fda"
FT                   /product="Probable fructose-bisphosphate aldolase fba"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0401c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70386"
FT                   /db_xref="GOA:A0A0H3M7T9"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7T9"
FT                   /protein_id="CAL70386.1"
FT                   /translation="MPIATPEVYAEMLGQAKQNSYAFPAINCTSSETVNAAIKGFADAG
FT                   SDGIIQFSTGGAEFGSGLGVKDMVTGAVALAEFTHVIAAKYPVNVALHTDHCPKDKLDS
FT                   YVRPLLAISAQRVSKGGNPLFQSHMWDGSAVPIDENLAIAQELLKAAAAAKIILEIEIG
FT                   VVGGEEDGVANEINEKLYTSPEDFEKTIEALGAGEHGKYLLAATFGNVHGVYKPGNVKL
FT                   RPDILAQGQQVAAAKLGLPADAKPFDFVFHGGSGSLKSEIEEALRYGVVKMNVDTDTQY
FT                   AFTRPIAGHMFTNYDGVLKVDGEVGVKKVYDPRSYLKKAEASMSQRVVQACNDLHCAGK
FT                   SLTH"
FT   CDS_pept        473208..473891
FT                   /transl_table=11
FT                   /gene="BCG_0402"
FT                   /locus_tag="BCG_0402"
FT                   /product="Possible conserved transmembrane protein"
FT                   /note="Differs from Rv0364 by 1aa, L193I"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0402"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70387"
FT                   /db_xref="GOA:A0A0H3M393"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M393"
FT                   /protein_id="CAL70387.1"
FT                   /translation="MSTAVTAMPDILDPMYWLGANGVFGSAVLPGILIIVFIETGLLFP
FT                   LLPGESLLFTGGLLSASPAPPVTIGVLAPCVALVAVLGDQTAYFIGRRIGPALFKKEDS
FT                   RFFKKHYVTESHAFFEKYGKWTIILARFVPIARTFVPVIAGVSYMRYPVFLGFDIVGGV
FT                   AWGAGVTLAGYFLGSVPFVHMNFQLIILALVFVSLLPALVSAARVYRARRNAPQSDPDP
FT                   LVLPE"
FT   CDS_pept        complement(473880..475010)
FT                   /transl_table=11
FT                   /gene="BCG_0403c"
FT                   /locus_tag="BCG_0403c"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0403c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70388"
FT                   /db_xref="GOA:A0A0H3MAD6"
FT                   /db_xref="InterPro:IPR005198"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR014512"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAD6"
FT                   /protein_id="CAL70388.1"
FT                   /translation="MNLANRAASAETAVTQRHLRRLWALPGTQLAVVAWPSTRRDRLFG
FT                   SWHYWWQAHLLDCLVDAQLRDPQPQRRARINRQVRSHRVRNNFSWLNSYYDDMAWLALA
FT                   LERADRVAGVRRRRALPKLTNQFVEAWVPEDGGGIPWRKQDQFFNAPANGPAGLFLARY
FT                   PDQYGKRLKRAEQMADWIDRTLIDPETHLVFDGIKAGSLVRAQYTYCQGVVLGLETELA
FT                   VRTGPAARARHCARVHRLVAAVNEHMAPLGVLRGAGGGDGGLFAGITARYLALVATTLP
FT                   GDSADDAAARDTARAIVLASAQSAWDYRQTVDGLPVFGAFWDREAELPTAGGEQARSVR
FT                   GAVHSSAIAERDLSVQLSGWMLMEAAHSAAAVSSLG"
FT   CDS_pept        complement(475035..475628)
FT                   /transl_table=11
FT                   /gene="BCG_0404c"
FT                   /locus_tag="BCG_0404c"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0404c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70389"
FT                   /db_xref="GOA:A0A0H3M215"
FT                   /db_xref="InterPro:IPR010488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M215"
FT                   /protein_id="CAL70389.1"
FT                   /translation="MKRLDLVAGPNGAGKSTFVALTLAPLLPGIVFVNADEIAKQRWPD
FT                   DPTSHAYQAAQVAADTRARLIDLGRPFIAETVFSHPSKLELIRTARTAGYTVVLHVLVI
FT                   PEGLAVERVRHRVAAGGHDVPETKIRERHRRLAELVAQAITLADGATVYDNSRLAGPRI
FT                   VAQFSGGGIIGRACWPSWTPPPLMSRWSNRPETA"
FT   CDS_pept        complement(475657..476046)
FT                   /transl_table=11
FT                   /gene="BCG_0405c"
FT                   /locus_tag="BCG_0405c"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0405c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70390"
FT                   /db_xref="InterPro:IPR021831"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1D1"
FT                   /protein_id="CAL70390.1"
FT                   /translation="MPKAVDRVTRVAADLVDSAAAEGARQSRSAKQQLDHWARVGRAVS
FT                   NQHTASRRRVEAALAGHLPMTDLTLEEGVVFNAEISAAIEERLSRTNYGDVLAAQGITT
FT                   VALNDAGDIVEHRPDGTSVVLAATP"
FT   CDS_pept        complement(476127..477338)
FT                   /transl_table=11
FT                   /gene="BCG_0406c"
FT                   /locus_tag="BCG_0406c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Differs from Rv0368c by 1aa, H249R, and from Mb0375c
FT                   by 1aa, G371S"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0406c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70391"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR011195"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7U2"
FT                   /protein_id="CAL70391.1"
FT                   /translation="MATPALLPGVDLAAFAAALAARLRDAGIPVSASGQASLVQALQQL
FT                   VPRTPAALYWGARLTLVSRVDELATFDAVFASLFGVFGSAEPDGANRPPPPIAGPRTPV
FT                   AGVGHRAKRRSCAAQAQNLPWDTRSLTMASAGQGGPSRTLPDVLPSRIVARADEPFDQF
FT                   DPDDLRLLGAWLEATMARWPRRRSMRFESSPHGKRIDLRATMNASRSTGWESVLLARIR
FT                   PRRRPRRVLLLCDVSRSMQPYAAIYLHLMRAAVLRRAGGHPEVFAFSTSLTRLTSVLSH
FT                   RSAEMALHRANARVTDRYGGTFIGRSVAALLAPPHGNALRGAVVIIASDGWDSDPPDVL
FT                   VHALTRVRRRAELLVWLNPRAAHPEFQPRAGSMAAALPYCDLFLPAHSLAGLHQLLLAL
FT                   AGAR"
FT   CDS_pept        complement(477344..477859)
FT                   /transl_table=11
FT                   /gene="BCG_0407c"
FT                   /locus_tag="BCG_0407c"
FT                   /product="Possible membrane oxidoreductase"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0407c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70392"
FT                   /db_xref="GOA:A0A0H3M399"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M399"
FT                   /protein_id="CAL70392.1"
FT                   /translation="MPGAQLIGHEGDEYLGKVKVKVGPVTSEFSGKVHFVEQDRNQHRA
FT                   VFDAKGKEARGTGNAAATVAAQLHEVGERTRVTVDTDLKIVGKLAQFGSGMLQQVSEKL
FT                   LGQFVDSLEAELAAQSSESPQGTPPATEAAPIDLLQLADGGQLKKYGSALLAALTVLLL
FT                   IWVLRRRR"
FT   CDS_pept        complement(477960..478856)
FT                   /transl_table=11
FT                   /gene="BCG_0408c"
FT                   /locus_tag="BCG_0408c"
FT                   /product="Possible oxidoreductase"
FT                   /EC_number="1.-.-.-"
FT                   /note="Differs from Rv0370c by 1aa, E201G"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0408c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70393"
FT                   /db_xref="GOA:A0A0H3MAE0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAE0"
FT                   /protein_id="CAL70393.1"
FT                   /translation="MTFASPDDVIRRFDEQNYLLDTGTASAIYLAVTLGRPLLLEGEPG
FT                   VGKTTAAKTLAVVLDTTLIRLQCYEGLTANEALYDWNYQRQLLSIRLAEARGKGISDIS
FT                   EADLYTEAYLVDRPILRCVRHRGPTPPVLLIDEIDRADDEFEALLLEFLGESAVTVPEL
FT                   GTFLAECPPIAVLTSNRSRDLHDALRRRCLYHWIDYPEPDRAAAIVRRTVPGATAPLIE
FT                   NATQFVCTARDLDLDKPPGVAETIDWVAALVALGVADLTAADSSPALASLGALAKTPDD
FT                   RTQIRDAYQAFTECSHA"
FT   CDS_pept        complement(478853..479446)
FT                   /transl_table=11
FT                   /gene="BCG_0409c"
FT                   /locus_tag="BCG_0409c"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0409c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70394"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M219"
FT                   /protein_id="CAL70394.1"
FT                   /translation="MTATQITGVVLAAGRSNRLGTPKQLLPYRDTTVLGATLDVARQAG
FT                   FDQLILTLGGAASAVRAAMALDGTDVVVVEDVERGCAASLRVALARVHPRATGIVLMLG
FT                   DQPQVAPATLRRIIDVGPATEIMVCRYADGVGHPFWFSRTVFGELARLHGDKGVWKLVH
FT                   SGRHPVRELAVDGCVPLDVDTWDDYRRLLESVPS"
FT   CDS_pept        complement(479443..480198)
FT                   /transl_table=11
FT                   /gene="BCG_0410c"
FT                   /locus_tag="BCG_0410c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Differs from Rv0372c by 1aa, G161S"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0410c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70395"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1D6"
FT                   /protein_id="CAL70395.1"
FT                   /translation="MSISDRAAQLVAARTPFVRATVVRAQQPTSARPGDEAILLADGTI
FT                   EGFVGGHCAQNSVRKAAMGVLQAGESVLLRVLPDGDVHFPEAPGACVVVNPCLAGGSLE
FT                   IFLTPQLPAPLIQIYGETPIADALIELCGLLGYDARRDTDPADTDALPTAIVIASHGGP
FT                   EAEIIRTALDNGVGYVGLVASTVRGASILDSLDLSDAERARVHTPVGLAIGAKTPAEIA
FT                   VSIAAELIATLRGGGPRGRKALADENGGA"
FT   CDS_pept        complement(480217..482616)
FT                   /transl_table=11
FT                   /gene="BCG_0411c"
FT                   /locus_tag="BCG_0411c"
FT                   /product="Probable carbon monoxyde dehydrogenase (large
FT                   chain)"
FT                   /EC_number="1.2.99.2"
FT                   /note="Differs from Rv0373c by 1aa, S122F"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0411c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70396"
FT                   /db_xref="GOA:A0A0H3M7U7"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012780"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7U7"
FT                   /protein_id="CAL70396.1"
FT                   /translation="MTTIESRPPSPEDLADNAQQPCGHGRMMRKEDPRFIRGRGTYVDD
FT                   VALPGMLHLAILRSPYAHARIVRIDVTAAQAHPKVKAVVTGADLAAKGLAWMPTLANDV
FT                   QAVLATDKTRFQGQEVASVVAEDRYSARDACELVDVDYEPRDPVVDARTALDPSAPVIR
FT                   TDLEGKSDNHIFDWETGDAAATEAVFAKADVVVQQEIVYPRVHPAPMETCGAVADLDPV
FT                   TGKLTLWTTSQAPHAHRTLYALVAGLPEHKIRVISPDIGGGFGNKVPIYPGYVCAIVAS
FT                   LLLDKPVKWMEDRSENLTSTGFARDYIMVGEIAANRDGKILAIRSNVLADHGAFNAQAA
FT                   PAKYPAGFFGVFTGSYDIEAAYCHMTAVYTNKAPGGVAYACSFRITEAVYFVERLVDCL
FT                   AFELKMDPAELRLRNLLRPNQFPYQSKTGWVYDSGDYETTMRKAMNMIGYEALRAEQKQ
FT                   RRARGELMGIGMSFFTEAVGAGPRKDMDILGLGMADGCELRVHPTGKAVLRLSVQTQGQ
FT                   GHETTFAQIVAEELGIAPDDIEVVHGDTDQTPFGLGTYGSRSTPVSGGAAALVARKVRD
FT                   KAKIIASGMLEVSVADLQWEKGKFHVKGDPSAAVTIADIAMRAHGAGDLPEGIEGGLDA
FT                   EVCYNPSNLTYPYGAYFCVVDIDPGTAVVKVRRFLAVDDCGTRINPMIIEGQVHGGIVD
FT                   GIGMALMEMIAFDEDGNCLGGSLMDYLIPTALEVPHLETGHTVTPSPHHPIGAKGIGES
FT                   ATVGSPPAVVNAVVDALAPFGVRHADMPLTPSRVWEAMQGRATPPI"
FT   CDS_pept        complement(482613..483092)
FT                   /transl_table=11
FT                   /gene="BCG_0412c"
FT                   /locus_tag="BCG_0412c"
FT                   /product="Probable carbon monoxyde dehydrogenase (small
FT                   chain)"
FT                   /EC_number="1.2.99.2"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0412c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70397"
FT                   /db_xref="GOA:A0A0H3M3A5"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M3A5"
FT                   /protein_id="CAL70397.1"
FT                   /translation="MQVNMTVNGEPVTAEVEPRMLLVHFLRDQLRLTGTHWGCDTSNCG
FT                   TCVVEVDGVPVKSCTMLAVMASGHSIRTVEGLAGPDGQLDPVQEGFMRCHGLQCGFCTP
FT                   GMLITARALLDRNPDPDEQTIREAISGQICRCTGYTTIVRSIQWAAAHQTVKAQS"
FT   CDS_pept        complement(483107..483967)
FT                   /transl_table=11
FT                   /gene="BCG_0413c"
FT                   /locus_tag="BCG_0413c"
FT                   /product="Probable carbon monoxyde dehydrogenase (medium
FT                   chain)"
FT                   /EC_number="1.2.99.2"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0413c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70398"
FT                   /db_xref="GOA:A0A0H3MAE2"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAE2"
FT                   /protein_id="CAL70398.1"
FT                   /translation="MDHAIGLLDRLGEGARVVAGGHSLLPMMKLRIANPEYLVDINDLA
FT                   PELGYVVVGGINNPNLVRLGAMTRHREILDSDALAAVCPIFRDAERVIADPVVRNRGTL
FT                   GGSLCQADPAEDLSTVCTVLDAVCLAKGPSGEREIAIDDFLVGPYETALAHNEVLIEVR
FT                   IPLRHNTSSAYAKVERRVGDWAITAAGAAVTLDGQTILAARVGLTAVNPDPVALAELSA
FT                   GLVGQPATEEVFAEAGRRAAQACTPVTDVRGTAEYKRHLAGELTVRTLRTAAGRVLGAP
FT                   AAPEA"
FT   CDS_pept        complement(484043..485185)
FT                   /transl_table=11
FT                   /gene="BCG_0414c"
FT                   /locus_tag="BCG_0414c"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0414c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70399"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M223"
FT                   /protein_id="CAL70399.1"
FT                   /translation="MAIWAAGDTAGVATVVRTLRSAPRPPGAAMVVAPDGSVSGSVSGG
FT                   CVEGAVYELAAEVAQTGIPRLEHYGVSDDTAFAVGLTCGGIIDVFVEPVSRATFPELGE
FT                   LADDIGAQRPVAIATVIAHPDERRVGRRLVIRPDTKSPVTGSLGSARADAAVIDDARGL
FT                   LAVGRSEILEYGPDGQRRGEGMEVFVSSHAPRPRMLVFGAIDFAAALARQGSFLGYRVT
FT                   VCDARAVFATPARFPTADDVVVAWPHRYLAAQAEAGGIDERTVICVLTHDPKFDVPVLE
FT                   VALRLGVGYVGAMGSRKTHDDRMDRLRAAGLTDAELSRLSSPIGLDLGARTPEETAVSI
FT                   AADIIARRWGGGGRPLADIAGRIHHDAQVAGEFKDYLTRH"
FT   CDS_pept        485234..486199
FT                   /transl_table=11
FT                   /gene="BCG_0415"
FT                   /locus_tag="BCG_0415"
FT                   /product="Probable transcriptional regulatory protein
FT                   (probably lysR-family)"
FT                   /note="Differs from Rv0377 by 1aa, R302P"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0415"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70400"
FT                   /db_xref="GOA:A0A0H3M1E1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1E1"
FT                   /protein_id="CAL70400.1"
FT                   /translation="MTPAQLRAYSAVVRLGSVRAAAAELGLSDAGVSMHVAALRKELDD
FT                   PLFTRTGAGLAFTPGGLRLASRAVEILGLQQQTAIEVTEAAHGRRLLRIAASSAFAEHA
FT                   APGLIELFSSRADDLSVELSVHPTSRFRELICSRAVDIAIGPASESSIGSDGSIFLRPF
FT                   LKYQIITVVAPNSPLAAGIPMPALLRHQQWMLGPSAGSVDGEIATMLRGLAIPESQQRI
FT                   FQSDAAALEEVMRVGGATLAIGFAVAKDLAAGRLVHVTGPGLDRAGEWCVATLAPSARQ
FT                   PAVSELVGFISTPRCIQAMIRGSGVGVTRFRPKVHVTLWS"
FT   CDS_pept        486450..486671
FT                   /transl_table=11
FT                   /gene="BCG_0416"
FT                   /locus_tag="BCG_0416"
FT                   /product="Conserved hypothetical glycine rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0416"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70401"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7V6"
FT                   /protein_id="CAL70401.1"
FT                   /translation="MSGRWEAGNADGNGGSAGLIGSGGAGGDGGSGGATGAGGEGGDAG
FT                   ASGSINGNAGDPGNSGERGAVGKPGAPG"
FT   CDS_pept        486790..487005
FT                   /transl_table=11
FT                   /gene="secE2"
FT                   /locus_tag="BCG_0417"
FT                   /product="Possible protein transport protein secE2"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0417"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70402"
FT                   /db_xref="InterPro:IPR009923"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036694"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M3B2"
FT                   /protein_id="CAL70402.1"
FT                   /translation="MSVYKVIDIIGTSPTSWEQAAAEAVQRARDSVDDIRVARVIEQDM
FT                   AVDSAGKITYRIKLEVSFKMRPAQPR"
FT   CDS_pept        complement(487081..487632)
FT                   /transl_table=11
FT                   /gene="BCG_0418c"
FT                   /locus_tag="BCG_0418c"
FT                   /product="Possible rna methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0418c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70403"
FT                   /db_xref="GOA:A0A0H3MAE3"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAE3"
FT                   /protein_id="CAL70403.1"
FT                   /translation="MLLRDGDARNVVDAYRYWTREAIIADIDTRRHPLHVAIENFGHDA
FT                   NIGSVVRTANAFAVHTVHIVGRRRWNRRGAMVTDRYQRLCHHDSTTGLLEFAAGAGLTV
FT                   VAVDNVPGAARLEQTALPRECLLLFGQEGPGITDDARAGAAVTVSIAQFGSTRSINAGV
FT                   AAGIAMHAWIRQHADLGRAW"
FT   CDS_pept        complement(487728..488636)
FT                   /transl_table=11
FT                   /gene="BCG_0419c"
FT                   /locus_tag="BCG_0419c"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0419c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70404"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M227"
FT                   /protein_id="CAL70404.1"
FT                   /translation="MRILVAWATCGAVVLSGLTGCSGSSHSGRTYGAQSARTGESLAVL
FT                   GWNMSVSNLRWSGDYVLIDVDASPTDPHAPHAKPEDIRFGLYGALAHPMESAALGSCGD
FT                   AMAHVRDVVSPLSAPAGRLTGTVCLGPLKERSAVRGVYTYSPRDRIPGTAAAYPAAFPV
FT                   GMLPTNQNDAGLVVKTTSVSAWRADGMQLGKPQLGDPVAFTGNGYMLLGLEVDAVPDRY
FT                   RDDSAARGGPMMLLAAPTLPGRGLSPACATYGSSVLILPDALLDAVHISASLCTQGEIN
FT                   EALLYATVATVGTHAALWTSR"
FT   CDS_pept        complement(488654..489193)
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="BCG_0420c"
FT                   /product="Probable orotate phosphoribosyltransferase pyrE"
FT                   /EC_number="2.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0420c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70405"
FT                   /db_xref="GOA:A1KFK3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KFK3"
FT                   /protein_id="CAL70405.1"
FT                   /translation="MAGPDRAELAELVRRLSVVHGRVTLSSGREADYYVDLRRATLHHR
FT                   ASALIGRLMRELTADWDYSVVGGLTLGADPVATAIMHAPGRPIDAFVVRKSAKAHGMQR
FT                   LIEGSEVTGQRVLVVEDTSTTGNSALTAVHAVQDVGGEVVGVATVVDRATGAAEAIEAE
FT                   GLRYRSVLGLADLGLD"
FT   CDS_pept        complement(489274..490128)
FT                   /transl_table=11
FT                   /gene="BCG_0421c"
FT                   /locus_tag="BCG_0421c"
FT                   /product="Possible conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0421c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70406"
FT                   /db_xref="GOA:A0A0H3M1E6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1E6"
FT                   /protein_id="CAL70406.1"
FT                   /translation="MVPLWFTLSALCFVGAVVLLYVDIDRRRGRSRRRKSWARSHGFDY
FT                   ERESTEILKRWTRGVMSTVGDVAAHNVVLGQIRGEAVYIFDLEEVATVIALHRKVGTNV
FT                   VVDLRLKGLKEPRESDIWLLGAIGPRMVYSTNLDAARRACDRRMVTFAHTAPDCAEIMW
FT                   NEQNWTLVSMPIASTRAQWDEGLRTVRQFNDLLRVLPPLPQEMPQQTGVGPRGAAPGRP
FT                   VAPGGPAELPPRRAQPDPATTVLPDPARRAPEPIRRDEGRSEGVRRPPPAGRNGQQATN
FT                   YQH"
FT   CDS_pept        complement(490269..492815)
FT                   /transl_table=11
FT                   /gene="clpB"
FT                   /locus_tag="BCG_0422c"
FT                   /standard_name="htpM"
FT                   /product="Probable endopeptidase ATP binding protein (chain
FT                   b) clpB"
FT                   /EC_number="3.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0422c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70407"
FT                   /db_xref="GOA:A0A0H3M7W9"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7W9"
FT                   /protein_id="CAL70407.1"
FT                   /translation="MDSFNPTTKTQAALTAALQAASTAGNPEIRPAHLLMALLTQNDGI
FT                   AAPLLEAVGVEPATVRAETQRLLDRLPQATGASTQPQLSRESLAAITTAQQLATELDDE
FT                   YVSTEHVMVGLATGDSDVAKLLTGHGASPQALREAFVKVRGSARVTSPEPEATYQALQK
FT                   YSTDLTARAREGKLDPVIGRDNEIRRVVQVLSRRTKNNPVLIGEPGVGKTAIVEGLAQR
FT                   IVAGDVPESLRDKTIVALDLGSMVAGSKYRGEFEERLKAVLDDIKNSAGQIITFIDELH
FT                   TIVGAGATGEGAMDAGNMIKPMLARGELRLVGATTLDEYRKHIEKDAALERRFQQVYVG
FT                   EPSVEDTIGILRGLKDRYEVHHGVRITDSALVAAATLSDRYITARFLPDKAIDLVDEAA
FT                   SRLRMEIDSRPVEIDEVERLVRRLEIEEMALSKEEDEASAERLAKLRSELADQKEKLAE
FT                   LTTRWQNEKNAIEIVRDLKEQLEALRGESERAERDGDLAKAAELRYGRIPEVEKKLDAA
FT                   LPQAQAREQVMLKEEVGPDDIADVVSAWTGIPAGRLLEGETAKLLRMEDELGKRVIGQK
FT                   AAVTAVSDAVRRSRAGVSDPNRPTGAFMFLGPTGVGKTELAKALADFLFDDERAMVRID
FT                   MSEYGEKHTVARLIGAPPGYVGYEAGGQLTEAVRRRPYTVVLFDEIEKAHPDVFDVLLQ
FT                   VLDEGRLTDGHGRTVDFRNTILILTSNLGSGGSAEQVLAAVRATFKPEFINRLDDVLIF
FT                   EGLNPEELVRIVDIQLAQLGKRLAQRRLQLQVSLPAKRWLAQRGFDPVYGARPLRRLVQ
FT                   QAIGDQLAKMLLAGQVHDGDTVPVNVSPDADSLILG"
FT   CDS_pept        492948..494120
FT                   /transl_table=11
FT                   /gene="BCG_0423"
FT                   /locus_tag="BCG_0423"
FT                   /product="Probable monooxygenase"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0423"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70408"
FT                   /db_xref="GOA:A0A0H3M3C0"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M3C0"
FT                   /protein_id="CAL70408.1"
FT                   /translation="MGLEDRDALRVLQNAFKLDDPELVRRFYAHWFALDASVRDLFPPD
FT                   MGAQRAAFGQALHWVYGELVAQRAEEPVAFLAQLGRDHRKYGVLPTQYDTLRRALYTTL
FT                   RDYLGHPSRGAWTDAVDEAAGQSLNLIIGVMSGAADADDAPAWWDGTVVEHIRVSRDLA
FT                   VARLQLDRPLHYYPGQYVNVHVPQCPRRWRYLSPAIPADPNGRIEFHVRVVPGGLVSNA
FT                   IVGETRPGDRWRLSGPHGAFRVDRDGGDVLMVAGSTGLAPLRALIIDLSRFAVNPRVHL
FT                   FFGARYACELYDLPTLWQIAAHNPWLSVSPVSEYNGDPAWAADYPDVSAPRGLHVRQTG
FT                   RLPDVVSRYGGWGDRQILICGGPAMVRATKAALIAKGAPPERIQHDPLSR"
FT   CDS_pept        494224..497481
FT                   /transl_table=11
FT                   /gene="BCG_0424"
FT                   /locus_tag="BCG_0424"
FT                   /product="Probable transcriptional regulatory protein
FT                   (probably luxR/uhpA-family)"
FT                   /note="Differs from Mb0393 by 1aa, D902A"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0424"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70409"
FT                   /db_xref="GOA:A0A0H3MAE6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAE6"
FT                   /protein_id="CAL70409.1"
FT                   /translation="MSKLLPRGTVTLLLADVEGSTWLWETHPDDMGAAVARLDKAVSGV
FT                   IAAHDGVRPVEQGEGDSFVLAFACASDAVAAALDLQRARLAPIRLRIGVHTGEVALRDE
FT                   GNYAGPTINRTARLRDLAHGGQTVLSGVTESLVIDRLPDKAWLVDLGTHALRDLSRPER
FT                   VMQLCHPELRIDFPPLRVANDDVAHGLPVHLTRFVGRGAQITEVHRLVTDNRLVTLTGA
FT                   GGVGKTRLAAQLAAQIAGEFGRAWFVDLAPITDPDLVPVTVAGALGLHDQPGRSTTDTV
FT                   LRFLGGRPALVVLDNCEHLLDATAALVLALVKACRGVRLLATCREPLRVEGEVSYRVPS
FT                   LSLSDEAVEMFCYRAQRVRPDFRLTDDNSAAVTEICKRLDGLPLAIELAAARLRSMTLD
FT                   EIIDGLRDRFALLTGGARTAAHRQQTLWASVDWSYTLLTEPERTLFRRLAVFVGCFFVD
FT                   DAQAVACSGDVQRYQVLDEITLLVDKSLVMADDNSGRTCYRLCETMRHYALEKLSEAGE
FT                   VDAVFARHRDYYTALAARVDNPGPSDYSHCLDQAETEIDNLRAAFVWNRENSDTEGALA
FT                   LASSLLRVWMTRGRIQEGRAWFDSILADENARHLEVAAAVRARALADKALLDIFVDAAA
FT                   GMEQAQQALVIAREVDEPALLSRALTACGLIAVAVARADAAASYFAEAIDLARAVDDRW
FT                   RLAQILTFQAVDAVVAGDPVAARPAAQEARELAAAIGDHSNALWCRWCLGYAQLMRGEL
FT                   AAAAAQFGEVVDEAEASQEVLHKANSLQGLAFALAYQGELSAARAAADAALEAAELGEY
FT                   FAGMGYSALTTAALAAGDVQTAQHASEAAWRNLSLALPLSAAVQRAFNAQAALAGGDLS
FT                   AARRWCDDAVQSMTGHHLAMALATRARIAVAEGKREEAERDAHKALACAAESGAHLDLP
FT                   DVLECLAGLASDAGTHHAAARLFGAAEAIRQQIGSVRFAIYRSDYVQSVTALRDAMGEK
FT                   DFDAAWAEGAALSIKETIAYAQRGHSWRKRPATGWESLTPTEIDVVRLVGEGLANKDIA
FT                   TRLFVSPRTVQTHLTHVYTKLGFTSRLQLAQAAARRT"
FT   CDS_pept        complement(497485..498816)
FT                   /transl_table=11
FT                   /gene="PPE9"
FT                   /locus_tag="BCG_0425c"
FT                   /product="PPE family protein"
FT                   /note="In Mycobacterium tuberculosis strain H37Rv, Rv0388c
FT                   and Rv0387c exist as 2 separate genes. In Mycobacterium
FT                   bovis BCG Pasteur, and Mycobacterium bovis, 3 different
FT                   base substitutions, the first of 14 bases, the second of 8
FT                   bases (tctacagt-gctacagg), and lastly of 28 bases, leads to
FT                   a longer single product"
FT                   /note="Differs from Mb0394c by 1aa, T361A"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0425c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70410"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR022171"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M232"
FT                   /protein_id="CAL70410.1"
FT                   /translation="MDFGALPPEINSARIYSGPGSRPLMQAAAAWQRLANELTATAASY
FT                   SSVISGLTGDDWLGPSALSMAAAAVPYVAWMRATAASAEQAAAQAVAAANAYESAYAAT
FT                   VPPTVIAANRRTMLSLVKTNVFGQNTPAIATSEAQYGAMWAQDIVAMEGYAGASAAASQ
FT                   LPPFTPPPATTSGAGSLSDAAATAAQAVVPAAAATDVSLLPTLQSFLPPPFDAIPNPIE
FT                   DLDVLVAAAVAVAAGSLGVSAAQLGEIYRHDVVDEAQKAPHCPAESDQTPAGAAGDGDL
FT                   PEVGGRVTSPPQPPVAALTGYSANIGGLSVPHSWNLPPAVRQVAAMFPGATPMYMTGSS
FT                   DGSYAGLAAAGLAGTGLAGLTARGGSAPTPAAAAPAGAGGAGPAATRPAAQQTPAVPAA
FT                   AAGSAIPGLPPGLPPGVVANLAATLAAIPGATIIVVPPSPNANQ"
FT   CDS_pept        499150..500409
FT                   /transl_table=11
FT                   /gene="purT"
FT                   /locus_tag="BCG_0426"
FT                   /product="Probable phosphoribosylglycinamide
FT                   formyltransferase 2 purT"
FT                   /EC_number="2.1.2.-"
FT                   /note="Differs from Rv0389 by 2aa, G8E, T332I"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0426"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70411"
FT                   /db_xref="GOA:A0A0H3M1F0"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005862"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1F0"
FT                   /protein_id="CAL70411.1"
FT                   /translation="MIDGWTEGQHEPTVRHERPAAPQDVRRVMLLGSAEPSRELAIALQ
FT                   GLGAEVIAVDGYVGAPAHRIADQSVVVTMTDAEELTAVIRRLQPDFLVTVTAAVSVDAL
FT                   DAVEQADGECTELVPNARAVRCTADREGLRRLAADQLGLPTAPFWFVGSLGELQAVAVH
FT                   AGFPLLVSPVAGVAGQGSSVVAGPNEVEPAWQRAAGHQVQPQTGGVSPRVCAESVVEIE
FT                   FLVTMIVVCSQGPNGPLIEFCAPIGHRDADAGELESWQPQKLSTAALDAAKSIAARIVK
FT                   ALGGRGVFGVELMINGDEVYFADVTVCPAGSAWVTVRSQRLSVFELQARATLGLAVDTL
FT                   MISPGAARVINPDHTAGRAAVGAAPPADALTGALGVPESDVVIFGRGLGVALATAPEVA
FT                   IARERAREVASRLNVPDSRE"
FT   CDS_pept        500406..500828
FT                   /transl_table=11
FT                   /gene="BCG_0427"
FT                   /locus_tag="BCG_0427"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0427"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70412"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7X2"
FT                   /protein_id="CAL70412.1"
FT                   /translation="MSYAGDITPLQAWEMLSDNPRAVLVDVRCEAEWRFVGVPDLSSLG
FT                   REVVYVEWATSDGTHNDNFLAELRDRIPADADQHERPVIFLCRSGNRSIGAAEVATEAG
FT                   ITPAYNVLDGFEGHLDAEGHRGATGWRAVGLPWRQG"
FT   CDS_pept        500825..502045
FT                   /transl_table=11
FT                   /gene="metZ"
FT                   /locus_tag="BCG_0428"
FT                   /product="Probable o-succinylhomoserine sulfhydrylase metZ"
FT                   /EC_number="4.2.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0428"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70413"
FT                   /db_xref="GOA:A0A0H3M3C7"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006234"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M3C7"
FT                   /protein_id="CAL70413.1"
FT                   /translation="MTDESSVRTPKALPDGVSQATVGVRGGMLRSGFEETAEAMYLTSG
FT                   YVYGSAAVAEKSFAGELDHYVYSRYGNPTVSVFEERLRLIEGAPAAFATASGMAAVFTS
FT                   LGALLGAGDRLVAARSLFGSCFVVCSEILPRWGVQTVFVDGDDLSQWERALSVPTQAVF
FT                   FETPSNPMQSLVDIAAVTELAHAAGAKVVLDNVFATPLLQQGFPLGVDVVVYSGTKHID
FT                   GQGRVLGGAILGDREYIDGPVQKLMRHTGPAMSAFNAWVLLKGLETLAIRVQHSNASAQ
FT                   RIAEFLNGHPSVRWVRYPYLPSHPQYDLAKRQMSGGGTVVTFALDCPEDVAKQRAFEVL
FT                   DKMRLIDISNNLGDAKSLVTHPATTTHRAMGPEGRAAIGLGDGVVRISVGLEDTDDLIA
FT                   DIDRALS"
FT   CDS_pept        complement(502042..503454)
FT                   /transl_table=11
FT                   /gene="ndhA"
FT                   /locus_tag="BCG_0429c"
FT                   /product="Probable membrane nadh dehydrogenase ndhA"
FT                   /EC_number="1.6.99.3"
FT                   /note="Differs from Rv0392c by 1aa, A241V"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0429c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70414"
FT                   /db_xref="GOA:A0A0H3MAE9"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAE9"
FT                   /protein_id="CAL70414.1"
FT                   /translation="MTLSSGEPSAVGGRHRVVIIGSGFGGLNAAKALKRADVDITLISK
FT                   TTTHLFQPLLYQVATGILSEGDIAPTTRLILRRQKNVRVLLGEVNAIDLKAQTVTSKLM
FT                   DMTTVTPYDSLIVAAGAQQSYFGNDEFATFAPGMKTIDDALELRGRILGAFEAAEVSTD
FT                   HAERERRLTFVVVGAGPTGVEVAGQIVELAERTLAGAFRTITPSECRVILLDAAPAVLP
FT                   PMGPKLGLKAQRRLEKMDAEVQLNAMVTAVDYKGITIKEKDGGERRIECACKVWAAGVA
FT                   ASPLGKMIAEGSDGTEIDRAGRVIVEPDLTVKGHPNVFVVGDLMFVPGVPGVAQGAIQG
FT                   ARYATTVIKHMVKGNDDPANRKPFHYFNKGSMATISRHSAVAQVGKLEFAGYFAWLAWL
FT                   VLHLVYLVGYRNRIAALFAWGISFMGRARGQMAITSQMIYARLVMTLMEQQAQGALAAA
FT                   EQAEHAEQEAAG"
FT   CDS_pept        503596..504921
FT                   /transl_table=11
FT                   /gene="BCG_0430"
FT                   /locus_tag="BCG_0430"
FT                   /product="Conserved 13E12 repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0430"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70415"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M236"
FT                   /protein_id="CAL70415.1"
FT                   /translation="MAVGRCAIPRFDQAASGSAINGGQVHLSDGSTSPARQLPAPWPGD
FT                   AGAAAEGRAGVCCRGNRLPHVSDVGVSHRFDHRPAGVGAGGCRAGAAGAGLAVDDPGQL
FT                   AAAIDRIVAVADPDAVRQVRERARDREVSIWNSADGMGEVYAQLYATDAQALDARLNAL
FT                   VATVCAGDPRSTDQRRADALGALAAGADRLACRCDNPDCAAEGRPVSAVVIHVVAEQAS
FT                   VKGHGQAPAALLGGDGLIPAELVAELAKTAGLQPIPVPAGTEPGYRPSVKLAAFVRARD
FT                   LTCRAPGCDRPATQCDLDHTIAFADGGATHAANLKCLCRLHHLLATFCGWRAQQLPDGT
FT                   VIWTLPGNQTYVTTPGSALLFPALCTPTGDPPAPEPARADRRGQRTAMMPRRASTRTQN
FT                   RAHCIAAERHRNHQARRIAQAAVIATETHGPPPDPDDDPPPF"
FT   CDS_pept        complement(504937..505656)
FT                   /transl_table=11
FT                   /gene="BCG_0431c"
FT                   /locus_tag="BCG_0431c"
FT                   /product="Possible secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0431c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70416"
FT                   /db_xref="GOA:A0A0H3M1F4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1F4"
FT                   /protein_id="CAL70416.1"
FT                   /translation="MTEPRPVFAVVISAGLSAIPMVGGPLQTVFDAIEERTRHRAETTT
FT                   REICESVGGADTVLSRIDKNPELEPLLSQAIEAATRTSMEAKRRLLAQAAAAALEDDQK
FT                   VEPASLIVATLSQLEPVHIHALVRLAKAAKSSPDQDEIQRREVMRAASKVEPVPVLAAL
FT                   IQTGVAIATTTVWHGNGTGTPAEESGHILIHDVSDFGHRLLAYLRAADAGAELLILPSG
FT                   GSAPTGDHPTPHPSTSR"
FT   CDS_pept        505755..506159
FT                   /transl_table=11
FT                   /gene="BCG_0432"
FT                   /locus_tag="BCG_0432"
FT                   /product="Hypothetical protein"
FT                   /note="Differs from Rv0395 by 1aa, A80V"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0432"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7X5"
FT                   /protein_id="CAL70417.1"
FT                   /translation="MDWMPLGDYETFRHWSGKPRAWGPQESGWRAWFGGKIVDGLCEVL
FT                   DEHLAVRRRGVPAAIGCVPWLSSEAVAETLLALSAFCVVIDKGTSFPSRLRNPDKGFPN
FT                   VALLRLRDMAPSEHGSRCSSARGRLCLSMS"
FT   CDS_pept        506165..506557
FT                   /transl_table=11
FT                   /gene="BCG_0433"
FT                   /locus_tag="BCG_0433"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0433"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70418"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M3D4"
FT                   /protein_id="CAL70418.1"
FT                   /translation="MRALGWLREDRKPLLNAKLLVLGHLALNVYDPDNGYGEEVLDFEP
FT                   RTVWWGSANWTVRAGSHLEVGFACDDPTLVEEATAFVADVIAFSEPIDTTCAGPEPNLV
FT                   QVEFDDAAMAEAMEEMAEPDDDGEDW"
FT   CDS_pept        506631..506999
FT                   /transl_table=11
FT                   /gene="BCG_0434"
FT                   /locus_tag="BCG_0434"
FT                   /product="Conserved 13E12 repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0434"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70419"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAF0"
FT                   /protein_id="CAL70419.1"
FT                   /translation="MLATFWGWRAQQLPDGTVIWTLPGDQTYVTTPGSALLFPALCTPT
FT                   GDPPRPDPARADRRGQRTAMMPRRASTRAQNRAHYIAAERHRNHQARRIAHVVTQTATT
FT                   APETNGPPPDPDDDPPPF"
FT   CDS_pept        complement(507494..508135)
FT                   /transl_table=11
FT                   /gene="BCG_0435c"
FT                   /locus_tag="BCG_0435c"
FT                   /product="Possible secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0435c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M240"
FT                   /protein_id="CAL70420.1"
FT                   /translation="MGVIARVVGVAACGLSLAVLAAAPTAGAEPTGALPPMTSSGSGPV
FT                   IGDGDAALRQRISQQLFSFGDPTVQEVDGSDAAQFITAAAAVADRDVASVFLPLQRVLG
FT                   CQQNTAGSGAGFGARAYRRTDGQWGGAMLVVAKSTVSDVDALKACVKSGWRKATAGTPT
FT                   SMCNNGWTYPPFADTRRGEEGYFVLLAGTASDFCSAPNANYRTTASSWPG"
FT   CDS_pept        complement(508142..509371)
FT                   /transl_table=11
FT                   /gene="lpqK"
FT                   /locus_tag="BCG_0436c"
FT                   /product="Possible conserved lipoprotein lpqK"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0436c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70421"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1G0"
FT                   /protein_id="CAL70421.1"
FT                   /translation="MPVLRRLGCSVLALGLLAGCAPPRTGPASSPTNNGAKADAVIRIV
FT                   RDFMTQAHLKAVLVRVTVAGKEVVTRAVGDSMTGVPATTAMHFRNGAVAISYVATLLLK
FT                   LVDEKKLRLDDKLSRWLPDFPHADRVTLGQLAQMTSGYPDYVLGNEAFDAELYANPFRQ
FT                   WTTQELLDQISSRPLLYDPGTNWNYAHTNYLLLGLALEKAAGQDMPTLLQRKVLSPLGL
FT                   TATANSDTPAIPEPALHAFTSERRAALKIPAGVPFYEESTFWNPSWTITHGAIQTTTIY
FT                   DMEATAVGIGSGRLLSADSYKKMVSTELRGKTRAQPGCPTCFEQNDGYSYGLGIVISGH
FT                   WLLQNPMFAGYAAVEAYLPSQRVAVAVAVTYAPEAFDDQGNYRNQADILFRKIGAEVAP
FT                   NDAPPMPPGR"
FT   CDS_pept        complement(509381..510568)
FT                   /transl_table=11
FT                   /gene="fadE7"
FT                   /locus_tag="BCG_0437c"
FT                   /product="Probable acyl-CoA dehydrogenase fadE7"
FT                   /EC_number="1.3.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0437c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70422"
FT                   /db_xref="GOA:A0A0H3M7X8"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7X8"
FT                   /protein_id="CAL70422.1"
FT                   /translation="MSTPTPPALDRDDPLGLDASLSSDEIAVRDTVRRFCAEHVTPHVA
FT                   AWFEDGDLPVARDLAKQFGELGLLGMQLHGHGCGGASAVHYGLACRELEAADSGIRSLV
FT                   SVQGSLAMFAIASFGSDEQKRQWLPGMATGDLLGCFGLTEPDVGSDPAAMKTRARRDGP
FT                   DWVITGGKMWITNGSVADVAIVWAATDDGIRGFIVPTDTPGFTANTIGHKLSLRASITS
FT                   ELVLDNVRLPADAMLPGATGLRAPLACLSEARYGIVWGAMGAARSAWQCALDYARQRTQ
FT                   FGRPIAGFQLTQAKLVDMAVELHKGQLLSLHLGRLKDRVGLRPDQVSFGKLNNTREALK
FT                   ICRTARTILGGNGISLEYPVIRHMVNLESVLTYEGTPEMHQLVLGQAFTGLAAFR"
FT   CDS_pept        510604..510975
FT                   /transl_table=11
FT                   /gene="BCG_0438"
FT                   /locus_tag="BCG_0438"
FT                   /product="Probable conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0438"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70423"
FT                   /db_xref="GOA:A0A0H3M3E0"
FT                   /db_xref="InterPro:IPR021414"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M3E0"
FT                   /protein_id="CAL70423.1"
FT                   /translation="MRPRRALAGLAADVVAVLVFCAVGRRSHAEGLSVTGLAATAWPFL
FT                   TGTGIGWVLARGWRRPTALAPTGVIVWLCTIVVGMVLRKVSSAGVAASFVVVASAVTAV
FT                   LLLGWRAAVALMAPHRADG"
FT   CDS_pept        complement(511170..512273)
FT                   /transl_table=11
FT                   /gene="mmpL1b"
FT                   /locus_tag="BCG_0439c"
FT                   /product="Probable conserved transmembrane transport
FT                   protein mmpL1b [second part]"
FT                   /note="In Mycobacterium tuberculosis strain H37Rv, mmpL1
FT                   exists as a single gene. In Mycobacterium bovis BCG
FT                   Pasteur, and Mycobacterium bovis, a frameshift due to a
FT                   single base deletion (c-*) splits mmpL1 into 2 parts,
FT                   mmpL1a and mmpL1b"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0439c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70424"
FT                   /db_xref="GOA:A0A0H3MAF3"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAF3"
FT                   /protein_id="CAL70424.1"
FT                   /translation="MNSMDNVDKLTEDLANLTDDTERMDTTQRQLLAQLDPTIATMQTV
FT                   KDLAQTLTSAFSGLVTQMEDMTRNATVMGRTFDAANNDDSFYLPPEAFQNPDFQRGLKL
FT                   FLSPDGTCARFVITHRGDPASAEGISHIDPIMQAADEAVKGTPLQAASIYLAGTSSTYK
FT                   DIHEGTLYDVMIAVVASLCLIFIIMLGITRSVVASAVIVGTVALSLGSAFGLSVLIWQH
FT                   ILHMPLHWLVLPMAIIVMLAVGSDYNLLLIARFQEEIGAGLKTGMIRAMAGTGRVVTIA
FT                   GLVFAFTMGSMVASDLRVVGQIGTTIMIGLLFDTLVVRSYMTPALATLLGRWFWWPRRV
FT                   DRLARQPQVLGPRRTTALSAERAALLQ"
FT   CDS_pept        complement(512270..514045)
FT                   /transl_table=11
FT                   /gene="mmpL1a"
FT                   /locus_tag="BCG_0440c"
FT                   /product="Probable conserved transmembrane transport
FT                   protein mmpL1a [first part]"
FT                   /note="In Mycobacterium tuberculosis strain H37Rv, mmpL1
FT                   exists as a single gene. In Mycobacterium bovis, a
FT                   frameshift due to a single base deletion (c-*) splits mmpL1
FT                   into 2 parts, mmpL1a and mmpL1b"
FT                   /note="Differs from Rv0402c by 1aa, P451L"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0440c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70425"
FT                   /db_xref="GOA:A0A0H3M242"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M242"
FT                   /protein_id="CAL70425.1"
FT                   /translation="MRSQRLAGHLSAAARTIHALSLPIILFWVALTIVVNVVAPQLQSV
FT                   ARTHSVALGPHDAPSLIAMKRIGKDFQQFDSDTTAMVLLEGQEKLGDEAHRFYDVLVTK
FT                   LSQDTTHVQHIENFWGDPLTAAGSQSADGKAAYVQLNLTGDQGGSQANESVAAVQRIVD
FT                   SVPPPPGIKAYVTGPGPLGADRVVYGDRSLHTITGISIAVIAIMLFIAYRSLSAALIML
FT                   LTVGLELLAVRGIISTFAVNDLMGLSTFTVNVLVALTIAASTDYIIFLVGRYQEARATG
FT                   QNREAAYYTMFGGTAHVVLASGLTVAGAMYCLGFTRLPYFNTLASPCAIGLVTVMLASL
FT                   TLAPAIIAVASRFGLFDPKRATTKRRWRRIGTVVVRWPGPVLAATLLIALIGLLALPKY
FT                   QTNYNERYYIPSAAPSNIGYLASDRHFPQARMEPEVLMVEADHDLRNPTDMPILDRIAK
FT                   TVFHTPGIARVQSITRPLGAPIDHSSIPFQLGMQSTMTIENLQNLKDRVADLSTLTDQL
FT                   QRMIDITQRTQELTRQLTDATHDMNAHTRQMRDNANELRDRIADFDDFWRPSEVSRTGS
FT                   ATASTFPSAGRCAPC"
FT   CDS_pept        complement(514042..514470)
FT                   /transl_table=11
FT                   /gene="mmpS1"
FT                   /locus_tag="BCG_0441c"
FT                   /product="Probable conserved membrane protein mmpS1"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0441c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70426"
FT                   /db_xref="InterPro:IPR008693"
FT                   /db_xref="InterPro:IPR038468"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1G4"
FT                   /protein_id="CAL70426.1"
FT                   /translation="MFGVAKRFWIPMVIVIVVAVAAVTVSRLHSVFGSHQHAPDTGNLD
FT                   PIIAFYPKHVLYEVFGPPGTVASINYLDADAQPHEVVNAAVPWSFTIVTTLTAVVANVV
FT                   ARGDGASLGCRITVNEVIREERIVNAYHAHTSCLVKSA"
FT   CDS_pept        514791..516548
FT                   /transl_table=11
FT                   /gene="fadD30"
FT                   /locus_tag="BCG_0442"
FT                   /product="Probable fatty-acid-CoA ligase fadD30"
FT                   /EC_number="6.2.1.-"
FT                   /note="Differs from Mb0411 by 1aa, S300S, and from Rv0404
FT                   by 2aa, A88T, S300A"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0442"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70427"
FT                   /db_xref="GOA:A0A0H3M7Y1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7Y1"
FT                   /protein_id="CAL70427.1"
FT                   /translation="MSVISTLRDRATTTPSDEAFVFMDYDTKTGDQIDRMTWSQLYSRV
FT                   TAVSAYLISYGRHADRRRTAAISAPQGLDYVAGFLGALCAGWAPVPLPEPLGSLRDKRT
FT                   GLAVLDCAADVVLTTSQAETRVRATIATHGASVTTPVIALDTLDEPSGDNCDLDSQLSD
FT                   WSSYLQYTSGSTANPRGVVLSMRNVTENVDQIIRNYFRHEGGAPRLPSSVVSWLPLYHD
FT                   MGLMVGLFIPLFVGCPVILTSPEAFIRKPARWMQLLAKHQAPFSAAPNFAFDLAVAKTS
FT                   EEDMAGLDLGHVNTIINGSEQVQPNTITKFLRRFRPYNLMPAAVKPSYGMAEAVVYLAT
FT                   TKAGSPPTSTEFDADSLARGHAELSTFETERATRLIRYHSDDKEPLLRIVDPDSNIELG
FT                   PGRIGEIWIHGKNVSTGYHNADDALNRDKFQASIREASAGTPRSPWLRTGDLGFIVGDE
FT                   FYIVGRMKDLIIQDGVNHYPDDIETTVKEFTGGRVAAFSVSDDGVEHLVIAAEVRTEHG
FT                   PDKVTIMDFSTIKRLVVSALSKLHGLHVTDFLLVPPGALPKTTSGKISRAACAKQYGAN
FT                   KLQRVATFP"
FT   CDS_pept        516545..517927
FT                   /transl_table=11
FT                   /gene="pks6a"
FT                   /locus_tag="BCG_0443"
FT                   /product="Probable membrane bound polyketide synthase pks6a
FT                   [first part]"
FT                   /note="In Mycobacterium tuberculosis strain H37Rv, pks6
FT                   exists as a single gene. In Mycobacterium bovis BCG
FT                   Pasteur, and Mycobacterium bovis, a frameshift due to
FT                   single base insertion (*-g) splits pks6 into 2 parts, pks6a
FT                   and pks6b"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0443"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70428"
FT                   /db_xref="GOA:A0A0H3M3E4"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M3E4"
FT                   /protein_id="CAL70428.1"
FT                   /translation="MTDGSVTADKLQKWFREYLSTHIECHPNEVSLDVPIRDLGLKSID
FT                   VLAIPGDLGDRFGFCIPDLAVWDNPSANDLIDSLLNQRSADSLRESHGHADRNTQGRGS
FT                   INEPVAVIGVGCRFPGDIDGPERLWDFLTEKKCAITAYPDRGFTNAGTFAESGGFLKDV
FT                   AGFDNRFFDIPPDEALRMDPQQRLLLEVSWEALEHAGIIPESLRLSRTGVFVGVSSTDY
FT                   VRLVSASAQQKSTIWDNTGGSSSIIANRISYFLDIQGPSIVIDTACSSSLVAVHLACRS
FT                   LSTWDCDIALVGGTNVLISPEPWGGFREAGILSQTGCCHAFDKSADGMVRGEGCGVIVL
FT                   QRLSDARLEGRRILAILTGSAVNQDGKSNGIMAPNPSAQIGVLENACKSARVDPLEIGY
FT                   VEAHGTGTSLGDRIEAHALGMVFGRKRPGSGPLMIGSIKPNIGHLEGAAGIAGLIKAGV
FT                   DG"
FT   CDS_pept        517914..520754
FT                   /transl_table=11
FT                   /gene="pks6b"
FT                   /locus_tag="BCG_0444"
FT                   /product="Probable membrane bound polyketide synthase pks6b
FT                   [second part]"
FT                   /note="In Mycobacterium tuberculosis strain H37Rv, pks6
FT                   exists as a single gene. In Mycobacterium bovis, a
FT                   frameshift due to single base insertion (*-g), splits pks6
FT                   into 2 parts, pks6a and pks6b"
FT                   /note="Differs from Mb0413 by 1aa, M921V"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0444"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70429"
FT                   /db_xref="GOA:A0A0H3MAF5"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAF5"
FT                   /protein_id="CAL70429.1"
FT                   /translation="MLMVERGSLLPSGGFTEPNPAIPFTELGLRVVDELQEWPVVAGRP
FT                   RRAGVSSFGFGGTNAHVIVEEAGSVGADTVSGRADVGGSGGGVVAWVISGKTASALAAQ
FT                   AGRLGRYVRARPALDVVDVGYSLVSTRSVFDHRAVVVGQTRDELLAGLAGVVAGRPEAG
FT                   VVCGVGKPAGKTAFVFAGQGSQWLGMGSELYAAYPVFAEALDAVVDELDRHLRYPLRDV
FT                   IWGHDQDLLNTTEFAQPALFAVEVALYRLLMSWGVRPGLVLGHSVGELAAAHVAGALCL
FT                   PDAAMLVAARGRLMQALPAGGAMFAVQAREDEVAPMLGHDVSIAAVNGPASVVISGAHD
FT                   AVSAIADRLRGQGRRVHRLAVSHAFHSALMEPMIAEFTAVAAELSVGLPTIPVISNVTG
FT                   QLVADDFASADYWARHIRAVVRFGDSVRSAHCAGASRFIEVGPGGGLTSLIEASLADAQ
FT                   IVSVPTLRKDRPEPVSVMTAAAQGFVSGMGLDWASVFSGYRPKRVELPTYAFQHQKFWL
FT                   APAPSVSDPTAAGQIGASDGGAELLASSGFAARLAGRSADEQLAAAIEVVCEHAAAVLG
FT                   RDGAAGLDAGQAFADSGFNSLSAVELRNRLTAVTAVTLPATAIFDHPTPTELAQYLITQ
FT                   IDGHGSSAAAAANPAERIDALTDLFLQACDAGRDADGWKMVALASNTRERMSSPVRNNV
FT                   SKNVALLADGISDVVVICIPTLTVLSDQREYRDIANAMTGRHSVYSLTLPGFDSSDALP
FT                   QNADMIVETVSNAIIDVVGGSCRFVLSGYSSGGVLAYALCSHLSVKHQRNPLGVALIDT
FT                   YLPSQIANPSMNEGFSPNDTGKGLSREVIRVARMLNRLTATRLTAAATYAAIFQAWEPG
FT                   RSMAPVLNIVAKDRIATVENLREERINRWRTAAAEAAYSVAEVPGDHFGMMSTSSEAIA
FT                   TEIHDWISGLVRGPHP"
FT   CDS_pept        complement(520702..521520)
FT                   /transl_table=11
FT                   /gene="BCG_0445c"
FT                   /locus_tag="BCG_0445c"
FT                   /product="Beta lactamase like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0445c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70430"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M246"
FT                   /protein_id="CAL70430.1"
FT                   /translation="MVATRGTRLAALALAPRLAGMAELVQITDKVHLARGHAVNWVLVT
FT                   DDTGVLLIDAGYPGDRAEVLASLNKLGYTPGDVRAIVLTHAHIDHLGSAIWFAREHSTP
FT                   VYCHAEEVGHAKREYRENASVFDVALRSWRPRVAVWGIHLLRRGGLTGDGIPTAQPLTA
FT                   EAAAGLPGQPMAIFTPGHTSGHCSYVVDGVLASGDALITGHPMLRHRGPQLLPAVFSHS
FT                   QQNSIRSLAALALLETNILAPGHGELWHGPIRKATDEALERAQKSNHVFR"
FT   CDS_pept        521598..522608
FT                   /transl_table=11
FT                   /gene="fgd1"
FT                   /locus_tag="BCG_0446"
FT                   /standard_name="fgd"
FT                   /product="Probable f420-dependent glucose-6-phosphate
FT                   dehydrogenase fgd1"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0446"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70431"
FT                   /db_xref="GOA:A0A0H3M1G9"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019944"
FT                   /db_xref="InterPro:IPR019945"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1G9"
FT                   /protein_id="CAL70431.1"
FT                   /translation="MAELKLGYKASAEQFAPRELVELAVAAEAHGMDSATVSDHFQPWR
FT                   HQGGHAPFSLSWMTAVGERTNRLLLGTSVLTPTFRYNPAVIAQAFATMGCLYPNRVFLG
FT                   VGTGEALNEIATGYEGAWPEFKERFARLRESVGLMRQLWSGDRVDFDGDYYRLKGASIY
FT                   DVPDGGVPVYIAAGGPAVAKYAGRAGDGFICTSGKGEELYTEKLMPAVREGAAAADRSV
FT                   DGIDKMIEIKISYDPDPELALNNTRFWAPLSLTAEQKHSIDDPIEMEKAADALPIEQIA
FT                   KRWIVASDPDEAVEKVGQYVTWGLNHLVFHAPGHDQRRFLELFQSDLAPRLRRLG"
FT   CDS_pept        522601..524673
FT                   /transl_table=11
FT                   /gene="pta"
FT                   /locus_tag="BCG_0447"
FT                   /product="Probable phosphate acetyltransferase pta"
FT                   /EC_number="2.3.1.8"
FT                   /note="Differs from Rv0408 by 1aa, A102G"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0447"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70432"
FT                   /db_xref="GOA:A0A0H3M7Y4"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR016475"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7Y4"
FT                   /protein_id="CAL70432.1"
FT                   /translation="MADSSAIYLAAPESQTGKSTIALGLLHRLTAMVAKVGVFRPITRL
FT                   SAERDYILELLLAHTSAGLPYERCVGVTYQQLHADRDDAIAEIVDSYHAMADECDAVVV
FT                   VGSDYTDVTSPTELSVNARIAVNLGAPVLLTVRAKDRTPDQVASVVEVCLAELDTQRAH
FT                   TAAVVANRCELSAIPAVTDALRRFTPPSYVVPEEPLLSAPTVAELTQAVNGAVVSGDVA
FT                   LREREVMGVLAAGMTADHVLERLTDGMAVITPGDRSDVVLAVASAHAAEGFPSLSCIVL
FT                   NGGFQLHPAIAALVSGLRLRLPVIATALGTYDTASAAASARGLVTATSQRKIDTALELM
FT                   DRHVDVAGLLAQLTIPIPTVTTPQMFTYRLLQQARSDLMRIVLPEGDDDRILKSAGRLL
FT                   QRGIVDLTILGDEAKVRLRAAELGVDLDGATVIEPCASELHDQFADQYAQLRKAKGITV
FT                   EHAREIMNDATYFGTMLVHNCHADGMVSGAAHTTAHTVRPALEIIKTVPGISTVSSIFL
FT                   MCLPDRVLAYGDCAIIPNPTVEQLADIAICSARTAAQFGIEPRVAMLSYSTGDSGKGAD
FT                   VDKVRAATELVRAREPQLPVEGPIQYDAAVEPSVAATKLRDSPVAGRATVLIFPDLNTG
FT                   NNTYKAVQRSAGAIAIGPVLQGLRKPVNDLSRGALVDDIVNTVAITAIQAQGVHE"
FT   CDS_pept        524666..525823
FT                   /transl_table=11
FT                   /gene="ackA"
FT                   /locus_tag="BCG_0448"
FT                   /product="Probable acetate kinase ackA"
FT                   /EC_number="2.7.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0448"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70433"
FT                   /db_xref="GOA:A0A0H3M3F1"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M3F1"
FT                   /protein_id="CAL70433.1"
FT                   /translation="MSSTVLVINSGSSSLKFQLVEPVAGMSRAAGIVERIGERSSPVAD
FT                   HAQALHRAFKMLAEDGIDLQTCGLVAVGHRVVHGGTEFHQPTLLDDTVIGKLEELSALA
FT                   PLHNPPAVLGIKVARRLLANVAHVAVFDTAFFHDLPPAAATYAIDRDVADRWHIRRYGF
FT                   HGTSHQYVSERAAAFLGRPLDGLNQIVLHLGNGASASAIARGRPVETSMGLTPLEGLVM
FT                   GTRSGDLDPGVISYLWRTARMGVEDIESMLNHRSGMLGLAGERDFRRLRLVIETGDRSA
FT                   QLAYEVFIHRLRKYLGAYLAVLGHTDVVSFTAGIGENDAAVRRDALAGLQGLGIALDQD
FT                   RNLGPGHGARRISSDDSPIAVLVVPTNEELAIARDCLRVLGGRRA"
FT   CDS_pept        complement(525877..528129)
FT                   /transl_table=11
FT                   /gene="pknG"
FT                   /locus_tag="BCG_0449c"
FT                   /product="Serine/threonine-protein kinase pknG"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0449c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70434"
FT                   /db_xref="GOA:A0A0H3MAF8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR031634"
FT                   /db_xref="InterPro:IPR031636"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAF8"
FT                   /protein_id="CAL70434.1"
FT                   /translation="MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDN
FT                   FPHPTLGPDTEPQDRMATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKR
FT                   FCWNCGRPVGRSDSETKGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLG
FT                   WIYLALDRNVNGRPVVLKGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDR
FT                   HGDPVGYIVMEYVGGQSLKRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPEN
FT                   IMLTEEQLKLIDLGAVSRINSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTL
FT                   DLPTRNGRYVDGLPEDDPVLKTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREV
FT                   VAQDTGVPRPGLSTIFSPSRSTFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLV
FT                   DPTDVAASVLQATVLSQPVQTLDSLRAARHGALDADGVDFSESVELPLMEVRALLDLGD
FT                   VAKATRKLDDLAERVGWRWRLVWYRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLAL
FT                   AATAELAGNTDEHKFYQTVWSTNDGVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRH
FT                   FTTARLTSAVTLLSGRSTSEVTEEQIRDAARRVEALPPTEPRVLQIRALVLGGALDWLK
FT                   DNKASTNHILGFPFTSHGLRLGVEASLRSLARVAPTQRHRYTLVDMANKVRPTSTF"
FT   CDS_pept        complement(528129..529115)
FT                   /transl_table=11
FT                   /gene="glnH"
FT                   /locus_tag="BCG_0450c"
FT                   /product="Probable glutamine-binding lipoprotein glnH"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0450c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70435"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M252"
FT                   /protein_id="CAL70435.1"
FT                   /translation="MTRRALLARAAAPLAPLALAMVLASCGHSETLGVEATPTLPLPTP
FT                   VGMEIMPPQPPLPPDSSSQDCDPTASLRPFATKAEADAAVADIRARGRLIVGLDIGSNL
FT                   FSFRDPITGEITGFDVDIAGEVARDIFGVPSHVEYRILSAAERVTALQKSQVDIVVKTM
FT                   SITCERRKLVNFSTVYLDANQRILAPRDSPITKVSDLSGKRVCVARGTTSLRRIREIAP
FT                   PPVIVSVVNWADCLVALQQREIDAVSTDDTILAGLVEEDPYLHIVGPDMADQPYGVGIN
FT                   LDNTGLVRFVNGTLERIRNDGTWNTLYRKWLTVLGPAPAPPTPRYVD"
FT   CDS_pept        complement(529115..530434)
FT                   /transl_table=11
FT                   /gene="BCG_0451c"
FT                   /locus_tag="BCG_0451c"
FT                   /product="Possible conserved membrane protein"
FT                   /note="Differs from Rv0412c by 1aa, Y355D"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0451c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70436"
FT                   /db_xref="GOA:A0A0H3M1H5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1H5"
FT                   /protein_id="CAL70436.1"
FT                   /translation="MTVELAHPSTEPLGSRSPAEPAHPRRWFISTTPGRIMTIGIVLAA
FT                   LGVASAFATSTTIEHRQQVLTAVLDHTEPLSFAAGRLYTTLSVADAAAATAFIAQAEPG
FT                   GVRLRYEQAITDASVAVTRASSGLTDESLVQLLGRINAELAVYTGLVEIARANNRAGNP
FT                   VGSSYLSEASGLMQSTILPDAQRLYQATSARVDRETTASTQIPAPVILVVATTVVFGAF
FT                   AHRWLARRTRRRINPGLVVGALGILVMVVWVGTALTISTTASRSAKDTAAESLKTITNL
FT                   AITAQQARADETLSLIRRGDEEVRKQAFYQRIDAMQRQLNDYMARRHAVDKPDLQGADQ
FT                   LLVRWRQANDRINSYISVGNYRAATQVALGKGEDDATPAFDKLDEALTKAMGQSRTQLR
FT                   HDILNAHRGLAGAQVGGVVLSLGAAIAVALGLWPRLKEYR"
FT   CDS_pept        530528..531181
FT                   /transl_table=11
FT                   /gene="mutT3"
FT                   /locus_tag="BCG_0452"
FT                   /product="Possible mutator protein mutT3
FT                   (7,8-DIHYDRO-8-OXOGUANINE-TRIPHOSPHATASE) (8-OXO-DGTPASE)
FT                   (DGTP PYROPHOSPHOHYDROLASE)"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0452"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70437"
FT                   /db_xref="GOA:A0A0H3M7Y8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M7Y8"
FT                   /protein_id="CAL70437.1"
FT                   /translation="MPSCPPAYSEQVRGDGDGWVVSDSGVAYWGRYGAAGLLLRAPRPD
FT                   GTPAVLLQHRALWSHQGGTWGLPGGARDSHETPEQTAVRESSEEAGLSAERLEVRATVV
FT                   TAEVCGVDDTHWTYTTVVADAGELLDTVPNRESAELRWVAENEVADLPLHPGFAASWQR
FT                   LRTAPATVPLARCDERRQRLPRTIQIEAGVFLWCTPGDADQAPSPLGRRISSLL"
FT   CDS_pept        complement(531165..531833)
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="BCG_0453c"
FT                   /product="Probable thiamine-phosphate pyrophosphorylase
FT                   thiE"
FT                   /EC_number="2.5.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0453c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70438"
FT                   /db_xref="GOA:A1KFN6"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KFN6"
FT                   /protein_id="CAL70438.1"
FT                   /translation="MHESRLASARLYLCTDARRERGDLAQFAEAALAGGVDIIQLRDKG
FT                   SPGELRFGPLQARDELAACEILADAAHRYGALFAVNDRADIARAAGADVLHLGQRDLPV
FT                   NVARQILAPDTLIGRSTHDPDQVAAAAAGDADYFCVGPCWPTPTKPGRAAPGLGLVRVA
FT                   AELGGDDKPWFAIGGINAQRLPAVLDAGARRIVVVRAITSADDPRAAAEQLRSALTAAN
FT                   "
FT   CDS_pept        531963..532985
FT                   /transl_table=11
FT                   /gene="thiO"
FT                   /locus_tag="BCG_0454"
FT                   /product="Possible thiamine biosynthesis oxidoreductase
FT                   thiO"
FT                   /EC_number="1.-.-.-"
FT                   /note="Differs from Rv0415 by 1aa, A158V"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0454"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70439"
FT                   /db_xref="GOA:A0A0H3M3G1"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR012727"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M3G1"
FT                   /protein_id="CAL70439.1"
FT                   /translation="MASDLHTGSLAVIGGGVIGLSVARRAAQAGWPVRVHRSDERGASW
FT                   VAGGMLAPHSEGWPGEERLLRLGLQSLRLWREGSFLDGLGPQLVTAHESLVVAVDRADV
FT                   ADLRTVADWLSAQGHPVIWESAARDVEPLLAQGIRHGFRAPTELAVDNRALLDALCRDC
FT                   ERLGVRWSSQVSSLSDVDAHTVVIANGIDAPALWPGLPIRPVKGEVLRLRWRPGCMPLP
FT                   QRVIRARVRGRQVYLVPRSDGVVVGATQYEHGRDTAPVVSGVRDLLDDACTVLPALGEY
FT                   ELAECEAGLRPMTPDNLPLVQRLDSRTLVAAGHGRSGFLLAPWTAEQIVSELVSVGAAS
FT                   "
FT   CDS_pept        532982..533188
FT                   /transl_table=11
FT                   /gene="thiS"
FT                   /locus_tag="BCG_0455"
FT                   /product="Possible protein thiS"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0455"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70440"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAG1"
FT                   /protein_id="CAL70440.1"
FT                   /translation="MIVVVNEQQVEVDEQTTIAALLDSLGFGDRGIAVALNFSVLPRSD
FT                   WATKICELRKPVRLEVVTAVQGG"
FT   CDS_pept        533181..533939
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="BCG_0456"
FT                   /product="Probable thiamin biosynthesis protein thiG"
FT                   /note="Differs from Rv0417 by 1aa, C75S"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0456"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70441"
FT                   /db_xref="GOA:A1KFN9"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KFN9"
FT                   /protein_id="CAL70441.1"
FT                   /translation="MAESKLVIGDRSFASRLIMGTGGATNLAVLEQALIASGTELTTVA
FT                   IRRVDADGGTGLLDLLNRLGITPLPNTAGCRSAAEAVLTAQLAREALNTNWVKLEVIAD
FT                   ERTLWPDAVELVRAAEQLVDDGFVVLPYTTDDPVLARRLEDTGCAAVMPLGSPIGTGLG
FT                   IANPHNIEMIVAGARVPVVLDAGIGTASDAALAMELGCDAVLLASAVTRAADPPAMAAA
FT                   MAAAVTAGYLARCAGRIPKRFWAQASSPAR"
FT   CDS_pept        534311..535813
FT                   /transl_table=11
FT                   /gene="lpqL"
FT                   /locus_tag="BCG_0457"
FT                   /product="Probable lipoprotein aminopeptidase lpqL"
FT                   /EC_number="3.4.11.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0457"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70442"
FT                   /db_xref="GOA:A0A0H3M264"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="InterPro:IPR041756"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M264"
FT                   /protein_id="CAL70442.1"
FT                   /translation="MVNKSRMMPAVLAVAVVVAFLTTGCIRWSTQSRPVVNGPAAAEFA
FT                   VALRNRVSTDAMMAHLSKLQDIANANDGTRAVGTPGYQASVDYVVNTLRNSGFDVQTPE
FT                   FSARVFKAEKGVVTLGGNTVEARALEYSLGTPPDGVTGPLVAAPADDSPGCSPSDYDRL
FT                   PVSGAVVLVDRGVCPFAQKEDAAAQRGAVALIIADNIDEQAMGGTLGANTDVKIPVVSV
FT                   TKSVGFQLRGQSGPTTVKLTASTQSFKARNVIAQTKTGSSANVVMAGAHLDSVPEGPGI
FT                   NDNGSGVAAVLETAVQLGNSPHVSNAVRFAFWGAEEFGLIGSRNYVESLDIDALKGIAL
FT                   YLNFDMLASPNPGYFTYDGDQSLPLDARGQPVVPEGSAGIERTFVAYLKMAGKTAQDTS
FT                   FDGRSDYDGFTLAGIPSGGLFSGAEVKKSAEQAELWGGTADEPFDPNYHQKTDTLDHID
FT                   RTALGINGAGVAYAVGLYAQDLGGPNGVPVMADRTRHLIAKP"
FT   CDS_pept        535901..537397
FT                   /transl_table=11
FT                   /gene="lpqM"
FT                   /locus_tag="BCG_0458"
FT                   /product="Possible lipoprotein peptidase lpqM"
FT                   /EC_number="3.4.11.-"
FT                   /note="Differs from Rv0419 by 2aa, T73A, T297A, and from
FT                   Mb0427 by 1aa, T73A"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0458"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70443"
FT                   /db_xref="GOA:A0A0H3M1I0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1I0"
FT                   /protein_id="CAL70443.1"
FT                   /translation="MHGRGRYRPLVRCVRPRRVAASVRTPIACLAAVVVIAGCTTVVDG
FT                   RALSILNDPFRVGGLPATNGPSGARPDTPAASGTVINTNNGAIDKLSLLSVNDIEDYWM
FT                   AVYSESLKGTFRPVGKLVSYDSNDPSSPIVCHIDTYQLVNAFFSSRCNLIAWDRGVFMA
FT                   VAQEYFGDMSVNGVLAHEFGHALQVMANLVTRKDPTIVREQQADCFAGVYLWWVAEGKS
FT                   TRFTLSTADGLDHVLAGIITTRDPVMEADAENDDEHGSALDRVSAFQLGFINGTPACAA
FT                   IDEDEVERRRGDLPTTLRVDASGNPETGEVGINEETLSTLMELMGKIFSPKNPPTLSYQ
FT                   PAGCPDAKPSPPAAYCPATNTIVVDLPALARMGKVASAAEHSLPQGDDTSLSIVMSRYA
FT                   LAVQHERGLPMQSPWTALRTACLTGVAHRKMAVPIDLPSGQQLVLTAGDLDEAVSGLLT
FT                   NRMVASDADGVSVPAGFTRIAAFRAGVGGDMDACYARYPG"
FT   CDS_pept        complement(537376..537786)
FT                   /transl_table=11
FT                   /gene="BCG_0459c"
FT                   /locus_tag="BCG_0459c"
FT                   /product="Possible transmembrane protein"
FT                   /note="Differs from Rv0420c by 1aa, G21E"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0459c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70444"
FT                   /db_xref="GOA:A0A0H3M807"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M807"
FT                   /protein_id="CAL70444.1"
FT                   /translation="MRLHDASAAAPESRMHIARHGEAVNRRQMFIGITGLLLAVIGLMA
FT                   LWFPVYLDQYDAYGIKVTCGSGWRSNLTQALYADGNDNTQALVTRCDTALLVRRAWAIP
FT                   SVALGWLLVTGFLVMWVHNDQHQGQSYPGYRA"
FT   CDS_pept        complement(537947..538576)
FT                   /transl_table=11
FT                   /gene="BCG_0460c"
FT                   /locus_tag="BCG_0460c"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0460c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70445"
FT                   /db_xref="InterPro:IPR026555"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M3G7"
FT                   /protein_id="CAL70445.1"
FT                   /translation="MNLDQIAGVAHQPAGPPHGVVVLTHGAGGSRESTLLQQVCAEWTR
FT                   RGWLAVRYNLPYRRRRPTGPPSGSGSGDRAGIVEAIQLCRGLAEGPLIAGGHSYGGRQT
FT                   SMVVAAGQAPVDVLTLFSYPVHPPGKPERVRTEHLPGIAVPTVFTHGTADPFGTLAQVR
FT                   SAAAMVSAPTEVVEITGARHDLGSKTLDVARLAVDAALRLSAGQIA"
FT   CDS_pept        complement(538573..539370)
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="BCG_0461c"
FT                   /product="Probable phosphomethylpyrimidine kinase thiD"
FT                   /EC_number="2.7.4.7"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0461c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70446"
FT                   /db_xref="GOA:A0A0H3MAG3"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAG3"
FT                   /protein_id="CAL70446.1"
FT                   /translation="MTPPRVLSIAGSDSGGGAGIQADMRTMALLGVHACVAVTAVTVQN
FT                   TLGVKDIHEVPNDVVAGQIEAVVTDIGVQAAKTGMLASSRIVATVAATWRRLELSVPLV
FT                   VDPVCASMHGDPLLAPSALDSLRGQLFPLATLLTPNLDEARLLVDIEVVDAESQRAAAK
FT                   ALHALGPQWVLVKGGHLRSSDGSCDLLYDGVSCYQFDAQRLPTGDDHGGGDTLATAIAA
FT                   ALAHGFTVPDAVDFGKRWVTECLRAAYPLGRGHGPVSPLFRLS"
FT   CDS_pept        complement(539397..541040)
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /locus_tag="BCG_0462c"
FT                   /product="Probable thiamine biosynthesis protein thiC"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0462c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70447"
FT                   /db_xref="GOA:A1KFP5"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KFP5"
FT                   /protein_id="CAL70447.1"
FT                   /translation="MTITVEPSVTTGPIAGSAKAYREIEAPGSGATLQVPFRRVHLSTG
FT                   DHFDLYDTSGPYTDTDTVIDLTAGLPHRPGVVRDRGTQLQRARAGEITAEMAFIAARED
FT                   MSAELVRDEVARGRAVIPANHHHPESEPMIIGKAFAVKVNANIGNSAVTSSIAEEVDKM
FT                   VWATRWGADTIMDLSTGKNIHETREWILRNSPVPVGTVPIYQALEKVKGDPTELTWEIY
FT                   RDTVIEQCEQGVDYMTVHAGVLLRYVPLTAKRVTGIVSRGGSIMAAWCLAHHRESFLYT
FT                   NFEELCDIFARYDVTFSLGDGLRPGSIADANDAAQFAELRTLGELTKIAKAHGAQVMIE
FT                   GPGHIPMHKIVENVRLEEELCEEAPFYTLGPLATDIAPAYDHITSAIGAAIIAQAGTAM
FT                   LCYVTPKEHLGLPDRKDVKDGVIAYKIAAHAADLAKGHPRAQERDDALSTARFEFRWND
FT                   QFALSLDPDTAREFHDETLPAEPAKTAHFCSMCGPKFCSMRITQDVREYAAEHGLETEA
FT                   DIEAVLAAGMAEKSREFAEHGNRVYLPITQ"
FT   CDS_pept        complement(541192..541467)
FT                   /transl_table=11
FT                   /gene="BCG_0463c"
FT                   /locus_tag="BCG_0463c"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0463c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70448"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M270"
FT                   /protein_id="CAL70448.1"
FT                   /translation="MAEKNTRRATSQREAVAKIREAETIVMNLPICGQVKIPRPEHLAY
FT                   YGGLAALAALELIDWPVALVIATGHILANNHHNRVLEELGEAMEEA"
FT   CDS_pept        complement(541517..546136)
FT                   /transl_table=11
FT                   /gene="ctpH"
FT                   /locus_tag="BCG_0464c"
FT                   /product="Possible metal cation transporting P-type atpase
FT                   ctpH"
FT                   /EC_number="3.6.1.-"
FT                   /note="Differs from Rv0425c by 1aa, A222E"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0464c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70449"
FT                   /db_xref="GOA:A0A0H3M1I5"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1I5"
FT                   /protein_id="CAL70449.1"
FT                   /translation="MPVRAVATGFRATATLTGASITAATAVSATLAKTGVGTGMKVAII
FT                   PLRAGAKALSGELSRETLGRNCWRGERRAWIEVRGLRSGGDDELGRVVLNAIQAHPGVG
FT                   SASLNYPLSRVVVAIDDPDTSLRELCRIVDDAEKAERHRHPDQAADQLAQSPGSLPGDG
FT                   VLLAVRAVTVAATAAGLGLALGGRALRWPRFPLVIEAAVAAVDHQPLLRRLLEDRIGTA
FT                   ATATVLELAMAAAHTVTLSPAALSVDLTIQALKAAECRAGARAWRRHEPQLALHADEPA
FT                   DQPQSLWPRPARSTQPVQRSVARFALIQALSAVLVGAGTRDADMAATATLVATPKASRT
FT                   TPEAFAAALGQGLADQHAVLPLRPESLRRLDRVDAIVIDPRVLCTDDLRVARIRGCGAD
FT                   ELSTAWNRAQLVLTESGLRPGWHRVPGVSASGSDSAVEALFRPMHDRLASAVVAEAHRT
FT                   GADLVSVDVDALGELRPVFDDIRPLDDGASGSLDEALARAVAELRQAGRTVAVLSSVGK
FT                   QALSAADVALGVLPPPGAGAPPWYADVLLPDLGAAWRVLHAIPAARAARQRGNEISGGA
FT                   SALGALLMLPGVRGLGPGPVTTGAAAGLLSGYLLARKVVDAQAPRPAPAHEWHAMSVEQ
FT                   VRKALPSPDEQAPAKAPPSPYPARALAGGLHTAKRGAQITQAPLNALWQLTKAVRAELS
FT                   DPLTPMLALGAMASAVLGSPVDAVMVGSVLTGNSILAASQRLRAESRLNRLLAQQIPPA
FT                   RKVLAGADDQPRYIEVRAEELRPGDIIEVRTHEVVPADARVIEEVDVEVDESALTGESL
FT                   SVTKQVEPTPGVDLIERRCMLYAGTTVVSGTAVAVVTAVGPDTQERRAAELVSGDLSSV
FT                   GLQHQLSRLTNQAWPVSMTGGALVTGLGLLRRRGLRQAVASGIAVTVAAVPEGMPLVAT
FT                   LAQQASARRLSHFGALVRIPRSVEALGRVDMVCFDKTGTLSENRLRVAQVRPVAGHSRE
FT                   EVLRCAAHAAPASNGPQVHATDVAIVQAAAAAAASGTDGAEPGAAEPAAHLPFRSGRSF
FT                   SASVSGTELTVKGAPEVVLAACEGIGSSMDDAVAELAANGLRVIAVAHRQLTAQQAQSV
FT                   VDDPDEIARLCRDELSLVGFLGLSDTPRAQAAALLADLHEHDLDIRLITGDHPITAAAI
FT                   AEELGMQVSPEQVISGAEWDALSRKDQERAVAERVIFARMTPENKVQIVQTLEHSGRVC
FT                   AMVGDGSNDAAAIRAATVGIGVVAHGSDPARVAADLVLVDGRIESLLPAILEGRQLWQR
FT                   VQAAVSVLLGGNAGEVAFAIIGSAITGTSPLNTRQLLLVNMLTDALPAAALAVSKPSDP
FT                   VTPATRGPDQRELWRAVGIRGATTAAAATVAWVMAGFTGLPRRASTVALVALVAAQLGQ
FT                   TLVDSHAWLVVLTALGSLAALATLISIPVVSQLLGCTPLDPLGWAQATAAATAATVAVA
FT                   VLNRVLTGRDKSGQPNPQPPETDALSRDASPGAPPGPRRRRRATARRKAPVKAPSATRQ
FT                   TTKPKGPPAHRSSSTYPRR"
FT   CDS_pept        complement(546188..546631)
FT                   /transl_table=11
FT                   /gene="BCG_0465c"
FT                   /locus_tag="BCG_0465c"
FT                   /product="Possible transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0465c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70450"
FT                   /db_xref="GOA:A0A0H3M812"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M812"
FT                   /protein_id="CAL70450.1"
FT                   /translation="MSVVGGTVRTVGRTVSGAATATTAAAGAVGGAAVSGIVGGVTGAA
FT                   KGIQKGLSSGSKSTAAAALAIGAIGVAGLVDWPILLAVGGGALLLRKLNRTPEVAAPPV
FT                   KAKLAPVPDKPAAAKEAPAKASKTTARKTSGRRAGTAELRSTN"
FT   CDS_pept        complement(546832..547707)
FT                   /transl_table=11
FT                   /gene="xthA"
FT                   /locus_tag="BCG_0466c"
FT                   /product="Probable exodeoxyribonuclease III protein xthA"
FT                   /EC_number="3.1.11.2"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0466c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70451"
FT                   /db_xref="GOA:A0A0H3M3H4"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M3H4"
FT                   /protein_id="CAL70451.1"
FT                   /translation="MPDGTIDGGHPQRPASPRLRSPLLRLATWNVNSIRTRLDRVLDWL
FT                   GRADVDVLAMQETKCPDGQFPALPLFELGYDVAHVGFDQWNGVAIASRVGLDDVRVGFD
FT                   GQPSWSGKPEVAATTEARALGATCGGIRVWSLYVPNGRALDDPHYTYKLDWLAALRDTA
FT                   EGWLRDDPAAPIALMGDWNIAPTDDDVWSTEFFAGCTHVSEPERKAFNAIVDAQFTDVV
FT                   RPFTPGPGVYTYWDYTQLRFPKKQGMRIDFILGSPALAARVMDAQIVREERKGKAPSDH
FT                   APVLVDLHAG"
FT   CDS_pept        complement(547710..548618)
FT                   /transl_table=11
FT                   /gene="BCG_0467c"
FT                   /locus_tag="BCG_0467c"
FT                   /product="Hypothetical protein"
FT                   /note="Differs from Rv0428c by 1aa G149D"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0467c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70452"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAG6"
FT                   /protein_id="CAL70452.1"
FT                   /translation="MVSWPGLGTRVTVRYRRPAGSMPPLTDAVGRLLAVDPTVRVQTKT
FT                   GTIVEFSPVDVVALRVLTDAPVRTAAIRALEHAAAAAWPGVERTWLDGWLLRAGHGAVL
FT                   AANSAVPLDISAHTNTITEISAWYASRDLQPWLAVPDRLLPLPAGLAGERREQVLVRDV
FT                   STGEPDRSVTLLDHPDDTWLRLYHQRLPLDMATPVIDGELAFGSYLGVAVARAAVTDAP
FT                   DGTRWVGLSAMRAADEQSATGSAGRQLWEALLGWGAGRGATRGYVRVHDTATSVLAESL
FT                   GFRLHHHCRYLPAQSVGWDTF"
FT   CDS_pept        complement(548618..549211)
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="BCG_0468c"
FT                   /product="Probable polypeptide deformylase def"
FT                   /EC_number="3.5.1.31"
FT                   /note="Differs from Rv0429c by 1aa, A2T"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0468c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70453"
FT                   /db_xref="GOA:A1KFQ1"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KFQ1"
FT                   /protein_id="CAL70453.1"
FT                   /translation="MAVVPIRIVGDPVLHTATTPVTVAADGSLPADLAQLIATMYDTMD
FT                   AANGVGLAANQIGCSLRLFVYDCAADRAMTARRRGVVINPVLETSEIPETMPDPDTDDE
FT                   GCLSVPGESFPTGRAKWARVTGLDADGSPVSIEGTGLFARMLQHETGHLDGFLYLDRLI
FT                   GRYARNAKRAVKSHGWGVPGLSWLPGEDPDPFGH"
FT   CDS_pept        549548..549856
FT                   /transl_table=11
FT                   /gene="BCG_0469"
FT                   /locus_tag="BCG_0469"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0469"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70454"
FT                   /db_xref="InterPro:IPR021678"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M274"
FT                   /protein_id="CAL70454.1"
FT                   /translation="MDSAMARAIRSGDDAEVADGLTRREHDILAFERQWWKFAGVKEEA
FT                   IKELFSMSATRYYQVLNALVDRPEALAADPMLVKRLRRLRASRQKARAARRLGFEVT"
FT   CDS_pept        549888..550382
FT                   /transl_table=11
FT                   /gene="BCG_0470"
FT                   /locus_tag="BCG_0470"
FT                   /product="Putative tuberculin related peptide"
FT                   /note="Differs from Rv0431 by 2aa, G38V, A87T"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0470"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70455"
FT                   /db_xref="GOA:A0A0H3M1J1"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1J1"
FT                   /protein_id="CAL70455.1"
FT                   /translation="MLVTVGSMNERVPDSSGLPLRAMVMVLLFLGVVFLLLGWQALGSS
FT                   PNSEDDSSAISTMTTTTAAPTSTSVKPAAPRAEVRVYNISGAEGAAARTADRLKAAGFT
FT                   VTDVGNLSLPDVAATTVYYTEVEGERATADAVGRTLGAAVELRLPELSDQPPGVIVVVT
FT                   G"
FT   CDS_pept        550415..551137
FT                   /transl_table=11
FT                   /gene="sodC"
FT                   /locus_tag="BCG_0471"
FT                   /product="Probable periplasmic superoxide dismutase [Cu-Zn]
FT                   sodC"
FT                   /EC_number="1.15.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0471"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70456"
FT                   /db_xref="GOA:A0A0H3M817"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR036423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M817"
FT                   /protein_id="CAL70456.1"
FT                   /translation="MPKPADHRNHAAVSTSVLSALFLGAGAALLSACSSPQHASTVPGT
FT                   TPSIWTGSPAPSGLSGHDEESPGAQSLTSTLTAPDGTKVATAKFEFANGYATVTIATTG
FT                   VGKLTPGFHGLHIHQVGKCEPNSVAPTGGAPGNFLSAGGHYHVPGHTGTPASGDLASLQ
FT                   VRGDGSAMLVTTTDAFTMDDLLSGAKTAIIIHAGADNFANIPPERYVQVNGTPGPDETT
FT                   LTTGDAGKRVACGVIGSG"
FT   CDS_pept        551139..552269
FT                   /transl_table=11
FT                   /gene="BCG_0472"
FT                   /locus_tag="BCG_0472"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0472"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70457"
FT                   /db_xref="GOA:A1KFQ5"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KFQ5"
FT                   /protein_id="CAL70457.1"
FT                   /translation="MPARRSAARIDFAGSPRPTLGVEWEFALVDSQTRDLSNEATAVIA
FT                   EIGENPRVHKELLRNTVEIVSGICECTAEAMQDLRDTLGPARQIVRDRGMELFCAGTHP
FT                   FARWSAQKLTDAPRYAELIKRTQWWGRQMLIWGVHVHVGIRSAHKVMPIMTSLLNYYPH
FT                   LLALSASSPWWGGEDTGYASNRAMMFQQLPTAGLPFHFQRWAEFEGFVYDQKKTGIIDH
FT                   MDEIRWDIRPSPHLGTLEVRICDGVSNLRELGALVALTHCLIVDLDRRLDAGETLPTMP
FT                   PWHVQENKWRAARYGLDAVIILDADSNERLVTDDLADVLTRLEPVAKSLNCADELAAVS
FT                   DIYRDGASYQRQLRVAQQHDGDLRAVVDALVAELVI"
FT   CDS_pept        552329..552982
FT                   /transl_table=11
FT                   /gene="BCG_0473"
FT                   /locus_tag="BCG_0473"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Differs from Rv0434 by 1aa, A190T"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0473"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70458"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M3I0"
FT                   /protein_id="CAL70458.1"
FT                   /translation="MADFAPVELAMFPLESAPLPDEDLPLHIFEPRYAALVRDCMDTAD
FT                   PRFGVVLISRGREVGGGDTRCDVGTLARITECADAGSGRYMLRCRVGERIRVCDWLPDD
FT                   PYPRAKVRFWPDQPGHPVTAAQLLEVEDRVVALFERIAAARGVRLPAREVVLGYPVVDP
FT                   ADTGQRLYALACRVPMGPADRYAVLAAPSAADRLVRLGDALDSVAAMVEFELST"
FT   CDS_pept        complement(553162..555348)
FT                   /transl_table=11
FT                   /gene="BCG_0474c"
FT                   /locus_tag="BCG_0474c"
FT                   /product="Putative conserved atpase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0474c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70459"
FT                   /db_xref="GOA:A0A0H3MAG9"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAG9"
FT                   /protein_id="CAL70459.1"
FT                   /translation="MTHPDPARQLTLTARLNTSAVDSRRGVVRLHPNAIAALGIREWDA
FT                   VSLTGSRTTAAVAGLAAADTAVGTVLLDDVTLSNAGLREGTEVIVSPVTVYGARSVTLS
FT                   GSTLATQSVPPVTLRQALLGKVMTVGDAVSLLPRDLGPGTSTSAASRALAAAVGISWTS
FT                   ELLTVTGVDPDGPVSVQPNSLVTWGAGVPAAMGTSTAGQVSISSPEIQIEELKGAQPQA
FT                   AKLTEWLKLALDEPHLLQTLGAGTNLGVLVSGPAGVGKATLVRAVCDGRRLVTLDGPEI
FT                   GALAAGDRVKAVASAVQAVRHEGGVLLITDADALLPAAAEPVASLILSELRTAVATAGV
FT                   VLIATSARPDQLDARLRSPELCDRELGLPLPDAATRKSLLEALLNPVPTGDLNLDEIAS
FT                   RTPGFVVADLAALVREAALRAASRASADGRPPMLHQDDLLGALTVIRPLSRSASDEVTV
FT                   GDVTLDDVGDMAAAKQALTEAVLWPLQHPDTFARLGVEPPRGVLLYGPPGCGKTFVVRA
FT                   LASTGQLSVHAVKGSELMDKWVGSSEKAVRELFRRARDSAPSLVFLDELDALAPRRGQS
FT                   FDSGVSDRVVAALLTELDGIDPLRDVVMLGATNRPDLIDPALLRPGRLERLVFVEPPDA
FT                   AARREILRTAGKSIPLSSDVDLDEVAAGLDGYSAADCVALLREAALTAMRRSIDAANVT
FT                   AADLATARETVRASLDPLQVASLRKFGTKGDLRS"
FT   CDS_pept        complement(555345..556205)
FT                   /transl_table=11
FT                   /gene="pssA"
FT                   /locus_tag="BCG_0475c"
FT                   /product="Probable cdp-diacylglycerol--serine
FT                   o-phosphatidyltransferase pssA"
FT                   /EC_number="2.7.8.8"
FT                   /note="Differs from Rv0436c by 1aa, V167G"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0475c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70460"
FT                   /db_xref="GOA:A0A0H3M280"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M280"
FT                   /protein_id="CAL70460.1"
FT                   /translation="MIGKPRGRRGVNLQILPSAMTVLSICAGLTAIKFALEHQPKAAMA
FT                   LIAAAAILDGLDGRVARILDAQSRMGAEIDSLADAVNFGVTPALVLYVSMLSKWPVGWV
FT                   VVLLYAVCVVLRLARYNALQDDGTQPAYAHEFFVGMPAPAGAVSMIGLLALKMQFGEGW
FT                   WTSVWFLSFWVTGTSILLVSGIPMKKMHAVSVPPNYAAALLAVLAICAAAAVLAPYLLI
FT                   WVIIIAYMCHIPFAVRSQRWLAQHPEVWDDKPKQRRAVRRASRRAHPYRPSMARLGLRK
FT                   PGRRL"
FT   CDS_pept        complement(556202..556897)
FT                   /transl_table=11
FT                   /gene="psd"
FT                   /locus_tag="BCG_0476c"
FT                   /product="possible phosphatidylserine decarboxylase psd"
FT                   /EC_number="4.1.1.65"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0476c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70461"
FT                   /db_xref="GOA:A1KFQ9"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033175"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KFQ9"
FT                   /protein_id="CAL70461.1"
FT                   /translation="MARRPRPDGPQHLLALVRSAVPPVHPAGRPFIAAGLAIAAVGHRY
FT                   RWLRGTGLLAAAACAGFFRHPQRVPPTRPAAIVAPADGVICAIDSAAPPAELSMGDTPL
FT                   PRVSIFLSILDAHVQRAPVSGEVIAVQHRPGRFGSADLPEASDDNERTSVRIRMPNGAE
FT                   VVAVQIAGLVARRIVCDAHVGDKLAIGDTYGLIRFGSRLDTYLPAGAEPIVNVGQRAVA
FT                   GETVLAECR"
FT   CDS_pept        complement(556958..558175)
FT                   /transl_table=11
FT                   /gene="moeA2"
FT                   /locus_tag="BCG_0477c"
FT                   /product="Probable molybdopterin biosynthesis protein
FT                   moeA2"
FT                   /note="Differs from Rv0438c by 1aa, I15M"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0477c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70462"
FT                   /db_xref="GOA:A0A0H3M1J6"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1J6"
FT                   /protein_id="CAL70462.1"
FT                   /translation="MRSVQEHQRVVAEMIRACRPITVPLTQAQGLVLGGDVVAPLSLPV
FT                   FDNSAMDGYAVRAEDTSGATPQNPVMLPVAEDIPAGRADMLTLQPVTAHRIMTGAPVPT
FT                   GATAIVPVEATDGGVDSVAIRQQATPGKHIRRSGEDVAAGTTVLHNGQIVTPAVLGLAA
FT                   ALGLAELPVLPRQRVLVISTGSELASPGTPLQPGQIYESNSIMLAAAVRDAGAAVVATA
FT                   TAGDDVAQFGAILDRYAVDADLIITSGGVSAGAYEVVKDAFGSADYRGGDHGVEFVKVA
FT                   MQPGMPQGVGRVAGTPIVTLPGNPVSALVSFEVFIRPPLRMAMGLPDPYRPHRSAVLTA
FT                   SLTSPRGKRQFRRAILDHQAGTVISYGPPASHHLRWLASANGLLDIPEDVVEVAAGTQL
FT                   QVWDLT"
FT   CDS_pept        complement(558194..559129)
FT                   /transl_table=11
FT                   /gene="BCG_0478c"
FT                   /locus_tag="BCG_0478c"
FT                   /product="Putative dehydrogenase/reductase"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0478c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70463"
FT                   /db_xref="GOA:A0A0H3M824"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M824"
FT                   /protein_id="CAL70463.1"
FT                   /translation="MTANDNKTRKWSAADVPDQSGRVVVVTGANTGIGYHTAAVFADRG
FT                   AHVVLAVRNLEKGNAARARIMAARPGAHVTLQQLDLCSLDSVRAAADALRTAYPRIDVL
FT                   INNAGVMWTPKQVTKDGFELQFGTNHLGHFALTGLVLDHMLPVPGSRVVTVSSQGHRIH
FT                   AAIHFDDLQWERRYNRVAAYGQAKLANLLFTYELQRRLGEAGKSTIAVAAHPGGSNTEL
FT                   TRNLPRLIRPVATVLGPLLFQSPEMGALPTLRAATDPTTQGGQYYGPDGFGEQRGHPKV
FT                   VQSSAQSHDKDLQRRLWTVSEELTGVSFGV"
FT   CDS_pept        559423..561045
FT                   /transl_table=11
FT                   /gene="groEL2"
FT                   /locus_tag="BCG_0479"
FT                   /standard_name="groL2; groEL-2; hsp65; hsp60"
FT                   /product="60 KDA chaperonin 2 groel2"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0479"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70464"
FT                   /db_xref="GOA:A1KFR2"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KFR2"
FT                   /protein_id="CAL70464.1"
FT                   /translation="MAKTIAYDEEARRGLERGLNALADAVKVTLGPKGRNVVLEKKWGA
FT                   PTITNDGVSIAKEIELEDPYEKIGAELVKEVAKKTDDVAGDGTTTATVLAQALVREGLR
FT                   NVAAGANPLGLKRGIEKAVEKVTETLLKGAKEVETKEQIAATAAISAGDQSIGDLIAEA
FT                   MDKVGNEGVITVEESNTFGLQLELTEGMRFDKGYISGYFVTDPERQEAVLEDPYILLVS
FT                   SKVSTVKDLLPLLEKVIGAGKPLLIIAEDVEGEALSTLVVNKIRGTFKSVAVKAPGFGD
FT                   RRKAMLQDMAILTGGQVISEEVGLTLENADLSLLGKARKVVVTKDETTIVEGAGDTDAI
FT                   AGRVAQIRQEIENSDSDYDREKLQERLAKLAGGVAVIKAGAATEVELKERKHRIEDAVR
FT                   NAKAAVEEGIVAGGGVTLLQAAPTLDELKLEGDEATGANIVKVALEAPLKQIAFNSGLE
FT                   PGVVAEKVRNLPAGHGLNAQTGVYEDLLAAGVADPVKVTRSALQNAASIAGLFLTTEAV
FT                   VADKPEKEKASVPGGGDMGGMDF"
FT   CDS_pept        complement(561111..561539)
FT                   /transl_table=11
FT                   /gene="BCG_0480c"
FT                   /locus_tag="BCG_0480c"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0480c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70465"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M3I8"
FT                   /protein_id="CAL70465.1"
FT                   /translation="MGAKKVDLKRLAAALPDYPFAYLITVDDGHRVHTVAVEPVLRELP
FT                   DGPDGPRAVVDVGLIGGRTRQNLAHRSEVTLLWPPSDPSGYSLIVDGRAQASDAGPDDD
FT                   TARCGVVPIRALLHRDAAPDSPTAAKGCLHDCVVFSVP"
FT   CDS_pept        complement(561566..563005)
FT                   /transl_table=11
FT                   /gene="PPE10"
FT                   /locus_tag="BCG_0481c"
FT                   /product="PPE family protein"
FT                   /note="In Mycobacterium bovis BCG Pasteur, and
FT                   Mycobacterium bovis, a single base transition (g-a) creates
FT                   an in-frame stop at codon 8, leads to a shorter product
FT                   compared to its homolog in Mycobacterium tuberculosis
FT                   strain H37Rv (479 aa versus 487 aa). Differs from Mb0450c
FT                   by 1aa, T214K, and from Rv0442c by 2aa, E23K, T214K"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0481c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70466"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR002989"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAH3"
FT                   /protein_id="CAL70466.1"
FT                   /translation="MPPEINSALMFAGPGSGPLIAAATAWGELAEELLASIASLGSVTS
FT                   ELTSGAWLGPSAAAMMAVATQYLAWLSTAAAQAEQAAAQAMAIATAFEAALAATVQPAV
FT                   VAANRGLMQLLAATNWFGQNAPALMDVEAAYEQMWALDVAAMAGYHFDASAAVAQLAPW
FT                   QQVLRNLGIDIGKNGQINLGFGNTGSGNIGNNNIGNNNIGSGNTGTGNIGTGNTGSGNL
FT                   GLGNLGDGNIGFGNTGSGNIGFGITGDHQMGFGGFNSGSGNIGFGNSGTGNVGLFNSGS
FT                   GNIGIGNSGSLNSGIGTSGTINAGLGSAGSLNTSFWNAGMQNAALGSAAGSEAALVSSA
FT                   GYATGGMSTAALSSGILASALGSTGGLQHGLANVLNSGLTNTPVAAPASAPVGGLDSGN
FT                   PNPGSGSAAAGSGANPGLRSPGTSYPSFVNSGSNDSGLRNTAVREPSTPGSGIPKSNFY
FT                   PSPDRESAYASPRIGQPVGSE"
FT   CDS_pept        563211..563726
FT                   /transl_table=11
FT                   /gene="BCG_0482"
FT                   /locus_tag="BCG_0482"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0482"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70467"
FT                   /db_xref="InterPro:IPR007061"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M286"
FT                   /protein_id="CAL70467.1"
FT                   /translation="MASTDAAAQELLRDAFTRLIEHVDELTDGLTDQLACYRPTPSANS
FT                   IAWLLWHSARVQDIQVAHVAGVEEVWTRDGWVDRFGLDLPRHDTGYGHRPEDVAKVRAP
FT                   ADLLSGYYHAVHKLTLEYIAGMTADELSRVVDTSWNPPVTVSARLVSIVDDCAQHLGQA
FT                   AYLRGIAR"
FT   CDS_pept        complement(563906..564604)
FT                   /transl_table=11
FT                   /gene="BCG_0483c"
FT                   /locus_tag="BCG_0483c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Differs from Rv0444c by 2aa, D107G, E184G"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0483c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70468"
FT                   /db_xref="GOA:A1KFR6"
FT                   /db_xref="InterPro:IPR018764"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KFR6"
FT                   /protein_id="CAL70468.1"
FT                   /translation="MTEHTDFELLELATPYALNAVSDDERADIDRRVAAAPSPVAAAFN
FT                   DEVRAVRETMAVVSAATTAEPPAHLRTAILDATKPEVRRQSRWRTAAFASAAAIAVGLG
FT                   AFDLGVLTRPSPPPTVAEQVLTAPDVRTVSRPLGAGTATVVFSRDRNTGLLVMNNVAPP
FT                   SRGTVYQMWLLGGAKGPRSAETMGTAAVTPSTTATLTDLGASTALAFTVEPGTGSPQPT
FT                   GTILAELPLG"
FT   CDS_pept        complement(564648..565211)
FT                   /transl_table=11
FT                   /transl_except=(pos:565209..565211,aa:Met)
FT                   /gene="sigK"
FT                   /locus_tag="BCG_0484c"
FT                   /product="Probable alternative rna polymerase sigma factor
FT                   sigK"
FT                   /note="Differs from Rv0445c and Mb0453c by 1aa, I1M, due to
FT                   c-t transition at position equivalent to Mycobacterium
FT                   tuberculosis strain H37Rv, 534394. Expression may be
FT                   affected"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0484c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70469"
FT                   /db_xref="GOA:A1KFR7"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KFR7"
FT                   /protein_id="CAL70469.1"
FT                   /translation="MTGPPRLSSDLDALLRRVAGHDQAAFAEFYDHTKSRVYGLVMRVL
FT                   RDTGYSEETTQEIYLEVWRNASEFDSAKGSALAWLLTMAHRRAVDRVRCEQAGNQREVR
FT                   YGAANVDPASDVVADLAIAGDERRRVTECLKALTDTQRQCIELAYYGGLTYVEVSRRLA
FT                   ANLSTIKSRMRDALRSLRNCLDVS"
FT   CDS_pept        complement(565260..566030)
FT                   /transl_table=11
FT                   /gene="BCG_0485c"
FT                   /locus_tag="BCG_0485c"
FT                   /product="Possible conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0485c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70470"
FT                   /db_xref="GOA:A0A0H3M1K1"
FT                   /db_xref="InterPro:IPR001104"
FT                   /db_xref="InterPro:IPR010721"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1K1"
FT                   /protein_id="CAL70470.1"
FT                   /translation="MVTSVSALAVAVVHSVAFAIGRRIGRYNVVDVVWGLGFVAVAVAA
FT                   ATLGHGDPVRRWLLLALVSTWGLRLSWHMYRKTAGQGEDPRYADLLRGATPVQALRKVF
FT                   GLQGLLTLFVSFPLQLSAVTGPTPKPLLAVGGVGLAVWLVGITFEAVGDWQLWVFKSDP
FT                   ANRGVIMDRGLWAWTRHPNYFGDACVWWGLWLITINDWAPLATVGSPLLMTYLLVDVSG
FT                   ARLTERYLKGRPGFAEYQRRTAYFVPRPPRSARR"
FT   CDS_pept        complement(566039..567322)
FT                   /transl_table=11
FT                   /gene="ufaA1"
FT                   /locus_tag="BCG_0486c"
FT                   /product="Putative cyclopropane-fatty-acyl-phospholipid
FT                   synthase ufaA1"
FT                   /EC_number="2.1.1.79"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0486c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70471"
FT                   /db_xref="GOA:A0A0H3M829"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M829"
FT                   /protein_id="CAL70471.1"
FT                   /translation="MTVETSQTPSAAIDSDRWPAVAKVPRGPLAAASAAIANRLLRRTA
FT                   THLPLRLVYSDGTATGAADPRAPSLFIHRPDALARRIGRHGLIGFGESYMAGEWSSKEL
FT                   TRVLTVLAGSVDELVPRSLHWLRPITPTFRPSWPDHSRDQARRNIAVHYDLSNDLFAAF
FT                   LDETMTYSCAMFTDLLAQPTPAWTELAAAQRRKIDRLLDVAGVQQGSHVLEIGTGWGEL
FT                   CIRAAARGAHIRSVTLSVEQQRLARQRVAAAGFGHRVEIDLCDYRDVDGQYDSVVSVEM
FT                   IEAVGYRSWPRYFAALEQLVRPGGPVAIQAITMPHHRMLATRHTQTWIQKYIFPGGLLP
FT                   STQAIIDITGQHTGLRIVDAASLRPHYAETLRLWRERFMQRRDGLAHLGFDEVFARMWE
FT                   LYLAYSEAGFRSGYLDVYQWTLIREGPP"
FT   CDS_pept        complement(567319..567984)
FT                   /transl_table=11
FT                   /gene="BCG_0487c"
FT                   /locus_tag="BCG_0487c"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0487c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70472"
FT                   /db_xref="InterPro:IPR010775"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M3J4"
FT                   /protein_id="CAL70472.1"
FT                   /translation="MHHSFAYRSYSWYVDVDNLPQLPWWLRPFARFHADDHFADPFSCP
FT                   PHSSLRDRLDAFFAARGLAVPDGRITALLQARVLGYVFNPLSIFWCHDRDGQLRHVIAE
FT                   VHNTYGGRHAYLLPPADLPVVTAKNFYVSPFHQLAGYYLIRAPRPDRELDVTVTLHRDR
FT                   RQVCPEFTATLRGQRRPATTRQIAMMQIISPLAPMVVAARIRIQGIRLWLRRVPVVPR"
FT   CDS_pept        complement(568044..569363)
FT                   /transl_table=11
FT                   /gene="BCG_0488c"
FT                   /locus_tag="BCG_0488c"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0488c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70473"
FT                   /db_xref="GOA:A0A0H3MAH5"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAH5"
FT                   /protein_id="CAL70473.1"
FT                   /translation="MQQSLRRSVAVVGSGVAGLTAAYILSGRDRVTLYEADGRLGGHAH
FT                   THYLDNGGGPRGTDVVGVDSAFLVHNDRTYPTLCRLFAELGVATQESEMSMSVRADDIG
FT                   LEYAGALGARGLFACRQSLRPRYLCMLAEILRFHRAAARLLREETDNAEDKPETLEAFL
FT                   SRHHFSQYFVDYFITPLVAAVWSCGGADALRYPARYLFVFLDHHGMLSVFGSPTWRTVT
FT                   GGSANYVQAIAAQLDEVSTRTPVHSLRRLPDGVLVGAGDGPSRRFDAAVVAVHPDQALL
FT                   LLDEPTPAERAVLGAIAYSTNSAQLHTDESVLPRHHRARASWNYLVTPGQHQVVVSYDI
FT                   SRLMRLDGGRRYLVTLGGHDRVDPSSVIAEMTYSHPLYTPESVAAQRLLPTLGDNRVVF
FT                   AGAYHGWGFHEDGAASGLRAARRLGADWPAAIPQEAMVAC"
FT   CDS_pept        complement(569403..572306)
FT                   /transl_table=11
FT                   /gene="mmpL4"
FT                   /locus_tag="BCG_0489c"
FT                   /product="Probable conserved transmembrane transport
FT                   protein mmpL4"
FT                   /note="Differs from Mb0458c by 1aa, A314T"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0489c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70474"
FT                   /db_xref="GOA:A0A0H3M291"
FT                   /db_xref="InterPro:IPR004707"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M291"
FT                   /protein_id="CAL70474.1"
FT                   /translation="MSTKFANDSNTNARPEKPFIARMIHAFAVPIILGWLAVCVVVTVF
FT                   VPSLEAVGQERSVSLSPKDAPSFEAMGRIGMVFKEGDSDSFAMVIIEGNQPLGDAAHKY
FT                   YDGLVAQLRADKKHVQSVQDLWGDPLTAAGVQSNDGKAAYVQLSLAGNQGTPLANESVE
FT                   AVRSIVESTPAPPGIKAYVTGPSALAADMHHSGDRSMARITMVTVAVIFIMLLLVYRSI
FT                   ITVVLLLITVGVELTAARGVVAVLGHSGAIGLTTFAVSLLTSLAIAAGTDYGIFIIGRY
FT                   QEARQAGEDKEAAYYTMYRGTAHVILGSGLTIAGATFCLSFARMPYFQTLGIPCAVGML
FT                   VAVAVALTLGPAVLHVGSRFGLFDPKRLLKVRGWRRVGTVVVRWPLPVLVATCAIALVG
FT                   LLALPGYKTSYNDRDYLPDFIPANQGYAAADRHFSQARMKPEILMIESDHDMRNPADFL
FT                   VLDKLAKGIFRVPGISRVQAITRPEGTTMDHTSIPFQISMQNAGQLQTIKYQRDRANDM
FT                   LKQADEMATTIAVLTRMHSLMAEMASTTHRMVGDTEEMKEITEELRDHVADFDDFWRPI
FT                   RSYFYWEKHCYGIPICWSFRSIFDALDGIDKLSEQIGVLLGDLREMDRLMPQMVAQIPP
FT                   QIEAMENMRTMILTMHSTMTGIFDQMLEMSDNATAMGKAFDAAKNDDSFYLPPEVFKNK
FT                   DFQRAMKSFLSSDGHAARFIILHRGDPQSPEGIKSIDAIRTAAEESLKGTPLEDAKIYL
FT                   AGTAAVFHDISEGAQWDLLIAAISSLCLIFIIMLIITRAFIAAAVIVGTVALSLGASFG
FT                   LSVLLWQHILAIHLHWLVLAMSVIVLLAVGSDYNLLLVSRFKQEIGAGLKTGIIRSMGG
FT                   TGKVVTNAGLVFAVTMASMAVSDLRVIGQVGTTIGLGLLFDTLIVRSFMTPSIAALLGR
FT                   WFWWPLRVRSRPARTPTVPSETQPAGRPLAMSSDRLG"
FT   CDS_pept        complement(572303..572725)
FT                   /transl_table=11
FT                   /gene="mmpS4"
FT                   /locus_tag="BCG_0490c"
FT                   /product="Probable conserved membrane protein mmpS4"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0490c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70475"
FT                   /db_xref="GOA:A0A0H3M1K6"
FT                   /db_xref="InterPro:IPR008693"
FT                   /db_xref="InterPro:IPR038468"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1K6"
FT                   /protein_id="CAL70475.1"
FT                   /translation="MLMRTWIPLVILVVVIVGGFTVHRIRGFFGSENRPSYSDTNLENS
FT                   KPFNPKHLTYEIFGPPGTVADISYFDVNSEPQRVDGAVLPWSLHITTNDAAVMGNIVAQ
FT                   GNSDSIGCRITVDGKVRAERVSNEVNAYTYCLVKSA"
FT   CDS_pept        572957..573667
FT                   /transl_table=11
FT                   /gene="BCG_0491"
FT                   /locus_tag="BCG_0491"
FT                   /product="Possible transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0491"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70476"
FT                   /db_xref="GOA:A0A0H3M835"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041483"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M835"
FT                   /protein_id="CAL70476.1"
FT                   /translation="MRYPLAVAQLGFQRARTEENKRQRAAALVEAARSLALETGVASVT
FT                   LTAVAGRAGIHYSAVRRYFTSHKEVLLHLAAEGWARWSGTVCEQLGEPGPMSAPRVAEA
FT                   LANGLAADPLFCDLLANLHLHLEQEVDVDRVIEVKRTSIAAVIALVDAIESALPALGRS
FT                   GAFDILLAAYSLAATLWQIANPPERLTDAYAEEPELLPPEWNLDFAAALTRLLTATLLG
FT                   LLAGSPCECRSPTR"
FT   CDS_pept        573989..575545
FT                   /transl_table=11
FT                   /gene="PPE11"
FT                   /locus_tag="BCG_0492"
FT                   /product="PPE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0492"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70477"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M3K1"
FT                   /protein_id="CAL70477.1"
FT                   /translation="MTSALIWMASPPEVHSALLSSGPGPGPVLAAATGWSSLGREYAAV
FT                   AEELGALLAAVQAGVWQGPSAESFAAACLPYLSWLTQASADCAAAAARLEAVTAAYAAA
FT                   LVAMPTLAELAANHATHGAMVATNFFGINTIPIAVNEADYVRMWLQAATTMATYQAVAD
FT                   SAVRSIPDSVPPPRILKSNAQSQHSSSNNSGGADPVDDFIAEILKIITGGRVIWDPEAG
FT                   TVNGLPYDAYTNPGTLMWWIARSLELLQDFQEFAKLLFTNPVKAFQFLVDLILFDWPTH
FT                   MLQLATWLAENPQLLVAALTPAISGLGAVSGLAGLTGLVPQPPVVPAPAPDAVVPTVLP
FT                   LAGTATPTTAPASAPAAGAAPGPPAGTATATSASVPTSAGGFPPYLVGSGPGIDFDAGT
FT                   PAGSRRAQPAADNVTAVAAAQVSARHQARRRRRAAAKERGNADEFVDMDSGPAIPPSGE
FT                   RDAWASNSGVGGLGFAGTASNETVAAPAGLTTLADDEFQCGPRMPMLPGAWDLGTWDRG
FT                   D"
FT   CDS_pept        575650..576000
FT                   /transl_table=11
FT                   /gene="BCG_0493"
FT                   /locus_tag="BCG_0493"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0493"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70478"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAH8"
FT                   /protein_id="CAL70478.1"
FT                   /translation="MKQDFGLDVPQAGNAQNFDGVPEWVQVGVVTFVYRMQMHHVTRPV
FT                   GAPGSGLAGDSTPVQGRQRVWDLVAGRLTHAPRSSVQAMRPTMFTSAPQRHGIPARGRW
FT                   WLGYQERSRAWP"
FT   CDS_pept        complement(576190..576636)
FT                   /transl_table=11
FT                   /gene="BCG_0494c"
FT                   /locus_tag="BCG_0494c"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0494c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70479"
FT                   /db_xref="InterPro:IPR031702"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M296"
FT                   /protein_id="CAL70479.1"
FT                   /translation="MSRLSSILRAGAAFLVLGIAAATFPQSAAADSTEDFPIPRRMIAT
FT                   TCDAEQYLAAVRDTSPVYYQRYMIDFNNHANLQQATINKAHWFFSLSPAERRDYSEHFY
FT                   NGDPLTFAWVNHMKIFFNNKGVVAKGTEVCNGYPAGDMSVWNWA"
FT   CDS_pept        complement(576704..577618)
FT                   /transl_table=11
FT                   /gene="echA2"
FT                   /locus_tag="BCG_0495c"
FT                   /product="Enoyl-CoA hydratase echA2"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0495c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70480"
FT                   /db_xref="GOA:A0A0H3M1L1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1L1"
FT                   /protein_id="CAL70480.1"
FT                   /translation="MPTPDFQTLLYTTAGPVATITLNRPEQLNTIVPPMPDEIEAAIGL
FT                   AERDQDIKVIVLRGAGRAFSGGYDFGGGFQHWGDAMMTDGRWDPGKDFAMVTARETGPT
FT                   QKFMAIWRASKPVIAQVHGWCVGGASDYALCADIVIASEDAVIGTPYSRMWGAYLTGMW
FT                   LYRLSLAKVKWHSLTGRPLTGVQAAEAELINEAVPFERLEARVAEIATELARIPLSQLQ
FT                   AQKLIVNQAYENMGLASTQLLGGILDGLMRNTPDALEFIRTAQTQGVRAAVERRDGPFG
FT                   DYSQAPPELRPDPTHVITPDGSM"
FT   CDS_pept        complement(577891..578172)
FT                   /transl_table=11
FT                   /gene="BCG_0496c"
FT                   /locus_tag="BCG_0496c"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0496c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70481"
FT                   /db_xref="GOA:A0A0H3M840"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M840"
FT                   /protein_id="CAL70481.1"
FT                   /translation="MLRGEIWQVDLDPARGSAANMRRPAVIVSNDRANAAAIRLDRGVV
FT                   PVVPVTSNTEKVPIPGVVAGSERWPGRRFEGAGPAGWIRRCATSPLPS"
FT   CDS_pept        complement(578401..580431)
FT                   /transl_table=11
FT                   /gene="BCG_0497c"
FT                   /locus_tag="BCG_0497c"
FT                   /product="Probable peptidase"
FT                   /EC_number="3.4.-.-"
FT                   /note="In Mycobacterium bovis and in Mycobacterium bovis
FT                   BCG, a possible RBS upstream leads to an earlier start
FT                   resulting in a slightly longer product compared to its
FT                   homolog in Mycobacterium tuberculosis strain H37Rv (676 aa
FT                   versus 673 aa)"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0497c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70482"
FT                   /db_xref="GOA:A0A0H3M3K7"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M3K7"
FT                   /protein_id="CAL70482.1"
FT                   /translation="MASMTFEPAPDGADPYLWLEDVTGAEALDWVRARNKPTTAAFCDA
FT                   EFERMRVEALEVLDTDARIPYVNRRGNYLYNFWRDAANPRGLWRRTTLDSYRTDSPGWD
FT                   VLIDVDELGRADDQKWVWGGAGVIEPDYTRALIGLSPGGSDASIVREFDMLTREFVEDG
FT                   FQLPPAKSQITWEDPDTVLLGTDFGGDSLTTSGYPRVIKRWRRGKPLADAETIFEGAGT
FT                   DVRVNASADRTPGFERTLLGRALDFWNEEVYELRGSELIRIEAPTDASVSIHRDWLLIE
FT                   LRTDWTVATTRYTAGSLLAAEYDEFLAGSAELQVVFEPDEHTALYQYAWTRDRLLIVTL
FT                   ADVASRVEIATPGSWRREPLSGIPAATNTVIVSADSHGDEFFLDSSGFDTPSRLMRGTD
FT                   DGRLAEIKSAPAFFDAENMAVTQYFATSDDGTSIPYFVVRRTDADNPGPTLLNGYGGFE
FT                   TSRTPTYDGVLGRLWLARGGTYALANIRGGGEYGPGWHTQAMREGRDKVAQDFAAVATD
FT                   LVTRGITTAEQLGARGGSNGGLLMGIMLTGYPEKFGALVCDVPLLDMKRYHLLLAGASW
FT                   MAEYGDPDNPDDWKFISEYSPYQNISANRKYPPVLMTTSTRDDRVHPGHARKMTAALQA
FT                   AGHPVWYYENIEGGHAGAADNAQIAFKSALSFAFLWRMLAG"
FT   CDS_pept        580490..582013
FT                   /transl_table=11
FT                   /gene="BCG_0498"
FT                   /locus_tag="BCG_0498"
FT                   /product="Probable aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0498"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70483"
FT                   /db_xref="GOA:A0A0H3MAI2"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAI2"
FT                   /protein_id="CAL70483.1"
FT                   /translation="MTVFSRPGSAGALMSYESRYQNFIGGQWVAPVHGRYFENPTPVTG
FT                   QPFCEVPRSDAADIDKALDAAHAAAPGWGKTAPAERAAILNMIADRIDKNAAALAVAEV
FT                   WDNGKPVREALAADIPLAVDHFRYFAAAIRAQEGALSQIDEDTVAYHFHEPLGVVGQII
FT                   PWNFPILMAAWKLAPALAAGNTAVLKPAEQTPASVLYLMSLIGDLLPPGVVNVVNGFGA
FT                   EAGKPLASSDRIAKVAFTGETTTGRLIMQYASHNLIPVTLELGGKSPNIFFADVLAAHD
FT                   DFCDKALEGFTMFALNQGEVCTCPSRSLIQADIYDEFLELAAIRTKAVRQGDPLDTETM
FT                   LGSQASNDQLEKVLSYIEIGKQEGAVIIAGGERAELGGDLSGGYYMQPTIFTGTNNMRI
FT                   FKEEIFGPVVAVTSFTDYDDAIGIANDTLYGLGAGVWSRDGNTAYRAGRDIQAGRVWVN
FT                   CYHLYPAHAAFGGYKQSGIGREGHQMMLQHYQHTKNLLVSYSDKALGFF"
FT   CDS_pept        582013..582504
FT                   /transl_table=11
FT                   /gene="BCG_0499"
FT                   /locus_tag="BCG_0499"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0499"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70484"
FT                   /db_xref="InterPro:IPR008497"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2A1"
FT                   /protein_id="CAL70484.1"
FT                   /translation="MNAPAGVLITAEAAALLAGLQDRHGPVMFHQSGGCCDGSAPMCYP
FT                   RADFLVGDRDILLGVLDVGEDGVPVWISGPQYQAWKHTQLIIDVVPGRGGGFSLEAPEG
FT                   VRFLSRGRVFSDAEKAMREAAPVITGAAYECGERPLVRGLVVDLDDPDATPGVCRASRR
FT                   "
FT   CDS_pept        582564..582803
FT                   /transl_table=11
FT                   /gene="BCG_0500"
FT                   /locus_tag="BCG_0500"
FT                   /product="Conserved hydrophobic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0500"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70485"
FT                   /db_xref="GOA:A0A0H3M1L7"
FT                   /db_xref="InterPro:IPR031614"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1L7"
FT                   /protein_id="CAL70485.1"
FT                   /translation="MLVGNAIGLLAGVACSVLVHARIRPDIVIAMVVGIPSAIGLLVIL
FT                   FSGRRWVTMLGAFILALAPGWFGVLVAIQVASSG"
FT   CDS_pept        582841..583365
FT                   /transl_table=11
FT                   /gene="BCG_0501"
FT                   /locus_tag="BCG_0501"
FT                   /product="Probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0501"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70486"
FT                   /db_xref="GOA:A0A0H3M845"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M845"
FT                   /protein_id="CAL70486.1"
FT                   /translation="MPDFDTGAHSQRFLSLAGQQDRAGKSWPGSTPKPQEDPVGVAPSA
FT                   SVEVLGSEPAATLAHSVTVPGRYTYLKWWKFVLVVLGVWIGAGEVGLSLFYWWYHTLDK
FT                   TAAVFVVLVYVVACTVGGLILALVPGRPLITALSLGVMSGPFASVAAAAPLYGYYYCER
FT                   MSHCLVGVIPY"
FT   CDS_pept        583429..584823
FT                   /transl_table=11
FT                   /gene="lpd"
FT                   /locus_tag="BCG_0502"
FT                   /standard_name="TB49.2"
FT                   /product="Dihydrolipoamide dehydrogenase lpd"
FT                   /EC_number="1.8.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0502"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70487"
FT                   /db_xref="GOA:A0A0H3M3L4"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M3L4"
FT                   /protein_id="CAL70487.1"
FT                   /translation="MTHYDVVVLGAGPGGYVAAIRAAQLGLSTAIVEPKYWGGVCLNVG
FT                   CIPSKALLRNAELVHIFTKDAKAFGISGEVTFDYGIAYDRSRKVAEGRVAGVHFLMKKN
FT                   KITEIHGYGTFADANTLLVDLNDGGTESVTFDNAIIATGSSTRLVPGTSLSANVVTYEE
FT                   QILSRELPKSIIIAGAGAIGMEFGYVLKNYGVDVTIVEFLPRALPNEDADVSKEIEKQF
FT                   KKLGVTILTATKVESIADGGSQVTVTVTKDGVAQELKAEKVLQAIGFAPNVEGYGLDKA
FT                   GVALTDRKAIGVDDYMRTNVGHIYAIGDVNGLLQLAHVAEAQGVVAAETIAGAETLTLG
FT                   DHRMLPRATFCQPNVASFGLTEQQARNEGYDVVVAKFPFTANAKAHGVGDPSGFVKLVA
FT                   DAKHGELLGGHLVGHDVAELLPELTLAQRWDLTASELARNVHTHPTMSEALQECFHGLV
FT                   GHMINF"
FT   CDS_pept        584831..585124
FT                   /transl_table=11
FT                   /gene="BCG_0503"
FT                   /locus_tag="BCG_0503"
FT                   /product="Probable conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0503"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70488"
FT                   /db_xref="GOA:A0A0H3MAI4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAI4"
FT                   /protein_id="CAL70488.1"
FT                   /translation="MTRRASTDTPQIIMGAIGGVVTGYILWLAAISVGDGLTTVSQWSR
FT                   VVLLLSVLVAVCGAAGGLRLRSRGKLAWSAFAFSLPIPPVVLTVAVLADIYL"
FT   CDS_pept        complement(585128..585700)
FT                   /transl_table=11
FT                   /gene="BCG_0504c"
FT                   /locus_tag="BCG_0504c"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0504c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70489"
FT                   /db_xref="GOA:A0A0H3M2A5"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2A5"
FT                   /protein_id="CAL70489.1"
FT                   /translation="MTGQNGQVARISPGKFRQLGPVNWLVAKLAARAVGAPQMHLFTTL
FT                   GYRQYLFWTFAIYTGRLLHGRLPGVDTELVILRVAHLRSCEYELQHHRRMARRRGLDAN
FT                   TQATIFAWPDVPDGDGPRKVLSARQQALLQATDELIKDRTITAGTWERLATHLDPRLLI
FT                   EFCLLATQYDAIAATITALAIPPDNPQ"
FT   CDS_pept        complement(585697..587121)
FT                   /transl_table=11
FT                   /gene="BCG_0505c"
FT                   /locus_tag="BCG_0505c"
FT                   /product="Probable transcriptional regulatory protein"
FT                   /note="Differs from Rv0465c by 2aa, D36N, R106C, and from
FT                   Mb0474c by 1aa, R326Q"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0505c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70490"
FT                   /db_xref="GOA:A0A0H3M1M2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR018653"
FT                   /db_xref="InterPro:IPR026281"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1M2"
FT                   /protein_id="CAL70490.1"
FT                   /translation="MSKTYVGSRVRQLRNERGFSQAALAQMLEISPSYLDQIEHDVRPL
FT                   TVAVLLRITEVFGVDATFFASQDDTRLVAELREVTLDRDLDIAIDPHEVAEMVSAHPGL
FT                   ARAVVNLHRRYRITTAQLAAATEERFSDGSGRGSITMPHEEVRDYFYQRQNYLHALDTA
FT                   AEDLTAQMRMHHGDLARELTRRLTEVHGVRINKRIDLGDTVLHRYDPATNTLEISSHLS
FT                   PGQQVFKMAAELAYLEFGDLIDAMVTDGKFTSAESRTLARLGLANYFAAATVLPYRQFH
FT                   DVAENFRYDVERLSAFYSVSYETIAHRLSTLQRPSMRGVPFTFVRVDRAGNMSKRQSAT
FT                   GFHFSSSGGTCPLWNVYETFANPGKILVQIAQMPDGRNYLWVARTVELRAARYGQPGKT
FT                   FAIGLGCELRHAHRLVYSEGLDLSGDPNTAATPIGAGCRVCERDNCPQRAFPALGRALD
FT                   LDEHRSTVSPYLVKQL"
FT   CDS_pept        587273..588067
FT                   /transl_table=11
FT                   /gene="BCG_0506"
FT                   /locus_tag="BCG_0506"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0506"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70491"
FT                   /db_xref="GOA:A0A0H3M851"
FT                   /db_xref="InterPro:IPR002864"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M851"
FT                   /protein_id="CAL70491.1"
FT                   /translation="MSLDKKLMPVPDGHPDVFDREWPLRVGDIDRAGRLRLDAACRHIQ
FT                   DIGQDQLREMGFEETHPLWIVRRTMVDLIRPIEFGDMLRCRRWCSGTSNRWCEMRVRVD
FT                   GRKGGLIESEAFWIHVNRETEMPARIADDFLAGLHRTTSVDRLRWKGYLKPGSRDDASE
FT                   IHEFPVRVTDIDLFDHMNNAVYWSVIEDYLASHAELLRGPLRVTIEHEAPVALGDKLEI
FT                   ISHVHPAGSTEIFGPGLVDRAVTTLTYVVGDEPKAVASLFNL"
FT   CDS_pept        588342..589628
FT                   /transl_table=11
FT                   /gene="icl"
FT                   /locus_tag="BCG_0507"
FT                   /product="Isocitrate lyase icl"
FT                   /EC_number="4.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0507"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70492"
FT                   /db_xref="GOA:A0A0H3M3L9"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M3L9"
FT                   /protein_id="CAL70492.1"
FT                   /translation="MSVVGTPKSAEQIQQEWDTNPRWKDVTRTYSAEDVVALQGSVVEE
FT                   HTLARRGAEVLWEQLHDLEWVNALGALTGNMAVQQVRAGLKAIYLSGWQVAGDANLSGH
FT                   TYPDQSLYPANSVPQVVRRINNALQRADQIAKIEGDTSVENWLAPIVADGEAGFGGALN
FT                   VYELQKALIAAGVAGSHWEDQLASEKKCGHLGGKVLIPTQQHIRTLTSARLAADVADVP
FT                   TVVIARTDAEAATLITSDVDERDQPFITGERTREGFYRTKNGIEPCIARAKAYAPFADL
FT                   IWMETGTPDLEAARQFSEAVKAEYPDQMLAYNCSPSFNWKKHLDDATIAKFQKELAAMG
FT                   FKFQFITLAGFHALNYSMFDLAYGYAQNQMSAYVELQEREFAAEERGYTATKHQREVGA
FT                   GYFDRIATTVDPNSSTTALTGSTEEGQFH"
FT   CDS_pept        589710..590570
FT                   /transl_table=11
FT                   /gene="fadB2"
FT                   /locus_tag="BCG_0508"
FT                   /product="Probable 3-hydroxybutyryl-CoA dehydrogenase
FT                   fadB2"
FT                   /EC_number="1.1.1.157"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0508"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70493"
FT                   /db_xref="GOA:A0A0H3MAI7"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAI7"
FT                   /protein_id="CAL70493.1"
FT                   /translation="MSDAIQRVGVVGAGQMGSGIAEVSARAGVEVTVFEPAEALITAGR
FT                   NRIVKSLERAVSAGKVTERERDRALGLLTFTTDLNDLSDRQLVIEAVVEDEAVKSEIFA
FT                   ELDRVVTDPDAVLASNTSSIPIMKVAAATKQPQRVLGLHFFNPVPVLPLVELVRTLVTD
FT                   EAAAARTEEFASTVLGKQVVRCSDRSGFVVNALLVPYLLSAIRMVEAGFATVEDVDKAV
FT                   VAGLSHPMGPLRLSDLVGLDTLKLIADKMFEEFKEPHYGPPPLLLRMVEAGQLGKKSGR
FT                   GFYTY"
FT   CDS_pept        590703..591563
FT                   /transl_table=11
FT                   /gene="umaA1"
FT                   /locus_tag="BCG_0509"
FT                   /product="Possible mycolic acid synthase umaA1"
FT                   /EC_number="2.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0509"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70494"
FT                   /db_xref="GOA:A0A0H3M2B0"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2B0"
FT                   /protein_id="CAL70494.1"
FT                   /translation="MTELRPFYEESQSIYDVSDEFFSLFLDPTMAYTCAYFEREDMTLE
FT                   EAQNAKFDLALDKLHLEPGMTLLDIGCGWGGGLQRAIENYDVNVIGITLSRNQFEYSKA
FT                   KLAKIPTERSVQVRLQGWDEFTDKVDRIVSIGAFEAFKMERYAAFFERSYDILPDDGRM
FT                   LLHTILTYTQKQMHEMGVKVTMSDVRFMKFIGEEIFPGGQLPAQEDIFKFAQAADFSVE
FT                   KVQLLQQHYARTLNIWAANLEANKDRAIALQSEEIYNKYMHYLTGCEHFFRKGISNVGQ
FT                   FTLTK"
FT   CDS_pept        complement(591663..592526)
FT                   /transl_table=11
FT                   /gene="pcaA"
FT                   /locus_tag="BCG_0510c"
FT                   /product="Mycolic acid synthase pcaA"
FT                   /EC_number="2.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0510c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70495"
FT                   /db_xref="GOA:A0A0H3M1M7"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1M7"
FT                   /protein_id="CAL70495.1"
FT                   /translation="MSVQLTPHFGNVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDMTL
FT                   QEAQIAKIDLALGKLNLEPGMTLLDIGCGWGATMRRAIEKYDVNVVGLTLSENQAGHVQ
FT                   KMFDQMDTPRSRRVLLEGWEKFDEPVDRIVSIGAFEHFGHQRYHHFFEVTHRTLPADGK
FT                   MLLHTIVRPTFKEGREKGLTLTHELVHFTKFILAEIFPGGWLPSIPTVHEYAEKVGFRV
FT                   TAVQSLQLHYARTLDMWATALEANKDQAIAIQSQTVYDRYMKYLTGCAKLFRQGYTDVD
FT                   QFTLEK"
FT   CDS_pept        complement(592669..593109)
FT                   /transl_table=11
FT                   /gene="BCG_0511c"
FT                   /locus_tag="BCG_0511c"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0511c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70496"
FT                   /db_xref="GOA:A0A0H3M856"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M856"
FT                   /protein_id="CAL70496.1"
FT                   /translation="MGAGGWEVVLASLPYGLLCTTVLMGKHIDKIGYDEPLGIRTLPVL
FT                   LGETCARTVTLAMMVGFYLLIAVNVMLAAMPWPRCWSPGRCPGWRKCGPISCDGGPSSR
FT                   HRRFRCGRCGMPRWPGCTCVRPVRCWLWAWRSVPGGAPGDFR"
FT   CDS_pept        complement(593040..593528)
FT                   /transl_table=11
FT                   /gene="BCG_0512c"
FT                   /locus_tag="BCG_0512c"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0512c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70497"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M3M6"
FT                   /protein_id="CAL70497.1"
FT                   /translation="MPDAGAGSRLRSWAYALRTTNPPADGPTDTVTRWLVVTRAAVLPM
FT                   TLVSGLVAGLLAIGEPGLDWRWLVLWWESHAPHIANNLMNDLYDTDVGTDSATYARARY
FT                   AQHPAATGANRAAYTTPRRTTSCGSPERALEPTTPRWARAVGRSCWRRSPTGCCAPRC"
FT   CDS_pept        complement(593538..594242)
FT                   /transl_table=11
FT                   /gene="BCG_0513c"
FT                   /locus_tag="BCG_0513c"
FT                   /product="Probable transcriptional regulatory protein
FT                   (possibly tetR-family)"
FT                   /note="Differs from Rv0472c and Mb0482c by 1aa, D162G"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0513c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70498"
FT                   /db_xref="GOA:A0A0H3MAJ8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAJ8"
FT                   /protein_id="CAL70498.1"
FT                   /translation="MAERIPAVTVKTDGRKRRWHQHKVERRNELVDGTIEAIRRHGRFL
FT                   SMDEIAAEIGVSKTVLYRYFVDKNDLTTAVMMRFTQTTLIPNMIAALSADMDGFELTRE
FT                   IIRVYVETVAAQPEPYRFVMANSSASKSKVIADSERIIARMLAVMLRRRMQEAGMDTDG
FT                   VEPWAYLIVGGVQLATHSWMSDPRMSSDELIDYLTMLSWSALCGIVEAGGSLEKFREQP
FT                   HPSPIVPAWGQV"
FT   CDS_pept        594379..595749
FT                   /transl_table=11
FT                   /gene="BCG_0514"
FT                   /locus_tag="BCG_0514"
FT                   /product="Possible conserved transmembrane protein"
FT                   /note="Differs from Rv0473 by 1aa, R5K"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0514"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70499"
FT                   /db_xref="GOA:A0A0H3M2D4"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2D4"
FT                   /protein_id="CAL70499.1"
FT                   /translation="MVAHRAEVSGSPPPRLNLSTQPTVARRVRASFAESFAAADPEADA
FT                   ARRMALRRMKVVAVGFLVGATGVFLACRWAQADGADHAWLGYLGAAAEAGMVGALADWF
FT                   AVTALFKHPLGIPIPHTAIIKRKKDQLGEGLGTFVRENFLSPPVVETKLRDAQIPSRLG
FT                   KWLSEATHAQRVAAETATVLRVLVELLRDEDIQQVIDRMIVRRIAEPQWGPPAGRVLAT
FT                   LLAENRQEAFIQLLADRAFQWSLNAGVVIQRVVERDSPSWSPRFIDHLVGDRIHRELME
FT                   FTDKVRRNPDHELRRSATRFLFDFADDLQHDPATVARADAIKEELMARDEIATAAAAAW
FT                   KTLKRLVLEGVDDPSSALRTRITDAVIRIGESLRDDADLRDKVDSWTVRAAQHLVSEYG
FT                   VEITAIITETIERWDAEEASRRIELHVGRDLQFIRINGTVVGAMAGLAIYAIAQLLF"
FT   CDS_pept        595836..596258
FT                   /transl_table=11
FT                   /gene="BCG_0515"
FT                   /locus_tag="BCG_0515"
FT                   /product="Probable transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0515"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70500"
FT                   /db_xref="GOA:A0A0H3M1R0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1R0"
FT                   /protein_id="CAL70500.1"
FT                   /translation="MSSEEKLAAKVSTKASDVASDIGSFIRSQRETAHVSMRQLAERSG
FT                   VSNPYLSQVERGLRKPSADVLSQIAKALRVSAEVLYVRAGILEPSETSQVRDAIITDTA
FT                   ITERQKQILLDIYASFTHQNEATREECPSDPTPTDD"
FT   CDS_pept        596612..597211
FT                   /transl_table=11
FT                   /gene="hbhA"
FT                   /locus_tag="BCG_0516"
FT                   /product="Heparin binding hemagglutinin hbhA (adhesin)"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0516"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70501"
FT                   /db_xref="GOA:A1KFU9"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KFU9"
FT                   /protein_id="CAL70501.1"
FT                   /translation="MAENSNIDDIKAPLLAALGAADLALATVNELITNLRERAEETRTD
FT                   TRSRVEESRARLTKLQEDLPEQLTELREKFTAEELRKAAEGYLEAATSRYNELVERGEA
FT                   ALERLRSQQSFEEVSARAEGYVDQAVELTQEALGTVASQTRAVGERAAKLVGIELPKKA
FT                   APAKKAAPAKKAAPAKKAAAKKAPAKKAAAKKVTQK"
FT   CDS_pept        597323..597586
FT                   /transl_table=11
FT                   /gene="BCG_0517"
FT                   /locus_tag="BCG_0517"
FT                   /product="Possible conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0517"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70502"
FT                   /db_xref="GOA:A0A0H3M881"
FT                   /db_xref="InterPro:IPR019662"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M881"
FT                   /protein_id="CAL70502.1"
FT                   /translation="MLVLLVAVLVTAVYAFVHAALQRPDAYTAADKLTKPVWLVILGAA
FT                   VALASILYPVLGVLGMAMSACASGVYLVDVRPKLLEIQGKSR"
FT   CDS_pept        597591..598037
FT                   /transl_table=11
FT                   /gene="BCG_0518"
FT                   /locus_tag="BCG_0518"
FT                   /product="Possible conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0518"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70503"
FT                   /db_xref="InterPro:IPR019719"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M3Q1"
FT                   /protein_id="CAL70503.1"
FT                   /translation="MKALVAVSAVAVVALLGVSSAQADPEADPGAGEANYGGPPSSPRL
FT                   VDHTEWAQWGSLPSLRVYPSQVGRTASRRLGMAAADAAWAEVLALSPEADTAGMRAQFI
FT                   CHWQYAEIRQPGKPSWNLEPWRPVVDDSEMLASGCNPGSPEESF"
FT   CDS_pept        598037..598711
FT                   /transl_table=11
FT                   /gene="deoC"
FT                   /locus_tag="BCG_0519"
FT                   /product="Probable deoxyribose-phosphate aldolase deoC"
FT                   /EC_number="4.1.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0519"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70504"
FT                   /db_xref="GOA:A1KFV2"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KFV2"
FT                   /protein_id="CAL70504.1"
FT                   /translation="MLGQPTRAQLAALVDHTLLKPETTRADVAALVAEAAELGVYAVCV
FT                   SPSMVPVAVQAGGVRVAAVTGFPSGKHVSSVKAHEAAAALASGASEIDMVIDIGAALCG
FT                   DIDAVRSDIEAVRAAAAGAVLKVIVESAVLLGQSNAHTLVDACRAAEDAGADFVKTSTG
FT                   CHPAGGATVRAVELMAETVGPRLGVKASGGIRTAADAVAMLNAGATRLGLSGTRAVLDG
FT                   LS"
FT   CDS_pept        complement(598736..599782)
FT                   /transl_table=11
FT                   /gene="BCG_0520c"
FT                   /locus_tag="BCG_0520c"
FT                   /product="Probable conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0520c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70505"
FT                   /db_xref="GOA:A0A0H3MAK0"
FT                   /db_xref="InterPro:IPR021373"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAK0"
FT                   /protein_id="CAL70505.1"
FT                   /translation="MTNPQGPPNDPSPWARPGDQGPLARPPASSEASTGRLRPGEPAGH
FT                   IQEPVSPPTQPEQQPQTEHLAASHAHTRRSGRQAAHQAWDPTGLLAAQEEEPAAVKTKR
FT                   RARRDPLTVFLVLIIVFSLVLAGLIGGELYARHVANSKVAQAVACVVKDQATASFGVAP
FT                   LLLWQVATRHFTNISVETAGNQIRDAKGMQIKLTIQNVRLKNTPNSRGTIGALDATITW
FT                   SSEGIKESVQNAIPILGAFVTSSVVTHPADGTVELKGLLNNITAKPIVAGKGLELQIIN
FT                   FNTLGFSLPKETVQSTLNEFTSSLTKNYPLGIHADSVQVTSTGVVSRFSTRDAAIPTGI
FT                   QNPCFSHI"
FT   CDS_pept        complement(599779..600714)
FT                   /transl_table=11
FT                   /gene="BCG_0521c"
FT                   /locus_tag="BCG_0521c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="In Mycobacterium bovis, a 56 bp deletion results in
FT                   a different NH2 part and leads to a shorter product
FT                   compared to its homolog in Mycobacterium tuberculosis
FT                   strain H37Rv (311 aa versus 340 aa)"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0521c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70506"
FT                   /db_xref="GOA:A0A0H3M2D7"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2D7"
FT                   /protein_id="CAL70506.1"
FT                   /translation="MRRARRRAQAGLPGSCARRCGALVAGPRLARMRIALAQIRSGTDP
FT                   AANLQLVGKYAGEAATAGAQLVVFPEATMCRLGVPLRQVAEPVDGPWANGVRRIATEAG
FT                   ITVIAGMFTPTGDGRVTNTLIAAGPGTPNQPDAHYHKIHLYDAFGFTESRTVAPGREPV
FT                   VVVVDGVRVGLTVCYDIRFPALYTELARRGAQLIAVCASWGSGPGKLEQWTLLARARAL
FT                   DSMSYVAAAGQADPGDARTGVGASSAAPTGVGGSLVASPLGEVVVSAGTQPQLLVADID
FT                   VDNVAAARDRIAVLRNQTDFVQIDKAQSRG"
FT   CDS_pept        complement(600747..601271)
FT                   /transl_table=11
FT                   /gene="BCG_0522c"
FT                   /locus_tag="BCG_0522c"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0522c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70507"
FT                   /db_xref="InterPro:IPR019639"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1R4"
FT                   /protein_id="CAL70507.1"
FT                   /translation="MPRSFDMSADYEGSVEEVHRAFYEADYWKARLAETPVDVATLESI
FT                   RVGGDSGDDGTIEVVTLQMVRSHNLPGLVTQLHRGDLSVRREETWGPVKEGIATASIAG
FT                   SIVDAPVNLWGTAVLSPIPESGGSRMTLQVTIQVRIPFIGGKLERLIGTQLSQLVTIEQ
FT                   RFTTLWITNNV"
FT   CDS_pept        601298..602407
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="BCG_0523"
FT                   /product="Probable UDP-N-acetylenolpyruvoylglucosamine
FT                   reductase murB"
FT                   /EC_number="1.1.1.158"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0523"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70508"
FT                   /db_xref="GOA:A1KFV6"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KFV6"
FT                   /protein_id="CAL70508.1"
FT                   /translation="MKRSGVGSLFAGAHIAEAVPLAPLTTLRVGPIARRVITCTSAEQV
FT                   VAALRHLDSAAKTGADRPLVFAGGSNLVIAENLTDLTVVRLANSGITIDGNLVRAEAGA
FT                   VFDDVVVRAIEQGLGGLECLSGIPGSAGATPVQNVGAYGAEVSDTITRVRLLDRCTGEV
FT                   RWVSARDLRFGYRTSVLKHADGLAVPTVVLEVEFALDPSGRSAPLRYGELIAALNATSG
FT                   ERADPQAVREAVLALRARKGMVLDPTDHDTWSVGSFFTNPVVTQDVYERLAGDAATRKD
FT                   GPVPHYPAPDGVKLAAGWLVERAGFGKGYPDAGAAPCRLSTKHALALTNRGGATAEDVV
FT                   TLARAVRDGVHDVFGITLKPEPVLIGCML"
FT   CDS_pept        602469..603824
FT                   /transl_table=11
FT                   /gene="lprQ"
FT                   /locus_tag="BCG_0524"
FT                   /product="Probable conserved lipoprotein lprQ"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0524"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70509"
FT                   /db_xref="GOA:A0A0H3M887"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="InterPro:IPR041280"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M887"
FT                   /protein_id="CAL70509.1"
FT                   /translation="MVIRVLFRPVSLIPVNNSSTPQSQGPISRRLALTALGFGVLAPNV
FT                   LVACAGKVTKLAEKRPPPAPRLTFRPADSAADVVPIAPISVEVGDGWFQRVALTNSAGK
FT                   VVAGAYSRDRTIYTITEPLGYDTTYTWSGSAVGHDGKAVPVAGKFTTVAPVKTINAGFQ
FT                   LADGQTVGIAAPVIIQFDSPISDKAAVERALTVTTDPPVEGGWAWLPDEAQGARVHWRP
FT                   REYYPAGTTVDVDAKLYGLPFGDGAYGAQDMSLHFQIGRRQVVKAEVSSHRIQVVTDAG
FT                   VIMDFPCSYGEADLARNVTRNGIHVVTEKYSDFYMSNPAAGYSHIHERWAVRISNNGEF
FT                   IHANPMSAGAQGNSNVTNGCINLSTENAEQYYRSAVYGDPVEVTGSSIQLSYADGDIWD
FT                   WAVDWDTWVSMSALPPPAAKPAATQIPVTAPVTPSDAPTPSGTPTTTNGPGG"
FT   CDS_pept        complement(603805..604560)
FT                   /transl_table=11
FT                   /gene="BCG_0525c"
FT                   /locus_tag="BCG_0525c"
FT                   /product="Putative short-chain type oxidoreductase"
FT                   /EC_number="1.-.-.-"
FT                   /note="Differs from Rv0484c by 1aa, L140I"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0525c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70510"
FT                   /db_xref="GOA:A0A0H3M3Q6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M3Q6"
FT                   /protein_id="CAL70510.1"
FT                   /translation="MTTIGTRKRVAVVTGASSGIGEATARTLAAQGFHVVAVARRADRI
FT                   TALANQIGGTAIVADVTDDAAVEALARALSRVDVLVNNAGGAKGLQFVADADLEHWRWM
FT                   WDTNVLGTLRVTRALLPKLIDSGDGLIVTVTSIAALEVYDGGAGYTAAKHAQGALHRTL
FT                   RGELLGKPVRLTEIAPGAVETEFSLVRFDGDQQRADAVYAGMTPLVAADVAEVIGFVAT
FT                   RPSHVNLDQIVIRPRDQASASRRATHPVR"
FT   CDS_pept        604743..606059
FT                   /transl_table=11
FT                   /gene="BCG_0526"
FT                   /locus_tag="BCG_0526"
FT                   /product="Possible transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0526"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70511"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAK2"
FT                   /protein_id="CAL70511.1"
FT                   /translation="MYSTNRTSQSLSRKPGRKHQLRSHRYVMPPSLHLSDSAAASVFRA
FT                   VRLRGPVGRDVIAGSTSLSIATVNRQVIALLEAGLLRERADLAVSGAIGRPRVPVEVNH
FT                   EPFVTLGIHIGARTTSIVATDLFGRTLDTVETPTPRNAAGAALTSLADSADRYLQRWRR
FT                   RRALWVGVTLGGAVDSATGHVDHPRLGWRQAPVGPVLADALGLPVSVASHVDAMAGAEL
FT                   MLGMRRFAPSSSTSLYVYARETVGYALMIGGRVHCPASGPGTIAPLPVHSEMLGGTGQL
FT                   ESTVSDEAVLAAARRLRIIPGIASRTRTGGSATAITDLLRVARAGNQQAKELLAERARV
FT                   LGGAVALLRDLLNPDEVVVGGQAFTEYPEAMEQVEAAFTAGSVLAPRDIRVTVFGNRVQ
FT                   EAGAGIVSLSGLYADPLGALRRSGALDARLQDTAPEALA"
FT   CDS_pept        606107..607549
FT                   /transl_table=11
FT                   /gene="BCG_0527"
FT                   /locus_tag="BCG_0527"
FT                   /product="Mannosyltransferase"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0527"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70512"
FT                   /db_xref="GOA:A1KFW0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR017814"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KFW0"
FT                   /protein_id="CAL70512.1"
FT                   /translation="MAGVRHDDGSGLIAQRRPVRGEGATRSRGPSGPSNRNVSAADDPR
FT                   RVALLAVHTSPLAQPGTGDAGGMNVYMLQSALHLARRGIEVEIFTRATASADPPVVRVA
FT                   PGVLVRNVVAGPFEGLDKYDLPTQLCAFAAGVLRAEAVHEPGYYDIVHSHYWLSGQVGW
FT                   LARDRWAVPLVHTAHTLAAVKNAALADGDGPEPPLRTVGEQQVVDEADRLIVNTDDEAR
FT                   QVISLHGADPARIDVVHPGVDLDVFRPGDRRAARAALGLPVDERVVAFVGRIQPLKAPD
FT                   IVLRAAAKLPGVRIIVAGGPSGSGLASPDGLVRLADELGISARVTFLPPQSHTDLATLF
FT                   RAADLVAVPSYSESFGLVAVEAQACGTPVVAAAVGGLPVAVRDGITGTLVSGHEVGQWA
FT                   DAIDHLLRLCAGPRGRVMSRAAARHAATFSWENTTDALLASYRRAIGEYNAERQRRGGE
FT                   VISDLVAVGKPRHWTPRRGVGA"
FT   CDS_pept        607546..608097
FT                   /transl_table=11
FT                   /gene="BCG_0528"
FT                   /locus_tag="BCG_0528"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0528"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70513"
FT                   /db_xref="InterPro:IPR019660"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2E1"
FT                   /protein_id="CAL70513.1"
FT                   /translation="MTSSLPTVQRVIQNALEVSQLKYSQHPRPGGAPPALIVELPGERK
FT                   LKINTILSVGEHSVRVEAFVCRKPDENREDVYRFLLRRNRRLYGVAYTLDNVGDIYLVG
FT                   QMALSAVDADEVDRVLGQVLEVVDSDFNALLELGFRSSIQREWQWRLSRGESLQNLQAF
FT                   AHLRPTTMQSAQRDEKELGG"
FT   CDS_pept        608539..609144
FT                   /transl_table=11
FT                   /gene="BCG_0529"
FT                   /locus_tag="BCG_0529"
FT                   /product="Probable conserved integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0529"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70514"
FT                   /db_xref="GOA:A0A0H3M1R8"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="InterPro:IPR004777"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1R8"
FT                   /protein_id="CAL70514.1"
FT                   /translation="MMTLKVAIGPQNAFVLRQGIRREYVLVIVALCGIADGALIAAGVG
FT                   GFAALIHAHPNMTLVARFGGAAFLIGYALLAARNAWRPSGLVPSESGPAALIGVVQMCL
FT                   VVTFLNPHVYLDTVVLIGALANEESDLRWFFGAGAWAASVVWFAVLGFSAGRLQPFFAT
FT                   PAAWRILDALVAVTMIGVAVVVLVTSPSVPTANVALII"
FT   CDS_pept        609301..610050
FT                   /transl_table=11
FT                   /gene="gpm1"
FT                   /locus_tag="BCG_0530"
FT                   /product="Probable phosphoglycerate mutase 1 gpm1"
FT                   /EC_number="5.4.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0530"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70515"
FT                   /db_xref="GOA:A1KFW3"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KFW3"
FT                   /protein_id="CAL70515.1"
FT                   /translation="MANTGSLVLLRHGESDWNALNLFTGWVDVGLTDKGQAEAVRSGEL
FT                   IAEHDLLPDVLYTSLLRRAITTAHLALDSADRLWIPVRRSWRLNERHYGALQGLDKAET
FT                   KARYGEEQFMAWRRSYDTPPPPIERGSQFSQDADPRYADIGGGPLTECLADVVARFLPY
FT                   FTDVIVGDLRVGKTVLIVAHGNSLRALVKHLDQMSDDEIVGLNIPTGIPLRYDLDSAMR
FT                   PLVRGGTYLDPEAAAAGAAAVAGQGRG"
FT   CDS_pept        610224..611456
FT                   /transl_table=11
FT                   /gene="senX3"
FT                   /locus_tag="BCG_0531"
FT                   /product="Putative two component sensor histidine kinase
FT                   senX3"
FT                   /EC_number="2.7.3.-"
FT                   /note="Differs from Rv0490 and Mb0500 by 1aa, S109F"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0531"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70516"
FT                   /db_xref="GOA:A0A0H3M893"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M893"
FT                   /protein_id="CAL70516.1"
FT                   /translation="MTVFSALLLAGVLSALALAVGGAVGMRLTSRVVEQRQRVATEWSG
FT                   ITVSQMLQCIVTLMPLGAAVVDTHRDVVYLNERAKELGLVRDRQLDDQAWRAARQALGG
FT                   EDVESDLSPRKRSATGRSGLSVHGHARLLSEEDRRFAVVFVHDQSDYARMEAARRDFVA
FT                   NVSHELKTPVGAMALLAEALLASADDSETVRRFAEKVLIEANRLGDMVAELIELSRLQG
FT                   AERLPNMTDVDVDTIVSEAISRHKVAADNADIEVRTDAPSNLRVLGDQTLLVTALANLV
FT                   SNAIAYSPRGSLVSISRRRRGANIEIAVTDRGIGIAPEDQERVFERFFRGDKARSRATG
FT                   GSGLGLAIVKHVAANHDGTIRVWSKPGTGSTFTLALPALIEAYHDDERPEQAREPELRS
FT                   NRSQREEELSR"
FT   CDS_pept        611607..612290
FT                   /transl_table=11
FT                   /gene="regX3"
FT                   /locus_tag="BCG_0532"
FT                   /product="Two component sensory transduction protein regX3
FT                   (probably luxR-family)"
FT                   /note="Differs from Rv0491 and Mb0501 by 1aa, T18A"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0532"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70517"
FT                   /db_xref="GOA:A0A0H3M3R1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M3R1"
FT                   /protein_id="CAL70517.1"
FT                   /translation="MTSVLIVEDEESLADPLTFLLRKEGFEATVVTDGPAALAEFDRAG
FT                   ADIVLLDLMLPGMSGTDVCKQLRARSSVPVIMVTARDSEIDKVVGLELGADDYVTKPYS
FT                   ARELIARIRAVLRRGGDDDSEMSDGVLESGPVRMDVERHVVSVNGDTITLPLKEFDLLE
FT                   YLMRNSGRVLTRGQLIDRVWGADYVGDTKTLDVHVKRLRSKIEADPANPVHLVTVRGLG
FT                   YKLEG"
FT   CDS_pept        complement(612287..614176)
FT                   /transl_table=11
FT                   /gene="BCG_0533c"
FT                   /locus_tag="BCG_0533c"
FT                   /product="Probable oxidoreductase gmc-type"
FT                   /EC_number="1.-.-.-"
FT                   /note="Differs from Rv0492c by 1aa, F520L"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0533c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70518"
FT                   /db_xref="GOA:A0A0H3MAK4"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAK4"
FT                   /protein_id="CAL70518.1"
FT                   /translation="MSRLADRAKSYPLASFGAALLPPELGGPLPAQFVQRVDRYVTRLP
FT                   ATSRFAVRAGLASLAAASYLTTGRSLPRLHPDERARVLHRIAALSPEVAAAVEGLKAIV
FT                   LLANGADTYAHELLARAQEHDAARPDAELTVILSADSPSVTRADAVVVGSGAGGAMVAR
FT                   TLARAGLDVVVLEEGRRWTVEEFRSTHPVDRYAGLYRGAGATVALGRPAVVLPMGRAVG
FT                   GTTVVNSGTCFRPSLAVQRRWRDEFGLGLADPDQLGRRLDDAEQTLRVAPVPLEIMGRN
FT                   GRLLLQAAKSLGWRAAPIPRNAPGCRGCCQCAIGCPSNAKFGVHLNALPQACAAGARII
FT                   SWARVERILHRAGRAYGVRARRPDGTTLDVLADAVVVAAGATETPGLLRRSGLGGHPRL
FT                   GHNLALHPATMLAGLFDDDVFAWRGVLQSAAVHEFHESDGVLIEATSTPPGMGSMVFPG
FT                   YGAELLRWLDRAPQIATFGAMVADRGVGTVRSVRGETVVRYDIAPGEIAKLRVALQAIG
FT                   RLFFAAGAVEVLTGIPGAPPMRSLPELQDVLRRANPRSLHLAAFHPTGTAAAGADEQLC
FT                   PVDATGRLRGVEGVWVADASILPSCPEVNPQLSIMAMALAVADQTVAKVVGVR"
FT   CDS_pept        complement(614173..614502)
FT                   /transl_table=11
FT                   /gene="BCG_0534c"
FT                   /locus_tag="BCG_0534c"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0534c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70519"
FT                   /db_xref="GOA:A0A0H3M2E4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2E4"
FT                   /protein_id="CAL70519.1"
FT                   /translation="MSFLLDPPLLFVCGVLIERRLPVDRRDAAEAAALGVFFGASFGLY
FT                   HNVPGLGMLWRPFRAQNGRDFMWNSGVFSVDVARAEWPLHAMAAAIFATYPFFIKLGRR
FT                   LGRRI"
FT   CDS_pept        complement(614499..615488)
FT                   /transl_table=11
FT                   /gene="BCG_0535c"
FT                   /locus_tag="BCG_0535c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Differs from Rv0493c by 1aa, G174S"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0535c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70520"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1S4"
FT                   /protein_id="CAL70520.1"
FT                   /translation="MGESTTQPAGGAAVDDETRSAALPRWRGAAGRLEVWYATLSDPLT
FT                   RTGLWVHCETVAPTTGGPYAHGWVTWFPPDAPPGTERFGPQPAQPAAGPAWFDIAGVRM
FT                   APAELTGRTRSLAWELSWKDTAAPLWTFPRVAWERELLPGAQVVIAPTAVFAGSLAVGE
FT                   TTHRVDSWRGGVAHIYGHGNAKRWGWIHADLGDGDVLEVVTAVSHKPGLRRLAPLAFVR
FT                   FRIDGKDWPASPLPSLRMRTTLGVRHWQLEGRIGGREALIRVDQPPERCVSLGYTDPDG
FT                   AKAVCTNTEQADIHIELGGRHWSVLGTGHAEVGLRGTAAPAIKEGTPA"
FT   CDS_pept        615493..616221
FT                   /transl_table=11
FT                   /gene="BCG_0536"
FT                   /locus_tag="BCG_0536"
FT                   /product="Probable transcriptional regulatory protein
FT                   (probably gntR-family)"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0536"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70521"
FT                   /db_xref="GOA:A0A0H3M8A4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M8A4"
FT                   /protein_id="CAL70521.1"
FT                   /translation="MVEPMNQSSVFQPPDRQRVDERIATTIADAILDGVFPPGSTLPPE
FT                   RDLAERLGVNRTSLRQGLARLQQMGLIEVRHGSGSVVRDPEGLTHPAVVEALVRKLGPD
FT                   FLVELLEIRAALGPLIGRLAAARSTPEDAEALCAALEVVQQADTAAARQAADLAYFRVL
FT                   IHSTRNRALGLLYRWVEHAFGGREHALTGAYDDADPVLTDLRAINGAVLAGDPAAAAAT
FT                   VEAYLNASALRMVKSYRDRA"
FT   CDS_pept        complement(616222..617112)
FT                   /transl_table=11
FT                   /gene="BCG_0537c"
FT                   /locus_tag="BCG_0537c"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0537c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70522"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M3R6"
FT                   /protein_id="CAL70522.1"
FT                   /translation="MWRPAQGARWHVPAVLGYGGIPRRASWSNVESVANSRRRPVHPGQ
FT                   EVELDFAREWVEFYDPDNPEHLIAADLTWLLSRWACVFGTPACQGTVAGRPNDGCCSHG
FT                   AFLSDDDDRTRLADAVHKLTDDDWQFRAKGLRRKGYLELDEHDGQPQHRTRKHKGACIF
FT                   LNRPGFAGGAGCALHSKALKLGVPPLTMKPDVCWQLPIRRSQEWVTRPDGTEILKTTLT
FT                   EYDRRGWGSGGADLHWYCTGDPAAHVGTKQVWQSLADELTELLGEKAYGELAAMCKRRS
FT                   QLGLIAVHPATRAAQ"
FT   CDS_pept        617192..618178
FT                   /transl_table=11
FT                   /gene="BCG_0538"
FT                   /locus_tag="BCG_0538"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0538"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70523"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAK5"
FT                   /protein_id="CAL70523.1"
FT                   /translation="MVDAHRGGHPTPMSSTKATLRLAEATDSSGKITKRGADKLISTID
FT                   EFAKIAISSGCAELMAFATSAVRDAENSEDVLSRVRKETGVELQALRGEDESRLTFLAV
FT                   RRWYGWSAGRILNLDIGGGSLEVSSGVDEEPEIALSLPLGAGRLTREWLPDDPPGRRRV
FT                   AMLRDWLDAELAEPSVTVLEAGSPDLAVATSKTFRSLARLTGAAPSMAGPRVKRTLTAN
FT                   GLRQLIAFISRMTAVDRAELEGVSADRAPQIVAGALVAEASMRALSIEAVEICPWALRE
FT                   GLILRKLDSEADGTALIESSSVHTSVRAVGGQPADRNAANRSRGSKP"
FT   CDS_pept        618175..619107
FT                   /transl_table=11
FT                   /gene="BCG_0539"
FT                   /locus_tag="BCG_0539"
FT                   /product="Probable conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0539"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70524"
FT                   /db_xref="GOA:A0A0H3M2E7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2E7"
FT                   /protein_id="CAL70524.1"
FT                   /translation="MTGPHPETESSGNRQISVAELLARQGVTGAPARRRRRRRGDSDAI
FT                   TVAELTGEIPIIRDDHHHAGPDAHASQSPAANGRVQVGEAAPQSPAEPVAEQVAEEPTR
FT                   TVYWSQPEPRWPKSPPQDRRESGPELSEYPRPLRHTHSDRAPAGPPSGAEHMSPDPVEH
FT                   YPDLWVDVLDTEVGEAEAETEVREAQPGRGERHAAAAAAGTDVEGDGAAEARVARRALD
FT                   VVPTLWRGALVVLQSILAVAFGAGLFIAFDQLWRWNSIVALVLSVMVILGLVVSVRAVR
FT                   KTEDIASTLIAVAVGALITLGPLALLQSG"
FT   CDS_pept        619123..619965
FT                   /transl_table=11
FT                   /gene="BCG_0540"
FT                   /locus_tag="BCG_0540"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0540"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70525"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1S9"
FT                   /protein_id="CAL70525.1"
FT                   /translation="MRPAIKVGLSTASVYPLRAEAAFEYADRLGYDGVELMVWGESVSQ
FT                   DIDAVRKLSRRYRVPVLSVHAPCLLISQRVWGANPILKLDRSVRAAEQLGAQTVVVHPP
FT                   FRWQRRYAEGFSDQVAALEAASTVMVAVENMFPFRADRFFGAGQSRERMRKRGGGPGPA
FT                   ISAFAPSYDPLDGNHAHYTLDLSHTATAGTDSLDMARRMGPGLVHLHLCDGSGLPADEH
FT                   LVPGRGTQPTAEVCQMLAGSGFVGHVVLEVSTSSARSANERESMLAESLQFARTHLLR"
FT   CDS_pept        619981..620856
FT                   /transl_table=11
FT                   /gene="BCG_0541"
FT                   /locus_tag="BCG_0541"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0541"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70526"
FT                   /db_xref="GOA:A0A0H3M8A8"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M8A8"
FT                   /protein_id="CAL70526.1"
FT                   /translation="MNALFTTAMALRPLDSDPGNPACRVFEGELNEHWTIGPKVHGGAM
FT                   VALCANAARTAYGAAGQQPMRQPVAVSASFLWAPDPGTMRLVTSIRKRGRRISVADVEL
FT                   TQGGRTAVHAVVTLGEPEHFLPGVDGSGGASGTAPLLSANPVVELMAPEPPEGVVPIGP
FT                   GHQLAGLVHLGEGCDVRPVLSTLRSATDGRPPVIQLWARPRGVAPDALFALLCGDLSAP
FT                   VTFAVDRTGWAPTVALTAYLRALPADGWLRVLCTCVEIGQDWFDEDHIVVDRLGRIVVQ
FT                   TRQLAMVPAQ"
FT   CDS_pept        620881..621768
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="BCG_0542"
FT                   /product="Probable pyrroline-5-carboxylate reductase proC"
FT                   /EC_number="1.5.1.2"
FT                   /note="Differs from Rv0500 by 1aa, D227E"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0542"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70527"
FT                   /db_xref="GOA:A0A0H3M3S0"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M3S0"
FT                   /protein_id="CAL70527.1"
FT                   /translation="MLFGMARIAIIGGGSIGEALLSGLLRAGRQVKDLVVAERMPDRAN
FT                   YLAQTYSVLVTSAADAVENATFVVVAVKPADVEPVIADLANATAAAENDSAEQVFVTVV
FT                   AGITIAYFESKLPAGTPVVRAMPNAAALVGAGVTALAKGRFVTPQQLEEVSALFDAVGG
FT                   VLTVPESQLDAVTAVSGSGPAYFFLLVEALVDAGVGVGLSRQVATDLAAQTMAGSAAML
FT                   LERMDQDQGGANGELMGLRVDLTASRLRAAVTSPGGTTAAALRELERGGFRMAVDAAVQ
FT                   AAKSRSEQLRITPE"
FT   CDS_pept        621909..622145
FT                   /transl_table=11
FT                   /gene="BCG_0543"
FT                   /locus_tag="BCG_0543"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0543"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70528"
FT                   /db_xref="GOA:A0A0H3MAK6"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAK6"
FT                   /protein_id="CAL70528.1"
FT                   /translation="MTSTNGPSARDTGFVEGQQAKTQLLTVAEVAALMRVSKMTVYRLV
FT                   HNGELPAVRVGRSFRVHAKAVHDMLETSYFDAG"
FT   CDS_pept        622452..623582
FT                   /transl_table=11
FT                   /gene="galE2"
FT                   /locus_tag="BCG_0544"
FT                   /product="Possible udp-glucose 4-epimerase galE2"
FT                   /EC_number="5.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0544"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70529"
FT                   /db_xref="GOA:A0A0H3M2F1"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2F1"
FT                   /protein_id="CAL70529.1"
FT                   /translation="MSSSNGRGGAGGVGGSSEHPQYPKVVLVTGACRFLGGYLTARLAQ
FT                   NPLINRVIAVDAIAPSKDMLRRMGRAEFVRADIRNPFIAKVIRNGEVDTVVHAAAASYA
FT                   PRSGGSAALKELNVMGAMQLFAACQKAPSVRRVVLKSTSEVYGSSPHDPVMFTEDSSSR
FT                   RPFSQGFPKDSLDIEGYVRALGRRRPDIAVTILRLANMIGPAMDTTLSRYLAGPLVPTI
FT                   FGRDARLQLLHEQDALGALERAAMAGKAGTFNIGADGILMLSQAIRRAGRIPVPVPGFG
FT                   VWALDSLRRANHYTELNREQFAYLSYGRVMDTTRMRVELGYQPKWTTVEAFDDYFRGRG
FT                   LTPIIDPHRVRSWEGRAVGLAQRWGSRNPIPWSGLR"
FT   CDS_pept        623589..624665
FT                   /transl_table=11
FT                   /gene="BCG_0545"
FT                   /locus_tag="BCG_0545"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0545"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70530"
FT                   /db_xref="GOA:A0A0H3M1T2"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR016676"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1T2"
FT                   /protein_id="CAL70530.1"
FT                   /translation="MGNVAGETRANVIPLHTNRSRVAARRRAGQRAESRQHPSLLSDPN
FT                   DRASAEQIAAVVREIDEHRRAAGATTSSTEATPNDLAQLVAAVAGFLRQRLTGDYSVDE
FT                   FGFDPHFNSAIVRPLLRFFFKSWFRVEVSGVENIPRDGAALVVANHAGVLPFDGLMLSV
FT                   AVHDEHPAHRDLRLLAADMVFDLPVIGEAARKAGHTMACTTDAHRLLASGELTAVFPEG
FT                   YKGLGKRFEDRYRLQRFGRGGFVSAALRTKAPIVPCSIIGSEEIYPMLTDVKLLARLFG
FT                   LPYFPITPLFPLAGPVGLVPLPSKWRIAFGEPICTADYASTDADDPMVTFELTDQVRET
FT                   IQQTLYRLLAGRRNIFFG"
FT   CDS_pept        complement(624669..625577)
FT                   /transl_table=11
FT                   /gene="cmaA2"
FT                   /locus_tag="BCG_0546c"
FT                   /product="Cyclopropane-fatty-acyl-phospholipid synthase 2
FT                   cmaA2"
FT                   /EC_number="2.1.1.79"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0546c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70531"
FT                   /db_xref="GOA:A0A0H3M8B1"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M8B1"
FT                   /protein_id="CAL70531.1"
FT                   /translation="MTSQGDTTSGTQLKPPVEAVRSHYDKSNEFFKLWLDPSMTYSCAY
FT                   FERPDMTLEEAQYAKRKLALDKLNLEPGMTLLDIGCGWGSTMRHAVAEYDVNVIGLTLS
FT                   ENQYAHDKAMFDEVDSPRRKEVRIQGWEEFDEPVDRIVSLGAFEHFADGAGDAGFERYD
FT                   TFFKKFYNLTPDDGRMLLHTITIPDKEEAQELGLTSPMSLLRFIKFILTEIFPGGRLPR
FT                   ISQVDYYSSNAGWKVERYHRIGANYVPTLNAWADALQAHKDEAIALKGQETYDIYMHYL
FT                   RGCSDLFRDKYTDVCQFTLVK"
FT   CDS_pept        complement(625600..626100)
FT                   /transl_table=11
FT                   /gene="BCG_0547c"
FT                   /locus_tag="BCG_0547c"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0547c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70532"
FT                   /db_xref="InterPro:IPR016709"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M3S6"
FT                   /protein_id="CAL70532.1"
FT                   /translation="MTVPEEAQTLIGKHYRAPDHFLVGREKIREFAVAVKDDHPTHYSE
FT                   PDAAAAGYPALVAPLTFLAIAGRRVQLEIFTKFNIPINIARVFHRDQKFRFHRPILAND
FT                   KLYFDTYLDSVIESHGTVLAEIRSEVTDAEGKPVVTSVVTMLGEAAHHEADADATVAAI
FT                   ASI"
FT   CDS_pept        complement(626262..627383)
FT                   /transl_table=11
FT                   /gene="serB1"
FT                   /locus_tag="BCG_0548c"
FT                   /product="Possible phosphoserine phosphatase serB1"
FT                   /EC_number="3.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0548c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70533"
FT                   /db_xref="GOA:A0A0H3MAK8"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAK8"
FT                   /protein_id="CAL70533.1"
FT                   /translation="MGLTCWPRTAAGRVHDESRCGLANFDTALGLQINPRQPRAPPRIC
FT                   RIGLITAAASATGQAPRLGVMMVSSHLGSPDQAGHVDLASPADPPPPDASASHSPVDMP
FT                   APVAAAGSDRQPPIDLTAAAFFDVDNTLVQGSSAVHFGRGLAARHYFTYRDVLGFLYAQ
FT                   AKFQLLGKENSNDVAAGRRKALAFIEGRSVAELVALGEEIYDEIIADKIWDGTRELTQM
FT                   HLDAGQQVWLITATPYELAATIARRLGLTGALGTVAESVDGIFTGRLVGEILHGTGKAH
FT                   AVRSLAIREGLNLKRCTAYSDSYNDVPMLSLVGTAVAINPDARLRSLARERGWEIRDFR
FT                   IARKAARIGVPSALALGAAGGALAALASRRQSR"
FT   CDS_pept        627557..628000
FT                   /transl_table=11
FT                   /gene="mmpS2"
FT                   /locus_tag="BCG_0549"
FT                   /product="Probable conserved membrane protein mmpS2"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0549"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70534"
FT                   /db_xref="InterPro:IPR008693"
FT                   /db_xref="InterPro:IPR038468"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2F5"
FT                   /protein_id="CAL70534.1"
FT                   /translation="MRMISVSGAVKRMWLLLAIVVVAVVGGLGIYRLHSIFGVHEQPTV
FT                   MVKPDFDVPLFNPKRVTYEVFGPAKTAKIAYLDPDARVHRLDSVSLPWSVTVETTLPAV
FT                   SVNLMAQSNADVISCRIIVNGAVKDERSETSPRALTSCQVSSG"
FT   CDS_pept        627997..630903
FT                   /transl_table=11
FT                   /gene="mmpL2"
FT                   /locus_tag="BCG_0550"
FT                   /product="Probable conserved transmembrane transport
FT                   protein mmpL2"
FT                   /note="Differs from Mb0519 by 1aa, D119H, and from Rv0507
FT                   by 3aa, H426R, Y509D, C722S"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0550"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70535"
FT                   /db_xref="GOA:A0A0H3M1T6"
FT                   /db_xref="InterPro:IPR004707"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1T6"
FT                   /protein_id="CAL70535.1"
FT                   /translation="MSERHAALTSLPPILPRLIRRFAVVIVLLWLGFTAFVNLAVPQLE
FT                   VVGKAHSVSMSPSDAASIQAIKRVGQVFGEFDSDNAVTIVLEGDQPLGGDAHRFYSDLM
FT                   RKLSADTRHVAHIQDFWGDPLTAAGSQSADDRAAYVVVYLVGNNETEAYDSVHAVRHMV
FT                   DTTPPPHGVKAYVTGPAALNADQAEAGDKSIAKVTAITSMVIAAMLLVIYRSVITAVLV
FT                   LIMVGIDLGAIRGFIALLADHNIFSLSTFATNLLVLMAIAASTDYAIFMLGRYHESRYA
FT                   GEDRETAFYTMFHGTAHVILGSGLTIAGAMYCLSFARLPYFETLGAPIAIGMLVAVLAA
FT                   LTLGPAVLTVGSFFKLFDPKRRMNTRRWRRVGTAIVRWPGPVLAATCLVASIGLLALPS
FT                   YRTTYDLRKFMPASMPSNVGDAAAGRHFSRARLNPEVLLIETDHDMRNPVDMLVLDKVA
FT                   KNIYHSPGIEQVKAITRPLGTTIKHTSIPFIISMQGVNSSEQMEFMKDRIYDILVQVAA
FT                   MNTSIETMHRMYALMGEVIDNTVDMDHLTHDMSDITATLRDHLADFEDFFRPIRSYFYW
FT                   EKHCFDVPLCWSIRSIFDMFDSVDQLSEKLEYLVKDMDILITLLPQMRAQMPPMISAMT
FT                   TMRDMMLIWHGTLGAFYKQQERNNKDPGAMGRVFDAAQIDDSFYLPQSAFENPDFKRGL
FT                   KMFLSPDGKAARFVIALEGDPATPEGICRVEPIKREAREAIKGTPLQGAAIYLGGTAAT
FT                   FKDIREGARYDLLIAGVAAISLILIIMMIITRSVVAAVVIVGTVVLSMGASFGLSVLVW
FT                   QDILGIELYWMVLAMSVILLLAVGSDYNLLLISRLKEEIGAGLNTGIIRAMAGTGGVVT
FT                   AAGMVFAVTMSLFVFSDLRIIGQIGTTIGLGLLFDTLVVRSFMTPSIAALLGRWFWWPL
FT                   RVRPRPASQMLRPFAPRRLVRALLLPSGQHPSATGAHE"
FT   CDS_pept        630896..631189
FT                   /transl_table=11
FT                   /gene="BCG_0551"
FT                   /locus_tag="BCG_0551"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0551"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70536"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M8B6"
FT                   /protein_id="CAL70536.1"
FT                   /translation="MSRPQVELLTRAGCAICVRVAEQLAELSSELGFDMMTIDVDVAAS
FT                   TGNPGLRAEFGDRLPVVLLDGREHSYWEVDEHRLRADIARSTFGSPPDKRLP"
FT   CDS_pept        631239..632645
FT                   /transl_table=11
FT                   /gene="hemA"
FT                   /locus_tag="BCG_0552"
FT                   /product="Probable glutamyl-trna reductase hemA [first
FT                   part]"
FT                   /EC_number="1.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0552"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70537"
FT                   /db_xref="GOA:A1KFY5"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KFY5"
FT                   /protein_id="CAL70537.1"
FT                   /translation="MSVLLFGVSHRSAPVVVLEQLSIDESDQVKIIDRVLASPLVTEAM
FT                   VLSTCNRVEVYAVVDAFHGGLSVIGQVLAEHSGMSMGELTKYAYVRYSEAAVEHLFAVA
FT                   SGLDSAVIGEQQVLGQVRRAYAVAESNRTVGRVLHELAQRALSVGKRVHSETAIDAAGA
FT                   SVVSVALGMAERKLGSLAGTTAVVIGAGAMGALSAVHLTRAGVGHIQVLNRSLSRAQRL
FT                   ARRIRESGVPAEALALDRLANVLADADVVVSCTGAVRPVVSLADVHHALAAARRDEATR
FT                   PLVICDLGMPRDVDPAVARLPCVWVVDVDSVQHEPSAHAAAADVEAARHIVAAEVASYL
FT                   VGQRMAEVTPTVTALRQRAAEVVEAELLRLDNRLPGLQSVQREEVARTVRRVVDKLLHA
FT                   PTVRIKQLASAPGGDSYAEALRELFELDQTAVDAVATAGELPVVPSGFDAESRRGGGDM
FT                   QSSPKRSPSN"
FT   CDS_pept        632655..633584
FT                   /transl_table=11
FT                   /gene="hemC"
FT                   /locus_tag="BCG_0553"
FT                   /product="Probable porphobilinogen deaminase hemC"
FT                   /EC_number="2.5.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0553"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70538"
FT                   /db_xref="GOA:A1KFY6"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KFY6"
FT                   /protein_id="CAL70538.1"
FT                   /translation="MIRIGTRGSLLATTQAATVRDALIAGGHSAELVTISTEGDRSMAP
FT                   IASLGVGVFTTALREAMEAGLVDAAVHSYKDLPTAADPRFTVAAIPPRNDPRDAVVARD
FT                   GLTLGELPVGSLVGTSSPRRAAQLRALGLGLEIRPLRGNLDTRLNKVSSGDLDAIVVAR
FT                   AGLARLGRLDDVTETLEPVQMLPAPAQGALAVECRAGDSRLVAVLAELDDADTRAAVTA
FT                   ERALLADLEAGCSAPVGAIAEVVESIDEDGRVFEELSLRGCVAALDGSDVIRASGIGSC
FT                   GRARELGLSVAAELFELGARELMWGVRH"
FT   CDS_pept        633617..635314
FT                   /transl_table=11
FT                   /gene="hemD"
FT                   /locus_tag="BCG_0554"
FT                   /product="Probable uroporphyrin-III c-methyltransferase
FT                   hemD"
FT                   /EC_number="2.1.1.107"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0554"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70539"
FT                   /db_xref="GOA:A0A0H3M3T0"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M3T0"
FT                   /protein_id="CAL70539.1"
FT                   /translation="MTRGRKPRPGRIVFVGSGPGDPGLLTTRAAAVLANAALVFTDPDV
FT                   PEPVVALIGTDLPPVSGPAPAEPVAGNGDAAGGGSAQEHGRAASAVVSGGPDIRPALGD
FT                   PADVAKTLTAEARSGVDVVRLVAGDPLTVDAVISEVNAVARTHLHIEIVPGLAASSAVP
FT                   TYAGLPLGSSHTVADVRIDPENTDWDALAAAPGPLILQATASHLAESARSLIDHQLAES
FT                   TPCVVTAHGTTCQQRSVETTLQGLTDPAVLGATDPACSANGRDSQAGPLIVTIGKTVTS
FT                   RAKLNWWESRALYGWTVLVPRTKDQAGEMSERLTSYGALPVEVPTIAVEPPRSPAQMER
FT                   AVKGLVDGRFQWIVFTSTNAVRAVWEKFGEFGLDARAFSGVKIACVGESTADRVRAFGI
FT                   SPELVPSGEQSSLGLLDDFPPYDSVFDPVNRVLLPRADIATETLAEGLRERGWEIEDVT
FT                   AYRTVRAAPPPATTREMIKTGGFDAVCFTSSSTVRNLVGIAGKPHARTIIACIGPKTAE
FT                   TAAEFGLRVDVQPDTAAIGPLVDALAEHAARLRAEGALPPPRKKSRRR"
FT   CDS_pept        635400..636389
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="BCG_0555"
FT                   /product="Probable delta-aminolevulinic acid dehydratase
FT                   hemB"
FT                   /EC_number="4.2.1.24"
FT                   /note="Differs from Rv0512 by 1aa, G246E"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0555"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70540"
FT                   /db_xref="GOA:A0A0H3MAL2"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAL2"
FT                   /protein_id="CAL70540.1"
FT                   /translation="MSMSSYPRQRPRRLRSTVAMRRLVAQTSLEPRHLVLPMFVADGID
FT                   EPRPITSMPGVVQHTRDSLRRAAAAAVAAGVGGLMLFGVPRDQDKDGVGSAGIDPDGIL
FT                   NVALRDLAKDLGEATVLMADTCLDEFTDHGHCGVLDDRGRVDNDATVARYVELAVAQAE
FT                   SGAHVVGPSGMMDGQVAAIRDGLDAAGYIDVVILAYAAKFASAFYGPFREAVSSSLSGD
FT                   RRTYQQEPGNAAEALREIELDLDGGADIVMVKPAMGYLDVVAAAADVSPVPVAAYQVSG
FT                   EYAMIRAAAANNWIDERAAVLESLTGIRRAGADIVLTYWAVDAAGWLT"
FT   CDS_pept        636402..636950
FT                   /transl_table=11
FT                   /gene="BCG_0556"
FT                   /locus_tag="BCG_0556"
FT                   /product="Possible conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0556"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70541"
FT                   /db_xref="GOA:A0A0H3M2F9"
FT                   /db_xref="InterPro:IPR016844"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2F9"
FT                   /protein_id="CAL70541.1"
FT                   /translation="MTPTGDTKPKLLFYEPGASWYWVLTGPLAAVSVLLLEISSGAGVG
FT                   LITPAIFLVMVSAFVALQVKAARIHTSVELTHDALRQGTETIRLAEIVKIYPEADGRET
FT                   SGEEPAKWQSARTLGELVGVPRGRVGIGLKLTGGRTAQAWARRHQQLRAALTPLVQERL
FT                   GPVDSDVADVNGDDAGPAR"
FT   CDS_pept        636947..637246
FT                   /transl_table=11
FT                   /gene="BCG_0557"
FT                   /locus_tag="BCG_0557"
FT                   /product="Possible transmembrane protein"
FT                   /note="Differs from Mb0527 and Rv0514 by 1aa, G23A"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0557"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70542"
FT                   /db_xref="GOA:A0A0H3M1T8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1T8"
FT                   /protein_id="CAL70542.1"
FT                   /translation="MIARYRAGAELFLACAALAGSAGSWSRTRSTVAVAPVIDGQPVTL
FT                   SVVYHPQPLVLTLLLATIAGVLSVVGTARLRRARAGLNAHPDGLNQRPPGGWCH"
FT   CDS_pept        637349..638860
FT                   /transl_table=11
FT                   /gene="BCG_0558"
FT                   /locus_tag="BCG_0558"
FT                   /product="Conserved 13E12 repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0558"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70543"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2Q9G6"
FT                   /protein_id="CAL70543.1"
FT                   /translation="MPSPEAIAHFDERFECHAPRTTRVSAAFIDRICSATRAENRAAAA
FT                   QLVALGELFAYRWSRCGGREEWVMDTMAAVAAEVAAALRISQGLAASRLRYARAMRERL
FT                   PKTAEVFSAGDIGYLMFATIVYRTDLIVDPDVLAAVDAQLAANVARWPSMTKARLAGQV
FT                   DKIVARADADAVRRRKEYQAQRQFWVGESQDGVCQIGGSLLAVDAHALDARLSALAGTV
FT                   CEHDPRSREQRRADALGALAGGADRLGCGCGRADCAAGKRPAAPPVVIHLIAEAATING
FT                   TGSAPASQMNADGLITAELVAELAKTATLVPLVHPGDAPPEPGYAPSKALADFVRCRDL
FT                   TCRWPGCDEPATNCDLDHTIPYAAGGPTHASNLKCYCRTHHLVKTFWGWRDQQLPDGTL
FT                   ILTSPSGHTYVSTPGSALLFPSLCHFSGGIPAPEADPPYDHCDQRTAMMPKRRRTRAQD
FT                   RAYRIATERRQNHAARQRAQVLTQTAAATDTHGPPPDHNDDPPPF"
FT   CDS_pept        complement(638857..639333)
FT                   /transl_table=11
FT                   /gene="BCG_0559c"
FT                   /locus_tag="BCG_0559c"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0559c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70544"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M8C0"
FT                   /protein_id="CAL70544.1"
FT                   /translation="MTTTIPTSKSACSVTTRPGNAAVDYGGAQIRAYLHHLATVVTIRG
FT                   EIDAANVEQISEHVRRFSLGTNPMVLDLSELSHFSGAGISLLCILDEDCRAAGVQWALV
FT                   ASPAVVEQLGGRCDQGEHESMFPMARSVHKALHDLADAIDRRRQLVLPLISRSA"
FT   CDS_pept        639544..640854
FT                   /transl_table=11
FT                   /gene="BCG_0560"
FT                   /locus_tag="BCG_0560"
FT                   /product="Possible membrane acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="Differs from Rv0517 by 1aa, G394D"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0560"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70545"
FT                   /db_xref="GOA:A0A0H3M3T5"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M3T5"
FT                   /protein_id="CAL70545.1"
FT                   /translation="MAGGMDQPPGQPRRRTRQQSSDGKNGVRAAEITGEIRALTGLRIV
FT                   AAVWVVLFHFRPMLGDASPGFRDALAPVLDCGAQGVDLFFILSGFVLTWNYLDRMGRSW
FT                   SVRANLHFLWLRLARVWPVYLVTLHLAAVWVIFTLHVGHVPSPEAGQLTAISYVRQILL
FT                   VQLWFQPYFDGSSWDGPAWSISAEWLAYLLFGLLILVIFRMKHATRARGLMWLAFAASL
FT                   PPVVLLLASGQFYTPWSWLPRIVTQFAAGALACAAVRRLRPTDRARRIAGYLSVLVGVA
FT                   IVGILYLLHAHPLAGVEDSGGVVDVLFVPLVISLAIGVGSLPALLSTRLMVFGGQISFC
FT                   LYMVHELVHTAWGWAVQQYELALQDQPWKWNVVGLLAIALGAAILLYHFVEEPGRRWMR
FT                   RMVDVKAASARSEPGEPVGSTRYQIDDALEGVSARAV"
FT   CDS_pept        640986..641681
FT                   /transl_table=11
FT                   /gene="BCG_0561"
FT                   /locus_tag="BCG_0561"
FT                   /product="Possible exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0561"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70546"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAL6"
FT                   /protein_id="CAL70546.1"
FT                   /translation="MSRPGTYVIGLTLLVGLVVGNPGCPRSYRPLTLDYRLNPVAVIGD
FT                   SYTTGTDEGGLGSKSWTARTWQMLAARGVRIAADVAAEGRAGYGVPGDHGNVFEDLTAR
FT                   AVQPDDALVVFFGSRNDQGMDPEDPEMLAEKVRDTFDLARHRAPSASLLVIAPPWPTAD
FT                   VPGPMLRIRDVLGAQARAAGAVFVDPIADHWFVDRPELIGADGVHPNDAGHEYLADKIA
FT                   PLISMELVG"
FT   CDS_pept        complement(641970..642872)
FT                   /transl_table=11
FT                   /gene="BCG_0562c"
FT                   /locus_tag="BCG_0562c"
FT                   /product="Possible conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0562c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70547"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2G2"
FT                   /protein_id="CAL70547.1"
FT                   /translation="MLRRGCAGNTDRRGIMTPMADLTRRALLRWGAGAGAGAAGVWAFG
FT                   ALVDPLEPQAAPAPFEPPTAGSSLPTRISGSFISAARGGIKTNWVISMPPGQSGQLRPV
FT                   IALHGKDGNAGMMLDLGVEQGLARLVKEGKPAFAVVGVDGGNTYWHRRSSGGDSGAMVL
FT                   DELLPMLTSMGMDTSRVGFLGWSMGGYGALLLGARLGPARTAGICAISPALFTSFTGST
FT                   PGAFDSYDDYVQHSVLGLPALNSIPLRVDCGTSDRFYFATRQFVNQLHQPPAGSFSPGG
FT                   HDASYWREQLPGELAWMAS"
FT   CDS_pept        643053..643403
FT                   /transl_table=11
FT                   /gene="BCG_0563"
FT                   /locus_tag="BCG_0563"
FT                   /product="Possible methyltransferase/methylase (fragment)"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0563"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70548"
FT                   /db_xref="GOA:A0A0H3M1T9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1T9"
FT                   /protein_id="CAL70548.1"
FT                   /translation="MGGCSITCLNISEVPNETNRKKNRQAGLDRSIRVIHGSFDDIPEP
FT                   DSGYDVVWSQDAILHAPDRRKVLEEAFRVLRPGGELIFTDPMQADDVPDGVLQPVYDRL
FT                   NLRDLGSMRFYA"
FT   CDS_pept        643396..643701
FT                   /transl_table=11
FT                   /gene="BCG_0564"
FT                   /locus_tag="BCG_0564"
FT                   /product="Possible methyltransferase/methylase (fragment)"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0564"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70549"
FT                   /db_xref="GOA:A0A0H3M8C5"
FT                   /db_xref="InterPro:IPR023143"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M8C5"
FT                   /protein_id="CAL70549.1"
FT                   /translation="MREAAQALGFEVLDQRDLVRNLRTHYSRVFEELEARRLELEGKSS
FT                   QEYLDKMRVGLKNWVEAADNGHSRVGHPTFPRTRLTPICQLPTAAIDSTAGRRRYR"
FT   CDS_pept        643836..645140
FT                   /transl_table=11
FT                   /gene="gabP"
FT                   /locus_tag="BCG_0565"
FT                   /product="Probable gaba permease gabP (4-amino butyrate
FT                   transport carrier)"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0565"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70550"
FT                   /db_xref="GOA:A0A0H3M3T9"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M3T9"
FT                   /protein_id="CAL70550.1"
FT                   /translation="MIAIGGVIGAGLFVGSGVVIRATGPAAFLTYALCGALIVLVMRML
FT                   GEMAAANPSTGAFADYAAKALGGWAGFSVGWLYWYFWVIVVGFEAVAGGKVLTYWIDAP
FT                   LWLASLCLMMMMTATNLVSVSSFGEFEFWFAGVKVATIVGFLVLGTAFAFGLLPGHGMD
FT                   FSNLSAHGGFFPDGVGAVFAAIVVAIFSMTGTEVVTIAAAEAPDPQRAVQRAMSTVVAR
FT                   IVIFFVGSVFLLTVILPWNSLELGASPYVAALRHMGIGGADQIMNAVVLTAVLSCLNSG
FT                   LYTASRMLFVLAARQEAPAQLVKVNRRGVPTFAIMGSSVVGFLCVIMAWVSPATVFVFL
FT                   LNSSGAVILFVYLLIALSQIVLRRQTSGQNLGVRMWLFPGLSIVTVTGIVAVLARMAFD
FT                   YAARSQLWLSLLSWAVVVGCYLVTTLVRRPLNRPW"
FT   CDS_pept        complement(645124..645519)
FT                   /transl_table=11
FT                   /gene="BCG_0566c"
FT                   /locus_tag="BCG_0566c"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0566c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70551"
FT                   /db_xref="GOA:A0A0H3MAL9"
FT                   /db_xref="InterPro:IPR004378"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAL9"
FT                   /protein_id="CAL70551.1"
FT                   /translation="MQLPQWLARFNRYVTNPIQRLWAGWLPAFAILEHVGRRSGKPYRT
FT                   PLNVFSADVDGRAGVAILLTYGPNRDWLKNITAAGGGRMRRYGKTFGVANPRRLTKAEA
FT                   APYVSSRWRPVFARLPFDEAVLLTKAD"
FT   CDS_pept        645633..647021
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="BCG_0567"
FT                   /product="Probable glutamate-1-semialdehyde 2,1-aminomutase
FT                   hemL"
FT                   /EC_number="5.4.3.8"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0567"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70552"
FT                   /db_xref="GOA:A1KG00"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KG00"
FT                   /protein_id="CAL70552.1"
FT                   /translation="MGSTEQATSRVRGAARTSAQLFEAACSVIPGGVNSPVRAFTAVGG
FT                   TPRFITEAHGCWLIDADGNRYVDLVCSWGPMILGHAHPAVVEAVAKAAARGLSFGAPTP
FT                   AETQLAGEIIGRVAPVERIRLVNSGTEATMSAVRLARGFTGRAKIVKFSGCYHGHVDAL
FT                   LADAGSGVATLGLCDDPQRPASPRSQSSRGLPSSPGVTGAAAADTIVLPYNDIDAVQQT
FT                   FARFGEQIAAVITEASPGNMGVVPPGPGFNAALRAITAEHGALLILDEVMTGFRVSRSG
FT                   WYGIDPVPADLFAFGKVMSGGMPAAAFGGRAEVMQRLAPLGPVYQAGTLSGNPVAVAAG
FT                   LATLRAADDAVYTALDANADRLAGLLSEALTDAVVPHQISRAGNMLSVFFGETPVTDFA
FT                   SARASQTWRYPAFFHAMLDAGVYPPCSAFEAWFVSAALDDAAFGRIANALPAAARAAAQ
FT                   ERPA"
FT   CDS_pept        647021..647629
FT                   /transl_table=11
FT                   /gene="BCG_0568"
FT                   /locus_tag="BCG_0568"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0568"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70553"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2G6"
FT                   /protein_id="CAL70553.1"
FT                   /translation="MPEETQVHVVRHGEVHNPTGILYGRLPGFHLSATGAAQAAAVADA
FT                   LADRDIVAVIASPLQRAQETAAPIAARHDLAVETDPDLIESANFFEGRRVGPGDGAWRD
FT                   PRVWWQLRNPFTPSWGEPYVDIAARMTTAVDKARVRGAGHEVVCVSHQLPVWTLRLYLT
FT                   GKRLWHDPRRRDCALASVTSLIYDGDRLVDVVYSQPAAL"
FT   CDS_pept        647644..648294
FT                   /transl_table=11
FT                   /gene="BCG_0569"
FT                   /locus_tag="BCG_0569"
FT                   /product="Possible thioredoxin protein"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0569"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70554"
FT                   /db_xref="GOA:A0A0H3M1U2"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1U2"
FT                   /protein_id="CAL70554.1"
FT                   /translation="MQSRATRRSGALTMRRLVIAAAVSALLLTGCSGRDAVAQGGTFEF
FT                   VSPGGKTDIFYDPPASRGRPGPLSGPELADPARSVSLDDFPGQVVVVNVWGQWCGPCRA
FT                   EVSQLQRVYDATRGAGVSFLGIDVRDNNRQAPQDFINDRHVTYPSIYDPAMRTLIAFGG
FT                   KYPTSVIPSTLVLDRQHRVAAVFLRELLAADLQPVVERVAEEEPSGRAPVGAQ"
FT   CDS_pept        648291..649070
FT                   /transl_table=11
FT                   /gene="ccdA"
FT                   /locus_tag="BCG_0570"
FT                   /product="Possible cytochrome c-type biogenesis protein
FT                   ccdA"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0570"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70555"
FT                   /db_xref="GOA:A0A0H3M8C9"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M8C9"
FT                   /protein_id="CAL70555.1"
FT                   /translation="MTGFTEIAAVGPLLVAVGVCLLAGLVSFASPCVVPLVPGYLSYLA
FT                   AVVGVDEQLPAGVVKPPVAARWRVAGSAALFVAGFTTVFVLGTVAVLGMTTTLITNQLL
FT                   LQRVGGVLIVVMGLVFVGFIGALQRQARFTPRQLTSVAGAPVLGAVFALGWTPCLGPTL
FT                   TGVITVASATEGASVARGIVLVIAYCLGLGIPFVLLAFGSAWAVAGLGWLRRHTRAIQI
FT                   FGGALLIAVGAALVTGVWNDVVSWLRDAFVSDVRLPI"
FT   CDS_pept        649103..650692
FT                   /transl_table=11
FT                   /gene="BCG_0571"
FT                   /locus_tag="BCG_0571"
FT                   /product="Probable conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0571"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70556"
FT                   /db_xref="GOA:A0A0H3M3U4"
FT                   /db_xref="InterPro:IPR007816"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M3U4"
FT                   /protein_id="CAL70556.1"
FT                   /translation="MWRSLTSMGTALVLLFLLALAAIPGALLPQRGLNAAKVDDYLAAH
FT                   PLIGPWLDELQAFDVFSSFWFTAIYVLLFVSLVGCLAPRTIEHARSLRATPVAAPRNLA
FT                   RLPKHAHARLAGEPAALAATITGRLRGWRSITRQQGDSVEVSAEKGYLREFGNLVFHFA
FT                   LLGLLVAVAVGKLFGYEGNVIVIADGGPGFCSASPAAFDSFRAGNTVDGTSLHPICVRV
FT                   NNFQAHYLPSGQATSFAADIDYQADPATADLIANSWRPYRLQVNHPLRVGGDRVYLQGH
FT                   GYAPTFTVTFPDGQTRTSTVQWRPDNPQTLLSAGVVRIDPPAGSYPNPDERRKHQIAIQ
FT                   GLLAPTEQLDGTLLSSRFPALNAPAVAIDIYRGDTGLDSGRPQSLFTLDHRLIEQGRLV
FT                   KEKRVNLRAGQQVRIDQGPAAGTVVRFDGAVPFVNLQVSHDPGQSWVLVFAITMMAGLL
FT                   VSLLVRRRRVWARITPTTAGTVNVELGGLTRTDNSGWGAEFERLTGRLLAGFEARSPDM
FT                   AEAAAGTGRDVD"
FT   CDS_pept        650689..651663
FT                   /transl_table=11
FT                   /gene="ccsA"
FT                   /locus_tag="BCG_0572"
FT                   /product="Possible cytochrome c-type biogenesis protein
FT                   ccsA"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0572"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70557"
FT                   /db_xref="GOA:A0A0H3MAM2"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR017562"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAM2"
FT                   /protein_id="CAL70557.1"
FT                   /translation="MNTLHVNVGLARYSDWAFTSAVVALVVALLLLAFEFAQVRGRGLA
FT                   PLAVPAGSVATDSATPGIVADQRHRPFDERVGRGGLAVAYLGIGLLLACVVLRGLATQR
FT                   VPWGNMYEFINLTCLSGLIAGAVVLRRARYRPLWVFLLVPVLILLTVSGRWLYANAAPV
FT                   MPALQSYWLPIHVSVVSLGSGVFLVAGVASILFLVRTSRLGEPTGEGALAGMVRRLPDA
FT                   QTLDGIAYRTTIFAFPVFGFGVIFGAIWAEEAWGRYWGWDPKETVSFVAWVVYAAYLHA
FT                   RSTAGWRDRKAAWINVAGFVAMVFNLFFVNLVTVGLHSYAGVG"
FT   CDS_pept        651705..652922
FT                   /transl_table=11
FT                   /gene="BCG_0573"
FT                   /locus_tag="BCG_0573"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0573"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70558"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2H1"
FT                   /protein_id="CAL70558.1"
FT                   /translation="MLVTEHPRTGVGAPDSGNGGTDHPTVQLPPVPSVGAPPAAAGGET
FT                   PTRSVAGFRTQRLDPTAYGAYYSGPDEGPASPAERPPYRLEPVPHTPYPELATTTLLRP
FT                   VKPPPSEGWRRLLYLLSGRLINAGEGPRAAHLNDLVAQVNRPLRGCYRIAVLSLKGGVG
FT                   KTTITATLGATFADLRGDRVVAVDANPDRGTLSQKVPLETPATVRHLLRDADGIERYSD
FT                   VRGYTSKGPSGLEVLASDSDPASSDAFSADDYTRTLDILERFYGLVLTDCGTGLLHSAM
FT                   SAVLPRSDVLVVVSSGSIDGARSAAATLDWLQAHGHDDQVRNSIAVVNAVRPRAGKVDV
FT                   GKVVEHFSRRCRAVRVVPFDPHLEEGAEIALDRLRRETREALTELAAVVAAGFPGDPRR
FT                   CKPSFT"
FT   CDS_pept        653127..653444
FT                   /transl_table=11
FT                   /gene="BCG_0574"
FT                   /locus_tag="BCG_0574"
FT                   /product="Possible conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0574"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70559"
FT                   /db_xref="GOA:A0A0H3M1U3"
FT                   /db_xref="InterPro:IPR025323"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1U3"
FT                   /protein_id="CAL70559.1"
FT                   /translation="MSEAPNDKTTRGVVDILVYATARLLLVVAVSAAIFGVARLIGLTE
FT                   FPVVVATLFGLIIAMPLGIWVFSPLRRRATAALAVAGERRRAERERLRARLRGESLPEE
FT                   Q"
FT   CDS_pept        653591..655336
FT                   /transl_table=11
FT                   /gene="PE_PGRS6a"
FT                   /locus_tag="BCG_0575"
FT                   /product="PE-PGRS family protein [first part]"
FT                   /note="In Mycobacterium tuberculosis strain H37Rv, PE_PGRS6
FT                   exists as a single gene. In Mycobacterium bovis and
FT                   Mycobacterium bovis BCG Pasteur, a frameshift due to a
FT                   single base insertion (*-t) splits PE_PGRS6 into 2 parts,
FT                   PE_PGRS6a and PE_PGRS6b, resulting in PE_PGRS6a having a
FT                   different COOH part. There is also a 84 bp and a 9 bp
FT                   (*-cggggccgg) insertion in PE_PGRS6a"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0575"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70560"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M8D2"
FT                   /protein_id="CAL70560.1"
FT                   /translation="MSNLLVTPELVAAAAADLAGIGSAIGAANAAAGAPTMALLAAGAD
FT                   EVSAAVAAVFSSYAQQYQALSAAAAAFHDQFVRALAAGAGAYAGAEAANVEQQLLNAIN
FT                   APTLALLGRPLIGNGADGAAGTGQAGGAGGLLYGNGGNGGSGAAGQAGGAGGAAGLIGH
FT                   GGTGGVGGTGAAGGAGGTGGWLFGNGGAGGTGGAVTGVSTTGGPGGHGGDAGLYGFGGA
FT                   GGAGGFGQSGAAGGAGGAGGAGGWLYGDGGDGGAGGNGGNESGTGVSGVGGVGGAGGAG
FT                   GLLFGNGGDGGVGGDGGDGSSTQDSGGDGGAGGAGGAGGWLLGNGGAGGAGGAASIKVA
FT                   TGGLGGDGGDAGLFGFGGDGGWGGRGVDARFGAAGGAAGAGGAGGWLYGDGGAGGVGGV
FT                   GGAVFSLSSGDGGAGGAGGGGGWLFGNGGDGGAGGGGGGRFGSGSGAGGDGAVGGAGGA
FT                   GAWFGNGGAGGVGGGGGRGTTAIGGDGGAGGAGGAGGWLYGDGGAGGAGGGGGRGGTGN
FT                   DGGDGGDGGRGGDAQLLGNGGDGGAGGAGGPAGFGASPGAGAAGGGGGAGGSLFGSPGT
FT                   TGPHG"
FT   CDS_pept        655242..655469
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="PE_PGRS6b"
FT                   /locus_tag="BCG_0576"
FT                   /product="PE-PGRS family protein [second part]"
FT                   /note="In Mycobacterium tuberculosis strain H37Rv, PE_PGRS6
FT                   exists as a single gene. In Mycobacterium bovis and
FT                   Mycobacterium bovis BCG Pasteur, a frameshift due to a
FT                   single base insertion (*-t) splits PE_PGRS6 into 2 parts,
FT                   PE_PGRS6a and PE_PGRS6b"
FT                   /db_xref="PSEUDO:CAL70561.1"
FT   CDS_pept        complement(655365..656372)
FT                   /transl_table=11
FT                   /gene="fabH"
FT                   /locus_tag="BCG_0577c"
FT                   /standard_name="mtFabH"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase III
FT                   fabH"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0577c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70562"
FT                   /db_xref="GOA:A1KG10"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KG10"
FT                   /protein_id="CAL70562.1"
FT                   /translation="MTEIATTSGARSVGLLSVGAYRPERVVTNDEICQHIDSSDEWIYT
FT                   RTGIKTRRFAADDESAASMATEACRRALSNAGLSAADIDGVIVTTNTHFLQTPPAAPMV
FT                   AASLGAKGILGFDLSAGCAGFGYALGAAADMIRGGGAATMLVVGTEKLSPTIDMYDRGN
FT                   CFIFADGAAAVVVGETPFQGIGPTVAGSDGEQADAIRQDIDWITFAQNPSGPRPFVRLE
FT                   GPAVFRWAAFKMGDVGRRAMDAAGVRPDQIDVFVPHQANSRINELLVKNLQLRPDAVVA
FT                   NDIEHTGNTSAASIPLAMAELLTTGAAKPGDLALLIGYGAGLSYAAQVVRMPKG"
FT   CDS_pept        complement(656454..657332)
FT                   /transl_table=11
FT                   /gene="menA"
FT                   /locus_tag="BCG_0578c"
FT                   /product="1,4-dihydroxy-2-naphthoate octaprenyltransferase
FT                   menA"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0578c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70563"
FT                   /db_xref="GOA:A0A0H3M3U8"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR004657"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M3U8"
FT                   /protein_id="CAL70563.1"
FT                   /translation="MASFAQWVSGARPRTLPNAIAPVVAGTGAAAWLHAAVWWKALLAL
FT                   AVAVALVIGVNYANDYSDGIRGTDDDRVGPVRLVGSRLATPRSVLTAAMTSLALGALAG
FT                   LVLALLSAPWLIAVGAICIAGAWLYTGGSKPYGYAGFGELAVFVFFGPVAVLGTQYTQA
FT                   LRVDWVGLAQAVATGALSCSVLVANNLRDIPTDARADKITLAVRLGDARTRMLYQGLLA
FT                   VAGVLTFVLMLATPWCVVGLVAAPLALRAAGPVRSGRGGRELIPVLRDTGLAMLVWALA
FT                   VAGALAFGQLS"
FT   CDS_pept        657349..658143
FT                   /transl_table=11
FT                   /gene="pnp"
FT                   /locus_tag="BCG_0579"
FT                   /product="Probable 5'-methylthioadenosine phosphorylase
FT                   pnp"
FT                   /EC_number="2.4.2.28"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0579"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70564"
FT                   /db_xref="GOA:A0A0H3MAM6"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010044"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAM6"
FT                   /protein_id="CAL70564.1"
FT                   /translation="MHNNGRMLGVIGGSGFYTFFGSDTRTVNSDTPYGQPSAPITIGTI
FT                   GVHDVAFLPRHGAHHQYSAHAVPYRANMWALRALGVRRVFGPCAVGSLDPELEPGAVVV
FT                   PDQLVDRTSGRADTYFDFGGVHAAFADPYCPTLRAAVTGLPGVVDGGTMVVIQGPRFST
FT                   RAESQWFAAAGCNLVNMTGYPEAVLARELELCYAAIALVTDVDAGVAAGDGVKAADVFA
FT                   AFGENIELLKRLVRAAIDRVADERTCTHCQHHAGVPLPFELP"
FT   CDS_pept        658140..659180
FT                   /transl_table=11
FT                   /gene="galE3"
FT                   /locus_tag="BCG_0580"
FT                   /product="Probable udp-glucose 4-epimerase galE3"
FT                   /EC_number="5.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0580"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70565"
FT                   /db_xref="GOA:A0A0H3M2H5"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2H5"
FT                   /protein_id="CAL70565.1"
FT                   /translation="MRVLLTGAAGFIGSRVDAALRAAGHDVVGVDALLPAAHGPNPVLP
FT                   PGCQRVDVRDASALAPLLAGVDLVCHQAAMVGAGVNAADAPAYGGHNDFATTVLLAQMF
FT                   AAGVRRLVLASSMVVYGQGRYDCPQHGPVDPLPRRRADLDNGVFEHRCPGCGEPVIWQL
FT                   VDEDAPLRPRSLYAASKTAQEHYALAWSEASGGSVVALRYHNVYGPGMPRDTPYSGVAA
FT                   IFRSAVEKGKPPKVFEDGGQMRDFVHVDDVAAANLAAVHLGEADRDGFTAVNVCSGRPI
FT                   SILQVATAICDARGGSMSPAITGHYRSGDVRHIVADPARAARVLGFRAAVDPGEGLREF
FT                   AFAPLR"
FT   CDS_pept        complement(659190..660623)
FT                   /transl_table=11
FT                   /gene="BCG_0581c"
FT                   /locus_tag="BCG_0581c"
FT                   /product="Probable integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0581c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70566"
FT                   /db_xref="GOA:A0A0H3M1U6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1U6"
FT                   /protein_id="CAL70566.1"
FT                   /translation="MGLSSDDTRRREVVRDLAAGALLIGALFFPWNLYFGFRIPDSSKT
FT                   VFGLLLAVTSLSLASLAVTFAGRRSQLRLGLNVPYLLLVLAFVVFDAIQTIRLGGTVHV
FT                   PGGVGPGGWLGITGALLSAQPALTGATTDEGSHSRWLRATQFLGYASMLGAALSTGFNL
FT                   SWRVRYALEPAAGASGFGKQNLAVIDTAVVYGVVALAAVLVASRWLLRPTAAEALSTVA
FT                   LGGSTLIAGSIVWSLPIGREIDAFHGIAQNTSTAGVGYEGYLVWAAAAAMCAPLTLFRS
FT                   PNAPPIDKTVWRAASRNGLLLIAVWCLGSVAMRLTDLVVAVLLNYPFSRYDSMALAAFD
FT                   LATAVLAIWLRFNMATEALPARLISSLCGLLCTFTVSRVIVGVVLAPRFQASSGGSAHP
FT                   VYGNDLAQQITSTFDVVLCGLALSILAAAIVIGRLRQLPQPPHTPALSRPAGSPRIFRS
FT                   AGSTHPVRPKIYRPPDHSS"
FT   CDS_pept        660932..662578
FT                   /transl_table=11
FT                   /gene="BCG_0582"
FT                   /locus_tag="BCG_0582"
FT                   /product="Possible conserved membrane protein"
FT                   /note="Differs from Rv0538 by 1aa, P228R"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0582"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70567"
FT                   /db_xref="GOA:A0A0H3M8D6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M8D6"
FT                   /protein_id="CAL70567.1"
FT                   /translation="MDVALGVAVTDRVARLALVDSAAPGTVIDQFVLDVAEHPVEVLTE
FT                   TVVGTDRSLAGENHRLVATRLCWPDQAKADELQHALQDSGVHDVAVISEAQAATALVGA
FT                   AHAGSAVLLVGDETATLSVVGDPDAPPTMVAVAPVAGADATSTVDTLMARLGDQALAPG
FT                   DVFLVGRSAEHTTVLADQLRAASTMRVQTPDDPTFALARGAAMAAGAATMAHPALVADA
FT                   TTSLPPAEAGQSGSEGEQLAYSQASDYELLPVDEYEEHDEYGAAADRSAPLSRRSLLIG
FT                   NAVVAFAVIGFASLAVAVAVTIRPTAASKPVEGHQNAQPGKFMPLLPTQQQAPVPPPPP
FT                   DDPTAGFQGGTIPAVQNVVPRPGTSPGVGGTPASPAPEAPAVPGVVPAPVPIPVPIIIP
FT                   PFPGWQPGMPTIPTAPPTTPVTTSATTPPTTPPTTPVTTPPTTPPTTPVTTPPTTPPTT
FT                   PVTTPPTTVAPTTVAPTTVAPTTVAPTTVAPATATPTTVAPQPTQQPTQQPTQQMPTQQ
FT                   QTVAPQTVAPAPQPPSGGRNGSGGGDLFGGF"
FT   CDS_pept        662635..663267
FT                   /transl_table=11
FT                   /gene="BCG_0583"
FT                   /locus_tag="BCG_0583"
FT                   /product="Probable dolichyl-phosphate sugar synthase"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0583"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70568"
FT                   /db_xref="GOA:A0A0H3M3V2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M3V2"
FT                   /protein_id="CAL70568.1"
FT                   /translation="MLPCLNEEESLPAVLAAIPAGYRALVVDNNSTDDTATVAARHGAQ
FT                   VVVEPRPGYGSAVHAGVLAATTPIVAVIDADGSMDAGDLPKLVAELDKGADLVTGRRRP
FT                   VAGLHWPWVARVGTVVMSWRLRTRHRLPVHDIAPMRVARREALLDLGVVDRRSGYPLEL
FT                   LVRAAAAGWRVVELDVSYGPRTGGKSKVSGSLRGSIIAILDFWKVIS"
FT   CDS_pept        663264..663926
FT                   /transl_table=11
FT                   /gene="BCG_0584"
FT                   /locus_tag="BCG_0584"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0584"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70569"
FT                   /db_xref="InterPro:IPR018641"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAN1"
FT                   /protein_id="CAL70569.1"
FT                   /translation="MSCLPVSVLVVAKAPEPGRVKTRLAAAIGDKVAADIAAAALLDTL
FT                   DAVAAAPVTARAVALTGDLDSAADSAEIRRRLKSFTVFRQRGDAFADRLANAHVDAADG
FT                   YPVLQIGMDTPQVTAELLADCARLLLQIPAVLGLAFDGGWWVLGIRTPTAAECLRAVPM
FT                   SQPDTGELTLKALRDNGIDVTLVQRLGDFDIVDDIALVRDCCAPGSRFAQATRAAGL"
FT   CDS_pept        complement(663947..665296)
FT                   /transl_table=11
FT                   /gene="BCG_0585c"
FT                   /locus_tag="BCG_0585c"
FT                   /product="Probable conserved integral membrane protein"
FT                   /note="Differs from Rv0541c by 1aa, V226I"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0585c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70570"
FT                   /db_xref="GOA:A0A0H3M2I0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2I0"
FT                   /protein_id="CAL70570.1"
FT                   /translation="MRIGRREGLAVAIGFVLVGAAFVLPRLNLGIKPRSDIGLERFATR
FT                   AGAAPIFGYWDAHVGWGTAPAVLTAVAVVAWGPVVAHRLPWRVLTLSTWATAAAWAFSL
FT                   AMIDGWQRGFAGRLTTRDEYLWQVPGIADIPATLRTFTSRILDFQPNSWVTHVSGHPPG
FT                   ALLTFVWLDRIGLRGGGWAGLVCLLVGSSAAAAVLIAVRVLASEQMARRTAPFVAVAPT
FT                   AIWVAVSADGYFAGVAAWGIALLAVAVHGATRFPALVAAGAGLLLGWGVFLNYGLVLIV
FT                   LPGMAVLAAADWRPVLRALGPAVLAALVVAVSFAVAGFSWFDGYTLVQQRYWQGIAKDR
FT                   PFGYWSWANLACVVCAIGLGSVAGLSRVFDRAAISRRSGCHLLLLAVLAAIALADLSML
FT                   SKAETERIWLPFTIWLTAAPALLPPRSHRLWLAVNAAGALLLNSIIFTNW"
FT   CDS_pept        complement(665308..666396)
FT                   /transl_table=11
FT                   /gene="menE"
FT                   /locus_tag="BCG_0586c"
FT                   /product="Possible o-succinylbenzoic acid--CoA ligase menE"
FT                   /EC_number="6.2.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0586c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70571"
FT                   /db_xref="GOA:A0A0H3M1U9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1U9"
FT                   /protein_id="CAL70571.1"
FT                   /translation="MLGGSDPALVAVPTQHESLLGALRVGEQIDDDVALVVTTSGTTGP
FT                   PKGAMLTAAALTASASAAHDRLGGPGSWLLAVPPYHIAGLAVLVRSVIAGSVPVELNVS
FT                   AGFDVTELPNAIKRLGSGRRYTSLVAAQLAKALTDPAATAALAELDAVLIGGGPAPRPI
FT                   LDAAAAAGITVVRTYGMSETSGGCVYDGVPLDGVRLRVLAGGRIAIGGATLAKGYRNPV
FT                   SPDPFAEPGWFHTDDLGALESGDSGVLTVLGRADEAISTGGFTVLPQPVEAALGTHPAV
FT                   RDCAVFGLADDRLGQRVVAAIVVGDGCPPPTLEALRAHVARTLDVTAAPRELHVVNVLP
FT                   RRGIGKVDRAALVRRFAGEADQ"
FT   CDS_pept        complement(666465..666767)
FT                   /transl_table=11
FT                   /gene="BCG_0587c"
FT                   /locus_tag="BCG_0587c"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0587c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70572"
FT                   /db_xref="InterPro:IPR021784"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M8D7"
FT                   /protein_id="CAL70572.1"
FT                   /translation="MNRFLTSIVAWLRAGYPEGIPPTDSFAVLALLCRRLSHDEVKAVA
FT                   NELMRLGDFDQIDIGVVITHFTDELPSPEDVERVRARLAAQGWPLDDVRDREEHA"
FT   CDS_pept        complement(666827..667105)
FT                   /transl_table=11
FT                   /gene="BCG_0588c"
FT                   /locus_tag="BCG_0588c"
FT                   /product="Possible conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0588c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70573"
FT                   /db_xref="GOA:A0A0H3M3V8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M3V8"
FT                   /protein_id="CAL70573.1"
FT                   /translation="MSAWFNYTATLKILIFSLLAGALLPGLFAVGVRLQAAGDGADATA
FT                   RRRPLLVAVSWAIFALVLAVVIIGVLYIARDFIAHHTGWAFLGATPK"
FT   CDS_pept        complement(667102..668355)
FT                   /transl_table=11
FT                   /gene="pitA"
FT                   /locus_tag="BCG_0589c"
FT                   /product="Probable low-affinity inorganic phosphate
FT                   transporter integral membrane protein pitA"
FT                   /note="Differs from Rv0545c by 1aa, S49P"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0589c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70574"
FT                   /db_xref="GOA:A0A0H3MAN4"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAN4"
FT                   /protein_id="CAL70574.1"
FT                   /translation="MNLQLFLLLIVVVTALAFDFTNGFHDTGNAMATSIASGALAPRVA
FT                   VALSAVLNLIGAFLSTAVAATIAKGLIDANLVTLELVFAGLVGGIVWNLLTWLLGIPSS
FT                   SSHALIGGIVGATIAAVGLRGVIWSGVVSKVIVPAVVAALLATLVGAVGTWLVYRTTRG
FT                   VAEKRTERGFRRGQIGSASLVSLAHGTNDAQKTMGVIFLALMSYGAVSTTASVPPLWVI
FT                   VSCAVAMAAGTYLGGWRIIRTLGKGLVEIKPPQGMAAESSSAAVILLSAHFGYALSTTQ
FT                   VATGSVLGSGVGKPGAEVRWGVAGRMVVAWLVTLPLAGLVGAFTYGLVHFIGGYPGAIL
FT                   GFALLWLTATAIWLRSRRAPIDHTNVNADWEGNLTAGLEAGAQPLADQRPPVPAPPAPT
FT                   PPPNHRAPQFGVTTRNAP"
FT   CDS_pept        complement(668475..668861)
FT                   /transl_table=11
FT                   /gene="BCG_0590c"
FT                   /locus_tag="BCG_0590c"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0590c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70575"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2I4"
FT                   /protein_id="CAL70575.1"
FT                   /translation="MEILASRMLLRPADYQRSLSFYRDQIGLAIAREYGAGTVFFAGQS
FT                   LLELAGYGEPDHSRGPFPGALWLQVRDLEATQTELVSRGVSIAREPRREPWGLHEMHVT
FT                   DPDGITLIFVEVPEGHPLRTDTRA"
FT   CDS_pept        complement(668924..669808)
FT                   /transl_table=11
FT                   /gene="BCG_0591c"
FT                   /locus_tag="BCG_0591c"
FT                   /product="Possible oxidoreductase"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0591c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70576"
FT                   /db_xref="GOA:A0A0H3M1V2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1V2"
FT                   /protein_id="CAL70576.1"
FT                   /translation="MSKRPLRWLTEQITLAGMRPPISPQLLINRPAMQPVDLTGKRILL
FT                   TGASSGIGAAATKQFGLHRAVVVAVARRKDLLDAVADRITGDGGTAMSLPCDLSDMEAI
FT                   DALVEDVEKRIGGIDILINNAGRSIRRPLAESLERWHDVERTMVLNYYAPLRLIRGLAP
FT                   GMLERGDGHIINVATWGVLSEASPLFSVYNASKAALSAVSRIIETEWGSQGVHSTTLYY
FT                   PLVATPMIAPTKAYDGLPALTAAEAAEWMVTAARTRPVRIAPRVAVAVNALDSIGPRWV
FT                   NALMQRRNEQLNP"
FT   CDS_pept        complement(669904..670848)
FT                   /transl_table=11
FT                   /gene="menB"
FT                   /locus_tag="BCG_0592c"
FT                   /product="Probable naphthoate synthase menB"
FT                   /EC_number="4.1.3.36"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0592c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70577"
FT                   /db_xref="GOA:A0A0H3M8D9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR010198"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M8D9"
FT                   /protein_id="CAL70577.1"
FT                   /translation="MVAPAGEQGRSSTALSDNPFDAKAWRLVDGFDDLTDITYHRHVDD
FT                   ATVRVAFNRPEVRNAFRPHTVDELYRVLDHARMSPDVGVVLLTGNGPSPKDGGWAFCSG
FT                   GDQRIRGRSGYQYASGDTADTVDVARAGRLHILEVQRLIRFMPKVVICLVNGWAAGGGH
FT                   SLHVVCDLTLASREYARFKQTDADVGSFDGGYGSAYLARQVGQKFAREIFFLGRTYTAE
FT                   QMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRMLKFAFNLLDDGLVGQQLFAGE
FT                   ATRLAYMTDEAVEGRDAFLQKRPPDWSPFPRYF"
FT   CDS_pept        complement(671120..671257)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="BCG_0593c"
FT                   /locus_tag="BCG_0593c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="In Mycobacterium tuberculosis strain H37Rv, Rv0549c
FT                   exists as a single gene. In Mycobacterium bovis BCG
FT                   Pasteur, and Mycobacterium bovis, a frameshift due to a
FT                   single base deletion (t-*), splits Rv0549c into 2 parts"
FT   CDS_pept        complement(671224..671532)
FT                   /transl_table=11
FT                   /gene="BCG_0594c"
FT                   /locus_tag="BCG_0594c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="In Mycobacterium tuberculosis strain H37Rv, Rv0549c
FT                   exists as a single gene. In Mycobacterium bovis BCG
FT                   Pasteur, and Mycobacterium bovis, a frameshift due to a
FT                   single base deletion (t-*), splits Rv0549c into 2 parts"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0594c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70579"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M3W2"
FT                   /protein_id="CAL70579.1"
FT                   /translation="MRASPTSPPEQVVVDASAMVDLLARTSDRCSAVRARLARTAMHAP
FT                   AHFDAEVLSALGRMQRAGALTVAYVDAALEELRQVPVTRHGLSSLLAERGRAATPSA"
FT   CDS_pept        complement(671529..671795)
FT                   /transl_table=11
FT                   /gene="BCG_0595c"
FT                   /locus_tag="BCG_0595c"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0595c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70580"
FT                   /db_xref="InterPro:IPR009956"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAN8"
FT                   /protein_id="CAL70580.1"
FT                   /translation="MLSRRTKTIVVCTLVCMARLNVYVPDELAERARARGLNVSALTQA
FT                   AISAELENSATDAWLEGLEPRSTGARHDDVLGAIDAARDEFEA"
FT   CDS_pept        complement(671987..673702)
FT                   /transl_table=11
FT                   /gene="fadD8"
FT                   /locus_tag="BCG_0596c"
FT                   /product="Probable fatty-acid-CoA ligase fadD8"
FT                   /EC_number="6.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0596c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70581"
FT                   /db_xref="GOA:A0A0H3M2I7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2I7"
FT                   /protein_id="CAL70581.1"
FT                   /translation="MSTAGDDAVGVPPACGGRSDAVGVPQLARESGAMRDQDCSGELLR
FT                   SPTHNGHLLVGALKRHQNKPVLFLGDTRLTGGQLADRISQYIQAFEALGAGTGVAVGLL
FT                   SLNRPEVLMIIGAGQARGYRRTALHPLGSLADHAYVLNDAGISSLIIDPNPMFVERALA
FT                   LLEQVDSLQQILTIGPVPDALKHVAVDLSAEAAKYQPQPLVAADLPPDQVIGLTYTGGT
FT                   TGKPKGVIGTAQSIATMTSIQLAEWEWPANPRFLMCTPLSHAGAAFFTPTVIKGGEMIV
FT                   LAKFDPAEVLRIIEEQRITATMLVPSMLYALLDHPDSHTRDLSSLETVYYGASAINPVR
FT                   LAEAIRRFGPIFAQYYGQSEAPMVITYLAKGDHDEKRLTSCGRPTLFARVALLDEHGKP
FT                   VKQGEVGEICVSGPLLAGGYWNLPDETSRTFKDGWLHTGDLAREDSDGFYYIVDRVKDM
FT                   IVTGGFNVFPREVEDVVAEHPAVAQVCVVGAPDEKWGEAVTAVVVLRSNAARDEPAIEA
FT                   MTAEIQAAVKQRKGSVQAPKRVVVVDSLPLTGLGKPDKKAVRARFWEGAGRAVG"
FT   CDS_pept        673780..675384
FT                   /transl_table=11
FT                   /gene="BCG_0597"
FT                   /locus_tag="BCG_0597"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Differs from Rv0552 and Mb0567 by 1aa, T144I"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0597"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70582"
FT                   /db_xref="GOA:A0A0H3M1V4"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1V4"
FT                   /protein_id="CAL70582.1"
FT                   /translation="MADADLVMTGTVLTVDDARPTAEAIAVADGRVIAVGDRSEVAGLV
FT                   GANTRVIDLGAGCVMPGFVEAHGHPLLEAVVLSDRFVDIRPVTMRDADDVVAAIRGEVA
FT                   RRGPAGAYLVGWDPLLQSGLGEPTLTWLDSLAPNGPLVITHNSGHKAYFNSHAAWLNGL
FT                   TRDTADPKGAKYGRDGNGELDGTAEEIGAILPLLAGVADPSNFGAMLRAECARLNRAGL
FT                   TTCSEMAFDPGYRPMVEAVRAELTVRLCTYEISNARMCTDATPGQGDDMLRQVGIKIWV
FT                   DGSPWVGNIDLTFPYLDTPATRAIGVPPGSRGCANYTREQLAEIVGAYFPRGWQIACHV
FT                   HGDGGVDTILDVYEEALRRNPRDDHRLRLEHVGAIRPDQLRRAAELGVTCSIFVDQIHY
FT                   WGDVIVDDLFGAQRGSRWMPAGSAVAAGMRISLHNDPPVTPEEPLRNISVAATRVAPSG
FT                   RVLAPEERLTVEQAIRAQTIDAAWQLFAEDAIGSLQVGKYADMVVLSADPRTVPPEQIA
FT                   DLAVRATFLAGRQVYRR"
FT   CDS_pept        675381..676361
FT                   /transl_table=11
FT                   /gene="menC"
FT                   /locus_tag="BCG_0598"
FT                   /product="Probable muconate cycloisomerase menC"
FT                   /EC_number="5.5.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0598"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70583"
FT                   /db_xref="GOA:A1KG30"
FT                   /db_xref="InterPro:IPR010196"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="InterPro:IPR041338"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KG30"
FT                   /protein_id="CAL70583.1"
FT                   /translation="MIPVLPPLEALLDRLYVVALPMRVRFRGITTREVALIEGPAGWGE
FT                   FGAFVEYQSAQACAWLASAIETAYCAPPPVRRDRVPINATVPAVAAAQVGEVLARFPGA
FT                   RTAKVKVAEPGQSLADDIERVNAVRELVPMVRVDANGGWGVAEAVAAAAALTADGPLEY
FT                   LEQPCATVAELAELRRRVDVPIAADESIRKAEDPLAVVRAQAADIAVLKVAPLGGISAL
FT                   LDIAARIAVPVVVSSALDSAVGIAAGLTAAAALPELDHACGLGTGGLFEEDVAEPAAPV
FT                   DGFLAVARTTPDPARLQALGAPPQRRQWWIDRVKACYSLLVPSFG"
FT   CDS_pept        676358..677146
FT                   /transl_table=11
FT                   /gene="bpoC"
FT                   /locus_tag="BCG_0599"
FT                   /product="Possible peroxidase bpoC (non-haem peroxidase)"
FT                   /EC_number="1.11.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0599"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70584"
FT                   /db_xref="GOA:A0A0H3M8E0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M8E0"
FT                   /protein_id="CAL70584.1"
FT                   /translation="MINLAYDDNGTGDPVVFIAGRGGAGRTWHPHQVPAFLAAGYRCIT
FT                   FDNRGIGATENAEGFTTQTMVADTAALIETLDIAPARVVGVSMGAFIAQELMVVAPELV
FT                   SSAVLMATRGRLDRARQFFNKAEAELYDSGVQLPPTYDARARLLENFSRKTLNDDVAVG
FT                   DWIAMFSMWPIKSTPGLRCQLDCAPQTNRLPAYRNIAAPVLVIGFADDVVTPPYLGREV
FT                   ADALPNGRYLQIPDAGHLGFFERPEAVNTAMLKFFASVKA"
FT   CDS_pept        677189..678853
FT                   /transl_table=11
FT                   /gene="menD"
FT                   /locus_tag="BCG_0600"
FT                   /product="Probable bifunctional menaquinone biosynthesis
FT                   protein menD"
FT                   /EC_number="4.1.3.-"
FT                   /EC_number="4.1.1.71"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0600"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70585"
FT                   /db_xref="GOA:A1KG32"
FT                   /db_xref="InterPro:IPR004433"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KG32"
FT                   /protein_id="CAL70585.1"
FT                   /translation="MNPSTTQARVVVDELIRGGVRDVVLCPGSRNAPLAFALQDADRSG
FT                   RIRLHVRIDERTAGYLAIGLAIGAGAPVCVAMTSGTAVANLGPAVVEANYARVPLIVLS
FT                   ANRPYELLGTGANQTMEQLGYFGTQVRASISLGLAEDAPERTSALNATWRSATCRVLAA
FT                   ATGARTANAGPVHFDIPLREPLVPDPEPLGAVTPPGRPAGKPWTYTPPVTFDQPLDIDL
FT                   SVDTVVISGHGAGVHPNLAALPTVAEPTAPRSGDNPLHPLALPLLRPQQVIMLGRPTLH
FT                   RPVSVLLADAEVPVFALTTGPRWPDVSGNSQATGTRAVTTGAPRPAWLDRCAAMNRHAI
FT                   AAVREQLAAHPLTTGLHVAAAVSHALRPGDQLVLGASNPVRDVALAGLDTRGIRVRSNR
FT                   GVAGIDGTVSTAIGAALAYEGAHERTGSPDSPPRTIALIGDLTFVHDSSGLLIGPTEPI
FT                   PRSLTIVVSNDNGGGIFELLEQGDPRFSDVSSRIFGTPHDVDVGALCRAYHVESRQIEV
FT                   DELGPTLDQPGAGMRVLEVKADRSSLRQLHAAIKAAL"
FT   CDS_pept        678850..679365
FT                   /transl_table=11
FT                   /gene="BCG_0601"
FT                   /locus_tag="BCG_0601"
FT                   /product="Probable conserved transmembrane protein"
FT                   /note="Differs from Rv0556 by 1aa, R15L"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0601"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70586"
FT                   /db_xref="GOA:A0A0H3M3W5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M3W5"
FT                   /protein_id="CAL70586.1"
FT                   /translation="MISPKPLLHILIHGRSDELPDTRGRIVLRWLRIAVLIVTGLVTLQ
FT                   SVLLVAGAWRNDIAIQRNMGVAQAEVLSAGPRRSTIEFVTPDRITYRPQLGVLYPSELS
FT                   TGMRIYVEYNKRDPNLVRVQHRNAGLAIIPAGSIAVVAWLIAAAALVVLAVLDKRLERR
FT                   ENSASATG"
FT   CDS_pept        679427..680563
FT                   /transl_table=11
FT                   /gene="pimB"
FT                   /locus_tag="BCG_0602"
FT                   /product="Mannosyltransferase pimB"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0602"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70587"
FT                   /db_xref="GOA:A0A0H3MAP2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAP2"
FT                   /protein_id="CAL70587.1"
FT                   /translation="MCGVRVAIVAESFLPQVNGVSNSVVKVLEHLRRTGHEALVIAPDT
FT                   PPGEDRAERLHDGVRVHRVPSRMFPKVTTLPLGVPTFRMLRALRGFDPDVVHLASPALL
FT                   GYGGLHAARRLGVPTVAVYQTDVPGFASSYGIPMTARAAWAWFRHLHRLADRTLAPSTA
FT                   TMESLIAQGIPRVHRWARGVDVQRFAPSARNEVLRRRWSPDGKPIVGFVGRLAPEKHVD
FT                   RLTGLAASGAVRLVIVGDGIDRARLQSAMPTAVFTGARYGKELAEAYASMDVFVHSGEH
FT                   ETFCQVVQEALASGLPVIAPDAGGPRDLITPHRTGLLLPVGEFEHRLPDAVAHLVHERQ
FT                   RYALAARRSVLGRSWPVVCDELLGHYEAVRGRRTTQAA"
FT   CDS_pept        680580..681284
FT                   /transl_table=11
FT                   /gene="menH"
FT                   /locus_tag="BCG_0603"
FT                   /product="Probable ubiquinone/menaquinone biosynthesis
FT                   methyltransferase menH"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0603"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70588"
FT                   /db_xref="GOA:A1KG35"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KG35"
FT                   /protein_id="CAL70588.1"
FT                   /translation="MSRAALDKDPRDVASMFDGVARKYDLTNTVLSLGQDRYWRRATRS
FT                   ALRIGPGQKVLDLAAGTAVSTVELTKSGAWCVAADFSVGMLAAGAARKVPKVAGDATRL
FT                   PFGDDVFDAVTISFGLRNVANQQAALREMARVTRPGGRLLVCEFSTPTNALFATAYKEY
FT                   LMRALPRVARAVSSNPEAYEYLAESIRAWPDQAVLAHQISRAGWSGVRWRNLTGGIVAL
FT                   HAGYKPGKQTPQ"
FT   CDS_pept        complement(681298..681636)
FT                   /transl_table=11
FT                   /gene="BCG_0604c"
FT                   /locus_tag="BCG_0604c"
FT                   /product="Possible conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0604c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70589"
FT                   /db_xref="InterPro:IPR007969"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2J2"
FT                   /protein_id="CAL70589.1"
FT                   /translation="MKGTKLAVVVGMTVAAVSLAAPAQADDYDAPFNNTIHRFGIYGPQ
FT                   DYNAWLAKISCERLSRGVDGDAYKSATFLQRNLPRGTTQGQAFQFLGAAIDHYCPEHVG
FT                   VLQRAGTR"
FT   CDS_pept        complement(681670..682395)
FT                   /transl_table=11
FT                   /gene="BCG_0605c"
FT                   /locus_tag="BCG_0605c"
FT                   /product="POssible benzoquinone methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0605c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70590"
FT                   /db_xref="GOA:A1KG37"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KG37"
FT                   /protein_id="CAL70590.1"
FT                   /translation="MSTVLTYIRAVDIYEHMTESLDLEFESAYRGESVAFGEGVRPPWS
FT                   IGEPQPELAALIVQGKFRGDVLDVGCGEAAISLALAERGHTTVGLDLSPAAVELARHEA
FT                   AKRGLANASFEVADASSFTGYDGRFDTIVDSTLFHSMPVESREGYLQSIVRAAAPGASY
FT                   FVLVFDRAAIPEGPINAVTEDELRAAVSKYWIIDEIKPARLYARFPAGFAGMPALLDIR
FT                   EEPNGLQSIGGWLLSAHLG"
FT   CDS_pept        complement(682420..683646)
FT                   /transl_table=11
FT                   /gene="BCG_0606c"
FT                   /locus_tag="BCG_0606c"
FT                   /product="Possible oxidoreductase"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0606c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70591"
FT                   /db_xref="GOA:A0A0H3M1V6"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1V6"
FT                   /protein_id="CAL70591.1"
FT                   /translation="MSVDDSADVVVVGAGPAGSAAAAWAARAGRDVLVIDTATFPRDKP
FT                   CGDGLTPRAVAELHQLGLGKWLADHIRHRGLRMSGFGGEVEVDWPGPSFPSYGSAVARL
FT                   ELDDRIRKVAEDTGARMLLGAKAVAVHHDSSRRVVSLTLADGTEVGCRQLIVADGARSP
FT                   LGRKLGRRWHRETVYGVAVRGYLSTAYSDDPWLTSHLELRSPDGAVLPGYGWIFPLGNG
FT                   EVNIGVGALSTSRRPADLALRPLISYYTDLRRDEWGFTGQPRAVSSALLPMGGAVSGVA
FT                   GSNWMLIGDAAACVNPLNGEGIDYGLETGRLAAELLDSRDLARLWPSLLADRYGRGFSV
FT                   ARRLALLLTFPRFLPTTGPITMRSTALMNIAVRVMSNLVTDDDRDWVARVWRGGGQLSR
FT                   LVDRRPPFS"
FT   CDS_pept        683662..684669
FT                   /transl_table=11
FT                   /gene="grcC1"
FT                   /locus_tag="BCG_0607"
FT                   /product="Probable polyprenyl-diphosphate synthase grcC1"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0607"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70592"
FT                   /db_xref="GOA:A0A0H3M8E2"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M8E2"
FT                   /protein_id="CAL70592.1"
FT                   /translation="MRTPATVVAGVDLGDAVFAAAVRAGVARVEQLMDTELRQADEVMS
FT                   DSLLHLFNAGGKRFRPLFTVLSAQIGPQPDAAAVTVAGAVIEMIHLATLYHDDVMDEAQ
FT                   VRRGAPSANAQWGNNVAILAGDYLLATASRLVARLGPEAVRIIADTFAQLVTGQMRETR
FT                   GTSENVDSIEQYLKVVQEKTGSLIGAAGRLGGMFSGATDEQVERLSRLGGVVGTAFQIA
FT                   DDIIDIDSESDESGKLPGTDVREGVHTLPMLYALRESGPDCARLRALLNGPVDDDAEVR
FT                   EALTLLRASPGMARAKDVLAQYAAQARHELALLPDVPGRRALAALVDYTVSRHG"
FT   CDS_pept        684770..685630
FT                   /transl_table=11
FT                   /gene="htpX"
FT                   /locus_tag="BCG_0608"
FT                   /product="Probable protease transmembrane protein heat
FT                   shock protein htpX"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0608"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70593"
FT                   /db_xref="GOA:A1KG40"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KG40"
FT                   /protein_id="CAL70593.1"
FT                   /translation="MTWHPHANRLKTFLLLVGMSALIVAVGALFGRTALMLAALFAVGM
FT                   NVYVYFNSDKLALRAMHAQPVSELQAPAMYRIVRELATSAHQPMPRLYISDTAAPNAFA
FT                   TGRNPRNAAVCCTTGILRILNERELRAVLGHELSHVYNRDILISCVAGALAAVITALAN
FT                   MAMWAGMFGGNRDNANPFALLLVALLGPIAATVIRMAVSRSREYQADESGAVLTGDPLA
FT                   LASALRKISGGVQAAPLPPEPQLASQAHLMIANPFRAGERIGSLFSTHPPIEDRIRRLE
FT                   AMARG"
FT   CDS_pept        complement(685815..686840)
FT                   /transl_table=11
FT                   /gene="gpdA1"
FT                   /locus_tag="BCG_0609c"
FT                   /product="Probable glycerol-3-phosphate dehydrogenase
FT                   [nad(p)+] gpdA1"
FT                   /EC_number="1.1.1.94"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0609c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70594"
FT                   /db_xref="GOA:A0A0H3M3X0"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M3X0"
FT                   /protein_id="CAL70594.1"
FT                   /translation="MAANKREPKVVVLGGGSWGTTVASICARRGPTLQWVRSAVTAQDI
FT                   NDNHRNSRYLGNDVVLSDTLRATTDFTEAANCADVVVMGVPSHGFRGVLVELSKELRPW
FT                   VPVVSLVKGLEQGTNMRMSQIIEEVLPGHPAGILAGPNIAREVAEGYAAAAVLAMPDQH
FT                   LATRLSAMFRTRRFRVYTTDDVVGVETAGALKNVFAIAVGMGYSLGIGENTRALVIARA
FT                   LREMTKLGVAMGGKSETFPGLAGLGDLIVTCTSQRSRNRHVGEQLGAGKPIDEIIASMS
FT                   QVAEGVKAAGVVMEFANEFGLNMPIAREVDAVINHGSTVEQAYRGLIAEVPGHEVHGSG
FT                   F"
FT   CDS_pept        complement(686901..688361)
FT                   /transl_table=11
FT                   /gene="BCG_0610c"
FT                   /locus_tag="BCG_0610c"
FT                   /product="Probable monooxygenase"
FT                   /EC_number="1.14.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0610c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70595"
FT                   /db_xref="GOA:A0A0H3MAR0"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAR0"
FT                   /protein_id="CAL70595.1"
FT                   /translation="MSVTPNAGCVDVVIVGAGISGLGAAYRIIERNPQLTYTILERRAR
FT                   IGGTWDLFRYPGVRSDSSIFTLSFPYEPWTREEGIADGAHIREYLTDMAHKYGIDRHIE
FT                   FNSYVRAADWDSSTDTWTVTFEQNGVHKHYRSRFVFFGSGYYNYDEGYTPDFGGIEKFG
FT                   GAVVHPQHWPEDLDYTGKKIVVIGSGATAVTLIPSLTDRAEKVTMLQRSPTYLISASKY
FT                   STFAAVVRKALPPKTSHLIVRMYNALLEAVFWFLSRKTPVFVKWLLRRTAIKNLPEGYD
FT                   IETHFTPRYNPWDQRLCLIPDADLYNAITSGRAEVVTDHIDHFDATGIALKSGGHLDAD
FT                   IIVTATGLQLQALGGAAISLDGVEIDPRDRFVYKAHMLEDVPNLFWCVGYTNASWTLRA
FT                   DMTARATAKLLAHMAAHGHTRAAPHLGDEPMDEKPSWDIQAGYVKRAPYALPKSGTKRP
FT                   WNVRQNYLADAIDYRFDRIEEAMVFGAA"
FT   CDS_pept        complement(688439..688930)
FT                   /transl_table=11
FT                   /gene="BCG_0611c"
FT                   /locus_tag="BCG_0611c"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0611c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70596"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KG43"
FT                   /protein_id="CAL70596.1"
FT                   /translation="MADSSFDIVSKVDRQEVDNALNQAAKELATRFDFRGTDTKIAWKG
FT                   DEAVELTSSTEERVKAAVDVFKEKLIRRDISLKAFEAGEPQASGKTYKVTGALKQGISS
FT                   ENAKKITKLIRDAGPKNVKTQIQGDEVRVTSKKRDDLQAVIAMLKKADLDVALQFVNYR
FT                   "
FT   tRNA            689000..689080
FT                   /gene="tRNA-Tyr"
FT                   /locus_tag="tyrT"
FT                   /product="transfer RNA-Tyr"
FT                   /anticodon="(pos:689034..689036,aa:Tyr)"
FT                   /note="tyrT, len: 81 nt. Equivalent to tyrT, len: 81 nt,
FT                   from Mycobacterium tuberculosis strain H37Rv, (100.0%
FT                   identity in 81 nt overlap). tRNA-Tyr, anticodon gta, length
FT                   = 81"
FT   CDS_pept        689212..690231
FT                   /transl_table=11
FT                   /gene="BCG_0612"
FT                   /locus_tag="BCG_0612"
FT                   /product="Probable methyltransferase/methylase"
FT                   /EC_number="2.1.1.-"
FT                   /note="Differs from Rv0567 by 1aa, L201F"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0612"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70597"
FT                   /db_xref="GOA:A0A0H3M2J6"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031725"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2J6"
FT                   /protein_id="CAL70597.1"
FT                   /translation="MELSPDRIMAIGGGYGPSKVLLTAVGLGLFTELGDEAMTAEAIAD
FT                   RLGLLKRPAIDFLDALVSLDLLARDGDGPGSHYRNTPETAHFLDEARPTYAGGLLKIWN
FT                   ERNYRFWADLTEALKTGKAQSEVKQTGRPFFEALYADPRRLEAFMAAMDAASRRNIELL
FT                   AKRFPFERYRRLCDVGCADGLLSRIVAAAHPHLQCVSLDLPAVTEIARRKLTAEGLGER
FT                   VQACAGDFLADPLPAADVITMGQILHDWNLDRKQQLVAKAYEALSKEGAFIVIETLIDD
FT                   ARRENTTGLMMSLNMLIEFGDAFDYSAADFRGWCGEAGFRSFEVIPLAGGSSAAVAYK"
FT   CDS_pept        690341..691759
FT                   /transl_table=11
FT                   /gene="cyp135B1"
FT                   /locus_tag="BCG_0613"
FT                   /product="Possible cytochrome p450 135b1 cyp135B1"
FT                   /EC_number="1.14.-.-"
FT                   /note="Differs from Rv0568 and Mb0583 by 1aa, E120G"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0613"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70598"
FT                   /db_xref="GOA:A0A0H3M1V8"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1V8"
FT                   /protein_id="CAL70598.1"
FT                   /translation="MSGTSSMGLPPGPRLSGSVQAVLMLRHGLRFLTACQRRYGSVFTL
FT                   HVAGFGHMVYLSDPAAIKTVFAGNPSVFHAGEANSMLAGLLGDSSLLLIDDDVHRDRRR
FT                   LMSPPFHRDAVARQAEPIAEIAAANIAGWPMAKAFAVAPKMSEITLEVILRTVIGASDP
FT                   VRLAALRKVMPRLLNVGPWATLALANPSLLNNRLWSRLRRRIEEADALLYAEIADRRAD
FT                   PDLAARTDTLAMLVRAADEDGRTMTERELRDQLITLLVAGHDTTATGLSWALERLTRHP
FT                   VTLAKAVQAADASAAGDPAGDEYLDAVAKETLRIRPVVYDVGRVLTEAVEVAGYRLPAG
FT                   VMVVPAIGLVHASAQLYPDPERFDPDRMVGATLSPTTWLPFGGGNRRCLGATFAMVEMR
FT                   VVLREILRRVELSTTTTSGERPKLKHVIMVPHRGARIRVRATRDVSATSQATAQGAGCP
FT                   AARGGGPSRAVGSQ"
FT   CDS_pept        691894..692160
FT                   /transl_table=11
FT                   /gene="BCG_0614"
FT                   /locus_tag="BCG_0614"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0614"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70599"
FT                   /db_xref="InterPro:IPR015035"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M8E5"
FT                   /protein_id="CAL70599.1"
FT                   /translation="MKAKVGDWLVIKGATIDQPDHRGLIIEVRSSDGSPPYVVRWLETD
FT                   HVATVIPGPDAVVVTAEEQNAADERAQHRFGAVQSAILHARGT"
FT   CDS_pept        692186..694318
FT                   /transl_table=11
FT                   /gene="nrdZ"
FT                   /locus_tag="BCG_0615"
FT                   /product="Probable ribonucleoside-diphosphate reductase
FT                   (large subunit) nrdZ"
FT                   /EC_number="1.17.4.-"
FT                   /note="In Mycobacterium bovis BCG Pasteur, and
FT                   Mycobacterium bovis, a frameshift due to a single base
FT                   deletion (c-*) leads to a product with a different COOH
FT                   part compared to its homolog in Mycobacterium tuberculosis
FT                   strain H37Rv"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0615"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70600"
FT                   /db_xref="GOA:A0A0H3M3X4"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013344"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M3X4"
FT                   /protein_id="CAL70600.1"
FT                   /translation="MGVSWPAKVRRRDGTLVPFDIARIEAAVTRAAREVACDDPDMPGT
FT                   VAKAVADALGRGIAPVEDIQDCVEARLGEAGLDDVARVYIIYRQRRAELRTAKALLGVR
FT                   DELKLSLAAVTVLRERYLLHDEQGRPAESTGELMDRSARCVAAAEDQYEPGSSRRWAER
FT                   FATLLRNLEFLPNSPTLMNSGTDLGLLAGCFVLPIEDSLQSIFATLGQAAELQRAGGGT
FT                   GYAFSHLRPAGDRVASTGGTASGPVSFLRLYDSAAGVVSMGGRRRGACMAVLDVSHPDI
FT                   CDFVTAKAESPSELPHFNLSVGVTDAFLRAVERNGLHRLVNPRTGKIVARMPAAELFDA
FT                   ICKAAHAGGDPGLVFLDTINRANPVPGRGRIEATNPCGEVPLLPYESCNLGSINLARML
FT                   ADGRVDWDRLEEVAGVAVRFLDDVIDVSRYPFPELGEAARATRKIGLGVMGLAELLAAL
FT                   GIPYDSEEAVRLATRLMRRIQQAAHTASRRLAEERGAFPAFTDSRFARSGPRRNAQVTS
FT                   VAPTGTISLIAGTTAGIEPMFAIAFTRAIVGRHLLEVNPCFDRLARDRGFYRDELIAEI
FT                   AQRGGVRGYPRLPAEVRAAFPTAAEIAPQWHLRMQAAVQRHVEAAVSKTVNLPATGRSM
FT                   TSAPSMWPPGRQRSRASRCIATAAGKDRYCPTPRRNRYWRRLTRSSAAAVRAAPASSDG
FT                   GSHGASRRRIAQNQRF"
FT   CDS_pept        complement(694377..695708)
FT                   /transl_table=11
FT                   /gene="BCG_0616c"
FT                   /locus_tag="BCG_0616c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Differs from Rv0571c and Mb0586c by 1aa, L258F"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0616c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70601"
FT                   /db_xref="GOA:A0A0H3MAR4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAR4"
FT                   /protein_id="CAL70601.1"
FT                   /translation="MKLFDDRGDAGRQLAQRLAQLSGKAVVVLGLPRGGVPVAFEVAKS
FT                   LQAPLDVLVVRKLGVPFQPELAFGAIGEDGVRVLNDDVVRGTHLDAAAMDAVERKQLIE
FT                   LQRRAERFRRGRDRIPLTGRIAVIVDDGIATGATAKAACQVARAHGADKVVLAVPIGPD
FT                   DIVARFAGYADEVVCLATPALFFAVGQGYRNFTQTSDDEVVAFLDRAHRDFAEAGAIDA
FT                   AADPPLRDEEVQVVAGPVPVAGHLTVPEKPRGIVVLAHGSGSSRHSIRNRYVAEVLTGA
FT                   GFATLLFDLLTPEEERNRANVFDIELLASRLIDVTGWLATQPDTASLPVGYFGASTGAG
FT                   AALVAAADPRVNVRAVVSRGGRPDLAGDSLGSVVAPTLLIVGGRDQVVLELNQRAQAVI
FT                   PGKCQLTVVPGATHLFEEPGTLEQVAKLACDWFIDHLCGPGPSG"
FT   CDS_pept        complement(695932..696273)
FT                   /transl_table=11
FT                   /gene="BCG_0617c"
FT                   /locus_tag="BCG_0617c"
FT                   /product="Hypothetical protein"
FT                   /note="Differs from Rv0572c by 1aa, L31F"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0617c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70602"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2K2"
FT                   /protein_id="CAL70602.1"
FT                   /translation="MGEHAIKRHMRQRKPTKHPLAQKRGARILVLTDDPRRSVLIVPGC
FT                   HLDSMRREKNAYYFQDGNALVGMVVSGGTVEYDADDRTYVVQLTDGRHTTESSFEHSSP
FT                   SRSPQSDDL"
FT   CDS_pept        complement(696741..698132)
FT                   /transl_table=11
FT                   /gene="BCG_0618c"
FT                   /locus_tag="BCG_0618c"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0618c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70603"
FT                   /db_xref="GOA:A0A0H3M1W3"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1W3"
FT                   /protein_id="CAL70603.1"
FT                   /translation="MAIRQHVGALFTDLYEVTMAQAYWAERMSGTAVFEIFFRKLPPGR
FT                   SYIMAAGLADVVEFLEAFRFDEQDLRYLRGLGQFSDEFLRWLAGVRFTGDVWAAPEGTV
FT                   IFPNEPAVQLIAPIIEAQLVETFVLNQIHLQSVLASKAARVVAAARGRPVVDFGARRAH
FT                   GTDAACKVARTSYLAGAAGTSNLLAARQYGIPTFGTMAHSFVQAFDSEVAAFEAFARLY
FT                   PATMLLVDTYDTLRGVDHVIELAKRLGNRFDVRAVRLDSGDLDELSKATRARLDTAGLE
FT                   QVEIFASSGLDENRIAALLAARCPIDGFGVGTQLVVAQDAPALDMAYKLVAYDGSGRTK
FT                   FSSGKVIYPGRKQVFRKLEHGVFCGDTLGEHGENLPGDPLLVPIMTNGRRIRQHAPTLD
FT                   GARDWARQQIDALPPELRSLEDTGYSYPVAVSDRIVGELARLRHADTAEAHPGSNVVGA
FT                   KAKRP"
FT   CDS_pept        complement(698142..699284)
FT                   /transl_table=11
FT                   /gene="BCG_0619c"
FT                   /locus_tag="BCG_0619c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Differs from Rv0574c by 1aa, K4N"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0619c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70604"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M8E9"
FT                   /protein_id="CAL70604.1"
FT                   /translation="MAGKPDVVTVLLGGDVMLGRGVDQILPHPGKPQLRERYMRDATGY
FT                   VRLAERVNGRIPLPVDWRWPWGEALAVLENTATDVCLINLETTITADGEFADRKPVCYR
FT                   MHPDNVPALTALRPHVCALANNHILDFGYQGLTDTVAALAGAGIQSVGAGADLLAARRS
FT                   ALVTVGHERRVIVGSVAAESSGVPESWAARRDRPGVWLIRDPAQRDVADDVAAQVLADK
FT                   RPGDIAIVSMHWGSNWGYATAPGDVAFAHRLIDAGIDMVHGHSSHHPRPIEIYRGKPIL
FT                   YGCGDVVDDYEGIGGHESFRSELRLLYLTVTDPASGNLISLQMLPLRVSRMRLQRASQT
FT                   DTEWLRNTIERISRRFGIRVVTRPDNLLEVVPAANLTSKE"
FT   CDS_pept        complement(699500..700636)
FT                   /transl_table=11
FT                   /gene="BCG_0620c"
FT                   /locus_tag="BCG_0620c"
FT                   /product="Possible oxidoreductase"
FT                   /EC_number="1.-.-.-"
FT                   /note="In Mycobacterium bovis BCG Pasteur, and
FT                   Mycobacterium bovis, a frameshift due to a single base
FT                   insertion (*-c) leads to a shorter product with a different
FT                   COOH part compared to its homolog in Mycobacterium
FT                   tuberculosis strain H37Rv"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0620c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70605"
FT                   /db_xref="GOA:A0A0H3M3X8"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M3X8"
FT                   /protein_id="CAL70605.1"
FT                   /translation="MKVAISGAGVAGAALAHWLQRTGHTPTVIERAPKFRTGGYMIDFW
FT                   GVGYQVAKRMGITDQIAAAGYHMEHVRSVGPTGKVKADLGVDVFRRMVGDDFTSLPRGD
FT                   LAAAIYTTIEDQVETIFDDSIATIDEHRDGVRLTFERTAPRDFDLVIGADGLHSNVRRL
FT                   VFGPERDFEHYLGCKVAACVVDGYRPRDERSYVLYNTVDRQLARFALRGDRTMFLFVFR
FT                   AEHDNPGVAPKDELRDQFGDVGWESRDILAALDDVEDLYFDVVSQIRMDRWSRGRVLLI
FT                   GDAAGCISLLGGEGTGLAITEAYVLAGELARAGGDHRRAFDAYEKRLRPFIEGKQASAA
FT                   KFIWFFRHPNPIRPVVSQRCDAHDELRPAGDAVRRQRA"
FT   CDS_pept        700739..702043
FT                   /transl_table=11
FT                   /gene="BCG_0621"
FT                   /locus_tag="BCG_0621"
FT                   /product="Probable transcriptional regulatory protein
FT                   (possibly arsR-family)"
FT                   /note="Differs from Rv0576 by 1aa, H233R"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0621"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70606"
FT                   /db_xref="GOA:A0A0H3MAR6"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR017520"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAR6"
FT                   /protein_id="CAL70606.1"
FT                   /translation="MLEVAAEPTRRRLLQLLAPGERTVTQLASQFTVTRSAISQHLGML
FT                   AEAGLVTARKQGRERYYRLDERGVLRLRALMESFWSDELDRLVADAAHYPPSQGDCAMP
FT                   FEKAVVVPLDPTSTFALITQPDRLRRWMAVAARIELRTGGAYRWTVTPGHSAAGTVIDV
FT                   DPGKRVVFTWGWEDHGDPPPGGSTVTITLTPVDGGTEVRLVHDGLTAQQAARHAKGWNH
FT                   FLDRLVVAGQHGDAGPDEWAAAPDPLDELSCAEATLAVLQHVLRGIGASDLTRQTPCTE
FT                   YDVSQLADHLLRSLAIIGAAAGAQLAPRDVDAPLETQVADAAQAVMEAWRRRGLAGTVE
FT                   LNSNQVPATVPVGILCLEFLVHAWDFAIATGSQVIASEPVSEYVLAVAGKVITPATRNS
FT                   AGFAAPAAVGSFAPVLDRLIAFTGRQPTAGHVSAT"
FT   CDS_pept        702057..702842
FT                   /transl_table=11
FT                   /gene="TB27.3"
FT                   /locus_tag="BCG_0622"
FT                   /product="Conserved hypothetical protein TB27.3"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0622"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70607"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2K7"
FT                   /protein_id="CAL70607.1"
FT                   /translation="MPKRSEYRQGTPNWVDLQTTDQSAAKKFYTSLFGWGYDDNPVPGG
FT                   GGVYSMATLNGEAVAAIAPMPPGAPEGMPPIWNTYIAVDDVDAVVDKVVPGGGQVMMPA
FT                   FDIGDAGRMSFITDPTGAAVGLWQANRHIGATLVNETGTLIWNELLTDKPDLALAFYEA
FT                   VVGLTHSSMEIAAGQNYRVLKAGDAEVGGCMEPPMPGVPNHWHVYFAVDDADATAAKAA
FT                   AAGGQVIAEPADIPSVGRFAVLSDPQGAIFSVLKPAPQQ"
FT   CDS_pept        complement(702887..706798)
FT                   /transl_table=11
FT                   /gene="PE_PGRS7"
FT                   /locus_tag="BCG_0623c"
FT                   /product="PE-PGRS family protein"
FT                   /note="Differs from Rv0578c and from Mb0593c by 3aa, there
FT                   are deleted in Mycobacterium BCG bovis Pasteur"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0623c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70608"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1W6"
FT                   /protein_id="CAL70608.1"
FT                   /translation="MSFVIATPEMLTTAATDLAKIGSTITAANTAAAAVAKVLPASADE
FT                   VSVAVAALFGTHAQEYQTVSAQVATFHDRFVQTLSAAASSYVAAEAVNVEQSLLAAVNA
FT                   PTQALFGRPLIGNGADGSPGTGQAGGPGGILYGNGGNGGSGAPGQRGGAGGAAGLIGNG
FT                   GNGGAGGVGTTGGAGGHGGAGGWLYGNGGAGGFGGAGAVGGNGGAGGTAGLFGVGGAGG
FT                   AGGNGIAGVTGTSASTPGGSGTAGGAGGIGGNGGAGGAGGVLMGNGGNGGAGGEGGPGG
FT                   AGGAGASGAHATNLGADGQAGGNGGNGGAGGTGGVGGPGGGHGLLGLGGSHGAGGAGGS
FT                   GGDGGAPGDGGNGATGTWGHNLGAGGTGGNGGNPGAGGAGGAGGASVGGSAHGANGAPG
FT                   TTSTSGGNGGDGGKGADAISSGQTGANGGRGGDGGQVGNGGAGGAGGRGGAGGLGFGSE
FT                   APGRPGGAGGTGGAGGNGGTQAGDGGTGGAGGAGGDGGSGGAGSIGFNASAPGAAGSPG
FT                   GNGGNGGPGGAGGEGGAGGLALAASGQNGSQGAGGDGGAGGNGGTPGNGGHGAAGALGV
FT                   NGGVGGAGGHGGDPGVGGAGGQGGSGSTPGANGAPGNTPTSGGNGGNGGRGADATGFGQ
FT                   TGASGGRGGDGGLVGNGGAGGAGGNGSKGLPGLGRLGNPGLDGGTGGNGGAGGSGGAWA
FT                   GNGGTGGAGGTGGVGGTGGSGSDGVNGSSAGADGHPGGTGGVGGTGGKGGDGGDGGAAP
FT                   NGVAGSQGPGGAGGDGGTGGVGGNGGRGIDGADGATAGARGQDGGAGGKGGRGGTGGPG
FT                   GAGPAGTTGSQGAGGNGGSGGTGGDPGDGGNGANGSVFTNNGIGGNGGNGGNAGPSGAG
FT                   GSGGAGSTFGATGSSSSIHVNGGNGGNGGNGDHALSGNGAAGGNGGNGGNGSLRGSGGA
FT                   GGHGGNGGNASRGMGGDGGTGGAGGNAGQIGNGGAGGNGGDGGTGSDGNPGAITGSGGR
FT                   GGDGGVGGQGGSVAGDGADGGRGGAGGTGGTGLRGTTGATGATGTFDAGADGHGGNGGT
FT                   GGVGGTGGAGGGGGNGGAGGKALSPTGNNGSQGAGGDGGAGGAGGTGGTGGDGGRGAHG
FT                   TLFSSLAGTGGTGGNGGTGGTGGTGGAGGAGGTGSTLGATGATGAAGRAGNGGVGGSGG
FT                   LGSAFGPGGTGGMGGAGGTSTVSAGGDGGRGGFGGDGLDASSGGNGGDGGHGGDGFRTA
FT                   GAGGRGGDGGKGADPGGLFPIPGAGGKGGTGGTGGTAHLGPLAIIGQSGQPGQFGSPGA
FT                   DGRGGAGGAGGGGGAGGSF"
FT   CDS_pept        707120..707878
FT                   /transl_table=11
FT                   /gene="BCG_0624"
FT                   /locus_tag="BCG_0624"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0624"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70609"
FT                   /db_xref="InterPro:IPR002782"
FT                   /db_xref="InterPro:IPR027798"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M8F0"
FT                   /protein_id="CAL70609.1"
FT                   /translation="MVGYVDVRAYAELNEFVELQARGLTVRRPFRSHQTVKDVLEAMGI
FT                   PHTEVDLILVNGDPADFSYRPVAGDRIAAYPMFEALDIGSTARLRPAPLRNPRFVVDVN
FT                   LGQLARLLRLLGFDTRWSSAADDPTLADISLGEQRILLTRDRGLLKRRAITHGLFVHSQ
FT                   HPEEQALEVLRRLDLNGRLAPLSRCLRCNGELAAVSKDEVIGQLEPLTRRYYESFSRCF
FT                   GCGRIYWPGSHHARLVRLVERLRDQLTTST"
FT   CDS_pept        complement(708007..708498)
FT                   /transl_table=11
FT                   /gene="BCG_0625c"
FT                   /locus_tag="BCG_0625c"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0625c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70610"
FT                   /db_xref="InterPro:IPR016791"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M3Y3"
FT                   /protein_id="CAL70610.1"
FT                   /translation="MTDQSYAVDIAHPPAALLRLVNPILRSLLHTPLAGPLRTQLMVVS
FT                   FTGRKTGRHFSIPLSAHVIDNDLYALTEAGWKHNFSDGAAAQVVYDGKTTAMRGELIRD
FT                   RAVVSELFLRAAQAYGVKRGQRMLGLSFRDRRIPTLEEFAEAVDRLKLVAIRLTPADNS
FT                   "
FT   CDS_pept        708592..708807
FT                   /transl_table=11
FT                   /gene="BCG_0626"
FT                   /locus_tag="BCG_0626"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0626"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70611"
FT                   /db_xref="GOA:A0A0H3MAR9"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAR9"
FT                   /protein_id="CAL70611.1"
FT                   /translation="MDKTTVYLPDELKAAVKRAARQRGVSEAQVIRESIRAAVGGAKPP
FT                   PRGGLYAGSEPIARRVDELLAGFGER"
FT   CDS_pept        708804..709211
FT                   /transl_table=11
FT                   /gene="BCG_0627"
FT                   /locus_tag="BCG_0627"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0627"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70612"
FT                   /db_xref="GOA:A0A0H3M2K9"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2K9"
FT                   /protein_id="CAL70612.1"
FT                   /translation="MIIDTSALLAYFDAAEPDHAAVSECIDSSADALVVSPYVVAELDY
FT                   LVATRVGVDAELAVLRELAGGAWELANCGAAEIEQAARIVTKYQDQRIGIADAANVVLA
FT                   DRYRTRTILTLDRRHFSALRPIGGGRFTVIP"
FT   CDS_pept        complement(709271..709957)
FT                   /transl_table=11
FT                   /gene="lpqN"
FT                   /locus_tag="BCG_0628c"
FT                   /product="Probable conserved lipoprotein lpqN"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0628c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70613"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="InterPro:IPR019674"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1X0"
FT                   /protein_id="CAL70613.1"
FT                   /translation="MKHFTAAVATVALSLALAGCSFNIKTDSAPTTSPTTTSPTTSTTT
FT                   TSATTSAQAAGPNYTIADYIRDNHIQETPVHHGDPGSPTIDLPVPDDWRLLPESSRAPY
FT                   GGIVYTQPADPNDPPTIVAILSKLTGDIDPAKVLQFAPGELKNLPGFQGSGDGSAATLG
FT                   GFSAWQLGGSYSKNGKLRTVAQKTVVIPSQGAVFVLQLNADALDDETMTLMDAANVIDE
FT                   QTTITP"
FT   CDS_pept        710111..712744
FT                   /transl_table=11
FT                   /gene="BCG_0629"
FT                   /locus_tag="BCG_0629"
FT                   /product="Possible conserved exported protein"
FT                   /note="Differs from Rv0584 by 1aa G90D"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0629"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70614"
FT                   /db_xref="GOA:A0A0H3M8F2"
FT                   /db_xref="InterPro:IPR005887"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012939"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR041371"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M8F2"
FT                   /protein_id="CAL70614.1"
FT                   /translation="MRARRLRRALAALLAVAGLFVPFIVGVPTAYDGEPVFVAIPVEHV
FT                   NTLIGTGTGAAIVGEINNFPGASVPFGMVQYSPDTVDNYAGYDYGNPHSTGFSMTHASV
FT                   GCPAFGDISMLPTTTPLGSQPWSAWEEIAHDDTEVGVPGYYTVRFPGTGVIAELTATTR
FT                   TGVGRFRYPRNGWPALFHVRSGASLAGNYAATLQIEDNTTITGSATSGGFCGKKNLYTV
FT                   YFAMKFSQPFSSYGTWDGYAVYPGSHSMNSSYSGGYVGFPAGSVLEVRTALSYVSVDGA
FT                   RANLDAEGGASFDDIRAATSSEWNAALSRIAVAGRGPGDVDTFYTCLYRSLLHPNTFND
FT                   VDGRYIGFDGVIHSVASGHTHYANFSDWDTYRSLAPLQGLLFPQRASDMIQSLVTDAEQ
FT                   SGAYPRWALANSATGMMSGDSVVPLIVNLYAFGARDFDLKSALHYMVNAATQGGVGLDG
FT                   FLERPGIAAYLRLGYGPQTAEFRANGRIAGASVTLEWSVDDFAISRFADSLGDTATAAV
FT                   FQNRSQYWQNLFNPTTGYISPRSAAGFFPDGPGFVAYPSGFGQDGYDEGNAEQYLWWVP
FT                   HNVAGLVTALGGRTAVVKRLDRFTKKLNVGPNEPYLWAGNEPGFGVPWLYNYIGQPWKT
FT                   QRTVDRVRGLFGPTPGGAPGNDDLGALSSWYVWAALGLYPSTPGTTILTVNTPLFDRAV
FT                   IALPTGKSIQITAPGASGRNRLKYIDGLTIDRQPSNQTFLPESIVRTGGDLTFSLAGTP
FT                   NKVWGTAASAAPPSFGAGSSAVTVNIARPIIGIVPGATGTVTVDAQRMIDGVDDYTVTP
FT                   TSYVVGIAAEPLSGQFDDDGAVSASVAITVARSVPSGYYPIYVTTSAGDSARTLIVLVV
FT                   VAEAVE"
FT   CDS_pept        complement(712767..715154)
FT                   /transl_table=11
FT                   /gene="BCG_0630c"
FT                   /locus_tag="BCG_0630c"
FT                   /product="Probable conserved integral membrane protein"
FT                   /note="Differs from Rv0585c by 1aa V438I and from Mb0600c
FT                   by 2aa M150I and V438I"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0630c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70615"
FT                   /db_xref="GOA:A0A0H3M3Z0"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M3Z0"
FT                   /protein_id="CAL70615.1"
FT                   /translation="MRVDGRDIGVSGNLLQPLTRRTNDIIRAVLAAIYLVAVITSSLIT
FT                   RPQWVALEKSISEIVGVLSPSQSDLVYLGYGLAILALPFVILIGLIVSRQWKLLGAYAA
FT                   AGLMAVLPLSISSSRIAAPRWHFDLSDRLATLLAQFLDDPRWIAMLAAVLTVSGPWLPA
FT                   RWRHWWWALLLAFVPIHLVVSAIVPARSLLGLAVGWLVGALVVLVVGTPALEVPLDGAI
FT                   RALAKRGFAVSGLAVVRPAGPGPLVLSAACEQPNAGACSEALIELYGPHQSGGGALRQL
FT                   WLKLTLRGTETAPLQASMRRAVEHRALMAIAFGDLGMANTTVIAVSPLDRGWTLYAHRP
FT                   ARGIGISECTKTTPTAHVWEALRTLHDQQISHGDLCSAEITVDNGAVLFGGFGEAEYGA
FT                   TDAQLQSDLAQLLVTTSALYDAEAAVTAAIDTFGKQAVLAASRRLTKSAVPKRIRESIT
FT                   DPNAVIASTRAEVMRQTGADQIKAETITRFSRGQLIQLVLIGALVYVAYPFISTVPTFF
FT                   SQLRTANWWWALLGLAVSALTYVGAAAALWACADGLVGFWKLSIMQVANTFAATTTPAG
FT                   VGGLALSTRFLQKGGLTAVRATAAVALQQSVQVIVHLVLLILFSALAGTSTDLSHFVPN
FT                   ATVLYLIAGVALGIVGTFLFVPKLRRWLATAVRPKLREVTNDLIALAREPKRLALIVLG
FT                   CAGTTLGAALALWASIEAFGGGTTFVTVTVVTMVGGTLASAAPTPGGVGAVEAALIGGL
FT                   AAFGVPAALGVPSVLLYRLLTCWLPVFAGWQVMHWLTRHEMI"
FT   CDS_pept        715292..716014
FT                   /transl_table=11
FT                   /gene="BCG_0631"
FT                   /locus_tag="BCG_0631"
FT                   /product="Probable transcriptional regulatory protein
FT                   (gntR-family)"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0631"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70616"
FT                   /db_xref="GOA:A0A0H3MAS1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAS1"
FT                   /protein_id="CAL70616.1"
FT                   /translation="MALQPVTRRSVPEEVFEQIATDVLTGEMPPGEALPSERRLAELLG
FT                   VSRPAVREALKRLSAAGLVEVRQGDVTTVRDFRRHAGLDLLPRLLFRNGELDISVVRSI
FT                   LEARLRNFPKVAELAAERNEPELAELLQDSLRALDTEEDPIVWQRHTLDFWDHVVDSAG
FT                   SIVDRLMYNAFRAAYEPTLAALTTTMTAAAKRPSDYRKLADAICSGDPTGAKKAAQDLL
FT                   ELANTSLMAVLVSQASRQ"
FT   CDS_pept        716011..716808
FT                   /transl_table=11
FT                   /gene="yrbE2A"
FT                   /locus_tag="BCG_0632"
FT                   /product="Conserved hypothetical integral membrane protein
FT                   yrbE2A"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0632"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70617"
FT                   /db_xref="GOA:A0A0H3M2L4"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2L4"
FT                   /protein_id="CAL70617.1"
FT                   /translation="MTTHAVIITYLRDQTQPAVDAIGGFYRTCVLTGKALVRRPFHWRE
FT                   AIEQGWFITSVSLLPTLAVSIPLTVLIIFTLNILLAEFGAADISGAGAALGAVTQLGPL
FT                   TTVLVIAGAGATAICADLGARTIREEIDAMEVLGIDPIHRLVVPRVVAATIVAALLNGA
FT                   VITIGLVGGFVFSVFIQHVSAGAYVGTLTLVTGLPEVIISVVKSATFGLIAGLVGCYRG
FT                   LTTKGGPKGVGTAVNETLVLCVIALFATNVVLTTIGVRFGTGH"
FT   CDS_pept        716810..717697
FT                   /transl_table=11
FT                   /gene="yrbE2B"
FT                   /locus_tag="BCG_0633"
FT                   /product="Conserved hypothetical integral membrane protein
FT                   yrbE2B"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0633"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70618"
FT                   /db_xref="GOA:A0A0H3M1Y5"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1Y5"
FT                   /protein_id="CAL70618.1"
FT                   /translation="MVESSTASAAAVLRARYPRTAASLDRYGGGTARRLERTGTFARFT
FT                   RISVVQIGWALRRYRRETLRLVAEIGMGTGAMAVVGGTVAIIGFVTLSGGSLIAIQGFA
FT                   SLGNIGVEAFTGFFAALANTRVAAPIVSGVALAATVGAGATAQLGAMRISEEIDALEVM
FT                   GIKSISFLVSTRILGGLVVIMPLYALALDMAFTSGQVVTTVFYGQSNGTYEHYFRTFLR
FT                   PEDVGWSVVEVVIIAVVVMITHCYYGYTASGGPVGVGQAVGRSMRFSLVSVVVVVLLAE
FT                   LALYGVDPNFNLTV"
FT   CDS_pept        717703..718917
FT                   /transl_table=11
FT                   /gene="mce2A"
FT                   /locus_tag="BCG_0634"
FT                   /product="mce-family protein mce2A"
FT                   /note="Differs from Rv0589 by 1aa S51F"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0634"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70619"
FT                   /db_xref="GOA:A0A0H3M8F7"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M8F7"
FT                   /protein_id="CAL70619.1"
FT                   /translation="MPTLVTRKNRRAWLYVEGVVLLLVGALVLVLVYKQFRGEFTPKTE
FT                   LTMVASRAGLVMEAGSKVTYNGVEIGRVGSISEIERDGRPAAKLVLDVNPRYISLIPVN
FT                   VVADIEAATLFGNKYVALSAPKIPQQQRISSHDVIDVGSVTTEFNTLFETITSIAEKVD
FT                   PIELNATLSAVAQAPDGLGGKFGESIVNGNQILAQLNPRLPQLGYDVRRLADLGEVYVD
FT                   ASPDLWSFLQNALTTARTLTSQQRDLDAALLAATGAGNTGEDVFARGGPYLARAAADLV
FT                   PTATLLDTYSPELFCMIRNFHDAAPKVADAVGGNGYSLAAAGTILGAPNPYVYPDNLPR
FT                   VNAHGGPGGRPGCWQTITRELWPAPYLVMDTGASLAPYNHVELGQPMFTEYVWGRQYGE
FT                   NTINP"
FT   CDS_pept        718914..719945
FT                   /transl_table=11
FT                   /gene="mce2B"
FT                   /locus_tag="BCG_0635"
FT                   /product="mce-family protein mce2B"
FT                   /note="In Mycobacterium tuberculosis strain H37Rv, mce2B
FT                   and Rv0590A are 2 genes, most likely to be linked. In
FT                   Mycobacterium bovis and Mycobacterium bovis BCG Pasteur, an
FT                   in-frame insertion of a single base (*-g) leads to a single
FT                   product"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0635"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70620"
FT                   /db_xref="GOA:A0A0H3M3Z7"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M3Z7"
FT                   /protein_id="CAL70620.1"
FT                   /translation="MKTTGTTIKLGIVWLVLSVFTVMIIVVFGQVRFHHTTGYSAVFTH
FT                   VSGLRAGQFVRAAGVEVGKVAKVTLIDGDKQVLVDFTVDRSLSLDQATTASIRYLNLIG
FT                   DRYLELGRGHSGQRLAPGATIPLEHTHPALDLDALLGGFRPLFQTLDPDKVNSIASSII
FT                   TVFQGQGATINDILDQTASLTATLADRDHAIGEVVNNLNTVLATTVKHQTEFDRTVDKL
FT                   EVLITGLKNRADPLAAAAAHISSAAGTLADLLGADRPLLHSSFGHLEGIQQPLIDELAE
FT                   LDHVLGKLPDAYRIIGRAGGIYGDFFNFYLCDISLKVNGLQPGGPVRTVKLFGQPTGRC
FT                   TPQ"
FT   CDS_pept        719942..721387
FT                   /transl_table=11
FT                   /gene="mce2C"
FT                   /locus_tag="BCG_0636"
FT                   /product="mce-family protein mce2C"
FT                   /note="Differs from Rv0591 by 2aa M49T and N398T"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0636"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70621"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAS2"
FT                   /protein_id="CAL70621.1"
FT                   /translation="MRTLTEFNRGRVGMMGAVVTVLVVGVAQSFTSVPMLFATPTYYAQ
FT                   FADMGGINTGDKVEIAGVNVGLVRSLAIRGNRVLIGFSLPGKTIGMQSRAAIRTDTILG
FT                   RKNLEIEPRGSEPLKPNGFLPLAQTTTPYQIYDAFVDVTKAATGWDIDAVKRSLNVLSE
FT                   TFDQTAPHLSAALEGVKAFSDTVGRRGEQIEQLLANANRIARVLGDRSEQVNGLLVNAK
FT                   TLLAAFKQRSQALRILLTNVSEASAQVSGLITDNPNLNHVLAQLRTVSEELVKRKNELA
FT                   DVAVLLGRYTAALTEAVGSGPFFKAMVVNLLPYQILQPWVDAAFKKRGIDPENFWRSAG
FT                   LPEFRWPDPNGTRFPNGAPPAAPPVREGTPKHPGPAVPPGTPCSYTPAAGALPRPDNPL
FT                   PCAGATVGPFGGPDFPAPLDVQPSPPNPDGPPPTPGILSAGRPGEPAPAVPGIPMPLPP
FT                   NAPPGARTQPLEPFPDGTGGSNQ"
FT   CDS_pept        721384..722934
FT                   /transl_table=11
FT                   /gene="mce2Da"
FT                   /locus_tag="BCG_0637"
FT                   /product="mce-family protein mce2Da [first part]"
FT                   /note="In Mycobacterium tuberculosis strain H37Rv, mce2D
FT                   exists as a single gene. In Mycobacterium bovis and
FT                   Mycobacterium bovis BCG Pasteur, a frameshift occurs in a
FT                   strech of C (7 for H37Rv, 8 for Mycobactrium bovis and 9
FT                   for Mycobacterium bovis BCG). This leads to mceDa genes
FT                   with different COOH parts and a remnant mc2Db pseudogene"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0637"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70622"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2L7"
FT                   /protein_id="CAL70622.1"
FT                   /translation="MSTIFDIRSLRLPKLSAKVVVVGGLVVVLAVVAAAAGARLYRKLT
FT                   TTTVVAYFSEALALYPGDKVQIMGVRVGSIDKIEPAGDKMRVTLHYSNKYQVPATATAS
FT                   ILNPSLVASRTIQLSPPYTGGPVLQDGAVIPIERTQVPVEWDQLRDSINGILRQLGPTE
FT                   RQPKGPFGDLIESAADNLAGKGRQLNETLNSLSQALTALNEGRGDFVAITRSLALFVSA
FT                   LYQNDQQFVALNENLAEFTDWFTKSDHDLADTVERIDDVLGTVRKFVSDNRSVLAADVN
FT                   NLADATTTLVQPEPRDGLETALHVLPTYASNFNNLYYPLHSSLVGQFVFPNFANPIQLI
FT                   CSAIQAGSRLGYQESAELCAQYLAPVLDALKFNYLPFGSNPFSSAATLPKEVAYSEERL
FT                   RPPPGYKDTTVPGIFSRDTPFSHGNHEPGWVVAPGMQGMQVQPFTANMLTPESLAELLG
FT                   GPDIAPPRRREPTCPDRRMRMTSPIRCRRRGTRSPRPSRLRAPQDSQARASEVRRERG"
FT   CDS_pept        722772..722912
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="mce2Db"
FT                   /locus_tag="BCG_0638"
FT                   /product="mce-family protein mce2Db [second part]"
FT                   /note="In Mycobacterium tuberculosis strain H37Rv, mce2D
FT                   exists as a single gene. In Mycobacterium bovis and
FT                   Mycobacterium bovis BCG Pasteur, a frameshift occurs in a
FT                   strech of C (7 for H37Rv, 8 for Mycobactrium bovis and 9
FT                   for Mycobacterium bovis BCG). This leads to mceDa gene with
FT                   different COOH parts and a remnant mc2Db pseudogene"
FT   CDS_pept        722909..724117
FT                   /transl_table=11
FT                   /gene="lprL"
FT                   /locus_tag="BCG_0639"
FT                   /product="Possible mce-family lipoprotein lprL"
FT                   /note="In Mycobacterium bovis, a single base transition
FT                   (c-t) introducing a stop codon, leads to the formation of a
FT                   truncated product compared to its homolog in Mycobacterium
FT                   tuberculosis strain H37Rv and Mycobacterium bovis BCG
FT                   Pasteur (188 aa versus 402 aa)"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0639"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70624"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1Z7"
FT                   /protein_id="CAL70624.1"
FT                   /translation="MRCGVSAGSANGKPNRWTLRCGVSAGHRGSVFLLAVLLAPVVLTS
FT                   CTWRGIANVPLPVGRGMGPDRMTIYVQMPDTLALNTNSRVRVADVWVGTVRDISLRNWI
FT                   ATLTLELEPTVRLPANATAKIGQTSLLGTQHVELAAPPIPSPQPLKSGDTIGLKNSSAY
FT                   PTVERTLASVALILTGGGIVNLDVIQTEILNILDGHAGQIREFLERLATFTAELNNQRG
FT                   DLTRAIDSTNQLLTIIANRNDTLDRVLTDVPPLIEHFADTGQLFADATESLGRFSEVAN
FT                   RALAATRPNLHQTLQSLQRPLRQLERASPYVVGALKLGLTAPFNIDEVPNVIRGDYVNV
FT                   SATFDVTLSALDNALLSGTGISGMLRALEQAWGRDPDTMIPDVRYTPNPNDAPGGPLVE
FT                   RAE"
FT   CDS_pept        724122..725672
FT                   /transl_table=11
FT                   /gene="mce2F"
FT                   /locus_tag="BCG_0640"
FT                   /product="mce-family protein mce2F"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0640"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70625"
FT                   /db_xref="GOA:A0A0H3M8G0"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M8G0"
FT                   /protein_id="CAL70625.1"
FT                   /translation="MLTRAIKTQLVLLTVLAVIAVVVLGWYFLRIPSLVGIGRYTLYAE
FT                   LPRSGGLYRTANVTYRGITIGKVTGVEPTERGARATMSIDNGYQIPTDASANVHSVSAV
FT                   GEQFVDLVSTRTSGPYLRHGQTITTTTVPSQIGPALDAANRGLAVLPKDRVASVLHEAS
FT                   EAVGGLGSSLNRLIEATQAIAHDVRGSLEDIDDIIERSAPIIDSQVNSGNEIARWAANL
FT                   NTLAAQTAQTDPAVRSILANAAPTADQVNATFSDVRESLPQTLANLEVVIDMLKRYHNG
FT                   VEQALVFLPQSGAIAQSVTTEFPGQAGLGVGGLALNQPPPCLTGFLPASEWRSPADTST
FT                   APLPKGTYCRIPMDASNVVRGARNNPCVDVPGKRAATPRECRSNEAYVPGGTNPWYGDP
FT                   NQMLSCPAPAARCDQPVKPGQVIPAPSVNNGINPLPADQLPGTPPPVNDPLQRPGSGTV
FT                   QCNGQQPNPCVYTPSTFPTTIYDVQSGKVVAPDGVVYSVEASTHAGADGWKVMLAPTG"
FT   CDS_pept        complement(725724..726116)
FT                   /transl_table=11
FT                   /gene="BCG_0641c"
FT                   /locus_tag="BCG_0641c"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0641c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70626"
FT                   /db_xref="GOA:A0A0H3M402"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M402"
FT                   /protein_id="CAL70626.1"
FT                   /translation="MNVRRALADTSVFIGIEATRFDPDRFAGYEWGVSVVTLGELRLGV
FT                   LQASGPEAAARRLSTYQLAQRFEPLGIDEAVSEAWALLVSKLRAAKLRVPINDSWIAAT
FT                   AVAHGIAILTQDNDYAAMPDVEVITI"
FT   CDS_pept        complement(726113..726370)
FT                   /transl_table=11
FT                   /gene="BCG_0642c"
FT                   /locus_tag="BCG_0642c"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0642c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70627"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAS5"
FT                   /protein_id="CAL70627.1"
FT                   /translation="MSATIPARDLRNHTAEVLRRVAAGEEIEVLKDNRPVARIVPLKRR
FT                   RQWLPAAEVIGELVRLGPDTTNLGEELRETLTQTTDDVRW"
FT   CDS_pept        complement(726553..727788)
FT                   /transl_table=11
FT                   /gene="BCG_0643c"
FT                   /locus_tag="BCG_0643c"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0643c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70628"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2M1"
FT                   /protein_id="CAL70628.1"
FT                   /translation="MGVVERAIAPSVLAALADTPVVVVNGARQVGKTTLVARLDYPGSS
FT                   EVVSLDDVANRDAARDDPRAFVSRPVDTLVIDEAQLEPGLFRAIKAEVDRDRRPGRFLL
FT                   TGSARLLSAPDMADALVGRVEIIELWPFSQGERAGIADGFVDALFTAPRELIHGSDMRR
FT                   ADLVDRIATGGFPDIVARSPSRRRAWFDNYLTTATQSVIREISPIERLAEMPRVLRLCA
FT                   ARTGAELNVSALANDLSIPARTTAGYLALLEAAFLIHRVPAWSTNLSRKVIRRPKLVVS
FT                   DSGLACHLLGVTGATLDRPGRPLGPLLETFVANEIRKQLTWSTERPSLWHFRDRGGAEV
FT                   DLVLEHPDGRVCGIEVKATSTPRAEDLRGLRYLAERLDDRFQFGVLLTAAPEATPFGPT
FT                   LAALPVSTLWAG"
FT   CDS_pept        complement(728039..728452)
FT                   /transl_table=11
FT                   /gene="BCG_0644c"
FT                   /locus_tag="BCG_0644c"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0644c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70629"
FT                   /db_xref="GOA:A0A0H3M200"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M200"
FT                   /protein_id="CAL70629.1"
FT                   /translation="MKPPLAVDTSVAIPLLVRTHTAHAAVVAWWAHREAALCGHALAET
FT                   YSVLTRLPRDLRLAPMDAARLLTERFAAPLLLSSRTTEHLPRVLAQFEITGGAVYDALV
FT                   ALAAAEHRAELATRDARAKDTYEKIGVHVVVAA"
FT   CDS_pept        complement(728449..728685)
FT                   /transl_table=11
FT                   /gene="BCG_0645c"
FT                   /locus_tag="BCG_0645c"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0645c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70630"
FT                   /db_xref="GOA:A0A0H3M8G3"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M8G3"
FT                   /protein_id="CAL70630.1"
FT                   /translation="MKAVVDAAGRIVVPKPLREALGLQPGSTVEISRYGAGLHLIPTGR
FT                   TARLEEENGVLVATGETTIDDEVVFGLIDSGRK"
FT   CDS_pept        complement(728789..729295)
FT                   /transl_table=11
FT                   /gene="BCG_0646c"
FT                   /locus_tag="BCG_0646c"
FT                   /product="Probable two component sensor kinase [second
FT                   part]"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0646c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70631"
FT                   /db_xref="GOA:A0A0H3M408"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M408"
FT                   /protein_id="CAL70631.1"
FT                   /translation="MPITPLLHESVARFAATGADITTRAEPDLFVSIDPDHLRRILTAV
FT                   LDNAITHGDGEIAVTAHARDGAVDIGVRDHGPGFADHFLPVAFDRFTRADTARGGRGSG
FT                   LGLAIVAALTTTHGGHANATNHPDGGAELRITLPTPRPPFHEELPRITSSDTKDPNREH
FT                   DTSDQ"
FT   CDS_pept        complement(729409..729879)
FT                   /transl_table=11
FT                   /gene="BCG_0647c"
FT                   /locus_tag="BCG_0647c"
FT                   /product="Probable two component sensor kinase (first
FT                   part)"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0647c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70632"
FT                   /db_xref="GOA:A0A0H3MAS7"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAS7"
FT                   /protein_id="CAL70632.1"
FT                   /translation="MALVLAAAGAVTVVQFRDAAHEADPDGALRGLTDDITADLVRELV
FT                   TILPIVLVIAAVAAYLLSRAALRPVDRIRAAAQTLTTTPHPDTDAPLPVPPTDDEIAWL
FT                   ATTLNTMLTRLQRALAHEQQFVADASHELRTPLALLTTELELRCAGPDPPTS"
FT   CDS_pept        complement(729923..730684)
FT                   /transl_table=11
FT                   /gene="tcrA"
FT                   /locus_tag="BCG_0648c"
FT                   /product="Putative two component DNA binding
FT                   Transcriptional regulatory protein tcrA"
FT                   /note="Differs from Rv0602c by 1aa I28V"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0648c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70633"
FT                   /db_xref="GOA:A0A0H3M2M6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2M6"
FT                   /protein_id="CAL70633.1"
FT                   /translation="MADETTMRAGRGPGRACGRVSGVRILVIEDEPKMTALLARALTEE
FT                   GHTVDTVADGRHAVAAVDGGDYDAVVLDVMLPGIDGFEVCARLRRQRVWTPVLMLTARG
FT                   AVTDRIAGLDGGADDYLTKPFNLDELFARLRALSRRGPIPRPPTLEAGDLRLDPSEHRV
FT                   WRADTEIRLSHKEFTLLEALIRRPGIVHTRAQLLERCWDAAYEARSNIVDVYIRYLRDK
FT                   IDRPFGVTSLETIRGAGYRLRKDGGRHALPR"
FT   CDS_pept        730741..731052
FT                   /transl_table=11
FT                   /gene="BCG_0649"
FT                   /locus_tag="BCG_0649"
FT                   /product="Possible exported protein"
FT                   /note="Differs from Mb0619 by 2aa P77A and E96K"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0649"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70634"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M203"
FT                   /protein_id="CAL70634.1"
FT                   /translation="MNRIVQFGVSAVAAAAIGIGAGSGIAAAFDGEDEVTGPDADRARA
FT                   AAVQAVPGGTAGEVETETGEGAAAYGVLVTRPDGTRVEVHLDRDFRVLDTEPADGDGG"
FT   CDS_pept        731124..732074
FT                   /transl_table=11
FT                   /gene="lpqO"
FT                   /locus_tag="BCG_0650"
FT                   /product="Probable conserved lipoprotein lpqO"
FT                   /note="Differs from Rv0604 by 1aa P180S"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0650"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70635"
FT                   /db_xref="InterPro:IPR011094"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M8G7"
FT                   /protein_id="CAL70635.1"
FT                   /translation="MIRRRGARMAALLAAAALALTACAGSDDKGEPDDGGDRGASLATT
FT                   SDADWKPVADILGRTGKLNDGSVYKIGFARSDLSVQTKGVTVAPALSLGSWVAFARTPD
FT                   GQTMLMGDLVVTEDELASVTDAVQAGGLQQTALHKHLLEQSPPIWWTHIAGHGDAADLA
FT                   RAVRSALDATDTPPPAPATSGQTSLDLDTAAIDEALGRSGTIAGGVYKFFIARRDPVTM
FT                   SGMLIPPSMGLATALNFQPTGNGRAAINGDFVMTAAEVQDVVQALRGGGIDIVAIHNHG
FT                   FDEQPRLFYMHFWAENDAVALARTLRAAVDATAAR"
FT   mobile_element  732269..733652
FT                   /mobile_element_type="insertion sequence:IS1536"
FT                   /locus_tag="IS1536"
FT                   /note="IS1536, len: 1384 nt. Equivalent to IS1536, len:
FT                   1384 nt, from Mycobacterium tuberculosis strain H37Rv, from
FT                   Mycobacterium bovis AF2122/97 (100.0% identity in 1384 nt
FT                   overlap to both). Partial copy of IS_1536"
FT   CDS_pept        732291..732899
FT                   /transl_table=11
FT                   /gene="BCG_0651"
FT                   /locus_tag="BCG_0651"
FT                   /product="Possible resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0651"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70636"
FT                   /db_xref="GOA:A0A0H3M414"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR041718"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M414"
FT                   /protein_id="CAL70636.1"
FT                   /translation="MACCRNRGMNLAAWAERNGVARVTAYRWFHAGLLPVPARKVGRLI
FT                   LVDELASEAGAQPKTAVYARVSSADQKSDLDRQVARVTSWATAEQIPVDKVVTEVGSVL
FT                   NGHRRKFPAVLRDLSVTRIVVEHRDRFCRFGSEYVHAALAAQGRELVVVDSAEVDDDLV
FT                   WDMTEILTSMCARLYGKRAAQNRAKRAVAAAAVDDHEAA"
FT   CDS_pept        732901..733644
FT                   /transl_table=11
FT                   /gene="BCG_0652"
FT                   /locus_tag="BCG_0652"
FT                   /product="Putative transposase (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0652"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70637"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAT0"
FT                   /protein_id="CAL70637.1"
FT                   /translation="MPRLEIPNGWCVQAFRFTLDPTAEQAHALARHFGARRKAYNWTVA
FT                   QLKADIQAWRATGAQTAKPSLRVLRKRWNTVKDEVCVNAETGTVWWPECSKEAYADGIA
FT                   GAVDAYWNWQQRRAGKRDGKRMGFPRFKKKGRDADRVSFTTGAMRVEPDRRHLTLPVIG
FT                   CVRTHENTRRIERLIAKDRARVLAITVRRNGTRLDASVRVLVQRPQQPNVELPESRIGV
FT                   DVGVRRLATVATADGACCPVLVPDG"
FT   CDS_pept        733698..734084
FT                   /transl_table=11
FT                   /gene="BCG_0653"
FT                   /locus_tag="BCG_0653"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0653"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70638"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2N1"
FT                   /protein_id="CAL70638.1"
FT                   /translation="MGAWQTADTMGIFQALPDVWGGWRTECWEDRFEEQLIRCNGALRL
FT                   PELDLAAGMDSAREWLRDRIFQRFSDSPAGQILKLSELLADVGPGLVVSDDAVTNGGAR
FT                   PNNEEWARFVAACDLVRGAHAESA"
FT   CDS_pept        734129..734374
FT                   /transl_table=11
FT                   /gene="BCG_0654"
FT                   /locus_tag="BCG_0654"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0654"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70639"
FT                   /db_xref="InterPro:IPR011660"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M206"
FT                   /protein_id="CAL70639.1"
FT                   /translation="MALNIKDPSVHQAVKQIAKITGESQARAVATAVNERLARLRSDDL
FT                   AARLLAIGHKTASRMSPEAKRLDHDALLYDERGLPA"
FT   CDS_pept        734371..734772
FT                   /transl_table=11
FT                   /gene="BCG_0655"
FT                   /locus_tag="BCG_0655"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0655"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70640"
FT                   /db_xref="GOA:A0A0H3M8H2"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M8H2"
FT                   /protein_id="CAL70640.1"
FT                   /translation="MIVDTSAIIAILRDEDDAAAYADALANADVRRLSAASYLECGIVL
FT                   DSQRDPVISRALDELIEEAEFVVEPVTERQARLARAAYADFGRGSGHPAGLNFGDCLSY
FT                   ALAIDRREPLLWKGNDFGHTGVQRALDRR"
FT   CDS_pept        734715..734942
FT                   /transl_table=11
FT                   /gene="BCG_0656"
FT                   /locus_tag="BCG_0656"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0656"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70641"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M417"
FT                   /protein_id="CAL70641.1"
FT                   /translation="MEGQRLWAHRRPKGTGSAVIDVSLARRCEAHGYDYFRSDDPVAAA
FT                   GFVVSAVWSCGRGPGNATGSGRLPKPLRHS"
FT   CDS_pept        complement(735637..736794)
FT                   /transl_table=11
FT                   /gene="BCG_0657c"
FT                   /locus_tag="BCG_0657c"
FT                   /product="Hypothetical protein"
FT                   /note="Differs from Rv0610c by 1aa S103N"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0657c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70642"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAT2"
FT                   /protein_id="CAL70642.1"
FT                   /translation="MDDELRGLLARYARGELSADDARRAILRYPKWRVAEIDGELETVA
FT                   LDDGTPMLIAESSASDGREYSGLELVRDIAPLVGGLSFDPDEPWGSAFRPGALPELQSW
FT                   ARTVELEDAVAKPGPGQRDLLYEGPWWVAVSPGTGRPAVHRADGLDVITIMTAPDAAAT
FT                   FRRTERHRGLDVVRLGPALWGDLAKRSDFDGVRLNPLRPLAQLWPPHVPAMLVAGCDPR
FT                   PNAEPLPARTVAEIHLWLDQHGARQEKRELSNRATPVGEVTVARAWWNYDRREIAFTRV
FT                   APASDTEGLGSVPSRILCAGKLRQSIQSKLAGLPRLTWRADAWHRQRAALAVGWALELE
FT                   KLVCGERVPFAALRTPEGAHLWHLEPQAFTARAIRKLRDRAASFR"
FT   CDS_pept        complement(736846..737229)
FT                   /transl_table=11
FT                   /gene="BCG_0658c"
FT                   /locus_tag="BCG_0658c"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0658c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70643"
FT                   /db_xref="InterPro:IPR032568"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2N8"
FT                   /protein_id="CAL70643.1"
FT                   /translation="MPDRPQHPTASRQSSMVSWNHGAAGWLHCVQCGSATNPTACLDWL
FT                   PPIHARSGPMYAEHDVVVLTRDVPDKSLIAGDVGAVVGRYAAGGYEVDFTAANGCTVAV
FT                   VTLAGDDIRPRRRREIPHVREVA"
FT   CDS_pept        737209..737814
FT                   /transl_table=11
FT                   /gene="BCG_0659"
FT                   /locus_tag="BCG_0659"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0659"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70644"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M211"
FT                   /protein_id="CAL70644.1"
FT                   /translation="MLGPIRQPRLTVRPGRLPGMIAGVAAKRMNREQFFRAASGLDEDR
FT                   LRKALWNLYWRGTANMRERIEAELASAGRARPARKIKPPADPDIVGWEVDEFVSLARSG
FT                   AYLGGDRRVSPRERSRWRFTFKRLAAEAQDALRAEDAEPAASALEQLIDLAREADGYDY
FT                   FRSDDPVAAAGFVVSDVAAAGHPHFREFAAEIGAAIPP"
FT   CDS_pept        complement(737833..740400)
FT                   /transl_table=11
FT                   /gene="BCG_0660c"
FT                   /locus_tag="BCG_0660c"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0660c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70645"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M8H6"
FT                   /protein_id="CAL70645.1"
FT                   /translation="MAEAFDATQAVARILAEHGPLSEDDIARRLLDSGVADPDAVLRAL
FT                   RLETEWPARQLVDDRWVWLPTLLAGRVFTHRLGADEAVHDMLGVTPDLDPITTLCEHEE
FT                   YGRLADGSAARIVLAGYDEELLERRGIPDEAIDPGGALLLEPGTLATLGAAAGDLVGVR
FT                   LTAAGLVLERIGTAGADTSVGARLAELVDPDEPAFFPAAVWTACVDDPAAFTEPVAPLR
FT                   EILDQHGLTHEDDWLAPGGFNFDAWRFENRCELLAFRHDLDPNDAVALYTLIKLHETMS
FT                   LLLEATDPDELPRDVLATAAETATETGSDSLVDLLGDIGAALADPLLAELLVAETVGTD
FT                   SGGAAALGLLTEMLEPKVPRAARVAVRWLRAVALDRIGDVEAAERELLAAESMDTEWPL
FT                   PLLDLARIASDRGDAERGLALLRRAGTEPDHPLVRLLERHRAQPRRDLGRNEACWCGSG
FT                   RKYKKCHLGREALPLAERVDWLYAKASQHALSGDWTGLLAEVSYERFRYADSDDEDALA
FT                   AALADPLVLDAVLFEGGAFAEFLEVRGSLLPDDERLLAEQWLLVERSVFEVEHVQPGEG
FT                   VIVRDVRTGDTHEVHERAASRQLRAGQLICARPVPAGDTMVFFGGIEPVALHERAVLIE
FT                   LLDDEPDPVTLVAQLSRRFAPPTLVNTEGDSLAICEASVRVDDPAGIQGALDGVYDRVD
FT                   GEEPPRWIEHVTNDGMLRVRATLVLDGDTLRVETNSEPRMDRVLATLTRLDPAMTVLDD
FT                   DRRPLRNTREAAALAEQMPVTGAGAPDPDSPELAAALEEFIRDYETSWLDQPIPALDGH
FT                   TPRQAADDPTRRADLIKLLDTFPAGAGARGGMDADRLRTALGL"
FT   CDS_pept        740241..741233
FT                   /transl_table=11
FT                   /gene="BCG_0661"
FT                   /locus_tag="BCG_0661"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0661"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70646"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M424"
FT                   /protein_id="CAL70646.1"
FT                   /translation="MPAIPFQGEARAGRRPGRPRRCPAGVVRCRPRSMGHVRPGFSPRL
FT                   GSHRTLRPRWPPYAAASRGLTSGTSRWGWPRLGFGVVTAPTRWTLADGRELLFFSLPGP
FT                   RTSGTAAERVARHAQAQTFAGDIRQRAIQLVVSEQEVASKITAATAGIATTTFPETPSI
FT                   DDTIIGNDNRDTGVRLVDVKQDGGTSPPPPFAPWDTPDGTPPPGTGLSPTLQQMILGGD
FT                   PANLTGQGLADNVQRFVQSLPANDPNTAWLRGQVADLQAHVADIEYARTHCSTNDWIDR
FT                   TAQFASGAIVFSIGVLTAETGAGVVAAAAGGVGAATAGVSLLQCLVGSK"
FT   CDS_pept        741230..741472
FT                   /transl_table=11
FT                   /gene="BCG_0662"
FT                   /locus_tag="BCG_0662"
FT                   /product="Probable integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0662"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70647"
FT                   /db_xref="GOA:A0A0H3MAT4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAT4"
FT                   /protein_id="CAL70647.1"
FT                   /translation="MMDVLAAGIAAGALTLAAWGAWRPHYRAASYLVAGAVELALIGLL
FT                   VVTGQTLMAISVAFLVALGGPLVVVNHRRAERSRG"
FT   CDS_pept        complement(741469..741735)
FT                   /transl_table=11
FT                   /gene="BCG_0663c"
FT                   /locus_tag="BCG_0663c"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0663c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70648"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2N9"
FT                   /protein_id="CAL70648.1"
FT                   /translation="MRIPGNRQCLLVQVLRQVDGSAHRLILTSLHRDARADAHRYSNGT
FT                   DHAGRAADEPAETAHEPCWVAARGLASQASRAMSATYRPSSFI"
FT   CDS_pept        741667..741894
FT                   /transl_table=11
FT                   /gene="BCG_0663A"
FT                   /locus_tag="BCG_0663A"
FT                   /product="Conserved hypothetical protein, antitoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0663A"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70649"
FT                   /db_xref="GOA:A0A0H3M214"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M214"
FT                   /protein_id="CAL70649.1"
FT                   /translation="MRTTIDLPQDLHKQALAIARDTHRTLSETVADLMRRGLAANRPTA
FT                   LSSDPRTGLPLVSVGTVVTSEDVRSLEDEQ"
FT   CDS_pept        741891..742292
FT                   /transl_table=11
FT                   /gene="BCG_0664"
FT                   /locus_tag="BCG_0664"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0664"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70650"
FT                   /db_xref="GOA:A0A0H3M8H8"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR006226"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M8H8"
FT                   /protein_id="CAL70650.1"
FT                   /translation="MTVLLDANVLIALVVAEHVHHDAAADWLMASDTGFATCPMTQGSL
FT                   VRFLVRSGQSAAAARDVVSAVQCTSRHEFWPDALSFAGVEVAGVVGHRQVTDAYLAQLA
FT                   RSHDGQLATLDSGLAHLHGDVAVLIPTTT"
FT   CDS_pept        742421..743605
FT                   /transl_table=11
FT                   /gene="galT"
FT                   /locus_tag="BCG_0665"
FT                   /product="Probable galactose-1-phosphate
FT                   uridylyltransferase galT"
FT                   /EC_number="2.7.7.10"
FT                   /note="In Mycobacterium tuberculosis strain H37Rv, galT is
FT                   split into 2 parts, galT' and 'galT. In Mycobacterium bovis
FT                   and Mycobacterium bovis BCG Pasteur, an in-frame insertion
FT                   of a single base (*-a) leads to a single product.Differs
FT                   from Mb0635 by 1aa R183G and from Rv0619 by 1aa A397T"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0665"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70651"
FT                   /db_xref="GOA:A0A0H3M429"
FT                   /db_xref="InterPro:IPR001937"
FT                   /db_xref="InterPro:IPR005849"
FT                   /db_xref="InterPro:IPR005850"
FT                   /db_xref="InterPro:IPR019779"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M429"
FT                   /protein_id="CAL70651.1"
FT                   /translation="MSATPPPGGLDASVFIANERGRQLDEALPVGFCVVTAPTRWTLAD
FT                   GRDLLFFSLPGHVPAPVSDRRPLPERDPAPSRLRFDRATGQWVIVAAQRQDRTYKPPAA
FT                   RCPLCPGPTGLSSEVPAPDYDVVVFENRFPSLAGAGIAPIGAPDGDGFVSAPGHGRCEV
FT                   ICFSADHTGSFAGLDPAHARLVVHAWRHRTAELTALPGVAQVFCFENRGEEIGVTLTHP
FT                   HGQIYAYPYLTPRTAAMLRQARRHRKRHGDNLFASLLAREVADGSRIVVRGELFTAFVP
FT                   FAARWPVEVHIYPNRLVRNLTELNDGELDEFARIYLDVLQRFDRMYSSPLPYMSALHQF
FT                   SEVQRDGYFHVELMSIRRSATKLKYLAAAESAMDAFIADVIPESVAARLRELGP"
FT   CDS_pept        743602..744693
FT                   /transl_table=11
FT                   /gene="galK"
FT                   /locus_tag="BCG_0666"
FT                   /product="Probable galactokinase galK"
FT                   /EC_number="2.7.1.6"
FT                   /note="Differs from Rv0620 by 1aa R199C"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0666"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70652"
FT                   /db_xref="GOA:A1KG98"
FT                   /db_xref="InterPro:IPR000705"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019539"
FT                   /db_xref="InterPro:IPR019741"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022963"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1KG98"
FT                   /protein_id="CAL70652.1"
FT                   /translation="MTVSYGAPGRVNLIGEHTDYNLGFALPIALPRRTVVTFTPEHTGA
FT                   ITARSDRADGSARIPLDTTPGQVTGWAAYAAGAIWALRGAGHPVPGGAMSITSDVEIGS
FT                   GLSSSAALIGAVLGAVGAATGTRIDRLERARLAQRAENDYVGAPTGLLDHLAALFGAPK
FT                   TALLIDFRDITVRPVAFDPDACDVVLLLMDSRARHRHAGGEYALRRASCERAAADLGVS
FT                   SLRAVQDRGLAALGAIADPIDARRARHVLTENQRVLDFAAALADSDFTAAGQLLTASHE
FT                   SMREDFAITTERIDLIAESAVRAGALGARMTGGGFGGAVIALVPADRARDVADTVRRAA
FT                   VTAGYDEPAVSRTYAAPGAAECC"
FT   CDS_pept        745088..746245
FT                   /transl_table=11
FT                   /gene="BCG_0667"
FT                   /locus_tag="BCG_0667"
FT                   /product="Possible membrane protein"
FT                   /note="In Mycobacterium bovis and Mycobacterium bovis BCG
FT                   Pasteur, a single base transition (a-g) leads to a longer
FT                   product compared to its homolog in Mycobacterium
FT                   tuberculosis strain H37Rv (385 aa versus 354 aa)"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0667"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70653"
FT                   /db_xref="GOA:A0A0H3MAT6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAT6"
FT                   /protein_id="CAL70653.1"
FT                   /translation="MAGDRGADPGPANVTPGADDHAQHASPTVLCPQGHVNAWDYRFCE
FT                   RCGSPIGVVPWPSEESGTRQTAPARSFVPLVVLAATLLVVAVVVTAVGYAVTRPARNDR
FT                   EEPSSARGAATTGVPFAQAEAASCPDDPVLEAESIDLTSDGLAVSAAFMSACAGGDVES
FT                   NSALEVTVADGRRDVAAGSFDFSADPLRIEPGVPARRTLVFPPGMYWRTPDMLSGAPAL
FT                   AATRKGRSDRSAARGGSARTTMVAAASAAPAYGSINAVAGAVLVELRDSDFPYVRVGIA
FT                   NRWVPQVSSKRVGLVAAGKTWTSADILRDHLALRQRFGGARLVWSGHWTTFSGPDFWVT
FT                   VVGPAQPTAAEANRWCDSNGFGADDCFAKFISTLVGAKGTTVYRK"
FT   CDS_pept        746256..747203
FT                   /transl_table=11
FT                   /gene="BCG_0668"
FT                   /locus_tag="BCG_0668"
FT                   /product="Possible membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0668"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70654"
FT                   /db_xref="GOA:A0A0H3M2P4"
FT                   /db_xref="InterPro:IPR007969"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2P4"
FT                   /protein_id="CAL70654.1"
FT                   /translation="MSFCVYCGAELADPTRCGACGAYKIGSTWHRTTTPTVGAATTATG
FT                   WRPDPTGRHEGRYFVAGQPTDLVREGDAEAVDPLGQQQLDQSGAVGVSPSAVSGWVRSG
FT                   HRRLWWALAGVVAFLGLVGAGVVGTLFLNRDRESIDDKYLAALRRSGLTGEFNSDANAI
FT                   ARGKQVCRQLQDGGEQQGMPVDQVAVQYYCPQFSDGFHILETITVTGSFTLKDESPNVY
FT                   APAITVSGSGCSGSAGYADIDRGTQVTVKNGQGDILATAFLQAGQGGRFLCTFPFSFEI
FT                   TEGEDRYVVSVSRRGEMSYSFADLKANGLSLVLG"
FT   CDS_pept        747296..747550
FT                   /transl_table=11
FT                   /gene="BCG_0669"
FT                   /locus_tag="BCG_0669"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0669"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70655"
FT                   /db_xref="InterPro:IPR011660"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M218"
FT                   /protein_id="CAL70655.1"
FT                   /translation="MALSIKHPEADRLARALAARTGETLTEAVVTALRERLARETGRAR
FT                   VVPLRDELAAIRHRCAALPVVDNRSAEAILGYDERGLPA"
FT   CDS_pept        747550..747945
FT                   /transl_table=11
FT                   /gene="BCG_0670"
FT                   /locus_tag="BCG_0670"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0670"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70656"
FT                   /db_xref="GOA:A0A0H3M8I3"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M8I3"
FT                   /protein_id="CAL70656.1"
FT                   /translation="MVIDTSALVAMLSDEPDAERFEAAVEADHIRLMSTASYLETALVI
FT                   EARFGEPGGRELDLWLHRAAVDLVAVHADQADAARAAYRTYGKGRHRAGLNYGDCFSYG
FT                   LAKISGQPLLFKGEDFQHTDIATVALP"
FT   CDS_pept        complement(748039..748779)
FT                   /transl_table=11
FT                   /gene="BCG_0671c"
FT                   /locus_tag="BCG_0671c"
FT                   /product="Probable conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0671c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70657"
FT                   /db_xref="GOA:A0A0H3M435"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M435"
FT                   /protein_id="CAL70657.1"
FT                   /translation="MSTHNDSAPTSRRRHIVRLVVFAGFLVGMFYLVAATDVIDVAAVR
FT                   GAVSATGPAAPLTYVVVSAVLGALFVPGPILAASSGLLFGPLVGVFVTLGATVGTAVVA
FT                   SLVGRRAGRASARALLGGERADRTDALIERCGLWAVVGQRFVPGISDAFASYAFGTFGV
FT                   PLWQMAVGAFIGSAPRAFAYTALGAAIGDRSPLLASCAIAVWCVTAIIGAFAARHGYRQ
FT                   WRAHARGDGADGGVEDPDREVGAR"
FT   CDS_pept        748911..749171
FT                   /transl_table=11
FT                   /gene="BCG_0672"
FT                   /locus_tag="BCG_0672"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0672"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70658"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MAT8"
FT                   /protein_id="CAL70658.1"
FT                   /translation="MSEVASRELRNDTAGVLRRVRAGEDVTITVSGRPVAVLTPVRPRR
FT                   RRWLSKTEFLSRLRGAQADPGLRNDLAVLAGDTTEDLGPIR"
FT   CDS_pept        749168..749575
FT                   /transl_table=11
FT                   /gene="BCG_0673"
FT                   /locus_tag="BCG_0673"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0673"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70659"
FT                   /db_xref="GOA:A0A0H3M2P9"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2P9"
FT                   /protein_id="CAL70659.1"
FT                   /translation="MSTTPAAGVLDTSVFIATESGRQLDEALIPDRVATTVVTLAELRV
FT                   GVLAAATTDIRAQRLATLESVADMETLPVDDDAARMWARLRIHLAESGRRVRINDLWIA
FT                   AVAASRALPVITQDDDFAALDGAASVEIIRV"
FT   CDS_pept        complement(749647..750798)
FT                   /transl_table=11
FT                   /gene="BCG_0674c"
FT                   /locus_tag="BCG_0674c"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCG_0674c"
FT                   /db_xref="EnsemblGenomes-Tr:CAL70660"
FT                   /db_xref="InterPro:IPR013702"
FT                   /db_xref="InterPro:IPR016741"
FT                   /db_xref="InterPro:IPR019494"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M222"
FT