(data stored in ACNUC7421 zone)

EMBL: AM420293

ID   AM420293; SV 1; circular; genomic DNA; STD; PRO; 8212805 BP.
XX
AC   AM420293;
XX
PR   Project:PRJEA18489;
XX
DT   21-MAR-2007 (Rel. 91, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 4)
XX
DE   Saccharopolyspora erythraea NRRL2338 complete genome
XX
KW   complete genome.
XX
OS   Saccharopolyspora erythraea NRRL 2338
OC   Bacteria; Actinobacteria; Pseudonocardiales; Pseudonocardiaceae;
OC   Saccharopolyspora.
XX
OS   Saccharopolyspora erythraea prophage pSE101
OC   Viruses; unclassified bacterial viruses.
XX
OS   Saccharopolyspora erythraea prophage pSE211
OC   Viruses; unclassified bacterial viruses.
XX
RN   [1]
RP   1-8212805
RA   Oliynyk M.;
RT   ;
RL   Submitted (10-NOV-2006) to the INSDC.
RL   Oliynyk M., Department of Biochemistry, University of Cambridge, 80 Tennis
RL   Court Road, Cambridge, CB21GA, UNITED KINGDOM.
XX
RN   [2]
RX   DOI; 10.1038/nbt1297.
RX   PUBMED; 17369815.
RA   Oliynyk M., Samborskyy M., Lester J.B., Mironenko T., Scott N., Dickens S.,
RA   Haydock S.F., Leadlay P.F.;
RT   "Complete genome sequence of the erythromycin-producing bacterium
RT   Saccharopolyspora erythraea NRRL23338";
RL   Nat. Biotechnol. 25(4):447-453(2007).
XX
DR   MD5; d73b5d30a88e1f65c555cce35a81f7e2.
DR   BioSample; SAMEA2272514.
DR   EnsemblGenomes-Gn; EBG00001140661.
DR   EnsemblGenomes-Gn; EBG00001140662.
DR   EnsemblGenomes-Gn; EBG00001140663.
DR   EnsemblGenomes-Gn; EBG00001140664.
DR   EnsemblGenomes-Gn; EBG00001140665.
DR   EnsemblGenomes-Gn; EBG00001140666.
DR   EnsemblGenomes-Gn; EBG00001140667.
DR   EnsemblGenomes-Gn; EBG00001140668.
DR   EnsemblGenomes-Gn; EBG00001140669.
DR   EnsemblGenomes-Gn; EBG00001140670.
DR   EnsemblGenomes-Gn; EBG00001140671.
DR   EnsemblGenomes-Gn; EBG00001140672.
DR   EnsemblGenomes-Gn; EBG00001140673.
DR   EnsemblGenomes-Gn; EBG00001140674.
DR   EnsemblGenomes-Gn; EBG00001140675.
DR   EnsemblGenomes-Gn; EBG00001140676.
DR   EnsemblGenomes-Gn; EBG00001140677.
DR   EnsemblGenomes-Gn; EBG00001140678.
DR   EnsemblGenomes-Gn; EBG00001140679.
DR   EnsemblGenomes-Gn; EBG00001140680.
DR   EnsemblGenomes-Gn; EBG00001140681.
DR   EnsemblGenomes-Gn; EBG00001140682.
DR   EnsemblGenomes-Gn; EBG00001140683.
DR   EnsemblGenomes-Gn; EBG00001140684.
DR   EnsemblGenomes-Gn; EBG00001140685.
DR   EnsemblGenomes-Gn; EBG00001140686.
DR   EnsemblGenomes-Gn; EBG00001140687.
DR   EnsemblGenomes-Gn; EBG00001140688.
DR   EnsemblGenomes-Gn; EBG00001140689.
DR   EnsemblGenomes-Gn; EBG00001140690.
DR   EnsemblGenomes-Gn; EBG00001140691.
DR   EnsemblGenomes-Gn; EBG00001140692.
DR   EnsemblGenomes-Gn; EBG00001140693.
DR   EnsemblGenomes-Gn; EBG00001140694.
DR   EnsemblGenomes-Gn; EBG00001140695.
DR   EnsemblGenomes-Gn; EBG00001140696.
DR   EnsemblGenomes-Gn; EBG00001140697.
DR   EnsemblGenomes-Gn; EBG00001140698.
DR   EnsemblGenomes-Gn; EBG00001140699.
DR   EnsemblGenomes-Gn; EBG00001140700.
DR   EnsemblGenomes-Gn; EBG00001140701.
DR   EnsemblGenomes-Gn; EBG00001140702.
DR   EnsemblGenomes-Gn; EBG00001140703.
DR   EnsemblGenomes-Gn; EBG00001140704.
DR   EnsemblGenomes-Gn; EBG00001140705.
DR   EnsemblGenomes-Gn; EBG00001140706.
DR   EnsemblGenomes-Gn; EBG00001140707.
DR   EnsemblGenomes-Gn; EBG00001140708.
DR   EnsemblGenomes-Gn; EBG00001140709.
DR   EnsemblGenomes-Gn; EBG00001140710.
DR   EnsemblGenomes-Gn; EBG00001140711.
DR   EnsemblGenomes-Gn; EBG00001140712.
DR   EnsemblGenomes-Gn; EBG00001140713.
DR   EnsemblGenomes-Gn; EBG00001140714.
DR   EnsemblGenomes-Gn; EBG00001140715.
DR   EnsemblGenomes-Gn; EBG00001140716.
DR   EnsemblGenomes-Gn; EBG00001140717.
DR   EnsemblGenomes-Gn; EBG00001140718.
DR   EnsemblGenomes-Gn; EBG00001140719.
DR   EnsemblGenomes-Gn; EBG00001140720.
DR   EnsemblGenomes-Gn; EBG00001140721.
DR   EnsemblGenomes-Gn; EBG00001140722.
DR   EnsemblGenomes-Gn; EBG00001140723.
DR   EnsemblGenomes-Gn; EBG00001140724.
DR   EnsemblGenomes-Gn; EBG00001140725.
DR   EnsemblGenomes-Gn; EBG00001140726.
DR   EnsemblGenomes-Gn; EBG00001140727.
DR   EnsemblGenomes-Gn; EBG00001140728.
DR   EnsemblGenomes-Gn; EBG00001140729.
DR   EnsemblGenomes-Gn; EBG00001140730.
DR   EnsemblGenomes-Gn; EBG00001140731.
DR   EnsemblGenomes-Gn; EBG00001140732.
DR   EnsemblGenomes-Gn; EBG00001140733.
DR   EnsemblGenomes-Gn; EBG00001140734.
DR   EnsemblGenomes-Gn; EBG00001140735.
DR   EnsemblGenomes-Gn; EBG00001140736.
DR   EnsemblGenomes-Gn; EBG00001140737.
DR   EnsemblGenomes-Gn; EBG00001140738.
DR   EnsemblGenomes-Gn; EBG00001140739.
DR   EnsemblGenomes-Gn; EBG00001140740.
DR   EnsemblGenomes-Gn; EBG00001140741.
DR   EnsemblGenomes-Gn; EBG00001140742.
DR   EnsemblGenomes-Gn; EBG00001140743.
DR   EnsemblGenomes-Gn; EBG00001140744.
DR   EnsemblGenomes-Gn; EBG00001140745.
DR   EnsemblGenomes-Gn; EBG00001140746.
DR   EnsemblGenomes-Gn; EBG00001140747.
DR   EnsemblGenomes-Gn; EBG00001140748.
DR   EnsemblGenomes-Gn; EBG00001140749.
DR   EnsemblGenomes-Gn; EBG00001140750.
DR   EnsemblGenomes-Gn; EBG00001140751.
DR   EnsemblGenomes-Gn; EBG00001140752.
DR   EnsemblGenomes-Gn; EBG00001140753.
DR   EnsemblGenomes-Gn; EBG00001140754.
DR   EnsemblGenomes-Gn; EBG00001140755.
DR   EnsemblGenomes-Gn; EBG00001140756.
DR   EnsemblGenomes-Gn; EBG00001140757.
DR   EnsemblGenomes-Gn; EBG00001140758.
DR   EnsemblGenomes-Gn; EBG00001140759.
DR   EnsemblGenomes-Gn; EBG00001140760.
DR   EnsemblGenomes-Gn; EBG00001140761.
DR   EnsemblGenomes-Gn; EBG00001140762.
DR   EnsemblGenomes-Gn; EBG00001140763.
DR   EnsemblGenomes-Gn; EBG00001140764.
DR   EnsemblGenomes-Gn; EBG00001140765.
DR   EnsemblGenomes-Gn; EBG00001140766.
DR   EnsemblGenomes-Gn; EBG00001140767.
DR   EnsemblGenomes-Gn; EBG00001140768.
DR   EnsemblGenomes-Gn; EBG00001140769.
DR   EnsemblGenomes-Gn; EBG00001140770.
DR   EnsemblGenomes-Gn; EBG00001140771.
DR   EnsemblGenomes-Gn; EBG00001140772.
DR   EnsemblGenomes-Gn; EBG00001140773.
DR   EnsemblGenomes-Gn; EBG00001140774.
DR   EnsemblGenomes-Gn; EBG00001140775.
DR   EnsemblGenomes-Gn; EBG00001140776.
DR   EnsemblGenomes-Gn; EBG00001140777.
DR   EnsemblGenomes-Gn; EBG00001140778.
DR   EnsemblGenomes-Gn; EBG00001140779.
DR   EnsemblGenomes-Gn; EBG00001140780.
DR   EnsemblGenomes-Gn; SACE_0856.
DR   EnsemblGenomes-Gn; SACE_8001.
DR   EnsemblGenomes-Gn; SACE_8002.
DR   EnsemblGenomes-Gn; SACE_8003.
DR   EnsemblGenomes-Gn; SACE_8004.
DR   EnsemblGenomes-Gn; SACE_8005.
DR   EnsemblGenomes-Gn; SACE_8006.
DR   EnsemblGenomes-Gn; SACE_8007.
DR   EnsemblGenomes-Gn; SACE_8008.
DR   EnsemblGenomes-Gn; SACE_8009.
DR   EnsemblGenomes-Gn; SACE_8010.
DR   EnsemblGenomes-Gn; SACE_8011.
DR   EnsemblGenomes-Gn; SACE_8012.
DR   EnsemblGenomes-Gn; SACE_8013.
DR   EnsemblGenomes-Gn; SACE_8014.
DR   EnsemblGenomes-Gn; SACE_8015.
DR   EnsemblGenomes-Gn; SACE_8016.
DR   EnsemblGenomes-Gn; SACE_8017.
DR   EnsemblGenomes-Gn; SACE_8018.
DR   EnsemblGenomes-Gn; SACE_8019.
DR   EnsemblGenomes-Gn; SACE_8020.
DR   EnsemblGenomes-Gn; SACE_8021.
DR   EnsemblGenomes-Gn; SACE_8022.
DR   EnsemblGenomes-Gn; SACE_8023.
DR   EnsemblGenomes-Gn; SACE_8024.
DR   EnsemblGenomes-Gn; SACE_8025.
DR   EnsemblGenomes-Gn; SACE_8026.
DR   EnsemblGenomes-Gn; SACE_8027.
DR   EnsemblGenomes-Gn; SACE_8028.
DR   EnsemblGenomes-Gn; SACE_8029.
DR   EnsemblGenomes-Gn; SACE_8030.
DR   EnsemblGenomes-Gn; SACE_8031.
DR   EnsemblGenomes-Gn; SACE_8032.
DR   EnsemblGenomes-Gn; SACE_8033.
DR   EnsemblGenomes-Gn; SACE_8034.
DR   EnsemblGenomes-Gn; SACE_8035.
DR   EnsemblGenomes-Gn; SACE_8036.
DR   EnsemblGenomes-Gn; SACE_8037.
DR   EnsemblGenomes-Gn; SACE_8038.
DR   EnsemblGenomes-Gn; SACE_8039.
DR   EnsemblGenomes-Gn; SACE_8040.
DR   EnsemblGenomes-Gn; SACE_8041.
DR   EnsemblGenomes-Gn; SACE_8042.
DR   EnsemblGenomes-Gn; SACE_8043.
DR   EnsemblGenomes-Gn; SACE_8044.
DR   EnsemblGenomes-Gn; SACE_8045.
DR   EnsemblGenomes-Gn; SACE_8046.
DR   EnsemblGenomes-Gn; SACE_8047.
DR   EnsemblGenomes-Gn; SACE_8048.
DR   EnsemblGenomes-Gn; SACE_8049.
DR   EnsemblGenomes-Gn; SACE_8050.
DR   EnsemblGenomes-Gn; SACE_8101.
DR   EnsemblGenomes-Gn; SACE_8102.
DR   EnsemblGenomes-Gn; SACE_8103.
DR   EnsemblGenomes-Gn; SACE_8104.
DR   EnsemblGenomes-Gn; SACE_8105.
DR   EnsemblGenomes-Gn; SACE_8106.
DR   EnsemblGenomes-Gn; SACE_8107.
DR   EnsemblGenomes-Gn; SACE_8108.
DR   EnsemblGenomes-Gn; SACE_8109.
DR   EnsemblGenomes-Gn; SACE_8110.
DR   EnsemblGenomes-Gn; SACE_8111.
DR   EnsemblGenomes-Gn; SACE_8112.
DR   EnsemblGenomes-Gn; SACE_8113.
DR   EnsemblGenomes-Gn; SACE_8114.
DR   EnsemblGenomes-Gn; SACE_8115.
DR   EnsemblGenomes-Gn; SACE_8116.
DR   EnsemblGenomes-Tr; EBT00001557739.
DR   EnsemblGenomes-Tr; EBT00001557740.
DR   EnsemblGenomes-Tr; EBT00001557741.
DR   EnsemblGenomes-Tr; EBT00001557742.
DR   EnsemblGenomes-Tr; EBT00001557743.
DR   EnsemblGenomes-Tr; EBT00001557744.
DR   EnsemblGenomes-Tr; EBT00001557745.
DR   EnsemblGenomes-Tr; EBT00001557746.
DR   EnsemblGenomes-Tr; EBT00001557747.
DR   EnsemblGenomes-Tr; EBT00001557748.
DR   EnsemblGenomes-Tr; EBT00001557749.
DR   EnsemblGenomes-Tr; EBT00001557750.
DR   EnsemblGenomes-Tr; EBT00001557751.
DR   EnsemblGenomes-Tr; EBT00001557752.
DR   EnsemblGenomes-Tr; EBT00001557753.
DR   EnsemblGenomes-Tr; EBT00001557754.
DR   EnsemblGenomes-Tr; EBT00001557755.
DR   EnsemblGenomes-Tr; EBT00001557756.
DR   EnsemblGenomes-Tr; EBT00001557757.
DR   EnsemblGenomes-Tr; EBT00001557758.
DR   EnsemblGenomes-Tr; EBT00001557759.
DR   EnsemblGenomes-Tr; EBT00001557760.
DR   EnsemblGenomes-Tr; EBT00001557761.
DR   EnsemblGenomes-Tr; EBT00001557762.
DR   EnsemblGenomes-Tr; EBT00001557763.
DR   EnsemblGenomes-Tr; EBT00001557764.
DR   EnsemblGenomes-Tr; EBT00001557765.
DR   EnsemblGenomes-Tr; EBT00001557766.
DR   EnsemblGenomes-Tr; EBT00001557767.
DR   EnsemblGenomes-Tr; EBT00001557768.
DR   EnsemblGenomes-Tr; EBT00001557769.
DR   EnsemblGenomes-Tr; EBT00001557770.
DR   EnsemblGenomes-Tr; EBT00001557771.
DR   EnsemblGenomes-Tr; EBT00001557772.
DR   EnsemblGenomes-Tr; EBT00001557773.
DR   EnsemblGenomes-Tr; EBT00001557774.
DR   EnsemblGenomes-Tr; EBT00001557775.
DR   EnsemblGenomes-Tr; EBT00001557776.
DR   EnsemblGenomes-Tr; EBT00001557777.
DR   EnsemblGenomes-Tr; EBT00001557778.
DR   EnsemblGenomes-Tr; EBT00001557779.
DR   EnsemblGenomes-Tr; EBT00001557780.
DR   EnsemblGenomes-Tr; EBT00001557781.
DR   EnsemblGenomes-Tr; EBT00001557782.
DR   EnsemblGenomes-Tr; EBT00001557783.
DR   EnsemblGenomes-Tr; EBT00001557784.
DR   EnsemblGenomes-Tr; EBT00001557785.
DR   EnsemblGenomes-Tr; EBT00001557786.
DR   EnsemblGenomes-Tr; EBT00001557787.
DR   EnsemblGenomes-Tr; EBT00001557788.
DR   EnsemblGenomes-Tr; EBT00001557789.
DR   EnsemblGenomes-Tr; EBT00001557790.
DR   EnsemblGenomes-Tr; EBT00001557791.
DR   EnsemblGenomes-Tr; EBT00001557792.
DR   EnsemblGenomes-Tr; EBT00001557793.
DR   EnsemblGenomes-Tr; EBT00001557794.
DR   EnsemblGenomes-Tr; EBT00001557795.
DR   EnsemblGenomes-Tr; EBT00001557796.
DR   EnsemblGenomes-Tr; EBT00001557797.
DR   EnsemblGenomes-Tr; EBT00001557798.
DR   EnsemblGenomes-Tr; EBT00001557799.
DR   EnsemblGenomes-Tr; EBT00001557800.
DR   EnsemblGenomes-Tr; EBT00001557801.
DR   EnsemblGenomes-Tr; EBT00001557802.
DR   EnsemblGenomes-Tr; EBT00001557803.
DR   EnsemblGenomes-Tr; EBT00001557804.
DR   EnsemblGenomes-Tr; EBT00001557805.
DR   EnsemblGenomes-Tr; EBT00001557806.
DR   EnsemblGenomes-Tr; EBT00001557807.
DR   EnsemblGenomes-Tr; EBT00001557808.
DR   EnsemblGenomes-Tr; EBT00001557809.
DR   EnsemblGenomes-Tr; EBT00001557810.
DR   EnsemblGenomes-Tr; EBT00001557811.
DR   EnsemblGenomes-Tr; EBT00001557812.
DR   EnsemblGenomes-Tr; EBT00001557813.
DR   EnsemblGenomes-Tr; EBT00001557814.
DR   EnsemblGenomes-Tr; EBT00001557815.
DR   EnsemblGenomes-Tr; EBT00001557816.
DR   EnsemblGenomes-Tr; EBT00001557817.
DR   EnsemblGenomes-Tr; EBT00001557818.
DR   EnsemblGenomes-Tr; EBT00001557819.
DR   EnsemblGenomes-Tr; EBT00001557820.
DR   EnsemblGenomes-Tr; EBT00001557821.
DR   EnsemblGenomes-Tr; EBT00001557822.
DR   EnsemblGenomes-Tr; EBT00001557823.
DR   EnsemblGenomes-Tr; EBT00001557824.
DR   EnsemblGenomes-Tr; EBT00001557825.
DR   EnsemblGenomes-Tr; EBT00001557826.
DR   EnsemblGenomes-Tr; EBT00001557827.
DR   EnsemblGenomes-Tr; EBT00001557828.
DR   EnsemblGenomes-Tr; EBT00001557829.
DR   EnsemblGenomes-Tr; EBT00001557830.
DR   EnsemblGenomes-Tr; EBT00001557831.
DR   EnsemblGenomes-Tr; EBT00001557832.
DR   EnsemblGenomes-Tr; EBT00001557833.
DR   EnsemblGenomes-Tr; EBT00001557834.
DR   EnsemblGenomes-Tr; EBT00001557835.
DR   EnsemblGenomes-Tr; EBT00001557836.
DR   EnsemblGenomes-Tr; EBT00001557837.
DR   EnsemblGenomes-Tr; EBT00001557838.
DR   EnsemblGenomes-Tr; EBT00001557839.
DR   EnsemblGenomes-Tr; EBT00001557840.
DR   EnsemblGenomes-Tr; EBT00001557841.
DR   EnsemblGenomes-Tr; EBT00001557842.
DR   EnsemblGenomes-Tr; EBT00001557843.
DR   EnsemblGenomes-Tr; EBT00001557844.
DR   EnsemblGenomes-Tr; EBT00001557845.
DR   EnsemblGenomes-Tr; EBT00001557846.
DR   EnsemblGenomes-Tr; EBT00001557847.
DR   EnsemblGenomes-Tr; EBT00001557848.
DR   EnsemblGenomes-Tr; EBT00001557849.
DR   EnsemblGenomes-Tr; EBT00001557850.
DR   EnsemblGenomes-Tr; EBT00001557851.
DR   EnsemblGenomes-Tr; EBT00001557852.
DR   EnsemblGenomes-Tr; EBT00001557853.
DR   EnsemblGenomes-Tr; EBT00001557854.
DR   EnsemblGenomes-Tr; EBT00001557855.
DR   EnsemblGenomes-Tr; EBT00001557856.
DR   EnsemblGenomes-Tr; EBT00001557857.
DR   EnsemblGenomes-Tr; EBT00001557858.
DR   EnsemblGenomes-Tr; SACE_0856.
DR   EnsemblGenomes-Tr; SACE_8001-1.
DR   EnsemblGenomes-Tr; SACE_8002-1.
DR   EnsemblGenomes-Tr; SACE_8003-1.
DR   EnsemblGenomes-Tr; SACE_8004-1.
DR   EnsemblGenomes-Tr; SACE_8005-1.
DR   EnsemblGenomes-Tr; SACE_8006-1.
DR   EnsemblGenomes-Tr; SACE_8007-1.
DR   EnsemblGenomes-Tr; SACE_8008-1.
DR   EnsemblGenomes-Tr; SACE_8009-1.
DR   EnsemblGenomes-Tr; SACE_8010-1.
DR   EnsemblGenomes-Tr; SACE_8011-1.
DR   EnsemblGenomes-Tr; SACE_8012-1.
DR   EnsemblGenomes-Tr; SACE_8013-1.
DR   EnsemblGenomes-Tr; SACE_8014-1.
DR   EnsemblGenomes-Tr; SACE_8015-1.
DR   EnsemblGenomes-Tr; SACE_8016-1.
DR   EnsemblGenomes-Tr; SACE_8017-1.
DR   EnsemblGenomes-Tr; SACE_8018-1.
DR   EnsemblGenomes-Tr; SACE_8019-1.
DR   EnsemblGenomes-Tr; SACE_8020-1.
DR   EnsemblGenomes-Tr; SACE_8021-1.
DR   EnsemblGenomes-Tr; SACE_8022-1.
DR   EnsemblGenomes-Tr; SACE_8023-1.
DR   EnsemblGenomes-Tr; SACE_8024-1.
DR   EnsemblGenomes-Tr; SACE_8025-1.
DR   EnsemblGenomes-Tr; SACE_8026-1.
DR   EnsemblGenomes-Tr; SACE_8027-1.
DR   EnsemblGenomes-Tr; SACE_8028-1.
DR   EnsemblGenomes-Tr; SACE_8029-1.
DR   EnsemblGenomes-Tr; SACE_8030-1.
DR   EnsemblGenomes-Tr; SACE_8031-1.
DR   EnsemblGenomes-Tr; SACE_8032-1.
DR   EnsemblGenomes-Tr; SACE_8033-1.
DR   EnsemblGenomes-Tr; SACE_8034-1.
DR   EnsemblGenomes-Tr; SACE_8035-1.
DR   EnsemblGenomes-Tr; SACE_8036-1.
DR   EnsemblGenomes-Tr; SACE_8037-1.
DR   EnsemblGenomes-Tr; SACE_8038-1.
DR   EnsemblGenomes-Tr; SACE_8039-1.
DR   EnsemblGenomes-Tr; SACE_8040-1.
DR   EnsemblGenomes-Tr; SACE_8041-1.
DR   EnsemblGenomes-Tr; SACE_8042-1.
DR   EnsemblGenomes-Tr; SACE_8043-1.
DR   EnsemblGenomes-Tr; SACE_8044-1.
DR   EnsemblGenomes-Tr; SACE_8045-1.
DR   EnsemblGenomes-Tr; SACE_8046-1.
DR   EnsemblGenomes-Tr; SACE_8047-1.
DR   EnsemblGenomes-Tr; SACE_8048-1.
DR   EnsemblGenomes-Tr; SACE_8049-1.
DR   EnsemblGenomes-Tr; SACE_8050-1.
DR   EnsemblGenomes-Tr; SACE_8101-1.
DR   EnsemblGenomes-Tr; SACE_8102-1.
DR   EnsemblGenomes-Tr; SACE_8103-1.
DR   EnsemblGenomes-Tr; SACE_8104-1.
DR   EnsemblGenomes-Tr; SACE_8105-1.
DR   EnsemblGenomes-Tr; SACE_8106-1.
DR   EnsemblGenomes-Tr; SACE_8107-1.
DR   EnsemblGenomes-Tr; SACE_8108-1.
DR   EnsemblGenomes-Tr; SACE_8109-1.
DR   EnsemblGenomes-Tr; SACE_8110-1.
DR   EnsemblGenomes-Tr; SACE_8111-1.
DR   EnsemblGenomes-Tr; SACE_8112-1.
DR   EnsemblGenomes-Tr; SACE_8113-1.
DR   EnsemblGenomes-Tr; SACE_8114-1.
DR   EnsemblGenomes-Tr; SACE_8115-1.
DR   EnsemblGenomes-Tr; SACE_8116-1.
DR   EuropePMC; PMC2268306; 18223111.
DR   EuropePMC; PMC3072421; 21490938.
DR   EuropePMC; PMC4210621; 25301375.
DR   EuropePMC; PMC5640789; 29062941.
DR   EuropePMC; PMC5747123; 29284541.
DR   EuropePMC; PMC6134474; 30203150.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00634; SAM-IV.
DR   RFAM; RF01066; 6C.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01333; CRISPR-DR20.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01746; mraW.
DR   RFAM; RF01782; ASpks.
DR   RFAM; RF01791; F6.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; AM420293.
DR   SILVA-SSU; AM420293.
DR   StrainInfo; 95816; 1.
XX
CC   Project: 18489
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..8212805
FT                   /organism="Saccharopolyspora erythraea NRRL 2338"
FT                   /focus
FT                   /strain="NRRL 2338"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:405948"
FT   source          complement(519391..530293)
FT                   /organism="Saccharopolyspora erythraea prophage pSE101"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:417289"
FT   source          complement(7823295..7840549)
FT                   /organism="Saccharopolyspora erythraea prophage pSE211"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:417290"
FT   CDS_pept        1..1779
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="SACE_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /function="ATPase involved in DNA replication initiation"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99356"
FT                   /db_xref="GOA:A4F5N2"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5N2"
FT                   /protein_id="CAL99356.1"
FT                   /translation="MADHQADLGRVWEEVVQELSSGTLSPQQRAWMRVTRPIGLLDGTA
FT                   LLAAPSDFAKEAIERALREPITDALSRRLGRDVSLAVKVDTAVQAPSRPAPPPAESWPT
FT                   RDSITGPDRPTGFAEAGVSPYISTSSSYLQPPRTDSFTPPVTGSLPAVDNHYPTAEQPR
FT                   VVDYQSADYPTTEYHDWPTAAELTAGTPHEGESEAAPESDDEVDEEREAIDAANEIWPT
FT                   FGRGQAPEAQQGQPFTAPKHAPPTSQTRLNAKYTFDTFVIGASNRFAHAAAVAAAEAPA
FT                   RAYNPLFIWGESGLGKTHLLHAVGHYAQRLFPGMRVRYVSTEEFTNDFINSLRDDRQVA
FT                   FQRRYRDVDVLLVDDIQFLEGKEGTQEEFFHTFNTLHNSNKQIVVSSDRPPKGLRTLED
FT                   RLRTRFEWGLITDIQPPELETRIAILRKKAAQDRMNAPADVLEFIAARIERNIRELEGA
FT                   LIRVTAFASLNRQPVDVQLAEIVLRDLIPDSQTPEITAPTIMAVTADFFSVTIDDLCGP
FT                   GKTKALAQARQIAMYLCRELTDSSLPKIGQSFGGRDHTTVMHADKKIRKEMAERRRVYD
FT                   QVQELTSRIKQQSRGS"
FT   regulatory      complement(2344..2385)
FT                   /regulatory_class="terminator"
FT   CDS_pept        3031..4155
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="SACE_0003"
FT                   /product="DNA polymerase III beta subunit"
FT                   /function="DNA polymerase sliding clamp subunit (PCNA
FT                   homolog)"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99357"
FT                   /db_xref="GOA:A4F5N3"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5N3"
FT                   /protein_id="CAL99357.1"
FT                   /translation="MKIRVERDGLADAVAWVARSLPSRPPVPVLGGVLLDASSGEALTI
FT                   SGFDYEVSAQVTIDASIDSTGRTLVSGRLLADITKALPNRPVEITVDGSRVTITCGSSR
FT                   FSLPTMPVEDYPELPAMPDHAGSVPGDLFSEAVSQVAVAAGKDDTLPMLTGVRMEINAD
FT                   RLTMVATDRFRLAMREFTWEPGTTIEDTSVLVPAKTLSDSAKTLGTGGNKVEISLASGD
FT                   GLLGLSGNSRRSTTRLLDAEFPKYRQLLPSESAVTAVVDVAPLVEAIKRVSLVAERGTQ
FT                   VRLEFSDAGLRLTAGGDDEGSAEEELPVELVGEALTIAFNPAYLLDGLGALKSDRAQML
FT                   FTTSNRPAVLKPVGEDGEVAEGYLYLLMPVRLPG"
FT   CDS_pept        4221..5102
FT                   /transl_table=11
FT                   /gene="gnd2"
FT                   /locus_tag="SACE_0004"
FT                   /product="phosphogluconate dehydrogenase (decarboxylating)"
FT                   /function="predicted 6-phosphogluconate dehydrogenase"
FT                   /EC_number="1.1.1.44"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99358"
FT                   /db_xref="GOA:A4F5N4"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5N4"
FT                   /protein_id="CAL99358.1"
FT                   /translation="MQLGLVGLGRMGFNMRKRLRAAGHEVVGYDRNQEVSDVASIADLV
FT                   QKLSGPRIVWIMVPHGDPTRQTVEELAGLLSAGDLVIEGGNSKFTDDQANAALLAEKGI
FT                   KYVDVGVSGGVWGADNGYGLMAGGDAEDVERAMPIFDALRPEGPRDEGFAHAGPVGAGH
FT                   YAKMVHNGIEYGLMQAYAEGFELLAAADVVTDVPATIKAWSRGTVVRSWLLDLLVRALE
FT                   EDPELEQLRGYVSDSGEGRWTVEEAINNAVPAPVITAALFARFASRQDDSPAMKAVAAL
FT                   RNQFGGHSVQKS"
FT   CDS_pept        5261..6436
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="SACE_0005"
FT                   /product="DNA replication and repair protein"
FT                   /function="Recombinational DNA repair ATPase (RecF
FT                   pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99359"
FT                   /db_xref="GOA:A4F5N5"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4F5N5"
FT                   /protein_id="CAL99359.1"
FT                   /translation="MYVRHLQVTDFRSWPHADLTFEPGPTVLVGSNGQGKTNLVEALGY
FT                   VATLGSHRVATDAPLVRYGTQRAVVRAAVVNHGRELLVELEITPGKANRARINRGAAGK
FT                   PRDVLGILRTVLFAPEDMAMVRGDPGERRRFLDDLLVARAPRYAGVRSDYDRVLRQRSA
FT                   LLKSAGAAKRGGSGGDLRTLEVWDGHLARYGAELLAGRLDLVAAIAPHVTSAYANVAAT
FT                   AEETAPSGRVADVRYRSSLGESLPEGYGVPRGEPADVEVLEKALLAELERVRAQELERG
FT                   VSLVGPHRDDLELMLGELPAKGYASHGESWSFALALRLASYHLLAEDGAEPVLILDDVF
FT                   AELDRRRRSRLAELVAGAEQVLVTAAVAEDVPEELTGVRFDVREGEVRRVE"
FT   CDS_pept        6543..7064
FT                   /transl_table=11
FT                   /locus_tag="SACE_0006"
FT                   /product="hypothetical protein"
FT                   /function="Zn-ribbon-containing, possibly RNA-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99360"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5N6"
FT                   /protein_id="CAL99360.1"
FT                   /translation="MAMGTDGAALNGPDLARAALQAAREQSKAKRSTARRRYGGGGQRR
FT                   RRSWSGPGADDRDPQPLGRLASRIAAERGWADRLSGGRVFGEWSTLVGGDIAEHTKPVA
FT                   LKDGELSVQAESTAWATQLRLLQRQILKRIADGVGKDVVRRIKVQGPAAPSWRHGPRHI
FT                   PGRGPRDTYG"
FT   regulatory      7130..7167
FT                   /regulatory_class="terminator"
FT   CDS_pept        8507..10399
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="SACE_0008"
FT                   /product="DNA gyrase subunit B"
FT                   /function="Type IIA topoisomerase (DNA gyrase/topo
FT                   II,topoisomerase IV), B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99361"
FT                   /db_xref="GOA:A4F5N7"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5N7"
FT                   /protein_id="CAL99361.1"
FT                   /translation="MYIGSTGERGLHHLVQEVVDNSVDEAMAGYATRVEVTLLADGGVR
FT                   VVDDGRGIPVDMHPVEKKPTLEVVLTVLHAGGKFGGDSYAVSGGLHGVGVSVVNALSTA
FT                   LEAEIHLHGHVWRQRYEDSKPVHDLQKGERTTRTGTTITFWADPTIFETTRYNAETISR
FT                   RLQEMAFLNKGLTIVLRDERAAEEHEGGEDASGAAARATERTFHYPGGLEDFVRHINAT
FT                   KEPIHKKVVSFSASGKGHELEVAMQWNSGYNQSVYTFANTINTHEGGTHEEGFRSALTR
FT                   VVNAYAKDKKLLKDKDGSLTGDDVREGLAAIVSVKVSEPQFEGQTKTKLGNTEVKSFVQ
FT                   TNAFEWLTDWFERNPTEAKTIVNKAVSSAQARVAARRAKELVRRKSAMDIGGLPGKLKD
FT                   CQSNQPDECELYIVEGDSAGGSAKEGRESRFQAILPIRGKIINVEKARIDKVLKNNEVQ
FT                   SIITALGTGIHDEFDLSKLRYHKIVLMADADVDGKHIQTLLMTLLFRFMRPLIEHGHVF
FT                   LARPPLYKIKWPRSEPEYAYSDKERDALLEAGASAGKKLPKEDGIQRYKGLGEMNADEL
FT                   WETTMDPATRLLMQVTLDDAATADELFSVLMGEDVEARRSFITRNAKDAGLLDI"
FT   CDS_pept        10554..13049
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="SACE_0009"
FT                   /product="DNA gyrase subunit A"
FT                   /function="Type IIA topoisomerase (DNA gyrase/topo
FT                   II,topoisomerase IV), A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99362"
FT                   /db_xref="GOA:A4F5N8"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5N8"
FT                   /protein_id="CAL99362.1"
FT                   /translation="MTETLPPEHGRIEPVDIQQEMQNSYINYAMSVIVARALPDVRDGL
FT                   KPVHRRVLYSMYDSGYRPDRGYVKCSRVVGDVMGNYHPHGDSSIYDTLVRLAQPWSMRH
FT                   PLIDGQGNFGSPGNDPAAAMRYTESRLDPLAMHMLADIEEDTVDFSDNYDGRSQEPDVL
FT                   PARIPNLLVNGGGGIAVGMATNIPPHNLREVADGVVWALENPEADDEALLEALIERIKG
FT                   PDFPTRGLIMGTNAIADAYRTGRGSIKMRAVVDVEEDTKGRTSLVVTELPYQVNPDNLI
FT                   ESIAAMHREGKLTGISDIADESNSRRGMRIVITLKRDSIPKVVLNNLYKHTQLQYTFGV
FT                   NMLALVEGVPRTLRLDQVIRHYVKHQVEVIVRRTRFRLRKAEERAHILRGLVKALDMLD
FT                   EVIALIRRSPTVDDARTGLIELLEVDEVQANAILEMQLRRLAALERQKIVDQLAEIERE
FT                   IEDLKDILDKPERQRQIIRDELMAIVDKHGDDRRTRIVPHEGEVSMEDLIADEDVVVTL
FT                   TRTGYAKRTRTDLYRAQKRGGKGVQGAQLKQDDIVSHFFVCSTHDWILFFTNKGRVYRA
FT                   KAYELPEANRTARGQHVANLLAFQPDEHIAQVMQIKDYTAAPYLVLATRNGLVKKSRLT
FT                   DFDSNRSGGLIGVNLKDDDELVGAVLCSADDDLLLVSAEGQSIRFHASDEALRPMGRAT
FT                   SGVLGMRFNEGDELLAMGVVRPDRYVLVATDGGYAKRTPIDDYPVQGRGGKGVLTIQYD
FT                   RKRGRLVGALIVDVDDELYAITSTGGVIRTTAKEVRKAGRQTKGVRLMNLGDGTSVVAV
FT                   ARNADEAADPDAAGPEQQK"
FT   CDS_pept        13104..13919
FT                   /transl_table=11
FT                   /locus_tag="SACE_0010"
FT                   /product="hypothetical protein Rv0007"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99363"
FT                   /db_xref="GOA:A4F5N9"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5N9"
FT                   /protein_id="CAL99363.1"
FT                   /translation="MTPSEKPGESASQSKDASHTSVITQSEEATESTAERGTPAAEDQA
FT                   PNHGEEAAALDGTDAPPPWQRGAATSSAGEQPSWPTEQPVGTSGSPADAGGAPDSEDTQ
FT                   KIPRPAQEQETARNEVPQSSSGGRTAVTFGSAGRATTAAGSARRPSRGPRRASLQVKRV
FT                   DPWSVLKLALVLSVALFFVWMIAVAVLYGVLDGMGVWDQLNGTFTELTQPDDAAAEPLI
FT                   SAGRVFGVASIIGAINIVLITALATVAAFIYNVAADFAGGVEVTLSERE"
FT   tRNA            14011..14087
FT                   /gene="tRNA-Ile (GAT)"
FT                   /locus_tag="SACE_8001"
FT                   /product="transfer RNA-Ile (GAT)"
FT   regulatory      14012..14071
FT                   /regulatory_class="promoter"
FT   CDS_pept        14150..14266
FT                   /transl_table=11
FT                   /locus_tag="SACE_0011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99364"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5P0"
FT                   /protein_id="CAL99364.1"
FT                   /translation="MKKLIALAVVAGAVLFVVRRNRAAKAEADLWREATAEA"
FT   tRNA            14402..14474
FT                   /gene="tRNA-Ala (TGC)"
FT                   /locus_tag="SACE_8002"
FT                   /product="transfer RNA-Ala (TGC)"
FT   regulatory      14428..14495
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(14813..15502)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0012"
FT                   /product="TetR-family transcriptional regulator"
FT                   /function="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99365"
FT                   /db_xref="GOA:A4F5P1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5P1"
FT                   /protein_id="CAL99365.1"
FT                   /translation="MKTASILIPTTKAQLRRHPKIKTLLCYVAGMGRKRVHDDKLRLRL
FT                   LDRAGELLAEGGADALGLRSLAKAADTSTSAVYSLFGGKDELLHALYEEGFRRLAERLR
FT                   AVPADDDIVEHLVRLSHAYRASALEGPHYYRAMFDRRRTAEEDDAVRRAGHDAFEPLLE
FT                   TVRQCVEQGRLVDADPTLVASALWAHVHGLVSLELSNLLPDVGDDMFERAIRAGLSGWQ
FT                   TTTTADR"
FT   CDS_pept        15524..16966
FT                   /transl_table=11
FT                   /locus_tag="SACE_0013"
FT                   /product="lignostilbene-alpha/beta-dioxygenase"
FT                   /function="Lignostilbene-alpha,beta-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99366"
FT                   /db_xref="GOA:A4F5P2"
FT                   /db_xref="InterPro:IPR004294"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5P2"
FT                   /protein_id="CAL99366.1"
FT                   /translation="MSTRTHSDDTPATGFARGFASLESEVEVAELPVTGELPEWLSGEL
FT                   LRNGPAKFEAGRRRFRHWFDGQAMLHRFAIADGRVAYRNRFLDSPALRSARDGRIRYAE
FT                   FATDPCRSLFARLFTRFRRSEPSANACVNVVPNGDDTYAALTEIPMAVDFDPHTLETIG
FT                   ISGYDDSIGGNVTTAHPHQAPRTGDLVNYVLRFSRQSEYRIYRQRPDGRTRELLASVPT
FT                   DQPGYLHSFAITEDHVVLVEFPFVVNPLAFLLSGKPFIENYRWRPELGTRFIVIGLDDG
FT                   SVRSVRTEEAFFAFHHINSYVDGGELVVDVCAYPDSGVVDSFYLDRLRSGARMPVPAPM
FT                   RYRVDLDAGTARSHRLAEEPLELPGISYGHRNGRPYRCAYGVGMRGHDGRDFLDQLVKI
FT                   DVEDGRSSTWYEGGCYPGEPVFVPAPEAEAEDDGAVLSVVLDSAAGRSFMLALDGRSFT
FT                   EIARAEVPHAIPFGFHGQFSSR"
FT   regulatory      16985..17032
FT                   /regulatory_class="terminator"
FT   CDS_pept        17128..20220
FT                   /transl_table=11
FT                   /gene="mmpL10"
FT                   /locus_tag="SACE_0014"
FT                   /product="conserved large membrane protein"
FT                   /function="predicted drug exporters of the RND superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99367"
FT                   /db_xref="GOA:A4F5P3"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="InterPro:IPR023908"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5P3"
FT                   /protein_id="CAL99367.1"
FT                   /translation="MNATGSDERDGGPLARLSRFVVRRRGAVVCAWVAFAALLNVLVPQ
FT                   LEAVIGQSRVPFVPDSAPSVRALPEMDRRFGGEGANSLVFVVLADESGLSEEDHRYYAE
FT                   LVGRMERDDSRIASVQDAVSQPELADALVSRDGKAIYIPVGLRGENGSPETTAQIKHIR
FT                   ETAQQGRPDSLAVHVTGPMATIADMQDEIERSMLVITAVTVGLITAILLVIYRSVVTAL
FT                   VALALIGLSLGTARAVTAVCGLQFFDVSTFTASLLTAVVLGAGTDYGVFLLSRFHERIR
FT                   AGDDPEQAVITANRRVAAVIAASAGTVIAACSGMALAEVSIFRTTGPAIAVSLAVTLAA
FT                   GLTLTPALLAIAATRGWAMPRRSPENGRWTAIAERVVARPARVLAAGLVVLLLLAAFYP
FT                   AARLSYDERAVQPAATDSNLGYGALGKHFPAGEILPEYLLVNSDHDMRNPQDLAALETA
FT                   AANVAKVDGVRAVRGVTRPTGEPIAEANVGNQVGVVGDRLGAAEEQLGGGQQGIGGLAD
FT                   GAGRLADGTGRLAGGAAELAAGSGRLAAGARSAVDGADQLLNGLNTAHGGLGTAGDGAD
FT                   DAGSAATTLAEGARQLATGLDLARDQTSLAVDGLGLAYHALQADAVCSLDPICAQARKG
FT                   IGDIYVSERDQLLPGLEQAAAAAHKIADGNGDLASGMDDLRGGIATARDGIARLAEGQR
FT                   TMRDQLGALADGAGQAANGAQQLSDNAGLAADGAGRLRDGTANATVSVKELERGLAQAA
FT                   DFLRTVRAESHHPGVGGFYLPPNALSDPRMAMASGMFLSGDGRTARLVVLHSGDPLDRA
FT                   AMDRTGEIVRTAEHALRGTSLDGSGVHNTGSASVNRDLARMSDADFSVFALVALLSVLV
FT                   ILMLLLRSVVAPIYLLVSVILSYAAAMGIAVLFWQFLLGGELDWSVQPIAFVILVAVGA
FT                   DYNMLLMSRIREESDDGSRAGIARAVATTGGVITSAGIIFAASMFALMSGTVDILAQLG
FT                   FTIGVGLLLDTFVVRTLVIPAIAVLLRKWNWWPSKNAGESG"
FT   CDS_pept        20297..22072
FT                   /transl_table=11
FT                   /locus_tag="SACE_0015"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /function="Acyl-CoA dehydrogenases"
FT                   /EC_number="1.3.99.10"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99368"
FT                   /db_xref="GOA:A4F5P4"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5P4"
FT                   /protein_id="CAL99368.1"
FT                   /translation="MTVSHLISLAEEVERYLGDPHDPSSRMSYQRILEHDESERYPHEL
FT                   VDVLHEWGLHTYLLPEEWGGRAIDVEVGFNLLRLVARRDPAAATAVMLTDLAFMPAWIA
FT                   GTAEQREGFVRAITDGTKMAWGLSERHHGSDVLANEMRAEKVPGGYLLSGEKYLIGNAT
FT                   VSDVVSLQARTDERGGPGGWSLFAVDKRECAPGTFEHLPRERLHGLRASDLGGFRLDQV
FT                   FVPESSRFGEEGRGLEISIKGAQVARISICSMSLGAVDTALRLAMDFAEQREIFGRKVV
FT                   EIPYSRRQLAECFADLLIGDALCTEAVRGLQGNPAQASVFSSVVKYFVPTLLERTMAQT
FT                   SVVLGARLYLRDHPHFGVYQKMMRDVLVAIFADGNTVVNLKNIALELHELLGTARDPGE
FT                   ELRAGAEKSVGLLYDVDAKLPRWQPQRQSLFSRGKDDTVLAMPDGIERLRALAERQHDP
FT                   AQRRWYLRSAEVAQRLMGELDRLHEGTTRLKQRWGKEYSTSDELFRLGEQYCAVHAGAA
FT                   LVHLVTRSADVLQDPMPDGAVLLLCLERVWRQFRSDEPVTDIDVIDRVVEVLRWQHSEH
FT                   RLFSHWQFRLRASSS"
FT   CDS_pept        22287..25007
FT                   /transl_table=11
FT                   /locus_tag="SACE_0016"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /function="DNA-binding HTH domain-containing proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99369"
FT                   /db_xref="GOA:A4F5P5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5P5"
FT                   /protein_id="CAL99369.1"
FT                   /translation="MHGRERERRAIRSILEDARSARGRALVLRGETGIGKSTLLKYAQR
FT                   RAAGMRLLSCSGLESESELAFSGLQHLVAPLLDEIDGLPPSQAEALRAALGMSELPVTE
FT                   FVVSAAVCSLLSYSARGTPLLVVVDDAQWLDRATLGALYFTARRIATEPIALLFGMGEA
FT                   EQHEREARDLPTMLLTGLSDEAADDLLDELGWNAPARDSLITATGGNPLALRELTRLGA
FT                   PEQLVGDALLLGTVPLSERLRTAFIQRMEGLPAKARALLLVVAVEETGRLGVVLGACAR
FT                   LGIDAGVLDSVLRGYDQLEITERWVRFRHSLMRSAAYHKASLRMRSKAHAAVAEELTDR
FT                   GESDRASWHRAMAAVEPDEELATALERSADTAERRGGSAAVVSVLQRAAKLSTDPEGRT
FT                   RRTASAAYAAWQSGQPDLARALTTEVMTAPTDMHARVGLTRLLGLIDLDSNDPAVACAQ
FT                   FVRGAQEVAEHNPEEALTLLFLAVDGGYLSGRIEDAGRAARLMTELDCGPDYRLLAERM
FT                   CAALEGRLPLEGTTPRELLDAAPALPTPDDEIRFLWVMAMSWLGPHQRQAREFGLAACR
FT                   TFRLKGVASVLPVMLNWVADTEYHLGLWRDGQAHAEEAVRLARDTGQRNRMADGLALLA
FT                   RFASVRGDWDGCRDHADAALETALVLRNRAAAAHVSWALGLADLARGRDADAYRRLSSI
FT                   RSEGSPYANSKVAALVHPDLVEAAVRCGHSDIAEVLLSEVREGCRGTTARWRKLHLHMC
FT                   RALVEESGADFATATGADLGEDRPFDRARAALLHGEWLRRNRRQAEARWQLQQAAELFD
FT                   SLGAAPWSERARGQLRAARGALLRTADPAVLTRQEKQIAGMAATGMTNKEIAAQLSVSP
FT                   RTVSHHLYKLFPKLGISSRAQLRGLDLESAPTQDG"
FT   regulatory      complement(25121..25151)
FT                   /regulatory_class="terminator"
FT   regulatory      25222..25278
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(25251..26165)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0017"
FT                   /product="hypothetical protein"
FT                   /function="O-Methyltransferase involved in polyketide
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99370"
FT                   /db_xref="GOA:A4F5P6"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5P6"
FT                   /protein_id="CAL99370.1"
FT                   /translation="MTLAGKVRAAKGATSPTAELCAVIRAAETQQPERSRLLDDPFAQY
FT                   FLQNWRFRTTHPFPPVFRLCLRMADRRYTGLLAEVVLRHRFCDEVVEAEVAAGCTQVVL
FT                   LGAGYDTTALRHDFGPGVVVYEVDKPDTQAEKTAIMRRNSLRPKGRVQYVTCDFAAGDD
FT                   LGERLTSQGFDPALPSVVLWMGVTYYLPGDSVLDTLGKLGAITAPGSKVVLDYMDASVV
FT                   SGSGDDSARRARQLVASGGEPFVFGVESDDIRAFCDAGGFGVAEHHRIPDLLRRYGDDD
FT                   RFWLTVVDYMGVVVLEKENAPAA"
FT   CDS_pept        26416..27711
FT                   /transl_table=11
FT                   /locus_tag="SACE_0018"
FT                   /product="amine oxidase, flavin-containing"
FT                   /function="predicted NAD/FAD-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99371"
FT                   /db_xref="GOA:A4F5P7"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5P7"
FT                   /protein_id="CAL99371.1"
FT                   /translation="MRVAVVGAGAAGISAAHRLRSDADVTVFEASDRPGGHARTVEVTD
FT                   DGRTLGLDTAFVVYNEPHYPEITRFFDHLGVATREHPGRFSFFDLDSPTAYVSEDFDLT
FT                   AEQVRERYPDEFVRLWEEATRFYRESPRDFIRKRTDCPLGEYLDRNGYSEEFKYGFVVL
FT                   VSTAAWSVPAERIWDMPASTVVAFFLAHGAEGLGGRAVPWRTVTGGSVHYVRAAVEELR
FT                   RCGNEVRVNAPVTRVREQEDGVAVRTDEGVEHFDYAVLATHADDALAVLDRPTERQRML
FT                   EAVRYHRTRVDLHTDPAVMPADRGRWRSWNYGRLRGGGTQDSWVVYYLNELQGLTSEHD
FT                   YFVTLDCPVPIDESRLIERFDYRHPIFTIDVRRMQPDIHSVNEGSRVKFAGSYFHSRRM
FT                   GPDIVGSHESAFDSGSAAAESVRRDAADRAVA"
FT   CDS_pept        27746..28033
FT                   /transl_table=11
FT                   /locus_tag="SACE_0019"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /function="Acyl carrier protein"
FT                   /EC_number="6.2.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99372"
FT                   /db_xref="GOA:A4F5P8"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5P8"
FT                   /protein_id="CAL99372.1"
FT                   /translation="MAETTNSTGTLTPEQVERWLVDKMAYKLDVEPAKVDVDMYFDEFD
FT                   LDSTEALVLSGELEKWLGFELEATALWYHPTISDLSRHIAQEYGGGNAGG"
FT   CDS_pept        28020..28928
FT                   /transl_table=11
FT                   /locus_tag="SACE_0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99373"
FT                   /db_xref="GOA:A4F5P9"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5P9"
FT                   /protein_id="CAL99373.1"
FT                   /translation="MRGDEPLVRELLAGSGPGRRVVLVHPGALPLSCYRPLAAELSGDT
FT                   SLHVVDLEKVPEYFEAALTDHDTGLSLDGVAERVHRELAAHGLLGDDVVLGGWSFGGVV
FT                   GYAVAARSAPRKRPRRLLVADSIAPVAEFTTTTDDEIGPELLLPWFAMYLGAKRGVAID
FT                   LDAGDVRGMDVEAGLQRALTAVLDAGALPPDTSVAGLRSVYRAYSRGLLRNDRVARDHA
FT                   AKPVDVPITLVRPRSGLLGGSRPLGWDQLAAAGLSTLDCPGDHYSMLSDPDAVAVLADA
FT                   ALERGGSRAPAPSRTTGRQPS"
FT   CDS_pept        28925..32869
FT                   /transl_table=11
FT                   /locus_tag="SACE_0021"
FT                   /product="putative multi-domain beta-ketoacyl synthase"
FT                   /function="Polyketide synthase modules"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99374"
FT                   /db_xref="GOA:A4F5Q0"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004432"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5Q0"
FT                   /protein_id="CAL99374.1"
FT                   /translation="MTPTAQRRLADNPVAVVGLGALFPRSGDLGEFWSNVVEARDCIEE
FT                   VPESHWRIDDHYDPDPEAPDKTYCKRGGFVPTVDFDPMEFGLPPNMLEVTDVLQLLSLV
FT                   VAKQTLDDAGVRGAEWYDPSRTGAVLGVTGANSLTQPLATRLQTPVLKEVVRSCGLTEQ
FT                   DADAIADKFTRAFAPWEENSFPGMLGNVVAGRLANRFDFGGKNCTVDAACASSLAAVDM
FT                   AVDELVSGRADLMVTGGCDAENTILMYLCFSKTPAFSRSGRIRPFDESSDGTLIGEGMG
FT                   MLALKRLEDAERDGDRVYSVLRGMGSASDGRSKSIYAPRKEGQVLALRRAYQDAGFGPD
FT                   QVGLVECHGTGTAVGDLTELSALREVYAAESDDTQFAAVGSVKSQIGHTKAAAGAASLI
FT                   KVSLALHEKVLAPTINVEQPRRDADFANSPFHVAARTRPWVHDPDRPVRRAAVSSFGFG
FT                   GTNFHAVLEEHAATSSTRRLHPGTRVHVWHAPTADELLDALRQDAEGIDPQEPVPAEDA
FT                   RLAVVATDEHELASLREQSIERLSSEPGQESFDLPGGAHYRSRSLVGSERGGKVAALFA
FT                   GQGSQYVGMGARAAVAVPPVRAAFDAASASTALGRVVFPPPAFDEETGKAQQEELRRTE
FT                   HAQPAIGALSSGQHRFLAELGFRADGALGHSFGELTALWAAGSLDDDGFHRLARARGRA
FT                   MAVSPDGGADPGTMAAVSAGPERVRELLDGHDDVVVCNLNAPDQTVVGGGTEAVGEFVS
FT                   AARDAGVDVRPLPVSGAFHTRYVAHAVEPFAAEVAGVAVREPAFPVYADTAGASYGPDE
FT                   EANRDVLVGQLTSTLSFAPRLEQLHDDGFRVFVEFGPRSLLSGMVRRTLADRGDVVVLS
FT                   ADAGPDRDGDRALKQLAARLVVLGAPLTRLNRYAAEPARREPGKGMTIPLNGVNHVSEA
FT                   RREAYREALQNGYRVDQQGGAAAQTGNGDAPPPPANGHARQSNGHAPAQASNGQVARQQ
FT                   SNGHAPAQASNGQVARQQSDGHAPAQQSDGHAPAQQSDGQVARQHNGQASGQQPADDRQ
FT                   PAAHDGVPAAFGPGSVAAEHMAAHREFLDGQLRVAQQLSSMLQRESEQGPRDGMISGIS
FT                   AVAQQSVTVGESHMHASDVLRGFAEMETGAPPSPAVPPRRMPTAYSDQPAPPAQPAAPA
FT                   PEPEEQIALPTPAPEPAPAPVPPQAPEPPQQAGDAVAPAEPARTASGEPESGGGPADAE
FT                   EVRRTLLDIVAAKTGYPADMLDPGMDVEADLGIDSIKRVEIMGGLRERFPAMPEPSPEE
FT                   LAELRTLDDIVGLIASAGASEGGQAQAPKA"
FT   CDS_pept        32878..35136
FT                   /transl_table=11
FT                   /locus_tag="SACE_0022"
FT                   /product="putative multi-domain beta-ketoacyl synthase"
FT                   /function="Polyketide synthase modules"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99375"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042104"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5Q1"
FT                   /protein_id="CAL99375.1"
FT                   /translation="MPARTSRLPAPDHLAGAYRTDPVVLVAGEQSPLSTALADALCAAG
FT                   WRVRHEEPGDGGEPDVVLWLAPERPADWDRASSALTEALLLAGRVQEPLERVAESGRAA
FT                   FVTVTRIDGGLGMSGAGDMANAVLGGVVGLVSTLAIEAPALFCRSLDLDPELSEERCAE
FT                   LVVAELHDARSDLVKTGYSGDGARWTVEAADADGSAGGCAAPEPGPDDLLVVTGGGRGV
FT                   TAACTVGLARRYGCGALLLGRTEPADEPPWAEGVSGDAELKAAIADHLRAEGRKPTPRE
FT                   VGGLQRELVAQREIRQTLASIRESGAFAEYLPVDTTDAAATAEALAAYRDRVTGVVHGA
FT                   GVLADQLITAKQEPEVTRVLAPKLAGLRSVLGAVDQDRLRHLMLFSSVAGFFGNRGQSD
FT                   YGMANAALNSLACAFKRDHPDASVTAVNWGAWDGGMVTPELARMFAERGVELIPLQSGV
FT                   DVFVNEFRPERSGDVVCVVGPGKPLSERVPPRQDGEVHLRRDLGPLTDDPVIADHVIGG
FT                   AAVLPAAVAIGGMLNAVRQVRPDVRALEEFQVLSGVVFDGSVPALHLAVGDDVTASDDT
FT                   GKPRYRAAARTEPPTAEPLRDLPPTTAGEPLDPYSDGTLFHGPALRGIERLLADDDRLV
FT                   LGCRLRAAGIADGAYEVAAYRPEHADLLLQAVLVWVRRHLGRPSLPTAVGSVEPHAPLP
FT                   DGEPFHVVVDEVRAAEGSVRATATACDPAGGVLLRFRDVDAVVSTALESKFTRSERGS"
FT   CDS_pept        35138..42106
FT                   /transl_table=11
FT                   /locus_tag="SACE_0023"
FT                   /product="beta-ketoacyl synthase"
FT                   /function="3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl
FT                   carrier protein) dehydratases"
FT                   /EC_number="4.2.1.60"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99376"
FT                   /db_xref="GOA:A4F5Q2"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5Q2"
FT                   /protein_id="CAL99376.1"
FT                   /translation="MSSGTPIAVVGMSCLLPGASTPEEFWASLREGADQRSHGGREVFG
FT                   TDPSVPGGWGDDQHSITTTRGGFVGEVETDLEGLGLPAEELDGLGRVVRWPLHTARRAL
FT                   ADAGLPESGEGLARTGLVLGNYSFPTEESTRFVLPMLRAQVSDGLRRAGLPLPDDASPR
FT                   PDADPRSVWASGLPACVVHTALGLGGPHLALDAACSSTLYGIALARDYLLTGAADVMLA
FT                   GAVCAPDPLLIQLSFSDLRALPSDDDVSQPFDARSSGIVTGQGAGAFVLKRLPDALADG
FT                   DRVHAVVESIGLGNDGAGRHVLSPDAAGQLDAYRAAYADVDPATVDYVECHATGTPLGD
FT                   STELRSLSEFFDGRGSAPLLGSVKGNVGHLLTAAGLTSMLKVIMAMREGRIPATPGVGE
FT                   ALSPSGGEAAARRVVLEERAWPETAGRPRRAGVSAFGFGGTNAHLVLSSEPGPEPSRHA
FT                   PSRRVPRMAVTGVGARLGPLETTAPLQRKVRRAESGLRERPAGRWYGADDIAEPPGELG
FT                   ESGYAEQLKVDLSTYRIPPFELNQANPQHLMMFEAADAALADAGFDQPEETSGAERRPA
FT                   RRVAVVVAMEMEPHTHTHRARFDIGAHVRAECARAGVELGGEVLKRLERSVRDAVHEPI
FT                   GANEVLSYIGNIMSSRISASRNLVGPSFTISADRTAGARAVEIAGLLLLDESIEAVVVG
FT                   GVDLACGPANVNARARLADERGEELPPLGDGAAAVVLTRAGQVGPEGQEYATVDSVSLR
FT                   PDPGSAAREALRAAGSDASEVDYLELGSATSDGLATEVAELAGAYRADDLSCAVGGLAP
FT                   LVGDTQAGCAVASLVKVALCLDGAELPATPAEPPLAGPELAESAFYRVDEPRPWLRRHR
FT                   DGRRIAALSAVGSGTAAHLVLSSGQVATGDAVRTAHVAGPLVLALSADDAEGIAEQAAR
FT                   CAAELDSGGDALALCWEHAHGAQSARLTAVLVSDSGDGLREELRSAERDLPAAVADGEW
FT                   STPAGSFCTGRPLGPQGRVALVYPGAFTTYPGAGREMFRLFPELLADFEAECEHPAERF
FT                   KHRELYPRAREPLDRRTLLRHEAELLDDIPVMLATGTNFAVLATRMLRDVLGVRPDGGF
FT                   GYSLGESSMLFATGVWSAQARDDTALAASPLFRDELRGPKRQVRRSWDLAPETADSAVW
FT                   STHVLLADPETVRGHMRELDRVFLTHVNTPEEVVVAGDPGQCRALVERVGCQAAKAPAN
FT                   HVMHVPLVDPHLDALAALNDYPLGDPDPGLELLSAYDYEPVDFADRGRIAERIARTLRG
FT                   PIDFARLARTAHERGFRYFVEVGPGSTCTRWIDDTLDGREHVAVSLDRRGAPAGASLAR
FT                   AVARLVSHGMRVDLTRLLGMPDSTAQAPTTHVVPCGGESVVERVREAAEPVLHAAVQAE
FT                   DRDAGPADDEAITIEREPFVHLTTVTHAVPTQRGAPPARQHGQRSSPPEQRRAPGPVQA
FT                   IAATVGRAHRSALRTQAALQECALRELERTEPDASGNGSAHGTEPPAADPGGPADPPSG
FT                   GPTGGRPGVVWGESDLLEFAQGRISEVFGPSYAEIDSYPVRVRLPAPPYLFVSRVTDLD
FT                   ARPGQYEPSSLTTEYDVPDDPWYAVDGLVPCAVTIEAGQCDMLLISYLGIDFRNRGERV
FT                   YRLLDSSLVFHGDLPRRGQTLRYEIGIDRFVSTGDRLLFFFDYRCYADGELILELLEAS
FT                   AGFFSREELDESLGIVETDADRRRREAMTPSDFKPLARTGRTSLTAADLRLLAQGRPGE
FT                   VFGPSWDQSADGFNPSLRLPGDALRMIDEMPRIERQGGPRELGDLAAVKHLDPDGWYFE
FT                   CHFPGDPVLAGSLVAEGGVQILQVYAMYLGLHLVLPDAEFQSVPGLRTEVKVRGQITPQ
FT                   TPRIDYHVEITEITMLPRPTVIADITVYDGDKPIVAMRDFGVQVREKPGTPYRPGAGGV
FT                   PEVRPRRNESGEAAFINELHLAHAAKGHLGTAMGPEFDVYDDRRAPHIPNGDFRFVDRI
FT                   MRLDGTRGRLEPGVSMATEYDCPPEAWFHREAAVEDIPNCVYMETSLQAAILLGYYLGA
FT                   TLEHPHQELSIRNLDGNAELVKRVDLRGRTIRHETTMLSSGTATGAILQRFRYELSADG
FT                   EVFYRGESLFGYFTEQALANQVGLDSGSHVAPWLDRQTDIDPARVRTVPVRSDERWFTP
FT                   RDGLRLSGGHLRLVDEVDLVEDGGEHGRGYLRGRREIDPHEWYFDCHFHRDPVMPGSLG
FT                   VEAVIQALHLYVLETGLAGHLGEATFATPVDERMEWKYRGQILRTDGEMTFDAHITDVR
FT                   VDDDRVVVVADANVWKPGLRIYELTGVAVQARRVS"
FT   CDS_pept        42128..43708
FT                   /transl_table=11
FT                   /locus_tag="SACE_0024"
FT                   /product="2-nitropropane dioxygenase, NPD"
FT                   /function="Dioxygenases related to 2-nitropropane
FT                   dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0024"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99377"
FT                   /db_xref="GOA:A4F5Q3"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014179"
FT                   /db_xref="InterPro:IPR040981"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5Q3"
FT                   /protein_id="CAL99377.1"
FT                   /translation="MTATTAPDAAPAPVRTDPAGVYQALRRLDRPCYVVDTGAGYGASN
FT                   ELPAEQDQVLAAVGPLPPERLGSTAFGDRHGTRYAYMAGSMAGGVASEDLVIAMARAGL
FT                   LASFGSAGLLPERIEKALVRFAEEIPDRPYAVNLIHSPSEEGLERGAVELYLRHGVRCV
FT                   EASAFMDVTPHLVRYRVAGLERGAQGAPLARNRLIAKVSRPEVAEKFLHPAPPSMVDAL
FT                   AADGLVTAEQAELARHVPLADDVTAEADSGGHTDRRPMPALLPTILRQRDEVRRRHRYR
FT                   ERVGIGAAGGIGTPTAATAAFAMGADYVVTGSVNQSCLEAGTSPAVRGLLAGAGIADCE
FT                   MAPAADMFELGVQLQVLKRGTLFPMRAKQLYELYRDHDGVEALPEVERARLEKSVLRRP
FT                   VEQVWEEVVGYFRRRDPDQLERAAADPRRRMALIFRWYLGMASRWANTGEAGREQDYQI
FT                   WCGPAMGAFNEWVRGSHLAEPDNRAVAEVAWQLLRGAAFTSRVHQLQLCGVRLPASCAE
FT                   YRPEAGDQR"
FT   CDS_pept        43705..45474
FT                   /transl_table=11
FT                   /locus_tag="SACE_0025"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /function="Acyl-CoA dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99378"
FT                   /db_xref="GOA:A4F5Q4"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5Q4"
FT                   /protein_id="CAL99378.1"
FT                   /translation="MTTVNEVAWRGAAGNWTGPYAAAAELDAKLGDPADPDNPCGFAAM
FT                   RGRDECAAFPDALVESAGPALRLSYLPSRHGGELSTMDETLALVRVAARRDITVMPATM
FT                   FSITAAGCVLLAGSEEQRRRVVGLLRGGGAVGFALSEAEHGSDLLSNTCALSRDSEGAP
FT                   RLDGHKWLVGLGRRCDALLVVARSGGRGPAAFSTVLVEGDAVREARTGEQQHPAGMRGI
FT                   DFAGFRFEGAPVPEESVVGETGRGMETAMTAMQLVRTTSAAANLAASDTALRLALDFAT
FT                   EHVVAGSALIDQEHARRELGTAAAAVVACDALALACTRALHTAPAAASLHSSVVKKVLT
FT                   ELSAEVFARCADVLGTRSQLPGAFETARRDNEVVRYVDTGPVANIRQVAAQAARVLAAD
FT                   GSDPDDALAATFALDAPLPEFRLDRLVLSCRRDPFVSALPAVVGRADRALLTSGNGDAA
FT                   ALVRQVAHELAEMGEETGPARDAEDRFEHAERFCYLHAAACCVHLWWFSRHLPLFGGAP
FT                   ESPDWLAAALRLLLDRARGVTTRLPAGLTEPLARHVRALHGSGRLVSAVALPLAESGRA
FT                   HAGTEDDRGRHDG"
FT   CDS_pept        45467..47173
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="SACE_0026"
FT                   /product="acetyl carboxylase"
FT                   /function="Acetyl-CoA carboxylase alpha subunit"
FT                   /EC_number="6.4.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99379"
FT                   /db_xref="GOA:A4F5Q5"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="InterPro:IPR041010"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4F5Q5"
FT                   /protein_id="CAL99379.1"
FT                   /translation="MAEPARTLAQDPRLADADQVRWTRCPNCRSLVYLRRLRRNGHVCP
FT                   DCAHHMRMGVHDRIESLLDAGSFERFGADVAPVDVLGFTDSRPYTERLAQAQRRSGSNE
FT                   AVLCGTGTIDGAPLVVAALDFGFLGGSVGGVTGELVARAARTALDRRTPLVLVCASGGA
FT                   RMQEGTISLMQMAKTSQEVARLHEAGVLVVSIGTDPTYGGVTASFGMLGDVVVAEPGAR
FT                   IGFAGPQVIRQTIRQELPAGFQTAEYLRDAGMVDLVVPRHELRAHLARLLRVHSGGTAA
FT                   PAAERGYRTRPRPAADRDASEVLHAARDIGRPSTSDYCARIFEDFVELHGDRVSGDDPA
FT                   VVAGIGTLGGRPVVVVGHQKGHETAELVQRNFGMPQPAGYHKARRMMDYAERFGFPLVT
FT                   FVDTPGAHPGVDAEQRGQGTAIAECISRMARLKVPAVSVVTGEGGSGGALALGVGNRVL
FT                   VLENAYYSVISPEGCSTILWGTAERTSQAAEQLRITAEDLLRLGVVDGVVDEPAGGAQQ
FT                   DHAAMASRLAAALRASIGELSELDGDALLDQRRRRFDRFGDPDHSDSEVQP"
FT   CDS_pept        47170..47676
FT                   /transl_table=11
FT                   /locus_tag="SACE_0027"
FT                   /product="acetyl-CoA carboxylase, biotin carboxyl carrier
FT                   protein"
FT                   /function="Biotin carboxyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99380"
FT                   /db_xref="GOA:A4F5Q6"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5Q6"
FT                   /protein_id="CAL99380.1"
FT                   /translation="MTAHITDGTGVTRIAGEAPEHGDSLATLRAEAERLMRAAGRPVRR
FT                   VSLRAGGNAIEVDWETGDEQGGAAAVGTAQPPVEETAGEDRAIRVVAPLVGTFYHAPSP
FT                   GEAPFVEVGDVVEEGQQLGIVEAMKLMNPVTADRPGRVRAVLAPDGELVEFEQVLVELD
FT                   PVEEV"
FT   CDS_pept        47679..49028
FT                   /transl_table=11
FT                   /locus_tag="SACE_0028"
FT                   /product="acetyl-CoA carboxylase"
FT                   /function="Biotin carboxylase"
FT                   /EC_number="6.3.4.14"
FT                   /EC_number="6.4.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99381"
FT                   /db_xref="GOA:A4F5Q7"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5Q7"
FT                   /protein_id="CAL99381.1"
FT                   /translation="MFAKVLVANRGEIALRIIRACRELGIATVAAHSTADAESLPVRLA
FT                   DEAVRIGPAAARQSYLSIPNIIGAARKTGADAIHPGYGFLSEDPYFAEICQQHGITLIG
FT                   PPPGVMDVLGDKARTRRVMRDAGLPLLPGTLSPVASAGEAERIADEIGYPVIIKASAGG
FT                   GGSGITVVRDRESLPSALAETRATAQTLFKDPSVYLEKYLSPAHHVEIQVVCDSHGGAV
FT                   HLGERDCSVQRRNQKLVEEAPSPRVGDDLRARMGRAAVDGAVAAGYQGVGTAEFLLDDD
FT                   GEFWFMEVNPRIQVEHPVTELVTSLDLVREQIRVAAGERLSVRQQDVRMRGHAVECRVN
FT                   AEDPDRGFAATPGTIEQYVAPGGPGVRVDSHCFPGCTVPPNYDSMIAKLLVWAEDRDRA
FT                   LDRMGRALDEYRVEGRGMATTIGFHREVVDHPVFRDGAAGTDFVRQLRDG"
FT   CDS_pept        49183..49830
FT                   /transl_table=11
FT                   /locus_tag="SACE_0029"
FT                   /product="RNA polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99382"
FT                   /db_xref="GOA:A4F5Q8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5Q8"
FT                   /protein_id="CAL99382.1"
FT                   /translation="MPALGTADRETTANAAPAAEAEPTAREPRTEPSPLVDRCRRGDRR
FT                   AWNELVRCYSPVIWTVARSYELSPPDCEDVCQMTWQRLVEHLPRLHRADRIRPWLVTVA
FT                   KREAIRNRRVRIRTVPVADPTEVGPGRAAAGATPEEVAVTHDRDREVLAAFRLLPEKHQ
FT                   ALLGMLVSDPGTSYDDVAQALRMPRGSVGPTRMRVLARMRDMLTAEDGSDPG"
FT   CDS_pept        complement(49905..50441)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0030"
FT                   /product="probable ATP-dependent Clp protease ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99383"
FT                   /db_xref="GOA:A4F5Q9"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5Q9"
FT                   /protein_id="CAL99383.1"
FT                   /translation="MFERFTRTARDTVVRAVEEAKRAEAAEVTAEHLALALLATPCGAL
FT                   LAEHGVRREDIASAYETARRRAGLSESDASALRALAIEVDHVVGSVEGAHGTGAMVPRG
FT                   RRRRFAPRGHVPVAADTKEVLRRCLREAVDMGDRQLDDRHLLLGLVTTCGVAADLLDEH
FT                   GIDYASLRARRRKAS"
FT   CDS_pept        complement(50444..50653)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99384"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5R0"
FT                   /protein_id="CAL99384.1"
FT                   /translation="MTEATELASAAGGRDPRAGLRAVAALRKLLEQLEAVQVRNARNQG
FT                   WSWQEVANELGVSRQAVHKKHGRA"
FT   CDS_pept        complement(50707..51207)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99385"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5R1"
FT                   /protein_id="CAL99385.1"
FT                   /translation="MSEQIELSFDIEATTEVDASPDEVYRVVSDITRMGEWSPECTGGE
FT                   WLRGQPGAAGSRFHGHNRAGGETWTTECEVVAAVPGREFAWAVLTYARSPEVSVWSFAI
FT                   EPDGDGCVLTQRYRMQEPPARFASFMRGMDADQAAALGAKRRAMLEDAMSRTVAGIKAA
FT                   VED"
FT   regulatory      complement(51238..51274)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(51388..51921)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99386"
FT                   /db_xref="GOA:A4F5R2"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5R2"
FT                   /protein_id="CAL99386.1"
FT                   /translation="MDEVKAMTRAGENVGRAVGTGIRSARIGAARAGRAGMAMSKTAAA
FT                   RAEYELAHRGIDTDELQELIARKATGMSRKQLAKRRRKAQKQFARNAEIARRELASRIA
FT                   PEARRRRKWPWVLLVLAGVAAAGVALSRRPEELPVAEAEDGPRHGADGRHSPVPAQGDG
FT                   RADRPTSLGSEYQR"
FT   CDS_pept        52106..52624
FT                   /transl_table=11
FT                   /locus_tag="SACE_0034"
FT                   /product="putative peptidyl-prolyl cis-trans isomerase"
FT                   /function="Peptidyl-prolyl cis-trans isomerase (rotamase) -
FT                   cyclophilin family"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0034"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99387"
FT                   /db_xref="GOA:A4F5R3"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5R3"
FT                   /protein_id="CAL99387.1"
FT                   /translation="MTATLHTTQGDIRVNLFPNKAPKTVANFVGLAEGTKEYDAPNAKG
FT                   ERSGPFYDGVIFHRVIEGFMIQTGDPTGTGRGGPGYQFGDEFHPELQFDRPYLLAMANA
FT                   GPGTNGSQFFITVGATSWLNYKHTIFGEVSDQASRDVVDAIATTATGPADRPVNDIVIE
FT                   KVTVERGEG"
FT   CDS_pept        52773..53552
FT                   /transl_table=11
FT                   /locus_tag="SACE_0035"
FT                   /product="rhomboid-like protein"
FT                   /function="uncharacterized membrane protein (homolog of
FT                   Drosophila rhomboid)"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99388"
FT                   /db_xref="GOA:A4F5R4"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5R4"
FT                   /protein_id="CAL99388.1"
FT                   /translation="MGYHCVDCVQAGRGGTRQAVTVAGARLAAKPVVVPVLIAVNVLVH
FT                   VYTSVQAGSGMDNFDSDGFATSALLPILVAGGQWWRLVTSGFLHIGLPHLAMNMIALWV
FT                   IGRDLELVLGRLRFTAVYFLSLLGGSTAVFVFGELVQPVAGASGAVYGLMGGIAVAALR
FT                   LKVSLRPVLIVIGLNVLLSVTIPGLSLLGHLGGLFVGAAATAALVYAPRQRRLLFQGGA
FT                   LAAIFLVLAVALVTKDMSLGNMVCTGYGGAGTRCAVG"
FT   CDS_pept        complement(53632..54045)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99389"
FT                   /db_xref="GOA:A4F5R5"
FT                   /db_xref="InterPro:IPR019692"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5R5"
FT                   /protein_id="CAL99389.1"
FT                   /translation="MRSQISREWSTPVGLAASGWVLTAAAVAWWLLSGSAPDRLFVGAV
FT                   VVVLAAASAYATLCRPRLSADAAGITVRGLRGRRSWPWAAVTVRTERSSRLGRTVEVLV
FT                   LDTADDELVVLTRLELGADPVEVADALNAMRPG"
FT   regulatory      complement(54197..54241)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(54265..54531)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0037"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99390"
FT                   /db_xref="GOA:A4F5R6"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5R6"
FT                   /protein_id="CAL99390.1"
FT                   /translation="MPKSKVRKKDSSTPVADRRTPVKAKAVGPSHPIYVVVMLGMMVIG
FT                   LLWLVVNYLAGDKIPFMADLEAWNFAVGFAFMIIGLLMTMRWR"
FT   CDS_pept        54727..55548
FT                   /transl_table=11
FT                   /gene="srtB"
FT                   /locus_tag="SACE_0038"
FT                   /product="putative sortase-like protein"
FT                   /function="Sortase (surface protein transpeptidase)"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0038"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99391"
FT                   /db_xref="GOA:A4F5R7"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042003"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5R7"
FT                   /protein_id="CAL99391.1"
FT                   /translation="MGSTDFAVAPPPDRRPHRVRAAVRVFGEVLITLGLVLLLFVFYEV
FT                   YVTDWFTARKQDDASRRLDQQWRAPGPPPPAPGEGDAFARLHIPAFGPDYRFTVLEGTD
FT                   PATLAAGPGHYSATARPGEQGNFAVAGHRIGKGAPFNDLDRLHSCDALVVETATEWYIY
FT                   RVLPLAEEAPSWDSRAAYPKCRGVAPIGVPYDQAVGRRIVGPEQGEVIHPVPGRPRDTL
FT                   PKDQQTRLITLTTCHPEFSAAQRLIVHGVLVKRYPKDPADTGLRPPELEER"
FT   CDS_pept        55548..55703
FT                   /transl_table=11
FT                   /locus_tag="SACE_0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99392"
FT                   /db_xref="GOA:A4F5R8"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5R8"
FT                   /protein_id="CAL99392.1"
FT                   /translation="MYGWIWRRLPGPTAAKAVQAVLLVAAVIALLLFVVFPRVEPLLPF
FT                   NEVTTL"
FT   CDS_pept        55773..56420
FT                   /transl_table=11
FT                   /gene="pabA"
FT                   /locus_tag="SACE_0040"
FT                   /product="putative p-aminobenzoate synthase glutamine
FT                   amidotransferase"
FT                   /function="Anthranilate/para-aminobenzoate synthases
FT                   component II"
FT                   /EC_number="6.3.5.8"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99393"
FT                   /db_xref="GOA:A4F5R9"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5R9"
FT                   /protein_id="CAL99393.1"
FT                   /translation="MGVRVLVVDNYDSFVYNLVQYLAQLGAECVVRRNDVVTDDEVEWS
FT                   DGVLFSPGPGTPDRAGRTMELVRRCADERRPVLGVCLGHQAIGAAWGGVVERAPELLHG
FT                   KVSEIRHDGAGVFAGLPEPFIATRYHSLIVRADTIPDEFEVTARTESGIVMGMRHRELP
FT                   VEGVQFHPESVLTDGGHRMLANWMASAGNPVDEHVVSQLEEGMRQVAAAARR"
FT   CDS_pept        complement(56488..57294)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0041"
FT                   /product="transposase for IS3518"
FT                   /function="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99394"
FT                   /db_xref="GOA:A4F5S0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5S0"
FT                   /protein_id="CAL99394.1"
FT                   /translation="MLLAVAGVARSTFFYHQARMDAEDPQADLKEAVTEVFEQAHRRYG
FT                   HRRVHTILVRRGWQVAKKTVLKLMRALGLVCKVRRRRPYVSWKGEVGTIAANVLNREFA
FT                   ATAPNTKWVTDVTEFRVGTGKIYLSPVIDLFDRSVVAYSWSTSPNTELTNSSLRKAIAT
FT                   LEPGQTPLVHSDQGFQYQHASWRRLLTNAGLTQSMSRKATCLDNALAENFFGHLKEELF
FT                   HHNQFDTAKDLTTALDDYLDWYNTTRISTTMKGLSPAEYRAQTPTN"
FT   regulatory      56499..56545
FT                   /regulatory_class="terminator"
FT   CDS_pept        57533..58912
FT                   /transl_table=11
FT                   /locus_tag="SACE_0042"
FT                   /product="transposase for IS3508i"
FT                   /function="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99395"
FT                   /db_xref="GOA:A4F5S1"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5S1"
FT                   /protein_id="CAL99395.1"
FT                   /translation="MGTRDSQQQEGHPFGTAAQPSSARDAVNEMIEAGLLDGVMDTVDR
FT                   GGLALTGQGGFLPELVKAVLERGLQTEMADHLGYDKGDPAGRGSPNSRNGASGKTISTE
FT                   VGEVDLEVPRDRAGSFEPRLVPKGSRRAGGLDEIIISLYAGGMTVRDIQHHLQRTYGTE
FT                   LSHETISKITDTVLEEVTAWQSRPLEEIYPIIYLDALVVKVRDGHQVRNRSAHIAVGVD
FT                   LDGVKHVLGIWIQASEGAKFWAGVCAELRNRGVKDVLIVCCDGLPGLPEAIEATWPSST
FT                   VQTCTVHLIRAAMRFVSYQDRKKVAAALKPIYTAPTAQAAETALLEFAESDLGRKYPAA
FT                   VRTWENAWERFIPFLEFPPEVRKIIYTTNSIESLNYQLRKIIKNRGHFPSDDAVIKLLW
FT                   LAIRDIEDKRARQRDKQRGLPTHQRNAPARLVEGATVQGWKQALGALALHFPDRLDPYL
FT                   N"
FT   CDS_pept        complement(58787..59143)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99396"
FT                   /db_xref="GOA:A4F5S2"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5S2"
FT                   /protein_id="CAL99396.1"
FT                   /translation="MKPKQSFSFEFKLEVVRRFLDGEATTAELAREYALSSPKLVETWV
FT                   RKYRREGEDALRPKRRGRPEPVKWFVYRTLGGSVEVGVEAVGEVQGECAEGLFPALDGG
FT                   AFDQACGGVALVGG"
FT   regulatory      complement(59300..59359)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(59398..61359)
FT                   /transl_table=11
FT                   /gene="pknB"
FT                   /locus_tag="SACE_0044"
FT                   /product="serine/threonine protein kinase"
FT                   /function="15 Serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99397"
FT                   /db_xref="GOA:A4F5S3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5S3"
FT                   /protein_id="CAL99397.1"
FT                   /translation="MSSPRLLSNRYEIGDTLGYGGMSEVHRGRDIRLGRDVAVKVLRAD
FT                   LARDPTFQLRFRREAQNAAALNHPAIVAVYDTGETDSENGPLPYIVMEYVDGRTLRDIV
FT                   KSEGPLAPRRAMEVMADASAALDFSHRHHIIHRDVKPANIMITRSGAVKVMDFGIARAL
FT                   TDGQAAVTQTAAVIGTAQYLSPEQARGESVDARSDVYASGCVLFELLTGEPPFTGDSPV
FT                   AVAYQHVREDPRKPSDVNQQVPASLDAVVLKALSKNPANRYQSAAEMRADLVRVLSGQR
FT                   PKAPMIMSEEERTSMIAPAPATEVMAPGGRHRSVEPAVEDDLDAEQQRKRRKNWLIALV
FT                   TLICVAVFALVAWVANALLSGPSGDDKIAVPQLEGMTKSQALSELTAGNWLWQEQIPCP
FT                   SSREDVGRVINQTPDPGVPIDKKQDRIRVCFGTGPEQVQIPDLRGMSMDQASAKLSEVG
FT                   LMLGYNPKTREVDNDSQVDKILEWDPEGTVAKGTTINVVLGKKAEQRAVPDVRNMPYET
FT                   AERMLSYAGFQVQRSDRDSSEPAGIVVDQTPAADTKLKPGSKVTVYVSNGQQISMPPLT
FT                   GLSPTDAKRQLQQLGWNGQLVEQKESTSDSKLDGKVMRSSPSGGDKISKNQTITIYVGE
FT                   YDSSPTTQPDDGFFPPFP"
FT   CDS_pept        complement(61418..62728)
FT                   /transl_table=11
FT                   /gene="pknA"
FT                   /locus_tag="SACE_0045"
FT                   /product="putative serine/threonine protein kinase"
FT                   /function="15 Serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99398"
FT                   /db_xref="GOA:A4F5S4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5S4"
FT                   /protein_id="CAL99398.1"
FT                   /translation="MLTTGQLLAERYRLGQRIAVGGMGEVWKATDVRLDRTVAIKVLKA
FT                   ELCGNAEFLHRFRTEARTTASLNHPGIAAVHDYGETAAIPDGPEDTAYLVMELVEGEPL
FT                   AATLAREGRIKAEHALDMLEQAGHALQAAHERGLVHRDVKPGNILITPNGKVKLTDFGI
FT                   AKAADAAPVTRSGMVMGTAHYIAPEQALGSEATPASDVYSLAVVGYECLKGHRPFLSDN
FT                   AVTVAMMHIREVAPPLPPDVPPGARALIEATLVKDPRRRYATGGEFANAVAAVRAGLPL
FT                   PTPAALAVPQQRQQMGTPVPGTGVHQLPPAMPPMQNTYPPGLIPPQAAAPQPPPPAPRP
FT                   RYSRTMIWVAVSVVVVVALTAIGIAVALRTTNGQGVPHNDPERTRQVAAGAATNHLDSA
FT                   DRFDQTALRPVRGTNRTNTHQSTEVGGTAHGVQRGTS"
FT   CDS_pept        complement(62732..64183)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0046"
FT                   /product="peptidoglycan glycosyltransferase"
FT                   /function="Cell division protein FtsI/penicillin-binding
FT                   protein 2"
FT                   /EC_number="2.4.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0046"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99399"
FT                   /db_xref="GOA:A4F5S5"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5S5"
FT                   /protein_id="CAL99399.1"
FT                   /translation="MNKPLRRVALAMMVMVVLLMGNATYVQVIKADELRDGPGNTRTLY
FT                   DEYSRQRGQIIAGGQSLANSVETDDKLKYLRTYPEGPAFAPVTGYYSFVYGANGVERAQ
FT                   MNLLNGTDDSLAFDRLSDMITGEPPRGGDVELTINPAMQRVAYEQLTSKGFQGSVVALD
FT                   PKTGAILAMANAPSYDPNKLASHLKSEALAGWNEASQAEGDPMLNRAVSEIYPPGSTFK
FT                   LITTAAALQNGYNANSQVTDAPSITLPGTRTPLPNYGGNTCKGNTLTKALAHSCNTAFA
FT                   EIAGKLGADKMRETAAAFGFGQDLQVPMRAAKSDLGPMSDAPSLYQSGIGQRDVRVTPL
FT                   QNAMMVSAIANGGKLMKPELVRRTTAPDKSVINEMQPEELNQAVSPDVARTIRDMMLQS
FT                   EQNTKGDGKISGVEIASKTGTAQHGDPDDKPHGWYVAFAPAEAPSIAVAVIVENGGDEG
FT                   AEATGGSIAAPIGRAVIRAGLQGGG"
FT   CDS_pept        complement(64180..65616)
FT                   /transl_table=11
FT                   /gene="ftsW2"
FT                   /locus_tag="SACE_0047"
FT                   /product="putative cell division protein"
FT                   /function="Bacterial cell division membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99400"
FT                   /db_xref="GOA:A4F5S6"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5S6"
FT                   /protein_id="CAL99400.1"
FT                   /translation="MSQPAAAAGTQTPSGHTPEPGVPTRRGTELFLLICSAVIITVAIM
FT                   LVQISREQTISRELFYYGAAFLALFGAAHFAVRRWAPYADPLILPLVSLINGLGLVVLH
FT                   RLDFEEVTGSPFTGKQIMFATVGVVLFILVLALVKDHRTLARYSFTCGFVGLALLALPG
FT                   LLPSSISEVNGAKLWINIGGQSIQPGEFAKLLLLIFFASFLVSKRELFTTAGRRFLGVD
FT                   WPRARDLMPVIVAWLLSIGIVVLEKDLGTSLLFFGIVLVMLYIATERAVWVGLGLSLFG
FT                   IGCFIAFNLFDHVQGRVNTWLDPMATAGQDPDPGFQLRGGLYGMASGGIFGSGLGGGRP
FT                   DLTIWAASDFIIAAIGEELGLVGLMALLMVYLLLMMRGLRTALAVRDSFGKLFGGGLAF
FT                   TVCLQLFVVAGGVTGLIPMTGLTAPFLAYGGSSLLANYILVALLLRISDAARRPQAPSK
FT                   PKPKQAPIAEAHTELVERPR"
FT   CDS_pept        complement(65616..67034)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0048"
FT                   /product="protein serine/threonine phosphatases"
FT                   /function="Serine/threonine protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99401"
FT                   /db_xref="GOA:A4F5S7"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5S7"
FT                   /protein_id="CAL99401.1"
FT                   /translation="MTLVLHYAARSDRGLVRSNNQDSVYAGPRLLALADGMGGHAAGEV
FT                   ASKVVIAALAPLDDDEPGDDLLGQLRDAVLSGNSAISELVAGDPDLDGMGTTLTAVLFA
FT                   GSKLGLVHIGDSRAYLVRDGELSQITHDDTFVQSLIDEGRITEEEAANHPQRSLLLRAL
FT                   TGHEVEPSLAVREARAGDRYLLCSDGLTGPVSEETLAEALRIADPQQCADRMIELALKG
FT                   GGPDNVTVIIADVVDVEFGEDAPIVGGAAGNGDEHPQPDSSAARASAATMPRPQPQRYE
FT                   PTSPPPEPRRRRRWLRSVLVVAGVLVVLAGAALAGRWWMLNQYYIGVNQADDVVIFQGL
FT                   QGNVLGMPLSTQVEDSCPAGSPPTCDPINIKDLQEAQRADVRNGITEVNGLEAAQAAMH
FT                   RLRMTALLPECEQPKPQPNPNVPPPSGQNPPPASSVQPPPPPDPNQPNQPPSPEDTPLQ
FT                   QQEQKPGVTCRTVS"
FT   CDS_pept        complement(67031..67495)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0049"
FT                   /product="FHA domain containing protein"
FT                   /function="FOG: FHA domain"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99402"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5S8"
FT                   /protein_id="CAL99402.1"
FT                   /translation="MPELVIQLTRAGFLALLWLFVLAALRVVRSDLYSASGMRVPMPGS
FT                   GRVQAKQARGKSRAPRQMVVTHGALAGTRISLEGRPIMIGRADDSTLVLDDDYASTRHA
FT                   RLSLRGADWYVEDLGSTNGTYLDRAKVTGPTKVPLGVPIRIGKTVIELRS"
FT   CDS_pept        complement(67549..68862)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0050"
FT                   /product="FHA domain containing protein"
FT                   /function="FOG: FHA domain"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99403"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5S9"
FT                   /protein_id="CAL99403.1"
FT                   /translation="MGLVQRFERRLEGIVGNGFARVFGGKVVPQEVAQALQREAELQIR
FT                   ELAGGRLLACNHYVVQLSTPDHARLAGEEDRVTDLLADCVQEHLTEQGWDTYGDVVVSL
FT                   ERSETLHTGQFRIRSSVDPDVTRRPATPRTAGDRPMSQPPGHYPQGDPYGQQQGQYGYD
FT                   QGYGQGQYGQDPNYGYGQQPPGYDQGGYPQQPPGYDQGYPQQGYGQQPPGYDQGYGQPA
FT                   GYDQGYGQQPGGYDQGGYPQQPPAAYDQGYGQQPPGYDQGYGQPAGYDQGYGQQPPGYD
FT                   QGYPQQPGQYGYDQGGYGQQPGGAYPPSQPGGFPEQGYPQQPGGAYPPSAPGGYPEAAP
FT                   RQLTATLQLDDGSNRSYTLQHGSNVIGRGQEGQFRLPDTGVSRKHIEITWDGQSAMLAD
FT                   LGSTNGTTVNGTPVQTWQLADGDVIRVGHSSLVFRSQG"
FT   tRNA            69093..69175
FT                   /gene="tRNA-Leu (CAG)"
FT                   /locus_tag="SACE_8003"
FT                   /product="transfer RNA-Leu (CAG)"
FT   CDS_pept        complement(69439..70440)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0051"
FT                   /product="putative exported phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99404"
FT                   /db_xref="GOA:A4F5T0"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5T0"
FT                   /protein_id="CAL99404.1"
FT                   /translation="MRRLTALVAAAIAGLGAFPAAAAPEAEPAGTQVRVLTWNILHGGR
FT                   EYGPRNLPNLLDQVVAVRPDVFFTVETYGSGPDIERALTERAGKGAYTGVRVTDRPPGE
FT                   DNLWLFTRFPVSHRYPAPHGGVVDDFNFGGARVRLPDGAELNLFTVWLPYSDPWNGYLV
FT                   DDNAAAIRTGVPPRHSGADVQRAETEQQRHIDDIVRTQLPAMLGGNTDPVLMGGDFNTL
FT                   AAHDWRPEHAACSGHLGMSYPLGATAAVTAAGFADTYRTAHPDVCAEPGSTWSPQPAER
FT                   MITPQRIDFTFARGDVRVERSEVIDQRIPEHGPGVFYSDHAAVLTDLVVAHR"
FT   CDS_pept        complement(70473..72014)
FT                   /transl_table=11
FT                   /gene="phoD"
FT                   /locus_tag="SACE_0052"
FT                   /product="phosphodiesterase/alkaline phosphatase D"
FT                   /function="Phosphodiesterase/alkaline phosphatase D"
FT                   /EC_number="3.1.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99405"
FT                   /db_xref="GOA:A4F5T1"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR018946"
FT                   /db_xref="InterPro:IPR032093"
FT                   /db_xref="InterPro:IPR038607"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5T1"
FT                   /protein_id="CAL99405.1"
FT                   /translation="MRANRRDLLRGAVAAGALGAAWPLSVRLSPAQAHAAARELGATWD
FT                   EPPFTLGVASGDPLPDGVSLWTRLAPQPLADSQPLPDTVEVEWVVATDPELSNRVASGT
FT                   APARAEFGHSVHVDVGGLEPGRRYFYRFAARGRSSRLGRTRTAPVGPLERVRFAAANCQ
FT                   AFHDGFYAAHRGIAAEDVDFVVHLGDYIYEHGQVGGEHVRDHEGPEAFTLTDYRRRHAL
FT                   YKGDPSLRAAHAAHPWFLTWDDHEVVNDYSGTEPSKPFRERRAAAYQAWFEHMPVRSAN
FT                   AQAPRVHQQRHWGDLLELTILDLRQYRSAQNLPNGTILGREQKDWLKQRVDAAPDSWHC
FT                   WVNSIMLSQLAQPGGGYYFTDQWDGFLAERREVLTHVHDSGMPDLVVVTGDWHSAFVDD
FT                   VRPDFDDPDSPVIGTEFTAHSVSSSAYDAEWNRTNGPVMGGANPHLKYFEGDRYGYDVH
FT                   EVTPRRWSTHMRVVADRDDPRSPVSTLTTFHVDRGRPGSYEDPATIHSPAQYRRA"
FT   CDS_pept        complement(72170..72970)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0053"
FT                   /product="beta-lactamase fold-like Zn-dependent hydrolase"
FT                   /function="predicted Zn-dependent hydrolases of the
FT                   beta-lactamase fold"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99406"
FT                   /db_xref="GOA:A4F5T2"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5T2"
FT                   /protein_id="CAL99406.1"
FT                   /translation="MIDESQCSISFIGNATTLLRFGDFTLLTDPNFVRRGQWVHIGHGI
FT                   VTRRRTQPSMNVHELPDLDAVVLSHLHGDHFDRVARRGLHRDLPVFTTAHAARKLRGYG
FT                   FAEAVPMPRWTQRSMSKSGDRLEITSLPGKHACGALAAVVPPVMGTLVEYLPREGDPLR
FT                   VYLSGDTVLHSDLREITDLFPDIDVAVLHLGGTKVFGRLLTMDGGQGARLLDILKPAHT
FT                   IPVHYDDYGVMKSPLSDFQVAVDQRPGVHAQYVHRGQTCPLPPT"
FT   CDS_pept        complement(73710..75083)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0054"
FT                   /product="pyridoxal-dependent decarboxylase family protein,
FT                   putative"
FT                   /function="Glutamate decarboxylase"
FT                   /EC_number="4.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0054"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99407"
FT                   /db_xref="GOA:A4F5T3"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5T3"
FT                   /protein_id="CAL99407.1"
FT                   /translation="MDLRRWLTTAVAEVERWQEEFGDFTTHPAAEVADQELGPAFAELA
FT                   ERLRDNYPFFHPRYAGQMIKPAHPAAVAGHLAAMLVNPNNHALDGGPATARMEREVVAR
FT                   LAGVFGYGPDHLGHLTTSGTIANLEALYVARETHPGRAVAHSADAHYTHSRMCRLLGVE
FT                   AVPVPTDNAGRMDLDALDSLLRTHDIGTVVLTAGTTGLGAIDPVHEALALRERYGVRLH
FT                   VDAAYGGFFTLIADDSPDGVASAPFQALGACDSLVVDPHKHGLQPYGCGAVLFADPAAE
FT                   RFYRHDSPYTYFTSAERHLGEVSLECSRAGAAAAALWLTFRLLPPTPDGLGRVLRPGRR
FT                   AALRWADLLSESPVLAPYQRPELDIVTYLPRAGRLSDIDALSAAVLEGGMTAPAAESVF
FT                   VATYGVDRPALAARGHEVEADVAVGRILRSVLMKPEHDDWLDYLHTRIEELVRTAAGR"
FT   CDS_pept        75724..75891
FT                   /transl_table=11
FT                   /locus_tag="SACE_0055"
FT                   /product="hypothetical glycine-rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0055"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99408"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5T4"
FT                   /protein_id="CAL99408.1"
FT                   /translation="MRISTVFFSGKNRNNHRGGWGWGHGWGWGWGHGWGWGHGWGWGHW
FT                   GGWWGRWWDC"
FT   CDS_pept        75994..77856
FT                   /transl_table=11
FT                   /locus_tag="SACE_0056"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /function="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99409"
FT                   /db_xref="GOA:A4F5T5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5T5"
FT                   /protein_id="CAL99409.1"
FT                   /translation="MLGAMRWLLQPAAPDSEGLVEAAPTLRVREVFRRFWPDARPFWGW
FT                   MVLSLVLVLLSPLLDGAAIWLFKIVIDDVLTPRDFALFPAVAAAYAGITILGGAIDFAS
FT                   SYLTVWIGENFLHRMRTRVFAHLHTLSVGFFDRRRLGDTISRLTGDVGAIESLVLSGIS
FT                   QTVSSLVKVVVFAGVIFYLDWRLALVALVAVPLFLWVARFFSRRIKIASREVRGRSGSI
FT                   TTVAEESLGNAPLIQAYGREQAEVGRFYRQSIGNVRAELATARIGAMFSPLVDLVEVLG
FT                   VMAILGVGIWELASNRISLGGLLAFLVYLSQLYTPVRSLGQLANTVFEASAGAERIAEL
FT                   LDQKPHVRTPDKPVRIGRTEGTLSVEQVGFRYPDTGVDVLSGISFQALPGTTTAVVGAS
FT                   GAGKSTLTKLLLRFYDPTEGRIRLDGHDLRELDLSELRSNIAIVLQETLLLDGTIAENI
FT                   RAGKADADDREVVEAARAADAHEFILDLPDGYDTRVGQRGRLLSGGQRQRIAIARAMIR
FT                   DAPLLLLDEPTTSLDAEASKRVLGPLRRLMSGRTTIVISHNLLTVADANHIVYLDHGRI
FT                   VEAGTHAELLANDSGYANLYRLHHPAEVRPNGSSSGKAERWVRP"
FT   regulatory      complement(77852..77902)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(77915..79144)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0057"
FT                   /product="monooxygenase, FAD-binding"
FT                   /function="2-polyprenyl-6-methoxyphenol hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99410"
FT                   /db_xref="GOA:A4F5T6"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5T6"
FT                   /protein_id="CAL99410.1"
FT                   /translation="MKIKCVGAGPAGLYFAISAKLRDAGHDISVIERDPPGATYGWGVV
FT                   YWDDLLDVLYGNDRESAQQLRAASTLWQEQEICLRSEDSAYLGGYGYSLGRAALLDVLA
FT                   HRARSLGVDVQYRHGVEDLSELADADLIVGADGVHSRVRQTHEQEFGTQLDVGNNPYIW
FT                   LGTDKVFDRFTFAFEETPAGWVWFHAYPSSAGISTCIVECTAQTWEALGLDSRTDEDGV
FT                   RLLEKIFERPLDGRRLISQSRGRPAQWMRFTQVRNQSWVHGNIALMGDAAHTTHFTIGS
FT                   GTRLAMLDAIGLAQCLYESESVSAALHEYDRLARAALRPVQAAARSSMAWFEHADDYLD
FT                   RDATSFAYAMASRHGLQPPWRYQLHRATQVPAVRRTMRAIDSARRRVLALRRGESLLPP
FT                   VRQQRVPLTS"
FT   CDS_pept        complement(79288..80145)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0058"
FT                   /product="putative acetyltransferase"
FT                   /function="Arylamine N-acetyltransferase"
FT                   /EC_number="2.3.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99411"
FT                   /db_xref="GOA:A4F5T7"
FT                   /db_xref="InterPro:IPR001447"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5T7"
FT                   /protein_id="CAL99411.1"
FT                   /translation="MDTGKQREGRGWDGERLDLDAYLARIGYRGDRSPTIATLRALHFA
FT                   HVTSIPFENLEIVLGRGLPLDLEPLQDKLVRRSRGGYCFEHARLFSAAAERLGFGVTGL
FT                   LSRVSMGSGKLRPATHAVPLVTTADTGERWLCDVGFGSSPLQPIEFADGTVTSHGGWTH
FT                   RLALDGGTGEWEVQRPAGDGWEDLHHFPLNPAYAIDYVVGNHYVSTHPNSPFVGRVVLQ
FT                   RMEPGVLHVLDETVLTAHRPDGSVEKRTLDAGEVAEVVAEVFGIELEAEDDAALLAHLR
FT                   RDTA"
FT   CDS_pept        80445..81233
FT                   /transl_table=11
FT                   /locus_tag="SACE_0059"
FT                   /product="transcriptional regulator, IclR family"
FT                   /function="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0059"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99412"
FT                   /db_xref="GOA:A4F5T8"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5T8"
FT                   /protein_id="CAL99412.1"
FT                   /translation="MAGNSRDAGRSVTARALSVLTAFDIDHSRLTLTAIARRAGIPLAT
FT                   AHRLVRELEHWGALHRDPEGRYSIGLRLWEIGLLSPVNSTLRQVALPFMQELCAATRDN
FT                   VHLAVRDGTEAVYVEKLTAHTSVPIVSRSGGRLPLHATSVGKVLLAHAPASLLQECCEH
FT                   GLSRHTPYTITEPGRLGRELHGVRARGFAQATEEMSLGNCSVAVPVRDATGSVVAALGL
FT                   VAHSVRAEVVKLVKPLLPAAESIRQRLLEKDPAADGVLSL"
FT   CDS_pept        81429..82067
FT                   /transl_table=11
FT                   /locus_tag="SACE_0060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99413"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5T9"
FT                   /protein_id="CAL99413.1"
FT                   /translation="MTGTPGRTAIDNEIRVCSAHVRSPLDLPSSIGKLAEQSVRVLGWS
FT                   GSLLPPLKLLGRHVVPVADLVPDAHAERLCLGSEPVLDRAEIATWVWPEMDGRVPPPAA
FT                   RVTGVLAPARHWRSALTAAVPFARFTNTAIVVPRSVTVAPDFMSTCLIRARQFGIGVLS
FT                   ADGETVQSELEGRCFDDQPPVEHTAVSRWINEVVYQQLLAVEAPAPTRG"
FT   CDS_pept        82124..82780
FT                   /transl_table=11
FT                   /locus_tag="SACE_0061"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /function="predicted nucleoside-diphosphate-sugar
FT                   epimerases"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99414"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5U0"
FT                   /protein_id="CAL99414.1"
FT                   /translation="MRVAIAGGHGQIARLLGAALAARGDSALGLVRNPDHEADLRADGI
FT                   VPIVADLEQVGADELAGRIEGFDAAVFAAGAGPGSGVARKDTVDRAASAVLADACERAG
FT                   VRRFVQVSAMGTEGPYPPDIGEVFAAYLDAKRAAEQDLRERDLDWTILRPGRLTDDAPT
FT                   GRVRIGASVARAEITRADVASVIIALLDEPASAGKILEAVNGDTPIPDGVRAAVA"
FT   CDS_pept        83325..83432
FT                   /transl_table=11
FT                   /locus_tag="SACE_0062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99415"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5U1"
FT                   /protein_id="CAL99415.1"
FT                   /translation="MTPALGWWWRPARVRICSRGLSRRARTTLSRLQRL"
FT   regulatory      83662..83707
FT                   /regulatory_class="terminator"
FT   regulatory      complement(83729..83776)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(83918..85219)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0063"
FT                   /product="FAD-linked oxidoreductase"
FT                   /function="FAD/FMN-containing dehydrogenases"
FT                   /EC_number="1.1.3.8"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99416"
FT                   /db_xref="GOA:A4F5U2"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR007173"
FT                   /db_xref="InterPro:IPR010031"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5U2"
FT                   /protein_id="CAL99416.1"
FT                   /translation="MTRWTNWAATETADPARVVAPRDAEEAASEIRAAVEAGRRVRPLG
FT                   TGHSFTGVGAPEDGGVALDLSHWTGVVGVDGELVTVRAGTPLHRLNHELDELGLAMANL
FT                   GDIDRQTVAGAISTGTHGTGAALGGLATQVEAVELLLADGSLRRCSATEAPELFAAARV
FT                   GLGALGVVHTVTLRCVPAFDLSADEHPERLDSVLERFDELARDNDHFEFYWFPHSSNTL
FT                   VKRNNRLPTGTRPEPLGRLRHFVEYEIVENRLFGALCRIGRGIPATVRPFNRLSGAVLS
FT                   ARSYSDRSHRVFVTRRDVRFVESEYAVPVEELGAVIGELRSAVGTLEHPVMFPIEVRVA
FT                   AGDEVWMSTAYRRPSAYIAIHQFVGMPYRHYFETFESIVASVGGRPHWGKMHRLDAAAL
FT                   RSRYPRFDDFLRVRKSVDPGGAFGNSYLDRVLGA"
FT   regulatory      complement(85249..85308)
FT                   /regulatory_class="promoter"
FT   CDS_pept        85308..86507
FT                   /transl_table=11
FT                   /locus_tag="SACE_0064"
FT                   /product="amino acid aldolase or racemase-like"
FT                   /function="predicted amino acid aldolase or racemase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99417"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5U3"
FT                   /protein_id="CAL99417.1"
FT                   /translation="MLKALPESRRLDTATIELDPPFAVADLDAFHRNAADLVRRAAGRP
FT                   VRVATKSVRCRELLRRTLTTPGFAGLMCYSLAEALWLHGDGLSEDVLVAYPTADRGALR
FT                   QLVARPTAAAAITIMVDSVEHLDLVDAAVGTRRPEIRVCLDIDASWRPLPAMHIGTRRS
FT                   PVHTAADARRLAEAVVRRAGFRLAGLMAYEGQIAGLGDAPPGSPLRGAGVRWMQRRSAA
FT                   ELAGRRAEIVTAIRELAELEFVNGGGTGSIETTTAESAVTEVAAGSGLVGPTLFDAYRS
FT                   FRPEPALLFALPVVHRPGGRVATVFGGGYIASGPVGADRAPTPYLPTGLKLTAVEGAGE
FT                   VQTPVAGHAARRLRLGDRVWFRHAKAGELAERFNEYHLVDGDRVADSVPTYRGEGRSFG
FT                   "
FT   CDS_pept        complement(86477..87055)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0065"
FT                   /product="TetR-family transcriptional regulator"
FT                   /function="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99418"
FT                   /db_xref="GOA:A4F5U4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR041674"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5U4"
FT                   /protein_id="CAL99418.1"
FT                   /translation="MLEACAQLIDEVGYDGLSTTLIAERAGVAVGSLYQFFPDKRAVVQ
FT                   ELTLRNLDRFVRTVSARFEGVEMAHWWDAVDAVFDVYMTMHREVPGFSRLHFGDVVDLR
FT                   LLDASKDNNTVIAEKLTSLIAAEFDLEAADLMLPLSVAVEAADAVLHLAFRRDPAGDPT
FT                   LVTEARELVRGYLANRLPDDQPKDLPSPR"
FT   CDS_pept        87704..91024
FT                   /transl_table=11
FT                   /locus_tag="SACE_0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99419"
FT                   /db_xref="InterPro:IPR007817"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5U5"
FT                   /protein_id="CAL99419.1"
FT                   /translation="MDGWRRRDLWSPLAVAEANAMLRDGAYGLRVEPAPWRLTGPGAGV
FT                   GLPLGEAPTWADLYRALVRLRRTRRTHDPAWLHRLTRTLSGEVPAAGATRWVAVPPDRL
FT                   ERLTADCGTDLRHFLAPLVASDGSMLFPASGGGLERPDLVVDDNGGVITVRGEAGPPVR
FT                   LRATDLGGARSQLSNWSALAAAVESDPVLRMHCAAQAVPAALADADSVLLLQGIEPSPR
FT                   HPGHPGGTVVAGLPALLRPTAGGRAGLLRLVIENRFEHREDELGYFLDHLVRPLLRTFR
FT                   LALDDHRLALLSLNPDGAGFELSTELQLTGRAVVTDPGEVRPEPTGAEVTAAADGLTRT
FT                   LDELTAGFAAIGFAGGGHPHAAVRAAVDQVTAEELRFLRPRTAELLAGDHGLRGFAHSV
FT                   PEDQDRVLKEVLHAVEERTRKRRWKRDLPQPVVVIDLDLCGILPMRRTLDAARAVSGPR
FT                   PGAPEGILELARPGSLPVLPNFSESAWDNFVDLSGLGRKYPTVDWRQVHAEFFRAFSRP
FT                   WERLRTDTVNPGLARFVWDVHDGGGRVVFCTGRRERVRAHTEAVLAAAGVPDAALLCMP
FT                   DDRTRPISELKVEKLRELGDIDVVAVFDDLQRNRVALTEEFTGARAVAVEIPGMATERR
FT                   PGQPLGDQAPVISTFETVPRRAAPSLSNTHSLEELQIGAMRRNRISRDWAVHLSERETL
FT                   SLVGSVLADADRSAARTARGARVKFGLDQGEPGFEQVIRALHHVFTRKQFLKGSRSNYR
FT                   WEDMLRDAGPFVSRDEPLEIVLLGFPVKQCLNRLKAFGPLPDLAELGGLARLRELRQAV
FT                   SAVYPPGVHFNILTDGRHFRPRPAAITGAYSRKLREYVRLVGIDDCTTVEEIDTVARQR
FT                   LGPDLPARRAARLARYRAEIYQALQGLDITANPLRTLDGVDHRVSMMDGALGESMRLFR
FT                   EMLMSVVYSVPVTVPAGVDRLTWSTLVYADIYNTADPAVPDEVRRGRAAVLSRAWHTVV
FT                   RYLATLRVDEELGYEELFPHRVRLTVSAARPGRCGFTYLGGSGLLPWQGTGVLDPRGHV
FT                   AVDFAIAVLDQGFVPVYSPLLGPRQPLMMVPAQHTRPSASGGLRLDDALAERVRLRRK"
FT   regulatory      91095..91144
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(91437..91775)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99420"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5U6"
FT                   /protein_id="CAL99420.1"
FT                   /translation="MDEILGQVLRNAVWERLDVLTELANRADAPSLLAVARSELPRLTE
FT                   GWRTLLSAHDADEKGNCPECSSRWRPCKAPCTVWRSAYEHLVSGALAPRPARHLRPAHA
FT                   LREVAPVP"
FT   CDS_pept        complement(91789..92040)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0068"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99421"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5U7"
FT                   /protein_id="CAL99421.1"
FT                   /translation="MDSTEQQGDPAGPAESSGGAGDRTRWWRFHCRDATNAPRDLTVLV
FT                   NRDKVVLVGPPGETAVLSTGGAGELSTALRAAAEQARK"
FT   CDS_pept        92323..93633
FT                   /transl_table=11
FT                   /locus_tag="SACE_0069"
FT                   /product="regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99422"
FT                   /db_xref="GOA:A4F5U8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5U8"
FT                   /protein_id="CAL99422.1"
FT                   /translation="MRDALANRNISEVYKQLRRHGVSQRQIAASTGQSQSEVSEILKGR
FT                   QVMAYDVLARIADGLGIPRGYMGLAYDGATAVRVANSTSDSQAEEDESVKRRKFLSHAA
FT                   AVTMGAAVFGAEESSWVPASAQTPAPGRIGMTDVQQIQAATKALRDLDYRYGGGTCRDA
FT                   VVAQLSWAQQLLEATATDQVRRKLFVSLADMHSLAGWTSFDTGLLDPARGHFGKALEFA
FT                   KQAEDDSLVASVLYRMGRVYLHYQEPNEALKLFQLGQIAAQESGSALTVAVLCANEAWA
FT                   YGMLNKPDQVQKMVGRTKDEFARADVNDAPDWVRFFTENDLHGMIGSANDALAVFDPDR
FT                   YAPIAVAETIKCNEAYGTDMQRTHVFGLSLQATNHIRAGDLQQGIKVGRTALAIGEKVK
FT                   SARVADRLRPLELEAGRHRMNSDARDLSEEIRRFREV"
FT   CDS_pept        93764..94654
FT                   /transl_table=11
FT                   /locus_tag="SACE_0070"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0070"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99423"
FT                   /db_xref="GOA:A4F5U9"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5U9"
FT                   /protein_id="CAL99423.1"
FT                   /translation="MEDGRYTRPKLALALAEICAAVGLDSRDARLLRFVNNGVFLLERE
FT                   QVIVRIVLAPSFSYRAVNVVEAARWLAEHDVPAVRLLPGIRQPVRVGGHLATLWRSVPD
FT                   TGARPTGAHLGRLLRRVHSLPRPTTLPEWRPMEDVRRRLFDAEELDSDDRYFLEQRCDD
FT                   VEQRLDALRFPLPRGVVHGDAHLGNLIVTPGGPVLCDLDSLCVGPPEWDLTPMAVGRLR
FT                   LGHPPERYEELARAYGFDLLAWEGFQVLRDLRELKITVSVLPILRSNPGIRGELRRRLR
FT                   TMRAGDVTAQWAPYN"
FT   CDS_pept        94800..95108
FT                   /transl_table=11
FT                   /locus_tag="SACE_0071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99424"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5V0"
FT                   /protein_id="CAL99424.1"
FT                   /translation="MEIANMRRAKLVPRWRGKRALRSAQVLDDVVNAQVALLPQLSPEA
FT                   RQRSADHLAEMVMLGQAYRHYAAGWISRRELERRGKAALRRMESTKRPPLEQLTERE"
FT   CDS_pept        complement(95113..96060)
FT                   /transl_table=11
FT                   /gene="mphB"
FT                   /locus_tag="SACE_0072"
FT                   /product="macrolide 2'-phosphotransferase"
FT                   /function="predicted aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99425"
FT                   /db_xref="GOA:A4F5V1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016259"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5V1"
FT                   /protein_id="CAL99425.1"
FT                   /translation="MIERARAHGLRVRPVSVDETGWDFRVVHAVDDDGVRWVLRAPRRP
FT                   EVARLIDVEARVLEHLRPRLAVALPDWEIRAADLVAYRRLPGRPMADEDPLTLAFDWRA
FT                   EPTDAFFRALGEVIAELHRTPVAEAARLGVPVSSADQQRAEVARQLREARARLPVPAHE
FT                   VRRWERWLADDRFWTAETRLVHGDLHFGHTLVDGSGALVGLLDWTDAAVADPALDFAAP
FT                   RLAFGPDGLDRLLGHYAEAGGTVPELFGEHIAEHTAFRSSALLGLHGLRLGNPGYVAIA
FT                   RARLADQDRKRSARTKSCAVHQELFRDAKNRDCR"
FT   CDS_pept        complement(96483..97013)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0073"
FT                   /product="probable copper resistance protein"
FT                   /function="uncharacterized protein, homolog of Cu
FT                   resistance protein CopC"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99426"
FT                   /db_xref="GOA:A4F5V2"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5V2"
FT                   /protein_id="CAL99426.1"
FT                   /translation="MRRFVAVAALSLTALLGGAGTALAHNVLIGSDPTEGAQLEVGPQQ
FT                   VRLTFDQPVRAGEGYNTVNVVGPDGTYWTDGAVQVDGTSVTAPVRQLGPAGTYTVGYRI
FT                   LSADGHPVPGKVTFTLTKPGGGTPAQPPQAQQEQQSAESGGMPVWPWVLGAVVLVGVGL
FT                   TLALRMGRPTGKN"
FT   CDS_pept        complement(97010..97768)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0074"
FT                   /product="hypothetical protein"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99427"
FT                   /db_xref="GOA:A4F5V3"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012533"
FT                   /db_xref="InterPro:IPR038507"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5V3"
FT                   /protein_id="CAL99427.1"
FT                   /translation="MSPKSARRILSRSTASAAVVGIVALASAGTASAHVSVNPDGEAAK
FT                   GGHAKVAFRVPNERDGSGTVKIRVSLPLDHPLGSVRTKPMPGWTAQVEKVALPQPVVVA
FT                   GAQVTEAVSAITWTAQPGNRIAPDQFDEFEATLGTLPTDTDQLLLPTEQTYDNGEVVRW
FT                   DAPTPPGGEEPEHPAPTLELVEDSEGGHGQHGQPGQQGQHGTAEQAEPAHAAQSADDTA
FT                   RYLGGAGLGVGALALGIGIGALARSRKARS"
FT   CDS_pept        complement(97869..98423)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0075"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99428"
FT                   /db_xref="GOA:A4F5V4"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5V4"
FT                   /protein_id="CAL99428.1"
FT                   /translation="MTIQLTPAKGALRVLRGAGLAITSASLSVAAHMTSGGSLPDPGTT
FT                   ALITALLSGAGVALAGRRRGLPSIVGALAVAQLALHVFLQLAGSHQGTPGHLVAPFDPV
FT                   GMSAGHALAALLTAVLLARAERALFVIARLLGLFLPPSQPRLLTVTKPGVIRAPARPVR
FT                   IPSHQAHLRRHPLRGPPAHSW"
FT   CDS_pept        98700..100385
FT                   /transl_table=11
FT                   /locus_tag="SACE_0076"
FT                   /product="glycine betaine transporter, BCCT family"
FT                   /function="Choline-glycine betaine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0076"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99429"
FT                   /db_xref="GOA:A4F5V5"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5V5"
FT                   /protein_id="CAL99429.1"
FT                   /translation="MTDHPRTDWVVFGVTAAIMFGLVSWGVLATDSLSTSSQAAFSWMM
FT                   SNLGWGFVLAATGFVVFALFLAFSRYGRIPLGQDGEKPEFRTISWIAMMFSAGMGIGLM
FT                   FYGVSEPLSHFVDPPPGSVPGETDEAIKTAMATSLFHWTLHPWAIYAVAGLAIAYSSFR
FT                   RGRKQLISAVFLPLIGKRNAEGPIGRLIDILALFATLFGSAASLGIGTLQIKSGMQAAN
FT                   WIGETGTTILVLIIVVLTICFIASAVSGVAKGIQWLSNINMVLAALLAVFVFVVGPTVF
FT                   ILNLLPTTLGSYLSDFGEMASRAGATGGPDMLDWLSSWTVFYWAWWISWTPFVGMFIAR
FT                   ISRGRTIRQFIGGVLLVPSVVSLVWFAIFGGAAINTQQGGQPVYGDGSAEAQTFDVLAH
FT                   MPLTLVTSVLVMVLVAIFFVSGADAASVVMGTLSQRGSIEPSKWVVIFWGAATGAVAAI
FT                   MLVIGGGQETALQGIQNLTFIGALPFAIIMVLMCVALMRDLRSDRITLREEKGAEVLEQ
FT                   AVIIGTEEHDGDFQLEVSPAEPSENGDESEDDADSKAKSASGSE"
FT   CDS_pept        100390..101037
FT                   /transl_table=11
FT                   /locus_tag="SACE_0077"
FT                   /product="ABC quaternary amine transporter, permease
FT                   component"
FT                   /function="ABC-type proline/glycine betaine transport
FT                   systems, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0077"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99430"
FT                   /db_xref="GOA:A4F5V6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5V6"
FT                   /protein_id="CAL99430.1"
FT                   /translation="MGFLDYVASRWQLLLVDSYQHASMVVQCIVLATIVGVLVGVAVYR
FT                   SPAGAAIATALSSAVLTIPSFALFGLLLPFLGLGVAPSVVTLVLYALLPIVRNTIVGLS
FT                   TVDQPILDAARGIGMSRFGVLTRVELRLAWPAILAGMRVSTQMLMGIAAIAAYAKGPGL
FT                   GNLVFSGLSQLGGANAVNMALAGTLGVIVLALLLDAIFVLIGRLTTSRGIRG"
FT   CDS_pept        101030..102205
FT                   /transl_table=11
FT                   /locus_tag="SACE_0078"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /function="ABC-type proline/glycine betaine transport
FT                   systems, ATPase components"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99431"
FT                   /db_xref="GOA:A4F5V7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5V7"
FT                   /protein_id="CAL99431.1"
FT                   /translation="MADNDIEMPGHGVEICLEEVSKRYHGQKQPAVESVTMTIPAGETV
FT                   VLVGPSGSGKTTTMRMINRLIEPTSGRITIGGQDVLGLDPDKLRREIGYSIQHAGLFPH
FT                   MTVGENVGMVPSLVGWDKSRIVERVEEMLDLVGLDPSEYRTRYPRQLSGGQQQRVGVAR
FT                   ALAANPPVLLMDEPFGAVDPITRGVLQDELMRLQADLGKTIVFVTHDFDEAVKLGDRIA
FT                   VLGDRSKILQYDTPEAILANPADDTVAGFVGAGAALKQLTLRRVREIELGQVPTAQADE
FT                   PPWALRERLGTRRGAIGLVLDKRKRPLRWATAREAGAVSSLDRAGRPVEDSVSPASTLQ
FT                   DALEAILTDDDGVAVVTGSRGEYVGVVDIDTVMNTIKALREEYADDQETES"
FT   CDS_pept        102202..102969
FT                   /transl_table=11
FT                   /locus_tag="SACE_0079"
FT                   /product="probable ABC quaternary amine
FT                   transporter,permease component"
FT                   /function="ABC-type proline/glycine betaine transport
FT                   systems, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0079"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99432"
FT                   /db_xref="GOA:A4F5V8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5V8"
FT                   /protein_id="CAL99432.1"
FT                   /translation="MSSQYASDSGSRRAERLRLLLQPVAVLAIVGSVLGWAFSQDLDEV
FT                   TARSINATNIVSLTWQHFLLSLAVAVIVVVVAVPMGVLLSRPWARRVSPVVIGIANVGQ
FT                   AAPSVGLLVLFFLATKGSTGFWIAVLPIAVYALLPVLRNTMVGLQQVDRSLVDAGRGIG
FT                   MSAVKVLLRIELPLSVPYILAGLRTALVLAVGTATLALFVGAGGLGELIDTGYKLNNWT
FT                   VMCVGSVLAMALALLVDWLAALAEEYLSPRGLR"
FT   CDS_pept        102966..103961
FT                   /transl_table=11
FT                   /locus_tag="SACE_0080"
FT                   /product="possible glycine betaine/carnitine/choline
FT                   binding protein precursor"
FT                   /function="glycine betaine/choline-binding (lipo)protein of
FT                   an ABC-type transport system (osmoprotectant binding
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99433"
FT                   /db_xref="GOA:A4F5V9"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5V9"
FT                   /protein_id="CAL99433.1"
FT                   /translation="MNRRTALKLMSAGMAGMLVGGCGLSSGSAVPLPVAPGSIRPVPEL
FT                   EGVRITVGSKDFTEQIVLSYIAQFALDAAGANVRDLSNITGSASARNALASGQIDVLWE
FT                   YTGSSWISYNGNTDPIPDARRQYEAVRKLDLERNGIDWTAVTFDVDNTYAFAMTQEAAK
FT                   RLGVSKLSDVRRVVAENPQDATFCVDTEFASRNDGMPGVEQTYGFRADPAKIKTLTSGS
FT                   IYQATASGTCTFGEVFTTDGRIRSLNLKVLDDDRLFFPRYNLGVTLRADMLRQYPQITD
FT                   VLAPVSAQLNNVELMKLNAQVDVEGRDPADVARDWMVEKGFVTLPGRAAP"
FT   regulatory      complement(103828..103864)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(104011..104319)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0081"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0081"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99434"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5W0"
FT                   /protein_id="CAL99434.1"
FT                   /translation="MRAGFRFRHLPDADDVHALQGFRVLSGAMDVYLARAADDALGARY
FT                   RLEDLQGPSPAALWHRHGTVAEVVTALLELPEHGTPKAPKLAHARPDGLWVPHGANP"
FT   regulatory      complement(104491..104523)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(104560..105042)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99435"
FT                   /db_xref="GOA:A4F5W1"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5W1"
FT                   /protein_id="CAL99435.1"
FT                   /translation="MALVRLRGPNAADRPAAWRRSLSEVLAVAGTAPWLWMVLTPKAGD
FT                   RAVSPVPLRDLLELLGARPVAIAVQLTLNLLVLAAFGAALPVRFAAMAGPARVAVAAAC
FT                   AAASIELAQYALHLGRVTSVDDVLVNTACAVFGALLTRRWWKSPQVTGKSAEQADR"
FT   CDS_pept        complement(105198..106013)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0083"
FT                   /product="probable lipase"
FT                   /function="predicted lipase"
FT                   /EC_number="3.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99436"
FT                   /db_xref="GOA:A4F5W2"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5W2"
FT                   /protein_id="CAL99436.1"
FT                   /translation="MTVSELDHKATGYSTRQAYWLARAAELTYQDEAAMRSETQKWGFD
FT                   RFHYFYTQHHELPIEDTQGFVAASDKMIFVAFRGTEPTNIKDWLTDASGPASPGPGAKG
FT                   FVHLGFHQALMSVFPEIEDKIAEFSSNGQTLWITGHSLGGALAMLAAAQLHFEDPRLLP
FT                   DGVYTFGQPRTCDRLLANAYDGALKSRTFRYVNNNDIVPQVPPEPVYHHVSTLRYFDSN
FT                   GRLREKNSLLGGLDDKAKGLTADMFAPGTDGLRDHSMAKYVELLERNAN"
FT   CDS_pept        complement(106145..107527)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0084"
FT                   /product="drug resistance transporter, EmrB/QacA family"
FT                   /function="77 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0084"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99437"
FT                   /db_xref="GOA:A4F5W3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5W3"
FT                   /protein_id="CAL99437.1"
FT                   /translation="MTPTVEITAPPRRRLLLWVMCVGMFLVQLDVTVVNVALPRIGAEL
FT                   APDLSAQQWVVDAYAVVLAGLLLAGGAVGDRYGHRRVVLAGLGVFAAASLACGLAPDIA
FT                   VLVGGRAAQGLGAAMLLPSTLAVITRAFPDRAEQARAVGVWAGTSALALPAGPLIGGAL
FT                   VSTLGWRSAFLVNLPVIAVALPLAYGVVAESADRGVRSLDLPGAALATAGLAAPVYAVI
FT                   EAGAAGMTTSAWGALAISALAVTGFLLRESRAPQPLLPLRLLRSRRFSGANLVAAAMNL
FT                   VGIGTVFVTTLYLQGVQHRNAATAGAMLLPLFVPMAALAPVTGRLTGRFGPRPPMTAGL
FT                   VIGAAGAASLVGITPDSGYARLLPALLGLGTGMGLLTAAVVAAAVRAVPADRAGLAGGV
FT                   NNTARQTAGALAVAVFGGITGGPADAVRFTGGLHLLGLLSCALWISALALTWFAIPAEK
FT                   AW"
FT   CDS_pept        complement(107633..108427)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0085"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /function="predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0085"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99438"
FT                   /db_xref="GOA:A4F5W4"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5W4"
FT                   /protein_id="CAL99438.1"
FT                   /translation="MGVGERRGGPGLGAGGDADFTTPAELIGNPARSAMLLALLDGRAL
FT                   PMSMLASEAGVAPSTASAHLSRLVSGGLLRVRGQGRHRYYELASAEVVAALEALARLAP
FT                   PRPVRSLRAGTRAHALRLARTCYDHVAGHLGVALMQALLEAGAVVGGDGRHDPRVARLD
FT                   RLSAPGRDLDYRLTDAGWELFSRLGVVVPSGRRRLTAYCVDWTEQRHHLAGAAGSALLT
FT                   RFEELDWVRRGAKGAPRALGVTDAGRLGFAEHFAIDTEALAA"
FT   CDS_pept        complement(108471..109115)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0086"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99439"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5W5"
FT                   /protein_id="CAL99439.1"
FT                   /translation="MRRSAKKRARSPRLGCTRTAGRSHKALWMAEPADRADKRATRSQK
FT                   QRTKALKRQIKAEEKRLELQERGEGGRVTAGNAKKVIAVARVVVPVLAPFALRASVAVR
FT                   AYYDRMRARRLGVPVDDLGRFTGKGAALHARIAGDRDALRDIRTQTVGRSEEEVFAVDQ
FT                   YAEETDGRLGQLASAVRAAERMPAQRRRAAHRAIDGELKRLEGHLLRRLGV"
FT   CDS_pept        109281..110915
FT                   /transl_table=11
FT                   /locus_tag="SACE_0087"
FT                   /product="hypothetical protein"
FT                   /function="predicted nuclease (RecB family)"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0087"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99440"
FT                   /db_xref="InterPro:IPR019993"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5W6"
FT                   /protein_id="CAL99440.1"
FT                   /translation="MDDRVLLDAGVVTRCRRRVHLESDPAMREVEKAPPDPGIEQRIAD
FT                   ATEHRRFVAERLGRLLGDAWTEVPRELDAAERERLTVAAMNEGVRYISGAQLPLDRANG
FT                   RRGAVDLLVRGRDGYLPVLVVRHKITDPGSGARTSPLTDPNPASARTDERFKVRSHSRD
FT                   QLRLAHAVRMLEATGMGSAGATGGVIGVDADLVVWHDLRVPNWPGGRTALAEYDARFAD
FT                   RLAVASAAASGAEPLARPSRITECKGCPWWPTCERQLRTDRDVSLVVRGEDAVSLRAIG
FT                   VSTVDELARLSPEALETLPLTVARTGDVVLLAKAWLRELPLVRRVRRLSVPRADVEVDV
FT                   DMESYADSGAYMWGSWLSGADVGEEPGYRAFATWDPLPSDDEARSFAEFWSWFSSVRER
FT                   ALERGLTFRAYCYNELAENRWMLASAERFAGKPGVPPVAEVRAFIESDEWVDLFASVRD
FT                   QFLCPNGKGLKVIAPSAGFAWRDPEASGENSMRWYRDAVGLDGAPPVAAQRDRILRYNE
FT                   DDVRATWTIRRWMNSEAALAVPFAEDL"
FT   CDS_pept        complement(110943..111611)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99441"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5W7"
FT                   /protein_id="CAL99441.1"
FT                   /translation="MARKKPEWPEENAGTVRKYANRFDHEGALETLDMIRDELFGDSEA
FT                   MEALARQWGSDNTMTDSGLEIQRASNELAGYWQGGGYDAYTKHEFAVRGLFTNNETQMN
FT                   GISDVMLDCVELIYGTYADALRFISSCAHDLVSFSLADLIPGAGTIVKIIQVLNDFVKN
FT                   VSDLVAAAIEKMGTLMVKKGKLTTFANDFSGLGTDTGGPLVMPGAAGNPDAWNVKPIEA
FT                   "
FT   CDS_pept        complement(111623..111985)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99442"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5W8"
FT                   /protein_id="CAL99442.1"
FT                   /translation="MPGQVEGTGYSVVPESLRGTTTAWEESRDRWLLLASRMETEFYMP
FT                   DNAMGLLGREQNFPRTYNEARATIGRKLAEGADVLGGTSTDLDRVADEYEDRDYEYYKK
FT                   FGYLNDEMDDRVSGSF"
FT   CDS_pept        complement(112001..112315)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0090"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99443"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5W9"
FT                   /protein_id="CAL99443.1"
FT                   /translation="MSERMRRLVMLVDEMEESIVRARQAAETAAEHSYSMEIADDLGTV
FT                   VVDSSGRLVSIELDQENLRYTNAEALGPRLLEAVLAAERGAERASRQILESAGRTTRPN
FT                   "
FT   CDS_pept        complement(112312..112632)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0091"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99444"
FT                   /db_xref="GOA:A4F5X0"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5X0"
FT                   /protein_id="CAL99444.1"
FT                   /translation="MDNSRYDPDLRREQLQRWQRKAAELEYYAERLAEERFTGTSDSGL
FT                   VTAEVDGNGRLLDISVSDEALEQAHPQNIGPDAVEAIAQARATAAVTAMSWTESVVGEV
FT                   SA"
FT   CDS_pept        complement(112868..113626)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0092"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /function="8 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /EC_number="1.1.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0092"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99445"
FT                   /db_xref="GOA:A4F5X1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5X1"
FT                   /protein_id="CAL99445.1"
FT                   /translation="MLITDTAAIVTGGASGLGAATARSLASRGARVFAVDLPQVITKAP
FT                   VVDGVNYVGADVTDAEQVQTAVDQAAGGGVPLRIVVNCAGIGPSARVVGRKGPHDFDLF
FT                   RQVIEVNLIGTFNVLRLAAAAIGQTDADEQGQRGVVVNTASVAAYDGQIGQAAYAASKG
FT                   GVASLTLPAARDLSSSGIRVMTIAPGIVDTPMLATISEEFRKGLADSVPFPKRLGTPED
FT                   YAQLVVGIVEHDYLNGEVIRMDGALRMPPR"
FT   CDS_pept        complement(113835..113954)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0093"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0093"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99446"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5X2"
FT                   /protein_id="CAL99446.1"
FT                   /translation="MELIAFAAVFVGLALLAALPLMALLLLADTPSRHPDHDR"
FT   CDS_pept        complement(114171..115133)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0094"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /function="predicted oxidoreductases (related to
FT                   aryl-alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99447"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5X3"
FT                   /protein_id="CAL99447.1"
FT                   /translation="MEQRRLGESGLVVSAVGLGCNNLGRPGTATESLSGAREVVNTALD
FT                   CGITFFDVADVYGSPRGRSEELLGQALSGRRESAIIATKFGMDMQGYNGPDFAARGSRS
FT                   YVRRAVESSLRRLGTDWIDLYQLHRPDPVTPLEETLSVLDDLIREGKIRYVGHCNLAGW
FT                   QIADASWTATAAGLATPVSAQNHYSLLAREAEREVIPACQKFGVGVIPYFPLANGLLTG
FT                   KYRRDQEPPEGSRLAGRDQLLADAPWERIERLRAFADQRGVQMTAIAVGWLAAQEAVGS
FT                   VISGATTAEQVRANAAAGQWRPTPAEMEEIDALCPPLRR"
FT   CDS_pept        115409..116599
FT                   /transl_table=11
FT                   /gene="rkpK"
FT                   /locus_tag="SACE_0095"
FT                   /product="UDP-glucose 6-dehydrogenase protein"
FT                   /function="predicted UDP-glucose 6-dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0095"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99448"
FT                   /db_xref="GOA:A4F5X4"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5X4"
FT                   /protein_id="CAL99448.1"
FT                   /translation="MARGEVRILEPGLAELVGEGLAAGRLEFAVGSAAAVAEAEVVFLC
FT                   VPTPMGSGGAADLAAVESVVAEVGELLPAGCVLVCKSTVPVGTSARVAELVGRADVAVV
FT                   SNPEFLREGSAVHDFLNPDRIVVGSDSQDAAERVAALYARLGAPTVLTDAASAEMVKYA
FT                   ANCFLATKLSYVNAVAELCERLGADIADVTEGMGFDRRIGQSFLQPGPGWGGSCLPKDT
FT                   AALMRVAESVEFEFGLLRETIAANARQRERMVDKVAEACGVGAGASLRGVRLGLLGLTF
FT                   KAGTDDLRDSPAMAVAGLLAARGAELVAYDPGLRGDEPGVAELVTLVDDPYQAAKGAAG
FT                   LVVLTEWQEFRTVDWTRVAGLLEGPVVVDTRNHLDPDVLRRAGLSWRGVGRTPVTP"
FT   CDS_pept        117071..118876
FT                   /transl_table=11
FT                   /gene="ggt1"
FT                   /locus_tag="SACE_0096"
FT                   /product="putative gamma-glutamyl transferase"
FT                   /function="Gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0096"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99449"
FT                   /db_xref="GOA:A4F5X5"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5X5"
FT                   /protein_id="CAL99449.1"
FT                   /translation="MFTTRPELAGTHGMVASTHWLASAVGMAVLEDDGNAFDAAVAAGF
FT                   VLQVVEPHLNGPGGEVPALFATAEDPRPRALCGQGPAPRGATIRHYRDELGLELVPGTG
FT                   FLATTVPGAWDGWLTLLRDHGTKSLRDVLKYAIGYARNGYPAVERIATTIATVREMFTE
FT                   HWPTSAELWLLPGGEVPRPGALLRNPALAGTWERLLAESEAAATGREARIDAARRAWSQ
FT                   GFVAEAVEEFVRTPHRDNSGRDNAGVIIGQDLADFEATYEDPLTADLPGGWTLAKFGIW
FT                   SQGPALVQQLRMLEDAEVGYADGVADAATVHAAAEAAKLAFADREAWYGDSAEEGVLED
FT                   LVSRDYAASRRALIGERASMELRPGAPGGRRVRLPGFVAQERGAGGPKDPSGVGLGEPT
FT                   VSPTGESRGDTVHIDVVDRWGNMVSATPSGGWLQSSPAIPGLGFCLGSRAQMFWLDEGL
FT                   PNSLAPGRRPRITLSPSLALRDGVPVLAFGTPGGDQQDQWQLCFWLAHVRAGLNLQEAI
FT                   DSPAWHSGAFPSSFYPRTWEPGRLVVESRLGEDRIAELRRRGHDVLDGGPWALGRLSAV
FT                   SRDPETGTLRAAANARGAQGYAAGR"
FT   CDS_pept        119077..121176
FT                   /transl_table=11
FT                   /locus_tag="SACE_0097"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /function="predicted signal transduction protein containing
FT                   a membrane domain, an EAL and a GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0097"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99450"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5X6"
FT                   /protein_id="CAL99450.1"
FT                   /translation="MSDTGLHADTDQPVGPLGRALRDYAVFTLDPDGLVTSWNLGAELI
FT                   IGATASEVIGRSAAVFHTAEQRAEGHPEWVLEQARKLGSHVDEGWRVRKDGSLFWAHVV
FT                   TTALWSSKGELRGYAKVARDDTVVHNKLEQSSRRLEQSSRLFRDLFSLTPVALGLFDRH
FT                   GTVLDCNMAMCELFGHLPERLRGSHATALIPQDAPAREQLVEAFARGVPPDGESVQECR
FT                   LVRSDGEPVFCELHIARAEEDSGEPFWVVVFEDVTDRYREAESLRYWAYHDELTGLWNR
FT                   AAIPDLLADAHPDRAAVLYCDIRNFSRVNESLGYPAGDEVLVALARRLEEHLPEGWPVA
FT                   RAAGDEFAVICPDVEEAGGIAAVATTVSRVMHAAIEVRGERIQVSSMIGAAVASESGGR
FT                   GEDLVRLAMSALVRAKKTGRVGISMAEPALIDSLEGRLRLEAELRRALDRDELTLHYQP
FT                   QVGADGTIRSAEALIRWPHPQRGLLHPDVFLPIADQNGMMPDIDRWVVRRALRDAARWP
FT                   APRDGEPVAVSLNIGELMPGYPIFTDLLERAVTETGIDWSRIIVELVETAIVDLPSRVR
FT                   AGMAELTGRGVRFAVDDFGTGYSSLSRVRDFPAQIIKVDRTFVSEITTSPYDFVVVKAV
FT                   TDLAGALGCSCVAEGVETVGQFDRLRSIPIERYQGWLFSKAVPSAELADLIEAGPIRPA
FT                   LAVAE"
FT   CDS_pept        complement(121204..122355)
FT                   /transl_table=11
FT                   /gene="glxK"
FT                   /locus_tag="SACE_0098"
FT                   /product="glycerate kinase"
FT                   /function="Glycerate kinase"
FT                   /EC_number="2.7.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99451"
FT                   /db_xref="GOA:A4F5X7"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5X7"
FT                   /protein_id="CAL99451.1"
FT                   /translation="MRFLVAPTGFKECLDAREVADAIGAGIRRVVPRAVVDAMPLIDGG
FT                   EGSARQLAGTTGGELVPVVVTGPVGEPVRSHFALLGGDGPRTAFVEVAAAAGLSLVPPG
FT                   RRDPGLTTSRGVGELIAAALDAGTTRVVVGCGDSGICDGGAGALQALGAGVLDSTGRPV
FT                   GSGGYALARARRIDTSGLDPRLRGVKLVIAANPSNVLTGPHGVARVFGPQKGATPAQVE
FT                   EMAAAMSIWADLLRGHGGARIADLPGSGASGGLGAGLAAGLGGTLRSRFDVLFDQADLD
FT                   RRLAVADLVITGEGAIDASTARGKVPAEVARLAKRRGKPVLAITGTIGPGAESSYDIGI
FT                   DAIAGILTGPVDLADAISRAPELISDATARTLRMLLLGRSLAA"
FT   CDS_pept        complement(122370..123881)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0099"
FT                   /product="integral membrane transporter"
FT                   /function="Di- and tricarboxylate transporters"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0099"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99452"
FT                   /db_xref="GOA:A4F5X8"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5X8"
FT                   /protein_id="CAL99452.1"
FT                   /translation="MNVGQQGGDHRIAGRVHGDERGVDYRTPARPRAAEPPRRETGWAV
FT                   GLTAAALALLGGVSLLLLPAEQARAAGTVLVFAAAVAGWISKRFDDTHVALAAAAAVVA
FT                   IGALEPDEMFETLGSEQIWLLVAAFVLAAGISRTGLPARLAVSLICRARSARALVHLVS
FT                   AGLVVTALLIPSTSGRAALVLPVFTALASAFAGRPRLVRALSLLFPTVVLLSAVATLVG
FT                   AGAHLITSQILDEATGAGIGFAQWLLWGLPLAVVSSHVAAELVLLLFTRRADRTARLRV
FT                   DGAGLRERMGIPERVQRHELRAAALLGAVVVLWSTESLHPFPPALVALAGALLITAPKV
FT                   GTVRIGAAVSEIPWSTLLFMAATTALGLALTESGAASWAAELLLSGSGSTLLVSVVVLS
FT                   TLAHLLVQSRSARSSVLIPLVVPAAAAAGMNPAALAFASTAAAGFCHTLPSSAKPVAMF
FT                   AAVPDVPTYTARDLLKLSALLAPVLAALVLLFATQVWPVLGLPLR"
FT   CDS_pept        complement(124047..124961)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0100"
FT                   /product="permease of the drug/metabolite transporter (DMT)
FT                   superfamily"
FT                   /function="7 Permeases of the drug/metabolite transporter
FT                   (DMT) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0100"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99453"
FT                   /db_xref="GOA:A4F5X9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5X9"
FT                   /protein_id="CAL99453.1"
FT                   /translation="MSNDVFTPSRPAPGRTRFTTGPLPVLLASALWGTTGTAATYAPAS
FT                   AGALSIGAATMGFGGILLCLVAGRSALRVLRSAPVGLLLTGALSIAVYPLAFYSSMALA
FT                   GVAVGTVVTLGSAPVFAAVVERVLDGVRLDGRWALAAAVTVGGGVLLITDGVQLGDAGG
FT                   AVAGTLLGLLAGLSYAMYSWVAARILRGGRHGSRAVMGAMFGSAALVLLPVFAWTGGPL
FT                   LSTGVGVAVTAYLAVVPMGLAYVLFGAGLRHTPVRVATTLSLLEPVVAALLGVFVVGER
FT                   LGAMAWLGMAGIGIGLVLVLTRR"
FT   regulatory      complement(125040..125084)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(125201..125863)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0101"
FT                   /product="two component system response regulator"
FT                   /function="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0101"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99454"
FT                   /db_xref="GOA:A4F5Y0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5Y0"
FT                   /protein_id="CAL99454.1"
FT                   /translation="MSKILIAEDEARIAAFIEKGLRANGFTTTVVGDGDTALDYVLTGD
FT                   FDLVVLDLGLPGKDGFAVLRALRAQRVTVPVIILTARDSVHDTVAGLEGGADDYMTKPF
FT                   RFEELLARVRLRLRPTDRAPEVTVLRDGELSLDLRTRRAQVPEGTVDLTAREFSMLELF
FT                   LRHSGQVLSREQILSHVWGYDFDPGSNVVDVYVRALRRKIGSTRIHTVRGMGYRLGV"
FT   CDS_pept        complement(125860..127314)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0102"
FT                   /product="two component sensor kinase"
FT                   /function="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0102"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99455"
FT                   /db_xref="GOA:A4F5Y1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5Y1"
FT                   /protein_id="CAL99455.1"
FT                   /translation="MTTEPRTAQRRHGTRIPARAQIMGWMLLVLVVVLLSVILIVRQFL
FT                   HNDVNNQVTRSMEQEAREFSQFAEKGRDPVTRQLFTDPQSLFHSHLSRQYPDTAEALIG
FT                   VWRTPAGLEPITQAQDGLKPVASDPAVLGPIVSSPANHGRVDTPAGPMRWVKVHAVSNG
FT                   VDAWFVTEHFTAAETAEADRTVQTLLLVSAFGVLLAAISSWVVAAEILAPVRTVRQAAA
FT                   EISEHDLTRRIPVEGRDDIAALADQFNAMLDRLEDAFRTQRRFVDDASHELRTPITIVR
FT                   GNLELLGDDPAEREEVVRLCTDELDRMTRIVEDLLMLAKADRPDFVTPAPVSLAELTSD
FT                   IEAKARSIADRRWVLEGIGEGEVVVDEQRVTQAMVQLAQNAVQHTEPGSTIRIGSALSL
FT                   GRISLWVTDEGPGVDPAEVEKIFERFSHGSGPGRGGAGLGLAIVRAIAEAHHGRVRVLS
FT                   APGEGATFGLELPATPGTRTAEESDS"
FT   CDS_pept        complement(127304..127558)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0103"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0103"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99456"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5Y2"
FT                   /protein_id="CAL99456.1"
FT                   /translation="MRSVPRALLLVLALALPIAAVVVSFAITDGPRVPDVPAQVRIGSS
FT                   PGPDQPVPSVAPPPGTPPAQLPPPPPDDDDDDHDADHDD"
FT   CDS_pept        127730..130981
FT                   /transl_table=11
FT                   /locus_tag="SACE_0104"
FT                   /product="glycosyl transferase"
FT                   /function="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0104"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99457"
FT                   /db_xref="GOA:A4F5Y3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5Y3"
FT                   /protein_id="CAL99457.1"
FT                   /translation="MIDNSGSGDDRLIDWTGERCVPWADDVQVIYEHYHRYAIAARFVK
FT                   GKRVLDLACGEGYGAALLAAEGAEVVGVDIDETTVEHARRTYGGRDVSFRTGSITDPDL
FT                   LADEKPFDVVVCFEAIEHVAEHDAVLALVRNRLVRGGLFLVSTPDTAVYQHEHGNDNPF
FT                   HVKELTAPEFESLLEGAFRHVALLKQNVAVGSVMTPADPGDPDTAIDGVRLQTLRQGED
FT                   RWTVEPGLPHTYLVGIASDRQLPKLPGSAVLLDAGLTLAHGAGGAVVEQRDTAVADVAK
FT                   LNRLYQRSRVEAEELKATITKLESLRRQEEQRAETAERERAELRVVVDTKLSAAEQAAE
FT                   RDAARIEWLQDSLARLEGRVAEAEQRAAELTATNAELAAQNSALVQRAVGKYRQVVERV
FT                   APRGTTRRDVYEIALGRKPGVPQVTETAETSPLPVPCSDRPVVSVIVPVHGKWPYTRQC
FT                   LRFLAGHLVSVPFEVIVVDDASPDDSAAKLAACEGVRLVRAERNLGFIGACNLGAEHAR
FT                   GEHLFFLNNDAEVTESWLDILVETMESDERIGLVGAKLVYPDGRLQECGGIVWADGNGW
FT                   NYGRNGDAGAAEFNDVRDVDYCSGAAILVRAELFRGVGGFDTRYAPAYYEDTDLAFAVR
FT                   ARGYRTVVQPKAVVVHHEGVSNGTDISTGVKKHQELNRRAFVEKWADTLAAEHLPEASP
FT                   RNLWLARHRGTRGHHGPIVLVKDHQVPRPDFDSGSVRIRRIMQQLVELGCRVVFFPGNH
FT                   ARLEPYTTDLQQLGVTVLPAPELQQAFLAEAGSEISMALLSRPQVAWSLVEELRTSAPQ
FT                   CVIAYDTVDVHFLRLERQAALAESQGEAEAGQALRRKAFASRQMELGLTRSCDVTLVVS
FT                   EAERELLTELVPDADVRVLSNVHEIDWQAADPAGRRDVLFVGSFDHPPNSDAVRWAAQE
FT                   IMPLVREKCPDAVLHVVGSNPTGEVRELAGRGVEVHGWVPDLAPLYRRSRVTLAPLRFG
FT                   AGVKGKVGESLGEGVPVVGTTVATEGMHLVDGRDVLVADDARGFADAVVRLLIDDEAWQ
FT                   RLSEAGKVAVAAQFGPAVSLGTLRELLSKVTDEVA"
FT   regulatory      complement(131032..131078)
FT                   /regulatory_class="terminator"
FT   regulatory      131045..131091
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(131093..132340)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0105"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99458"
FT                   /db_xref="GOA:A4F5Y4"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5Y4"
FT                   /protein_id="CAL99458.1"
FT                   /translation="MTWQDELQHLDAELAAGRISAEEYRNRRDVALGRAQAQSGPTSGG
FT                   FPQQDPQSGGFPQQDPQSGGFPQQQPGQADPFPPAFNWGAAAQGVPQPGPQGPQPPAGE
FT                   ESTQIVHNPMLQQPPAQHGGDSESTQVVNLNQAPQQQWPGQQQGQQQWPQQQGWSTSDN
FT                   PGTPWGDELPPAEHGDTSWMRQGPEVFESAGKSSKGKLVAGLSIGGVLLAGVIVAGVFY
FT                   FTSGGEEQVPDAQGTTQQQEPPPTTSALPEPPAAKPAPPATSQEVLIASPGGPPHLWNG
FT                   ALDPALLSGPRAGLLQPQQVRDFALQNGFADGWFVGTEGAPRSTLLALRMPDQNTASGL
FT                   VKKYLESQQGLSTVDELSYQGVQVKSAGNVFRTAYVVHNWAVIIDVGADDKAAAQQQFQ
FT                   TVLGQQLQQSPPTVRE"
FT   CDS_pept        132651..134600
FT                   /transl_table=11
FT                   /locus_tag="SACE_0106"
FT                   /product="hypothetical protein"
FT                   /function="predicted acyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0106"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99459"
FT                   /db_xref="GOA:A4F5Y5"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5Y5"
FT                   /protein_id="CAL99459.1"
FT                   /translation="MIGALVVIYGHSSPLVGTGELFPPEWPVQPDEGVLMGFFAMSGFQ
FT                   ITESWIRDPHPARFAAKRVLRLWPPMLTVTLGMALVVGPMVTTLPVGEYFSAHGTWGYI
FT                   VNNAGMLTLKHELPGVFTGNPWPDAVNGSLWTLPMELLAYGGLYTLLLLGAGKQRYRWL
FT                   SVVALVGLVAWDRHLEDTPGAESAGSLLSVPIESLVAFLVAFALGVVLNLYRVPLSPVA
FT                   AAAGLGVLVLMPNNQVGSFLMTFAVSYAVIVTGHFWPSRLEVPGVWVNGSYGVYVWGFP
FT                   IQQLLAMAGIANQYLMLVCAAPLAYVMGTLSWKYVEDPTMRLRHYITPAQPEPSRKPSP
FT                   SLEDEEHGEADDEPDDDAFDDLADDLDGAEERNGADRRDRPAPPDRLDDREPRRAAFPE
FT                   SGRAAFPETEVTSLPAAEDATRRRMPPRDPSAPAHRRAADPGEPSHGSPSPWTPPTRRA
FT                   PDPAAAPSRPHQRPRPPASPGFPEASPSSPNGRSSRHATPPAAAQSGQPAPSAPYGPSG
FT                   PDSPASPRSAPPRPAGPAPRPGAVPGTWPVRPDAPRPDAPPSGGAAPPVPPRRPRPPRA
FT                   VAPPSSNGHRPPAPDEDSVLARRLSGAVEPPSGPRPAPPARGQGGRHARPDQRQSEEET
FT                   RPAMRSFPGEVDGT"
FT   CDS_pept        134622..135305
FT                   /transl_table=11
FT                   /gene="msrA"
FT                   /locus_tag="SACE_0107"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /function="Peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0107"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99460"
FT                   /db_xref="GOA:A4F5Y6"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5Y6"
FT                   /protein_id="CAL99460.1"
FT                   /translation="MALFGDPFSSHKVRMVEPGDALAGRSTPMPVSEWHAVHPDRRIVP
FT                   PFPEGLATAVVGMGCFWGAERTFWRTEGVWSTAVGYAGGYTPNPTYEEVCSGLTGHTEA
FT                   VLVVFDPKVISYEQVLKVFWENHDPTQGMRQGNDVGTQYRSAIYYADDQQRQIAEASRD
FT                   QFQAALTAAGHGTVSTELAPLRDFYYAETYHQQYLSDAKNPNGYCGIGGTGVSCPVGLA
FT                   MPGDS"
FT   regulatory      complement(135150..135178)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(135402..136646)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0108"
FT                   /product="endo-1,4-beta-glucanase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0108"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99461"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5Y7"
FT                   /protein_id="CAL99461.1"
FT                   /translation="MNDTGRFTPTDRVKPTRSTGNRTVAAVLTLGIAGGLGMASLGTAQ
FT                   AEPVASASTVAGAPSLTAGFKQRQVTPEEAKQVEDDANKAFRNAEEARNAADAARATAN
FT                   ELEGQRAAAEAERGRLFGIAFSKLDELNAAEEQLAKTIEDFNRAEAAAKADPTNVVLKA
FT                   VLLQARLAFNDAVQLHTNKKEELRQANTAVVTAGNQMRELENRVRMAESAARSAEGAAE
FT                   VADQEFAKAAKKFEDVTGVPFVPKPVEVPATPRPVEAPAAPTGDEIVKDEQKEDEQNKP
FT                   GEEEAKSPAQTADGEEDGKREQDPDQRVPGSGGEEQSSKKSDDVGTGSGVGSDTGDGKE
FT                   SAGKKGTTAGKSDGTAVGEGNASNGQNTGGTAVGEGDSTEAGTSSGGSAVGAGNATSGQ
FT                   SGSGGSAAGTGDGTK"
FT   CDS_pept        complement(136840..137538)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0109"
FT                   /product="protein of unknown function DUF867"
FT                   /function="Phage-related replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99462"
FT                   /db_xref="InterPro:IPR008585"
FT                   /db_xref="InterPro:IPR038128"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5Y8"
FT                   /protein_id="CAL99462.1"
FT                   /translation="MGVDTGRTPLPAGLPARAADTYPSNTALYADPALVHGTDYRIRHR
FT                   RHRTPSPPAVIAPHGGEIEAGTSELCLAIATWPDGAAFDYWAFEGLRSPSALHVTSTRC
FT                   DDPLALSLCARSPCALSLHGCRAEQTGTDRDAQSVLVGGRDGTTRHHLIRELRRAGFDA
FT                   TDASSHGVLSGMSPANICNRTRRGRGSQLEITTPLLDAMFTSNTIEGRKHTRTPVFWAF
FT                   VAAVRAAFLQ"
FT   regulatory      complement(137632..137691)
FT                   /regulatory_class="promoter"
FT   regulatory      complement(137682..137721)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(137744..138349)
FT                   /transl_table=11
FT                   /gene="chb"
FT                   /locus_tag="SACE_0110"
FT                   /product="secreted chitin binding protein"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0110"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99463"
FT                   /db_xref="InterPro:IPR004302"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5Y9"
FT                   /protein_id="CAL99463.1"
FT                   /translation="MLAKRMKRTLGIALFALVPLTLPVVTAGMAQSHGFTQSPSSRQDA
FT                   CAQGKVSDCGTIVWEPQSVEGPKGFPQAGPADGKICSAGLAQFAELDDPRGGQWPATNV
FT                   SAGQDFTFTWKITAAHSTMSFRYFVTKDGWDPSQPLTRAALEPAPFVSQDLGGQRPPNT
FT                   YTHTGKLPNKSGKHVILGVWDIADTGNAFYSCADVNFG"
FT   regulatory      complement(138959..138994)
FT                   /regulatory_class="terminator"
FT   tRNA            complement(139007..139079)
FT                   /gene="tRNA-Gly (GCC)"
FT                   /locus_tag="SACE_8004"
FT                   /product="transfer RNA-Gly (GCC)"
FT   CDS_pept        complement(139212..139622)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0111"
FT                   /product="pyridoxamine 5'-phosphate
FT                   oxidase-related,FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0111"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99464"
FT                   /db_xref="GOA:A4F5Z0"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019920"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5Z0"
FT                   /protein_id="CAL99464.1"
FT                   /translation="MDLEEAVAVVRQQHRAVLSTLRADGTPQMSPVLATTDDAGHVTVS
FT                   TSEKSAKVRNLRRDPRAWLCVLPDEFFGRWVQVEGDVEIVELPDAMPLLEEYFRSISGE
FT                   HDDWEQYRAAMRDEGRVLLRVTPTRAVSAPTG"
FT   CDS_pept        139738..140445
FT                   /transl_table=11
FT                   /locus_tag="SACE_0112"
FT                   /product="RNA polymerase, sigma-70 factor, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0112"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99465"
FT                   /db_xref="GOA:A4F5Z1"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5Z1"
FT                   /protein_id="CAL99465.1"
FT                   /translation="MHEDAGGAARPGPGRCEEIDRALLDRLRAGDDLAYGEFYWRHVQA
FT                   VRRFAMRAPRQGIDADDVVAEVFLRVLRAVRAGAGPKDYVRTYLLTVVRRVQAEWCAAR
FT                   REEPMLVDEIGKRIPGLRDHQGIQAEGELLARAFHRLPQRWREVLWRTEVEGHRPASIA
FT                   GQLGLSPNATAVLAHRARRGLRAAYFQAASAAEHRAGPENGADITGGPKSGATRAKARR
FT                   TFGAAPDLTCARQ"
FT   CDS_pept        140721..141158
FT                   /transl_table=11
FT                   /locus_tag="SACE_0113"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0113"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99466"
FT                   /db_xref="GOA:A4F5Z2"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5Z2"
FT                   /protein_id="CAL99466.1"
FT                   /translation="MNRVVRGSDGRMWTVKTNVEWSNPIAADEFEHDVNGGPMPGVIMG
FT                   AVLLFLVVVFVVWTPPEVVVPPWLLLALLAAALFFPVRWVLRRPWTIRAETPGDHDEHP
FT                   PETWLGVVRGGLNARQEAAKVARQIELYAEPDMNGQLQPVE"
FT   CDS_pept        141262..142089
FT                   /transl_table=11
FT                   /gene="mutM, fpg"
FT                   /locus_tag="SACE_0114"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /function="Formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0114"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99467"
FT                   /db_xref="GOA:A4F5Z3"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5Z3"
FT                   /protein_id="CAL99467.1"
FT                   /translation="MAQHLRDNATGRSVARVDIASLSVLKTVSPPWSELHGRTVTGATR
FT                   YGKYLDLDCEGLHLVFHLARAGWMRWSDSLSPAPPKPGRGPIALRVHLGGGVGFDLTEA
FT                   GTQKKLSAWVVEDPAEVPGIAKLGPDALSLDVEGLTAVLSGRTERIKTVLTDQSMIAGI
FT                   GNAYSDEILHAAKLSPYATAGRLDADAVERLHATMREILTDAVERSLKQDAARLKAEKR
FT                   SGMRVHGRTGLPCPVCGDKVREVSFADRSLQYCATCQTGGRPLADRRLSRLLK"
FT   CDS_pept        142234..143502
FT                   /transl_table=11
FT                   /locus_tag="SACE_0115"
FT                   /product="sensor kinase, two-component system"
FT                   /function="putative regulator of cell autolysis"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0115"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99468"
FT                   /db_xref="GOA:A4F5Z4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5Z4"
FT                   /protein_id="CAL99468.1"
FT                   /translation="MSNPNIDVVPELLTERTVLTTLAALAVLAMFVMLCRSRRVSTSVE
FT                   DATLAALHQVTSAAPHLRAGLTQESADQTAPHLRALLGCIAVGVVDAEGTLLSWDGEAN
FT                   HHYGGLRTRIEQVLRTGKREYVDHGEVACEQRPCVMRHAVVVPLEVEGENRGALVIISA
FT                   GDRRRLLRAAGEVANHVSTQLELAELQESKERLARAEVRALRAQISPHFIYNALNTISS
FT                   QIRNDPEQARDLLQEFADFTRYSFRTSGLYTTLADEIRNIDRYLTLERARFGPDRLKVQ
FT                   LKIAPEVLPVVVPFLALQPLVENAVRHGLANKPGGGTVSVIAEDNGVEALISVDDDGIG
FT                   MNPERLDAELADAHLTGAHVGLGNINNRMRATFGNDYGLVVETEEGAGMKVIMRVPKFA
FT                   PGVRPVPAQAIEEPSVGLAAGPQ"
FT   CDS_pept        143710..144606
FT                   /transl_table=11
FT                   /locus_tag="SACE_0116"
FT                   /product="possible signal peptide peptidase"
FT                   /function="serine proteases (ClpP class)"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0116"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99469"
FT                   /db_xref="GOA:A4F5Z5"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5Z5"
FT                   /protein_id="CAL99469.1"
FT                   /translation="MNDKAPQKFTDLLSEKLSAKLPGKLGEKAERGPVVAVVKLHGVIT
FT                   PTPSPVSRSTISAQTTESALTRAFGHDRLSAVVLSINSPGGAPTQSALVADRIRELADE
FT                   KKVPVLAFCEDVAASGGYWLACAADEIHAHQTSMVGSVGVVSATFGFNGLLDRFGVERR
FT                   VYTAGDHKVRLDPFSPEKEDDVRWLHGLQAELHDQFQQWVRDRRGERLKGTDEELFSGE
FT                   VYSGAKALELGLVDGVGSLRGIVRRKFPDAHLVTVEPRKPLLAKLGVGSPASARLGGVG
FT                   AVVEALEHRAMWSRFGL"
FT   CDS_pept        144878..145720
FT                   /transl_table=11
FT                   /locus_tag="SACE_0117"
FT                   /product="response regulator, two-component system"
FT                   /function="Response regulator of the LytR/AlgR family"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0117"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99470"
FT                   /db_xref="GOA:A4F5Z6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5Z6"
FT                   /protein_id="CAL99470.1"
FT                   /translation="MSIRQSSSGLVVLAVDDEMAGLDEMKYLLGNNPRVGRVLTAFDAA
FT                   EALRLLRSDDPELRGRRDQDESIVDAVFADVSMPGLSGMELARVLQAFRNPPALVFITG
FT                   HEENALEAFEVGALDYIMKPANAERVDRALRTIERRKSQNTAPSRPVEGSAPDDDEVIP
FT                   VELAGTTKLVPRKTVRWVEAQGDYARLHTTDGSHLVRIPLAQLEERWADAGFLRIHRSY
FT                   LVSLGLVNELRMSSSGYSVVLGGGPAKELPVSRRHTRELKDRLVRAPRSGWGQQPGMS"
FT   CDS_pept        145717..146127
FT                   /transl_table=11
FT                   /locus_tag="SACE_0118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0118"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99471"
FT                   /db_xref="GOA:A4F5Z7"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5Z7"
FT                   /protein_id="CAL99471.1"
FT                   /translation="MSRDHGFEIRARGESTRPPRRRRVVLADSKRRTRQVARTMMELEE
FT                   QTSVGEFLVRHLMKVQMRSALLLAGFALLVLLSLPALFYALPSLGDTVWFGMHVSWLVL
FT                   GVLPYPFLVLVGYLCVRVAERHERDFIHMVEQ"
FT   CDS_pept        146206..147963
FT                   /transl_table=11
FT                   /locus_tag="SACE_0119"
FT                   /product="sodium:solute symporter, SSF"
FT                   /function="predicted symporter"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0119"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99472"
FT                   /db_xref="GOA:A4F5Z8"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5Z8"
FT                   /protein_id="CAL99472.1"
FT                   /translation="MSSSIWALSGIGVIAAATFGIGFWGARNARATSDFLAARQSVREE
FT                   RNAAAISGEYLSAASFLGIAGLVLKEGVDALWYPIGFAAGYLALMLFVAAPLRRSGAYT
FT                   LPDFAEERLDSLPLRWLSTALVVLIGWLYLVPQMQAAGLTLSSVTGHPYWVGVLAVTGL
FT                   VLVSALSGGMRAVTLVQAFQYWVKLFAITLPAFVLFFVFMTGDAQHQRALDSPAPPVFE
FT                   RDTAVHFETDVRLRVDEPVWVQVVGAEHGTVYMRPGEHPVSTGVVLRFPAGSPVPVVDD
FT                   AEPDNASWLRPQDGGIRGLVETYSVIMATFLGTMGLPHVLARFYSNPNGQGARRTTLYV
FT                   LALLGAFYLFPTVFGLLSRFYVPMLLVTGETDAAVLLLPHLMLGNWLGGLLGAVTAAGA
FT                   FAAFLSTSSGLLVSVAGVLSADVLRGRAVDVRLVMVVSCVLPTLLALRMSDQDITQSVG
FT                   LAFAMAASTFCPMLVLGIWWRGLTAAGAAAGLVTGGGLVLVAVVVSMLTGDDGSWVSAL
FT                   SWQPAVVTVPVAFLVTWGVSRATRRRVPAGVSRVMLRMHAPDRLGFIDDRTSVRGVPQE
FT                   PKTGRHLRE"
FT   CDS_pept        148254..148925
FT                   /transl_table=11
FT                   /gene="clfB"
FT                   /locus_tag="SACE_0120"
FT                   /product="clumping factor B"
FT                   /function="predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0120"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99473"
FT                   /db_xref="GOA:A4F5Z9"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5Z9"
FT                   /protein_id="CAL99473.1"
FT                   /translation="MSTTDHPSGSGSGIDAETWASAQSSPEFKALRRRLRNFVFPVSAL
FT                   FLAWYLVYVLLADYAHGFMSIKLIGNVNVGLVLGLLQFVSTFVITTLYVRYANRHLDPV
FT                   SEEIRNSVESSVDSNSDSNSDSDSDSNSDSDSDSNSDSDSDSEGDADVDSDVESDSEGD
FT                   SDSESDSDSDVESKSDSDSDSESDSDSDVESKSETDSDSDSDSDSDADSKSASSAEGGK
FT                   P"
FT   CDS_pept        148922..150562
FT                   /transl_table=11
FT                   /locus_tag="SACE_0121"
FT                   /product="SSS sodium solute transporter superfamily"
FT                   /function="predicted symporter"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0121"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99474"
FT                   /db_xref="GOA:A4F600"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A4F600"
FT                   /protein_id="CAL99474.1"
FT                   /translation="MIALTSSPALSAQVLAQSETANNRWLNIGIFAVFVAVTMVIVFRA
FT                   SKNTKTASDYYAAGRAFTGPQNGIAIAGDYLSAASFLGIAGAIAVYGYDGFLYSIGFLV
FT                   AWLVALLLVAELLRNTGRYTMADVLSFRMRERPVRTAASLSTLSVTFFYLLAQMAGAGG
FT                   LIALLLGITDKVGQAVVIAVVGALMILYVLVGGMKGTTWVQIIKAALLIAGAFVMTLWV
FT                   LGMYGLNLSGLLGAAADAAGEKVLNPGAQYGKSPTSQLDFVSLGIALVLGTAGLPHVLM
FT                   RFYTVPTAKEARRSVVWAIWLIGLFYLFTLVLGYGAGALVGPSTIKEAPGGVNSAAPLL
FT                   ALELGGPLLLGFISAVAFATILAVVAGLTITASASFAHDIYANVLKKGAVDDKQQEVKV
FT                   ARITAVVIGVVSILGGIAANGQNVAFLVALAFAVAASANLPTLLYSLFWKRFNTAGALW
FT                   SIYGGLAVTIVLIVFSPAVSGNDEAMFPSLDIAYFPLKNPGLISIPVSFLLGYLGTVLS
FT                   KEPFNEEKYAEMEVRSLTGAGAEKAGSGH"
FT   regulatory      complement(150356..150393)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(150622..150735)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0122"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0122"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99475"
FT                   /db_xref="UniProtKB/TrEMBL:A4F601"
FT                   /protein_id="CAL99475.1"
FT                   /translation="MTDPRVLELLAENSPIKADSDMLELHFTVRDDALVAA"
FT   CDS_pept        151069..151395
FT                   /transl_table=11
FT                   /locus_tag="SACE_0123"
FT                   /product="rhodanese-like"
FT                   /function="Rhodanese-related sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0123"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99476"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A4F602"
FT                   /protein_id="CAL99476.1"
FT                   /translation="MQPEDLPENLPGEGTALLDVREHNEWAAGHAPGAVHIPMSQIPSR
FT                   LGDVPEADQLYVVCRSGGRSAKVTAYLNANGWDAVNVERGMNGWAASGRPLTGEDPDSE
FT                   PFVL"
FT   CDS_pept        151425..152300
FT                   /transl_table=11
FT                   /locus_tag="SACE_0124"
FT                   /product="possible membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0124"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99477"
FT                   /db_xref="GOA:A4F603"
FT                   /db_xref="InterPro:IPR025565"
FT                   /db_xref="UniProtKB/TrEMBL:A4F603"
FT                   /protein_id="CAL99477.1"
FT                   /translation="MATPPGGARPRAVRRQARPYAGPPAYPAVPRWGFPALAWRWPLAL
FT                   PTGPAVDPVRRVAALYATATSTLWIIAGMGGLTAVAELWRYVLLLRSRGEALPATTLAV
FT                   SDALVVTTGVLTLVLGALAGVVVVLWALRAREAATERIGVRSARSDAQFVLGVLVPGLN
FT                   LVVAGSSLSELEHAVLVGEGARERGARPRPSRLVLVWWAAWVASLLLGWTAFLWGFRSG
FT                   TQALADGVVLHVWTNIAVVVLAVVTIRVVRYLTTLLVPADPTELPHLRVLGLRDAPAPP
FT                   RPPRPADAQR"
FT   CDS_pept        complement(152305..153462)
FT                   /transl_table=11
FT                   /gene="cyp20"
FT                   /locus_tag="SACE_0125"
FT                   /product="putative cytochrome P450"
FT                   /function="Cytochrome P450"
FT                   /EC_number="1.14.14.1"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0125"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99478"
FT                   /db_xref="GOA:A4F604"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A4F604"
FT                   /protein_id="CAL99478.1"
FT                   /translation="MFDTADPAFVADPYPCFAELRRRGEVHRHPGLGMAVAVSHAAASE
FT                   VLRHRGLGRIWVDAQPAADFPAFNLLHRTSLLETEGAEHTRLRRSISAAFARGHVERVR
FT                   PWVAGLADALVGGLVERGGGDVVEEVAAPLPVQVIAELLGVPESDRNLLRPWSNAIVKM
FT                   YEPGLPERRRAAAESAAAEFAEYMRALADRRRSAPADDMVSDLVAAEELSADEVVGTAV
FT                   LLLMAGHEASVNLVANGVLALLRHPGQWRRLVDDPGLVPTAVEELIRYDSPLQLFERTA
FT                   VEDVVVAGHRVAAGSKIAALLGAAARDPEVFESPDVLDVGRQPNPHLGFGAGIHYCLGA
FT                   PLARVEAAAALSALVRLAPRLEQAGEPVRRPEFVIRGLRELPVSV"
FT   CDS_pept        153522..154286
FT                   /transl_table=11
FT                   /gene="glpQ1"
FT                   /locus_tag="SACE_0126"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /function="Glycerophosphoryl diester phosphodiesterase"
FT                   /EC_number="3.1.4.46"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0126"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99479"
FT                   /db_xref="GOA:A4F605"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:A4F605"
FT                   /protein_id="CAL99479.1"
FT                   /translation="MCQATPAVVAHRGASAQRAEHTLGAYELALEQGADALECDVRVSR
FT                   DGHLVCVHDRRIDRTSNGRGVVSELTVPMMSGLDFSGWRNPSGERGVLTLEMLLELVAG
FT                   TSVKLFVETKHPVRYAGLVEAKLVALLARHGLAAPRDAESSQVVMMSFSSNAVRRVRQT
FT                   APRLPTVLLFDRMPNGRRSGELPSWADCAGPDIRLLRQDPGYVARAAERGHPTYCWTVD
FT                   EPADIELCRRAGVRYIATNRPGSTRSYLVDQR"
FT   CDS_pept        154341..155288
FT                   /transl_table=11
FT                   /locus_tag="SACE_0127"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0127"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99480"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="UniProtKB/TrEMBL:A4F606"
FT                   /protein_id="CAL99480.1"
FT                   /translation="MAKRTAEPRPESGISPRQPCPCGSGKRYKACHGRAGGAADVIVTR
FT                   PFEGLAAECELVALREFVPSATAKLPVREGREVTLATVLPMAAAALMRVDEKAFVGLQV
FT                   QTRSGDISRDLARALEWVQSAEAGTSLPVVGPETAEAGTVPNRLQDLVDVDAKLDVELH
FT                   DDFSWWIPGDTEPTGEVALSLERANAAIMPTERLNAEGVESAYWVDAGEKAHLRWVRPE
FT                   PEEKLLAALARLSARGELALGEDSRYAGSFRAHGLLVPVWDLDREKHAREWEQPAAELG
FT                   TRLAEALESLDSEPLNAAERRSRDGLRGRQITVR"
FT   CDS_pept        155413..155994
FT                   /transl_table=11
FT                   /locus_tag="SACE_0128"
FT                   /product="RNA polymerase ECF sigma factor"
FT                   /function="DNA-directed RNA polymerase specialized sigma
FT                   subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0128"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99481"
FT                   /db_xref="GOA:A4F607"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A4F607"
FT                   /protein_id="CAL99481.1"
FT                   /translation="MTAHLPAAPASAAEAARSWPGRAHQGDMAATEDDFAEFVRVALPG
FT                   LMRYGHALTGNPHDAADLVQTVLEKVGARWAKVSQNCDDPRAYVRKAMANTHVSRWRRT
FT                   RRETLIAEFPDVPAQPRHDRLEDEPVWQALQTLPPRQRAVVVLRFYEGLSEAEIADTLG
FT                   VSCGTVKSQNSKAMATLRKRLGPLVEGGDV"
FT   CDS_pept        155994..156491
FT                   /transl_table=11
FT                   /locus_tag="SACE_0129"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99482"
FT                   /db_xref="GOA:A4F608"
FT                   /db_xref="UniProtKB/TrEMBL:A4F608"
FT                   /protein_id="CAL99482.1"
FT                   /translation="MGLEDELRRVLRDDKLDIPVRTGAEWSLVAGARRRRKRNTAVAAV
FT                   GGALAATVLVGGGVAAMSYEKRPVPPAVPPVVTSTTSPSGSSGSSPPPQVDPHHPWSPP
FT                   ESSHVTPSPQTSERPSILRDTLPPTTSEPPSTSEPENPPTTSRPSSESGENPSQDESGP
FT                   GG"
FT   regulatory      complement(156405..156446)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(156543..157103)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0130"
FT                   /product="ferritin family protein"
FT                   /function="Ferritin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0130"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99483"
FT                   /db_xref="GOA:A4F609"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR041719"
FT                   /db_xref="UniProtKB/TrEMBL:A4F609"
FT                   /protein_id="CAL99483.1"
FT                   /translation="MAITAKKIERRESKFHQLLQEQVHNEFTASQQYIAVAVWFDNEDL
FT                   PRLASHFYKQALEERNHAMMIVQYLMDNNIKPNIPGVPDVRNDFSETRELVALALEQER
FT                   EVTQEIVNLAKTAREEGDYLGEQFMQWFLKEQVEEVSQMSTLLNVVDRSNGNLFDVETF
FT                   LARETVGDEGADSGAPPAAGGTL"
FT   CDS_pept        complement(157427..158608)
FT                   /transl_table=11
FT                   /gene="arcA"
FT                   /locus_tag="SACE_0131"
FT                   /product="arginine deiminase"
FT                   /function="Arginine deiminase"
FT                   /EC_number="3.5.3.6"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0131"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99484"
FT                   /db_xref="GOA:A4F610"
FT                   /db_xref="InterPro:IPR003876"
FT                   /db_xref="UniProtKB/TrEMBL:A4F610"
FT                   /protein_id="CAL99484.1"
FT                   /translation="MQSEVGPLHTVLLHRPGNELKRLTPRNNDQLLFDAIPWVDRAQEE
FT                   HDAFAETLRGRGVEVLLLHELLAETLTDTRARAAAVHSGVDELKVGTDIADTLRSHLSS
FT                   ADAPALAEVLIAGMTFEELPASEGQSLVRRMHHPHDFAIEPLPNLLFTRDSSAWVGDRV
FT                   AIAALAMPARRRESALTDLVYAYHPRFSHCARAYGAHSAPVEGGDVLLLSPGVVAIGVG
FT                   ERTTPAGAESFARSVFADDLAHTVLAVPITQQRASMHLDTVCTMVDRDAVVMYPAIQDS
FT                   LTAFSLRPRDGGIDVSGPQPFLTAAAEAMEIDHLRVIDTGLDPVTAEREQWEDGNNTLA
FT                   VAPGVVVAYERNAETNARLEEAGIEVLRISGSELGSGRGGPRCMSCPIIREVL"
FT   CDS_pept        complement(158740..159552)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0132"
FT                   /product="abortive infection protein"
FT                   /function="predicted metal-dependent membrane protease"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0132"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99485"
FT                   /db_xref="GOA:A4F611"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A4F611"
FT                   /protein_id="CAL99485.1"
FT                   /translation="MSGKLRAWLAPGRPGTPEVITDPAERRALVIELLIVFAVTLGLSA
FT                   LQSLLSLLDALMRPEPLADQAVAINVPRAELGLLDMAQQLAGVLRLCAWGALGVYLLWR
FT                   GGIALRSVGLDRSRPLRDALGGVGLAALIGVPGLGLYLVAHALGLSLTVQPSTLDEAWW
FT                   RAPVLVLAAFGNSFAEEVLMIAYLLTRLRQLGWGENRALWASSVLRGAYHLYQGFGGFV
FT                   GNVVMGLVYGRAWQRTGRIWPLVAGHALIDVVAFVGYAALRGRVGWLP"
FT   CDS_pept        159722..160063
FT                   /transl_table=11
FT                   /locus_tag="SACE_0133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0133"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99486"
FT                   /db_xref="UniProtKB/TrEMBL:A4F612"
FT                   /protein_id="CAL99486.1"
FT                   /translation="MFLWGWTDSRLIARTLESLRPFDTLDGPVGPAELVGMRDGVLVEV
FT                   TREGADATRVRFVDAGGPADAWTAAHSFLWVVTRRLPVEEALLLGDDTEPLHYREGRIR
FT                   TVPTSGERY"
FT   CDS_pept        complement(160145..160924)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0134"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99487"
FT                   /db_xref="InterPro:IPR019595"
FT                   /db_xref="InterPro:IPR037119"
FT                   /db_xref="UniProtKB/TrEMBL:A4F613"
FT                   /protein_id="CAL99487.1"
FT                   /translation="MGEKTTRRPALPSPAERARTIARRGGKGVLMPSGENSARIAPLLH
FT                   HVHPDGAATVLLADEHPLIASAWQAPRGELTAMLEVADPTPVRLREPVRGLLWLTGWLR
FT                   VLEPEQARAEVVRVAEQRPDSRLLDAGHGASVLRLESASMVLADAEGTASVQPEDFLAA
FT                   SPDPFCLMEDGWLRHLELSHRDVVGLLARHLPERLRGGHIRPLGLDKYGLRLRVESADG
FT                   DHDVRLAFSRTVTDAEHLGVELRRLVGCPFLAQQRQG"
FT   CDS_pept        161587..162348
FT                   /transl_table=11
FT                   /locus_tag="SACE_0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0135"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99488"
FT                   /db_xref="UniProtKB/TrEMBL:A4F614"
FT                   /protein_id="CAL99488.1"
FT                   /translation="MPQAVVDHLAARSGPYAGVMGPMLCQASRLAELITELAKAKPAEP
FT                   VALSLVCDTGLGGVPKALSIIEGRQELLALRMVEMPAPSDVDDIWLERVSEFVPEDIVR
FT                   VVEPRRGANGWLDGIKRVAEHGCWPKLRCGGQTAESFPSVEVVSDFLAVASTLGVPFKV
FT                   TAGVHSAVRRTDPETGFTHHGFLNLLVATARSLSGKNVREALGSTDDAGLADEARSLSD
FT                   DAARAVRDVFASYGSASLTDPVTDLEGLELL"
FT   CDS_pept        162345..163550
FT                   /transl_table=11
FT                   /gene="fahA"
FT                   /locus_tag="SACE_0136"
FT                   /product="fumarylacetoacetase hydrolase"
FT                   /function="2-keto-4-pentenoate
FT                   hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase
FT                   (catechol pathway)"
FT                   /EC_number="3.7.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0136"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99489"
FT                   /db_xref="GOA:A4F615"
FT                   /db_xref="InterPro:IPR005959"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR015377"
FT                   /db_xref="InterPro:IPR036462"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A4F615"
FT                   /protein_id="CAL99489.1"
FT                   /translation="MSWIEDPEFALDKPFGPQTLPYGVLVTSAGPVVSVRVGRHALPLR
FT                   RIAGSLGPRLPELVDGDSLDPLLAAGRESWRELRERLTEIVTAGSAPPGAELLRTDWHT
FT                   LVLPFRVADYVDFYSSRHHAENVGHIFRRGSSPLLENWTHLPVAYHGRAGTVYVSGTDV
FT                   HRPCGQRKAPGDLQPAFGPTRRLDFEAEVGFVCGGEPSGRVATSDIQEHVFGVGLVNDW
FT                   SARDIQAWEYQPLGPFLSKSFATSLAGWITPLEAFSHARVPTPVPEHGLQSYLVESEPW
FT                   GLDLSLEIRCNDTVLSRPRFADMAWSPAQQLAHMTVNGAPVRPGDLFASGTVSGPERGQ
FT                   RGCLLELTWGGAEPVSLEDGEQRTFLQDGDRVTLGGTAPGPDGSVVGLGEVTGTVLAVA
FT                   RR"
FT   CDS_pept        163555..164241
FT                   /transl_table=11
FT                   /gene="sdrB"
FT                   /locus_tag="SACE_0137"
FT                   /product="differentiation regulon (IclR-family
FT                   transcriptional regulator)"
FT                   /function="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0137"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99490"
FT                   /db_xref="GOA:A4F616"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4F616"
FT                   /protein_id="CAL99490.1"
FT                   /translation="MAFTPEPTRSPVTRAPGDAPAKESSLTLERGLNLLQAVADAESEA
FT                   PTISDLAAAIGVSRAAVYRLLGPLQNRGLVRREGSKVRLGLGVLWLAGRVLPQLRVASL
FT                   PALRGLAEQVGATVHLTVADGGEAQAVAVVEPSWTNYHVSYRVGTRHPVHRGAAGRAVD
FT                   LPPGGPRWVSSTGELQSGAFGVAAPVRGVPGLRASVGIVALVPVSPEEIGPLVLETAEA
FT                   VAAALK"
FT   CDS_pept        complement(164289..165488)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0138"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99491"
FT                   /db_xref="GOA:A4F617"
FT                   /db_xref="UniProtKB/TrEMBL:A4F617"
FT                   /protein_id="CAL99491.1"
FT                   /translation="MTGRIIRTELVRGAGGPLALVVLAATAGVLFTNPDWAGNWNGLAM
FT                   GVRGSLLLSCPLVAMAGTWAVGRQHRRQTSELLTIAPRPRWQPFTASWLALTAGACLGL
FT                   LAGWLTGGAFVLPVATYIGLGWVATLLACVPVLGASAAFGMLVGHFVPWRLMTPVTGMV
FT                   TGLGMLWTQSSVSGGLEWLGPVAGNSWLGGTGYAATTNALHTAWFSGLALTFLAVASLR
FT                   RRILALVPAALAVAAATSLMALPQHWTTEAVAEEQVCVTNGATVCGPRYQEHLYPELAG
FT                   LARPMLDKIRGVPGAPAQITYGGAEGTTLHESTPAGTLADPADERRALAYWLASANYRC
FT                   PGQPFSEGSSAAARWLLEGIPGTEGLISGVPVRDRDWVVRYYAALESCDTPAMHELVGE
FT                   "
FT   CDS_pept        complement(165485..166210)
FT                   /transl_table=11
FT                   /gene="yfiL"
FT                   /locus_tag="SACE_0139"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /function="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99492"
FT                   /db_xref="GOA:A4F618"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F618"
FT                   /protein_id="CAL99492.1"
FT                   /translation="MIQIEDLTVRYRARHALAGVTARFDVGVNGLLGPNGAGKSTLVRV
FT                   LATLITPTSGSAEVLGRRLDAASDPREIRRRLGYLPQELGYYPRFTAREFVEHFAWLKE
FT                   VPAAGLPDAVPRALERVGLADRADEKIRRLSGGMRRRVGIAQAIVGEPPVLLLDEPATG
FT                   LDPEQRMEFRQLLAELGRQSCVIVSSHLVEDVAKACDRMWVLDAGRPVFEGTPAELAAD
FT                   GDLEAGYRAVLSSAREEAA"
FT   CDS_pept        complement(166216..167022)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0140"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0140"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99493"
FT                   /db_xref="GOA:A4F619"
FT                   /db_xref="UniProtKB/TrEMBL:A4F619"
FT                   /protein_id="CAL99493.1"
FT                   /translation="MTHQHFPASTLRAYAEGALTDADAIEDHLLDCTDCRRLVNESALD
FT                   DPLVQQVRTGLTALPPQPPRPSRWRRLRVLLNAAPAVRGAWLFTVLATLAGAVAADLLG
FT                   GPGGGVGPWWSEHGSALLLVAPALPVLGVALCFGRLGDPAYEITASTASGGLRLVLWRT
FT                   LSVLLTTVPATVLVGTVTGRVTATAWLLPCLALTAMTLALGSLLRIEAAATAIAVGWLV
FT                   VAVGPLLADRVPVVLDRPLPLLWSALIAVSAFVLFLHRTTFHDSRS"
FT   CDS_pept        complement(167019..167516)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0141"
FT                   /product="ECF subfamily sigma factor"
FT                   /function="DNA-directed RNA polymerase specialized sigma
FT                   subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0141"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99494"
FT                   /db_xref="GOA:A4F620"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A4F620"
FT                   /protein_id="CAL99494.1"
FT                   /translation="MARGNRSAFDQLYQRNAGWIAARLRRRCEDPELAAEVLQECFLTV
FT                   WRSAGGFDPRKNAAAWLWTVASSRLVDAHRRRQARVRTTGEPHESALTSASAEAEYMRS
FT                   TLSPELADAVHRLPPELHAVLKATVLDGMTVRETAALLGIPEGTVKTRARKARHILREA
FT                   LA"
FT   CDS_pept        167948..169483
FT                   /transl_table=11
FT                   /locus_tag="SACE_0142"
FT                   /product="putative cytochrome ubiquinol oxidase subunit"
FT                   /function="Cytochrome bd-type quinol oxidase, subunit 1"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99495"
FT                   /db_xref="GOA:A4F621"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:A4F621"
FT                   /protein_id="CAL99495.1"
FT                   /translation="MDLLDIARWQFGITTVYHFLMVPLTIGLSILVAGMQTAWYRTGDR
FT                   RYLKMTKFWGKLMLINFAMGVVTGIVQEFQFGMSWSAYSRFVGDVFGAPLAMEGLVAFF
FT                   VESTFLGLWIFGWDRLSKGVHLACAWAFSLATVASAYFILAANSWMQHPVGIVFTDGRP
FT                   RLDSIWAVLTNNTVLAAFPHTVFGCFAVAGAFLVGISAWQIWKHHRDTVGKNPGLERRT
FT                   EEQNEDRKVWHGSLRLGAWVGVIAFAGLAISGDLQAKLMFEQQPMKMASAEALCHTEQP
FT                   AGFSIFAIGDVGQSNCEDVKSLTVPYLLSYLANGDLHSEVRGVQQLIGEYQAAYGSHYP
FT                   DDPRLGPYAGKPVDYVPNLPVTYWGFRFMIGFGAVAAAGAVVVLWLTRKGRYPKWRWWT
FT                   PLAVLSIATPYLGNSFGWIFTEMGRQPFVVAPNPNPSGVDGVFMYTATAVSSGVTPGEM
FT                   LTSLIGLTSIYGVLAVVEIFLIVRYVRGGIAGVLPPEPPEGKKESDEALSFAY"
FT   CDS_pept        169496..170506
FT                   /transl_table=11
FT                   /gene="cydB"
FT                   /locus_tag="SACE_0143"
FT                   /product="cytochrome d ubiquinol oxidase subunit II"
FT                   /function="Cytochrome bd-type quinol oxidase, subunit 2"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0143"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99496"
FT                   /db_xref="GOA:A4F622"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:A4F622"
FT                   /protein_id="CAL99496.1"
FT                   /translation="MDLPTVWFCLIALLWLGYLFLEGFDFGVGMLLPFLGREESERRVM
FT                   INTIGPVWDGNEVWLIVAAGATFAAFPGWYASLLSTAYLPFLVLLLALIGRGVAFEYRG
FT                   KVDSDRWRRGWDTVIVLASWISPLVVGLVLSANVFGLPLDANGDRVGGLLGIFSLPSVV
FT                   GALAVCGFALLHGAFFVTLKTEGDLRVRARKFALRLGVPLLLPVTALVLIAQFTQGTAW
FT                   TWVPLVIAVLAAAAGFLRLRGWRDGQAFALQGVALAAVVVGLFGTLWPNVLPSTLDPAW
FT                   SLSVAGTASSPYTLAVITWVAAFGTPAVLVYQGWTYWVFRKRIGTKHIPKVHAPS"
FT   CDS_pept        170503..173775
FT                   /transl_table=11
FT                   /gene="cydCD"
FT                   /locus_tag="SACE_0144"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /function="ABC-type transport system involved in cytochrome
FT                   bd biosynthesis, ATPase and permease components"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99497"
FT                   /db_xref="GOA:A4F623"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014216"
FT                   /db_xref="InterPro:IPR014223"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A4F623"
FT                   /protein_id="CAL99497.1"
FT                   /translation="MSPNGALPKLSRSARRALVAAGALALGNAVALIVQAWALATALAA
FT                   VVTTGTTAIGDELVVLAGAVVARAAFGWATEAVSARAAAGAKEELRAALLDSALRRGPE
FT                   WVRRRGPAELTALATKGLDALDAYFTKYLPALVTAGVVPLLVGAWILFSDWVSALAIVI
FT                   TVPLIPLFAWLVGRYTERRTARAADAVQRLSGQLLELIRALPVLTAFGRARAQGEVVRR
FT                   VGETHRRTTGATLRIAFLSALVLELFSSLSVALVAVGIGLRLVSGDLDLATGLLVLVLA
FT                   PECYLPLRAAGAAHHASEDGVEAVRRVEEVVEGSGDARPGRSSLPDEFTVRVSGLRVAR
FT                   RDGYAPDGLAFTARPGEVLRLEGFGGIGPSGSGKSTTFAALLGFASPESGGITCGGVDI
FT                   ADLDPREWRRLLAWVPQRPVFTGGTVLDELRLAVADSDVTVDRALAESVLADVAGAHLV
FT                   DRRIDELSTGERQRVAVARALLRLHGGARVLLLDEPTAHLDAATAHRVDSAVRAAADRG
FT                   TTVILASHRPRAEAEEAASAEVSRPHAAIDLPEARGRIRELLSPRTLTGVALGGLSLLS
FT                   GLALAATSAWLIARASQQPPVLMLSVAVVGVRTFALSRAALRYLERLVTHDAAFRLSGR
FT                   LRCRLWDALVRIGPVRSAGLRRGDGVARLVDDVDAVRDLVPRVLVPPLIALVVAIGAVA
FT                   IQTAVLPAAGALLAGCLLVAGIAGPVAAVLADRRATTVAARGRRRVAAQVLELLDGAAE
FT                   LLAFGADRQRRARLADEDARLAARARRAAFGAGSATAVVTLLVGAAVLGGAWLGAQAVA
FT                   GGRLAPELAPLLALVPLAAAEAVALLPPAAQQWRSLREAQARVAPLLAAEEPTGGVAPV
FT                   ADEDIALTGVRVRWPGSEEPALRDVDLRVPAGAHVAVVGPSGGGKSTLLALLLGFLRAE
FT                   RGEVRAPAAVSWCPQDAQLVSTTIRENLRVAAPRATDDELAEALRLAGLPGWGLDHLVE
FT                   SGGAALSGGEAQRVALARALLASDAEVVLLDEPTAHLDVPTSEALLERLHEALRGRTVV
FT                   HVTHRWAETDHADIVLRVEGGEVTVLRDASARPGAGRAVVGA"
FT   CDS_pept        174238..175386
FT                   /transl_table=11
FT                   /locus_tag="SACE_0145"
FT                   /product="two-component system sensor kinase"
FT                   /function="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0145"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99498"
FT                   /db_xref="GOA:A4F624"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4F624"
FT                   /protein_id="CAL99498.1"
FT                   /translation="MDSTLARQMLAASTEITTVALSAEDPETVLPMVVRKAAALAEADL
FT                   CLVMVRGDDGRLTVEAAYGGPSSTVPLADPVGAVLSTRSAAARVARSGVAVVVDDVIDD
FT                   PITAPYVPAALRVYGPFAAAPFGTRERRLGALAVYRRRGASTFTRVAVDVLTAFAAQAG
FT                   MALVLAEGSTARQRIAVYQERERIARDLHDVIVQRLYAAGVQLEVLERRLDGRLDTPDA
FT                   RRLAETMDQIDQTIAEVRATVRTLTSADPGTPAQAPDLAESMRSEVRIAGELLGRPPKL
FT                   DIEGDLSDVPVAVADHARAALREALSNVVRHSGARSVLVRVRRTPYGLLLQVVDDGCGV
FT                   PRDVSKRGLRNLEERATAAGGRCVITSSPDSGTTVTWEVPLG"
FT   regulatory      175434..175466
FT                   /regulatory_class="terminator"
FT   CDS_pept        176618..176845
FT                   /transl_table=11
FT                   /locus_tag="SACE_0147"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0147"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99499"
FT                   /db_xref="GOA:A4F625"
FT                   /db_xref="InterPro:IPR010445"
FT                   /db_xref="UniProtKB/TrEMBL:A4F625"
FT                   /protein_id="CAL99499.1"
FT                   /translation="MVKQNRPEKRSRGVSPRVVTGLVLVALAVVFILENRHVVDIRVFV
FT                   PVVTMPLWTALVAVMLVGIVVGLLLNRQKR"
FT   CDS_pept        complement(176842..177477)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0148"
FT                   /product="two-component system response regulator"
FT                   /function="Response regulator containing a CheY-like
FT                   receiver domain and an HTH DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0148"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99500"
FT                   /db_xref="GOA:A4F626"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A4F626"
FT                   /protein_id="CAL99500.1"
FT                   /translation="MRVLLVDDHEVVRRGLRDLLDTEDDVEIVAEAGGVDEALVRARSV
FT                   EPDVAVVDMRLPDGDGLELCRRLRALDPAPYCLVLTAFDDEQALVGAINAGASGYLLKQ
FT                   VRGQDLVNAVREVAAGRSLLDPVTTARVLDRLRQSTSPVPDELDALTERERKVLELIGE
FT                   GLTNRQIAERLFLAEKTVKNYVTAVLAKLGMERRTQAAAWVARRQSHT"
FT   CDS_pept        complement(177540..178079)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0149"
FT                   /product="DoxX"
FT                   /function="predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0149"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99501"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:A4F627"
FT                   /protein_id="CAL99501.1"
FT                   /translation="MLIRRLARPLLATTFIYGGVQALRDVPSHAKAASPLLEKTTGKVR
FT                   DSLPEQVPTDPETLVRIDAMVKIGAGTMLALGKFPRLASLLLAGSVVPTTLAGHPFWEI
FT                   SDPEQRQSQQIHFYKNLGLLGGLLISAVDTGGKPSVGYRARHTAQRARHTAHKVSEQTH
FT                   QAVGTGKGKGRKKRRK"
FT   CDS_pept        178272..178754
FT                   /transl_table=11
FT                   /locus_tag="SACE_0150"
FT                   /product="heat shock protein HSP20"
FT                   /function="Molecular chaperone (small heat shock protein)"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0150"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99502"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:A4F628"
FT                   /protein_id="CAL99502.1"
FT                   /translation="MTLVRRSSWDPFGNLVRQMDRDFDSISRRFFGSQGVEGFVPATNV
FT                   ERDGSDVVIKLELPGVDIAQDVEVEVTDGRLSISGQRRTEKTSGEDGAVLLREIRTGAF
FT                   RREFNLPEGVTAEQVEANYDRGVLEVRVHEVSKPAPAPTKIQIADRRQGDGKAELN"
FT   CDS_pept        complement(178862..179467)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0151"
FT                   /product="phage tail assembly-like protein"
FT                   /function="predicted phosphatase homologous to the
FT                   C-terminal domain of histone macroH2A1"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0151"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99503"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:A4F629"
FT                   /protein_id="CAL99503.1"
FT                   /translation="MSVTAESERSSDGAEPELRLVLCALDEPLAAAWHEVAEGRDGVEV
FT                   HRGSVLDMPVDAVVSPANSYGWMRGGINAVYARAFPDVEQHVRSAVLAYHGGELPVGEA
FT                   LLVPTGAPAPPWLFSSPTMREPGERLPADTVHPYLCARAVLRLWAGGALENGVLVRDFV
FT                   RSIAMPGLGTGVGGAAPELCARQVAAAWDEVFAHVEHR"
FT   CDS_pept        179583..180506
FT                   /transl_table=11
FT                   /gene="pheA"
FT                   /locus_tag="SACE_0152"
FT                   /product="prephenate dehydratase (PDT)"
FT                   /function="Prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0152"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99504"
FT                   /db_xref="GOA:A4F630"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:A4F630"
FT                   /protein_id="CAL99504.1"
FT                   /translation="MPRIAYLGPSGTFTEQATRALTADFDAELVPHDDVRQALAAVRSG
FT                   EVVAAGVPVENSVEGSVPATMDALVSDEPVVAVAETVLPVVFDVLVRPGTRPEEVSTVA
FT                   SHPHAIAQVRGWLEANLPRAEVHFAGSTAAAAAAVRDGEYDAAVAAPIAVERYPSLERL
FT                   SAGVADVRDAFTRFLLVRRPSPPPEPTGADRTSVAAVISDEVGTLALLLSELTLRDINL
FT                   SRIESRPTKDRLGEYRFFLDFDGHVADSRVGDALAALRRRCSEVRFLGSYPKADRAPSA
FT                   IRPSASEQAFRASARWLDDIRAGRIA"
FT   CDS_pept        180503..181144
FT                   /transl_table=11
FT                   /gene="pgmB"
FT                   /locus_tag="SACE_0153"
FT                   /product="2,3-PDG dependent phosphoglycerate mutase"
FT                   /function="Fructose-2,6-bisphosphatase"
FT                   /EC_number="5.4.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0153"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99505"
FT                   /db_xref="GOA:A4F631"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A4F631"
FT                   /protein_id="CAL99505.1"
FT                   /translation="MTDELALSSDGTRLVLARHGQTPSNVVHALDTLPPGPALTDEGRR
FT                   QARALADRLADEKVLAIRASRAVRAQQTAAPLARHHGLDVEVVDGTQEIYVGDLEGTTD
FT                   GESRQRFEDVYQSWHFGDIDVPMPGGETGREALARFLGAARHALDGASGGSVVLVSHGA
FT                   MLRLAAAHLAADVDAASANAAYLPNTGVIVLEPAPTPTGWHCVEWDGLGI"
FT   regulatory      complement(181237..181281)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(181291..181641)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0154"
FT                   /product="protein of unknown function DUF1025"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0154"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99506"
FT                   /db_xref="InterPro:IPR010428"
FT                   /db_xref="InterPro:IPR038555"
FT                   /db_xref="UniProtKB/TrEMBL:A4F632"
FT                   /protein_id="CAL99506.1"
FT                   /translation="MPVEMTRARFEELVADALDLLPAEFASAMNNVVVLVEDRNPEDPS
FT                   LLGLYEGIALTERDSTYGGVLPDHITIYREALLDMCADEDEVVDEVAVTVVHEIAHHFG
FT                   IDDEKLHALGWG"
FT   CDS_pept        complement(181682..182680)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0155"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0155"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99507"
FT                   /db_xref="GOA:A4F633"
FT                   /db_xref="InterPro:IPR026004"
FT                   /db_xref="UniProtKB/TrEMBL:A4F633"
FT                   /protein_id="CAL99507.1"
FT                   /translation="MADTDSPTRTSRRKPHTRLVMISAAIGAMLILLISALLNWPTGGD
FT                   GVGGPGRIGSAPAPRAVFSAKAGTCLNWTEPDAADIRQVTCSEPHLFEVTGTADLKGEF
FT                   GPQAPFPDTEQWQQLKTDRCTQVSTQFLSGRFDPHGRFAVGAFTPSEQGWAEGDRTLHC
FT                   GLQQPGPSGKLYRISGNASKIDQSNVYDEGRCLGINGTAVWDPVDCSQLHSVEITGVVD
FT                   LGQQFPEGFPAVPDQDNFLATRCGELTAAYAGGPNVVRDKGLTTYWDTLPMESWDAGSR
FT                   KVNCKVSAQLPDGSGLAPVTGGVKGEVRVDKEPAPEDAAPVQPGVPAEGER"
FT   CDS_pept        182841..183488
FT                   /transl_table=11
FT                   /locus_tag="SACE_0156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0156"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99508"
FT                   /db_xref="GOA:A4F634"
FT                   /db_xref="UniProtKB/TrEMBL:A4F634"
FT                   /protein_id="CAL99508.1"
FT                   /translation="MADDDKPQGQEPTTPGDGEQRRGQMRYQDPESTAPREPTLAEQRA
FT                   RIAAEKRREEKQAAELAEAERKTRTRRRVMIGGGATVGVVALVAAFYQGAAYSQEQAAV
FT                   TQYCAAVPQNGQVTADQDDFCDENYVNSHHGYVNHGTGMFFMPIFLPGGGIGGYNQYRY
FT                   GYTAPGAPAPAVGSTVSSPNFTKPSGSTIKDSKGSTVQRGGFGINNKSGSGS"
FT   CDS_pept        183493..184662
FT                   /transl_table=11
FT                   /locus_tag="SACE_0157"
FT                   /product="hypothetical protein"
FT                   /function="Glutathionylspermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0157"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99509"
FT                   /db_xref="InterPro:IPR005494"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A4F635"
FT                   /protein_id="CAL99509.1"
FT                   /translation="MRRRTTQRRPDWQSKVEELGLVFGTPARAADGSQRPYWDEGVHYE
FT                   FGLDEVLSLEADVELLHSMCLDAVDHVVTTERYRDFGIPEWVWPHIAESWKRHDPHLYG
FT                   RFDLRYDGSGPARLLEYNADTPTSLLEAAVVQWHWLTEVHEGDDQWNSIHEKLVERWEE
FT                   IGKQLGTNEVHFTWSGSDSTGEDNLTAAYLQETAAEAGLDTVGLAIEEIGWDSLLERFV
FT                   DLEEAPMSSVVKIYPWEWMVDDDFGTHAVKTLPQTQWIEPLWKMLLSNKALLAILWEMH
FT                   PGHPNLLPAYIGQPGLLTEYVRKPLLGREGNNISIVAPGWETETGGFYGEEGYVYQAFD
FT                   PLPEFDGMRPALGAWVVGDSSAGLGIRETAGLITDDGAAFVPHRIPDGS"
FT   CDS_pept        184811..185998
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="SACE_0158"
FT                   /product="seryl-tRNA synthetase"
FT                   /function="Seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0158"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99510"
FT                   /db_xref="GOA:A4F636"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:A4F636"
FT                   /protein_id="CAL99510.1"
FT                   /translation="MVDALLSADERRRSAVSRADSLRAEQKQLGKQVGKAAGEEREHLL
FT                   KKAKELSAQVKDAEAEQAEADQALVEAQKKLSNIVGPGVPPGGEDDYAVLKHVGVPPEF
FT                   DFEVKDHLELGTSLGAMDMERGAKVAGARFYFLTGIGAQLELALLNMAAAHATANGFTL
FT                   VVPPVLVRPEIMEGTGFLGAHSSEVYRLEEDDLYLVGTSEVPLAGYHSGEIIDLGAGPL
FT                   RYAGWSSCFRREAGSYGRDTRGIIRVHQFNKLEMFVYCREEDAVAEHERLLGWEEEMLA
FT                   KIEVPYRVIDTAAGDLGASAARKYDCEAWIPSQQTYRELTSTSNCTTFQARRLNTRYRE
FT                   ADGPTRIAATLNGTLATTRWIVAILENHQQADGSVRVPEALRPFLGGREVLEPTR"
FT   CDS_pept        complement(185988..186617)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0159"
FT                   /product="endonuclease III-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0159"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99511"
FT                   /db_xref="GOA:A4F637"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:A4F637"
FT                   /protein_id="CAL99511.1"
FT                   /translation="MSTKTAVRDLLDRAGTTYAEEAGIKLEDKPAPLYRLLVLSVLLST
FT                   RIKAGIAVSAARELAEFGTPQKMRDATWQQRVDALGRGHYVRYDESTATSLGDGAEYLL
FT                   DRYRGDLRKLRDEAGGGIKALKSKLQEVKGLGPVGADIFCREAQAVWPELRPYFDKKAL
FT                   SGAKKVGLPEDAKRLAELVGDKDLARLAAALVRATLEKDVAEKVSA"
FT   regulatory      186113..186146
FT                   /regulatory_class="terminator"
FT   CDS_pept        186701..187306
FT                   /transl_table=11
FT                   /locus_tag="SACE_0160"
FT                   /product="transcriptional regulator, Cro/CI family"
FT                   /function="predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0160"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99512"
FT                   /db_xref="GOA:A4F638"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A4F638"
FT                   /protein_id="CAL99512.1"
FT                   /translation="MVGGVSDQPETPNGSAGQALAGLGGRIGRLRTERGLDQATLARRA
FT                   ELEQTHLAGVESGTATPSLPVLAQLAEALDVGLSELFTDARPGPAAVVLRGDEVPSVDD
FT                   GGMSVQVLTPRAVIPGLYAARYRLSSASSAVRPVRHVGHDWLYVLSGELHVEFESDSTT
FT                   LRAGDSVSFSSKVPHKLSAVGGQDAEFLAVGATLLTPT"
FT   CDS_pept        complement(187313..188125)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0161"
FT                   /product="Cof protein"
FT                   /function="predicted hydrolases of the HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0161"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99513"
FT                   /db_xref="GOA:A4F639"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4F639"
FT                   /protein_id="CAL99513.1"
FT                   /translation="MRKPGLVASDVDGTLLDSMERVSSRTAATVRRVVADDVPFVLVTG
FT                   RPPRWMPSVVAGLGVSGVAVCANGAVLYDTKADAVLASTEIDTVTLHDVVHELHHEMPG
FT                   CAVAVERTTGGAHDRVHEQFLAEEGFLQVWANSDIHVAAPDELVGKPAVKLLVLHDAMN
FT                   SAQMAAIAEEVVGDRLEMTYSTGAGIIEFSAAGVDKASGLRTVAADLGVDQADVIAFGD
FT                   MPNDVPMLSWVGHGVAMRNAHEAALAVADEVTATNNDNGVAQVLERWW"
FT   CDS_pept        187923..189086
FT                   /transl_table=11
FT                   /locus_tag="SACE_0162"
FT                   /product="hypothetical protein"
FT                   /function="Coenzyme F420-dependent N5,N10-methylene
FT                   tetrahydromethanopterin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0162"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99514"
FT                   /db_xref="GOA:A4F640"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A4F640"
FT                   /protein_id="CAL99514.1"
FT                   /translation="MAHTATPDTPSPATTDGIQRGGLPVTSTKGTSSATTRRTVAAVRE
FT                   LTRSIESSSVPSTSEATRPGLRTAPSCPVAAARRTGVRPRPRRSRSPDTVRGVRVGIVI
FT                   LPEHRWWAAEPLWRMAEEYGFAHAWTYDHIGWRPGLERPWFDAVTTLTAAATVTSTLRI
FT                   GTFGSSPDFRHPVHYARQLTALDDISDGRLTLGLAAGGVDFDAHVLGGSELPASARVDR
FT                   FAEFVEVLDQVLVHDSTTYRGEYFTAVDARRAPGCVQPPRMPFAIAANGTRMMRLTARY
FT                   GRGWIAAGGYTDDLNTWWRAVADLSMRFTDVVAEEGGDPARIDRYLSLDAAPVYSLSSV
FT                   EYFREVVGRAHELGFTDVISHWPRPEEPYAGKESTVEEIASEVLPEL"
FT   CDS_pept        complement(189118..190218)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0163"
FT                   /product="LGFP"
FT                   /function="uncharacterized protein potentially involved in
FT                   peptidoglycan biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0163"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99515"
FT                   /db_xref="GOA:A4F641"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR006619"
FT                   /db_xref="InterPro:IPR015510"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:A4F641"
FT                   /protein_id="CAL99515.1"
FT                   /translation="MRLGLSFPCVLLLTAALATSVRAEPPEAPAGGTAVVPLGETPSRG
FT                   GQREVRLDQPFSMVGLTWSGEAPDRVELRPLTEGGWGAWTEAELTSARGSEPVWTGRTT
FT                   GVQVRATRGGDDVTGELRLVALRPSLGRTPVAAAPKAPAGRSAEPSAAPSPVPEAPSST
FT                   TATPRHASAPPPLVRRADWGADERNMKWTPQPTETRAATVHHTAGTNDYGCADSAAIVR
FT                   GIFEYHAVHLGWGDIGYHALVDKCGTIFEGRAQGLERDVIGGHAMGFNPNTFGVAMLGN
FT                   FQDVVPTSDALTAAGAIIGWKLRESGVAPDSAVELVSTGGEGSLHPPGAAVRLPAIFAH
FT                   RDVGQTLCPGQLAYDRLDEIRSAALN"
FT   CDS_pept        complement(190310..191563)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0164"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99516"
FT                   /db_xref="GOA:A4F642"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:A4F642"
FT                   /protein_id="CAL99516.1"
FT                   /translation="MTRTRERYLLATAIVLQVLSIWFVHWIDTRGYMDTDIYRLGARAW
FT                   LTGHEVYGDDLTPESPDSGTLPFIYPPFAAILFTPLTWMSSDAAVVTVAVCSHLALLLT
FT                   AYSLARSSTYLANRAGQVAVVTAVLMPLLTLIEPTRETLNYGQINLVLMALVAADCLLP
FT                   RTRWPRGLLVGIAAAIKLTPLGFLLLFLLRRDFRAAAVAGVTFAATVLLGLLAAPDDSA
FT                   DWWLDKMLSTGDSLGTVYAGNLTLRSLLAKQELTGLPLNVLWVAGSLVLLALAVLGIRY
FT                   ALRVRNVPLALMVNAVLVLLVSPISWSHHWVWAGPVLALLFAMSVRHRWYGVLLSTGLG
FT                   ALTVLVGPQWFLPNTDDRELDWTFSQQIVGNAYTLLGIAFLIAAAVAHFRMHPPIHRPP
FT                   EAARHEPAPSHGRPNLPA"
FT   CDS_pept        192028..193185
FT                   /transl_table=11
FT                   /gene="glf"
FT                   /locus_tag="SACE_0165"
FT                   /product="UDP-galactopyranose mutase"
FT                   /function="UDP-galactopyranose mutase"
FT                   /EC_number="5.4.99.9"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0165"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99517"
FT                   /db_xref="GOA:A4F643"
FT                   /db_xref="InterPro:IPR004379"
FT                   /db_xref="InterPro:IPR015899"
FT                   /db_xref="UniProtKB/TrEMBL:A4F643"
FT                   /protein_id="CAL99517.1"
FT                   /translation="MGSGFFGLTIAERTATQLDKRVLVLDRRDHIGGNAYSEAEPETGI
FT                   EVHRYGAHLFHTSNKRVWDYVNQFTDFTDYQHRVFTRHQGQIYSMPMNLGLLCQFFGRA
FT                   FTPDEAKALVAEQAAEIDTADAQNLEEKAISLIGRPLYEAFIKGYTAKQWQTDPKELPA
FT                   ANITRLPVRYNFNNRYFNDSYEGLPVDGYTAWLEKMAEHPNIEVRLSTDFFDVRGDLPE
FT                   GVPVVYTGPLDRYFDYVEGELGWRTLDFETEVVNTGDFQGTSVMNYADEEVPYTRIHEF
FT                   RHFHPERDYPKDKTVVVREYSRFAESGDEPYYPINTSEDRSKLEAYRELAKKEAKERGV
FT                   VFGGRLGTYKYLDMHMAIGSALSMFDNKIAPYFTEGRSLDGSLED"
FT   CDS_pept        193189..195150
FT                   /transl_table=11
FT                   /locus_tag="SACE_0166"
FT                   /product="galactofuranosyl transferase"
FT                   /function="predicted glycosyltransferases"
FT                   /EC_number="2.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0166"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99518"
FT                   /db_xref="GOA:A4F644"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR040492"
FT                   /db_xref="UniProtKB/TrEMBL:A4F644"
FT                   /protein_id="CAL99518.1"
FT                   /translation="MTDRTTEAPTAAAGESKLSDVASVRAGGSQVAAEQVLQRVVFPRD
FT                   EDPLDVRALYIDEPETLSSSATVVSRRSVRVPSHSKLSFASYFNAFPASYWKRWTKVSE
FT                   VVLRLKVRGAGRLDVYRSKPNGDSVHLQGTHVSSQDTWTDLEFRVSLAPFEDGGWIWFD
FT                   VFTNDASLEVDEAAWTTDLDLPRQKVVVGTTTIRPADCVTALKTLGEDPQVLDVVERVV
FT                   VADQGPQKIRDTEGFDEAAARLGDKLQVIEQANLGGAGGFGRVMYEGVYNSDAEQVMLI
FT                   DDDIALEPDGVLRANAFARASSQPVIVGGQMLNLQARSRLHTMGEVVDIGGAMWRPAPG
FT                   AVTDHDFAKKPLRRSKKLHQRVHATYNGWWMCLFPREVIERTGLPLPLFIKWDDAEYSL
FT                   RAGGHGYPTVTLPGAAIWHMPWTDKNDATDWTAYFHTRNRLILAALHSPDEVKVPIVKQ
FT                   GLKLALRHLLSMEYSTVAVQQKALEDFMAGPEGLFESLRTALPEVRELRKHYEDAQTLP
FT                   SAREFPPPSADPVMAEGLLKPPVNPAVIAARASKALLHNLKEPNREAADRPQLNVPAAS
FT                   ARWFLLGNLDSATVSNADGSGVAFRRRNPEEFRKLGLRALANYRRLGREWSRLREAYRA
FT                   ALPELTSAESWKQVFDQK"
FT   CDS_pept        195295..195783
FT                   /transl_table=11
FT                   /locus_tag="SACE_0167"
FT                   /product="membrane-associated phospholipid phosphatase"
FT                   /function="Membrane-associated phospholipid phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0167"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99519"
FT                   /db_xref="GOA:A4F645"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A4F645"
FT                   /protein_id="CAL99519.1"
FT                   /translation="MRKVQGALAKPQVVKAARAMSLFGEHAGGWLAIGAVGALVDRKRR
FT                   GEWITAAAGVALAHGASIGVKRVVRRRRPADPQVEVLVGTPSKLSFPSSHATSTTAAAV
FT                   LYGGLTGKKLTPVLVPPMMVSRLVLGVHYPSDVVAGSALGGVVAWGVRRFIRRRRNRG"
FT   CDS_pept        195776..196900
FT                   /transl_table=11
FT                   /locus_tag="SACE_0168"
FT                   /product="possible 4-hydroxybenzoate polyprenyltransferase"
FT                   /function="4-hydroxybenzoate polyprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0168"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99520"
FT                   /db_xref="GOA:A4F646"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:A4F646"
FT                   /protein_id="CAL99520.1"
FT                   /translation="MADNKETAAVREDEAAETKEEQTRAEQTETRAAEAKAEVEADAEG
FT                   TIGSEFGDEVLEPEATKVSDDPKDKSSDAYHAKVTAKAGTPAGLATGLVKELRPKQWVK
FT                   NVLVLAAPFASGRLLETGVLLDAVLAFVVFSMAASGIYFINDAIDVDADRQHPTKRNRP
FT                   IAAGLIPLPIAWVVAVLLLGGSLLISAFISFPLVVVMAVYIGVQLGYCFGLKHQPVIDL
FT                   CIVASGFLLRLVAGGAAAELAISQWFLLVTAFGSLFMVAGKRYAEVKLALETGAKIRKS
FT                   LKAYSPSYLRFVWAISAAITIMSFALWAYDIREIEQSRWGLISIVPFVIAMLRYAVDVD
FT                   RGVAGEPEEVALKDKVLLVLGVILAGFLFLAFYL"
FT   regulatory      complement(196905..196940)
FT                   /regulatory_class="terminator"
FT   regulatory      196917..196952
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(196982..197176)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99521"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:A4F647"
FT                   /protein_id="CAL99521.1"
FT                   /translation="MSLTWRKSSRSGSGPSNCVELAIEDLRTHIRDTKDRDGGTLRVSR
FT                   RAWASFLGEVKSGGLDLRR"
FT   CDS_pept        complement(197118..197879)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0170"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0170"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99522"
FT                   /db_xref="UniProtKB/TrEMBL:A4F648"
FT                   /protein_id="CAL99522.1"
FT                   /translation="MRPGWATMQALLAFYGAEDHERVEAAAMWEDAAEQATRVVTPAGS
FT                   SKALRAFLRAENEADTARILEPHVVPGLLQTHGYARAINLGGQQFHSTPPERYVTARLS
FT                   RQARLSPPSPLMLHAVIDESVIHRTVGGREVMIEQLRHLLKLADRDNVCLQLLPFGAGA
FT                   YGSMDGAFTILGYSDVEDPPAVYVDSAAGGTWVENGDDVTRFADMFTEVAESALSGEET
FT                   SLLIRSQIRTLEDEPDVAQEQPKRKRTKQLR"
FT   CDS_pept        198416..198577
FT                   /transl_table=11
FT                   /locus_tag="SACE_0171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0171"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99523"
FT                   /db_xref="UniProtKB/TrEMBL:A4F649"
FT                   /protein_id="CAL99523.1"
FT                   /translation="MSAAPDSSEITSADSGLGGPTPEDVLWLVHESIDWARVGPDLLRR
FT                   VVEGVRAL"
FT   regulatory      complement(198686..198734)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(198779..199438)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0172"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99524"
FT                   /db_xref="GOA:A4F650"
FT                   /db_xref="UniProtKB/TrEMBL:A4F650"
FT                   /protein_id="CAL99524.1"
FT                   /translation="MTLPQTQPASPVRKFLKIFGGLLVDVGLPMAAYYGLRSYGFSEHV
FT                   SLLAGAGVAGARLLFVAFRAGKLEPFAGFMLLTYLLALPLVLVSGDDRTLVIKDSLGTG
FT                   ITGLIFLASCFFGKPAMFHAARRFRSAGDDVEAWEGLWETNPGFRRSFIFMTAVWAVVL
FT                   LAEAALRVGLAFVLPIDVMVALSAVLGMGTIALLLTWTMIYGARRQRRLKQAAHAG"
FT   CDS_pept        complement(199531..200940)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0173"
FT                   /product="putative dioxygenase"
FT                   /function="Lignostilbene-alpha,beta-dioxygenase"
FT                   /EC_number="1.14.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0173"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99525"
FT                   /db_xref="GOA:A4F651"
FT                   /db_xref="InterPro:IPR004294"
FT                   /db_xref="UniProtKB/TrEMBL:A4F651"
FT                   /protein_id="CAL99525.1"
FT                   /translation="MTEVAEAASSAPPVHLVGHLEPVPDEVEVHDLRVTGTLPRELAGR
FT                   YLRNGPNPLPGENPGHWFAGHGMVHGIRIRDGRAEWYRNRWVRTNLLEGRFEAGDGATL
FT                   DRSVTPANTHVIEHSGHLLALCEGGLPYELTAGLDTEGPRAFDGRLTNGMTAHPKEDPD
FT                   TGELHFFGCGFRPPHLTYHRLSPAGELVRSQVVEVPGATMMHDFAITENHVIWLDLPVT
FT                   FDLDLVGRALPYRWNDDYGARLGVMARDGEPTVRWFEIDPCYVFHVGNAREDPAGRIVL
FT                   DAVRWDRDTFRRGWSRLGGDGRARRDGGPAAEFSGTGRSTLHRWIFDLASGSVREQAID
FT                   DRGVEFPTLNENRVGRDNRYLYTVAEQLDDSNTGAAIVKYDTATGIGETHELGADRTAG
FT                   EAVFVAAAGGRDEDDGWLLSIVSDRSGKSSDLVVLDATDLTAAPVATVHLPRRVPTGFH
FT                   GSWIPDAELDA"
FT   regulatory      complement(200977..201036)
FT                   /regulatory_class="promoter"
FT   CDS_pept        201074..201625
FT                   /transl_table=11
FT                   /locus_tag="SACE_0174"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /function="predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0174"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99526"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR018309"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4F652"
FT                   /protein_id="CAL99526.1"
FT                   /translation="MSLRYALLGLLADEPQSGYDLTQRFERSLKRYAWHARHSQIYPEL
FT                   NKLAADGLIAVVEEGARGRRTYALTEAGREALHGWLMDWSSLQPVRNEFVLRLFLMSVL
FT                   DPSEALPLLRGIHEHAKEEVAELEARVEAAGGPDGEWGFGRLAGEYGVRQYRAMVEWAE
FT                   WAESELARAVPDEGSGDTST"
FT   CDS_pept        201855..203429
FT                   /transl_table=11
FT                   /gene="phoD"
FT                   /locus_tag="SACE_0175"
FT                   /product="phosphodiesterase/alkaline phosphatase D"
FT                   /function="Phosphodiesterase/alkaline phosphatase D"
FT                   /EC_number="3.1.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0175"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99527"
FT                   /db_xref="GOA:A4F653"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR018946"
FT                   /db_xref="InterPro:IPR032093"
FT                   /db_xref="InterPro:IPR038607"
FT                   /db_xref="UniProtKB/TrEMBL:A4F653"
FT                   /protein_id="CAL99527.1"
FT                   /translation="MSDPTTVSRRSVLLGGTAAGAVALSTGAALPAAAQQGAGFARRGE
FT                   VFTLGVASGDPAPDGVVLWTRLAADPIAEDGMGGMPDKTFPVQWEVAEDERFHRVVQRG
FT                   EAQAAPSLGHSVHVELTGLRPDREYFYRFRAEGAVSPVGRTRTAPLPGAMTELTMAFAS
FT                   CAQFEHGFFTAYRHLAEEHPDLVLHLGDYQYEYKAGDYVIPGGNIRDHAGPETTTLANY
FT                   RQRHAQYKSDPDLQFAHAAAPWVVVWDDHELDNNWADEIHEKPEKPQPDFLERRKAAFQ
FT                   AYYENMPLRRAQIPKGIDLRLHRRIEWGRLATFHMLDTRQYRDDQVGGDKVPTTDPARL
FT                   DPARSLTGAEQERWLLTNLRSSQARWDVLGQQVMFAEIDLAEGDAEGYNPDAWDGYVGS
FT                   RQRVIQGFQQGKVRNPVVLTGDVHKNWANDVQSDGRTVATELTTTSITSGGDGSESLTE
FT                   KEKGYLRDNPHVRFYSNQRGYIRTRFTEGELRADYRVVPYVSKPGAPVRTAASFVVEDG
FT                   RPGLNPA"
FT   regulatory      complement(203267..203302)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(203508..204134)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0176"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99528"
FT                   /db_xref="UniProtKB/TrEMBL:A4F654"
FT                   /protein_id="CAL99528.1"
FT                   /translation="MHPVLSGTAGILLLGCAAAVALAVFPLRGGKGQHAHAGPGTVTVE
FT                   HLCGARAEAESEDQEEIEWPRVDWDELSAREMIEFPAGRDDLPAAEAFPDPADVFPGLA
FT                   DAFPGVPDAFPEPAFLDVAAALPESADAFPDVTDAFPDLASAFRGAADPVDHEYVGRHR
FT                   LRCNDMLSHRLEWELINWPEPVRGPYKVDIAFVPPGVEILAPASH"
FT   CDS_pept        204570..205394
FT                   /transl_table=11
FT                   /locus_tag="SACE_0177"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0177"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99529"
FT                   /db_xref="GOA:A4F655"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A4F655"
FT                   /protein_id="CAL99529.1"
FT                   /translation="MTVANPPVARLQLGQLLRELRESAGKKREDAAEVLECQAPKISKI
FT                   ETGRSTISAGDARLLIDLYGANGNTAQTVLELAREARKRTQVRVPDWARRFVAMESIAD
FT                   EIRGYEPELVPGLLQTAEYTRAHAMATDPGQVDRLMAVREERQTRMSGGNVPLLHVVLN
FT                   EAVLLRPVGGPEVMGGQLRHLRELVESPEITLQALPFHTGAHAGMGSSFVMLHLRESGS
FT                   TVVYVEDLYTAGYLDGGSHVERYGAAFDRLRESALDEAETTALLERQIKEYA"
FT   CDS_pept        205651..208779
FT                   /transl_table=11
FT                   /gene="embC"
FT                   /locus_tag="SACE_0178"
FT                   /product="probable arabinosyltransferase, membrane protein"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0178"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99530"
FT                   /db_xref="GOA:A4F656"
FT                   /db_xref="InterPro:IPR007680"
FT                   /db_xref="InterPro:IPR027451"
FT                   /db_xref="InterPro:IPR032731"
FT                   /db_xref="InterPro:IPR040920"
FT                   /db_xref="InterPro:IPR042486"
FT                   /db_xref="UniProtKB/TrEMBL:A4F656"
FT                   /protein_id="CAL99530.1"
FT                   /translation="MNHPIGSAVLERPAEPGPERPERRSAPLWLAHFVALTVGLLGLVC
FT                   ALSLPFAPVWSDRTEVRWPSVHAGTPDAPGTGTTLDDGLRSTTALFAPYRPAEFHAAVP
FT                   CATLRSADGTVFSTLPPGSDREGMVLAVREGEPRLLLGQREVELPPLAGDCTLNVNADS
FT                   AQSVVTVGASTTRLPGVAAPEIFTFSTDLEPVQAATLSVTARTFSWFDTTPTEQKRGMV
FT                   TGALLMAALSLLFLVVTAPPAMSALRGAARLRTWLLLPVDAAVLGILAWWLVIGPISDD
FT                   DGFAMMTVRNFEPTGDIGNYYRWFNASETPFTLVQHTMRWFADHSLAPVWLRLPSVLAG
FT                   ALTWVVLSRGVVGPLCGPGSRLRAHLLAAVFFLACWLPFDLGVRPEAFVALGTTVLVAA
FT                   LLKAEHSAGPFAWLGLAAVAAGLTVAVTPTGVAALVIVLVFSPRIGRLVVRPGAVPAWL
FT                   AIPARIALVGCAGSVGLVAMFADSTWNGVAQATWLHDEFGPSLGWYQEFNRYNVLLGTT
FT                   HWGAAGKRLAVFLVVTAALIAAGCVLRGLHRSTRTPDVALLLGAVAAIFAALWLTPSKW
FT                   THHFGSLAGLGPALLAVTVVMLTRVRAPREARVLGVCGASAASLAAGLAFMGPNAWYLY
FT                   SDIAMPWSDAPVDPLDQPVLWLAVGVASGLVAYAVVLLSRRGEAEARQAWTTMPSSVLA
FT                   LAALASTIVLLGSFTTAYRETGDRFSVARTNWHSVTATSCGVEDEVETLPLAATLRALP
FT                   GAPEPDGFALSGSPPPEPDLDPESRKDGEVQPQEDVPPVWDSREGGPQNTGTLTTGWFE
FT                   LPALEPDQVLAIWVAGRPEQGNSLAVEFGTPIGDVVRELRDPPPTELPFDDPRHGRPVD
FT                   WRDFRPWRVMTVEAPAGARTVRLHAEDRTTDEQGWLAVSAPVVRDVVPLPEVLDAQGPT
FT                   LVDWPMGLLFPCRIDYPRVSGGTADSPGVLVAPPAGEASMAYAPDLGGVFAGVPMQSRR
FT                   IELPSRLRGAPGVRWGHVYAVSYDTERDVYDRHVTRIRIGGADGDGAYPFEEH"
FT   regulatory      208909..208941
FT                   /regulatory_class="terminator"
FT   CDS_pept        209106..212237
FT                   /transl_table=11
FT                   /gene="embC"
FT                   /locus_tag="SACE_0179"
FT                   /product="integral membrane indolylacetylinositol
FT                   arabinosyltransferase EmbC (arabinosylindolylacetylinositol
FT                   synthase)"
FT                   /EC_number="2.4.2.34"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0179"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99531"
FT                   /db_xref="GOA:A4F657"
FT                   /db_xref="InterPro:IPR007680"
FT                   /db_xref="InterPro:IPR027451"
FT                   /db_xref="InterPro:IPR032731"
FT                   /db_xref="InterPro:IPR040920"
FT                   /db_xref="InterPro:IPR042486"
FT                   /db_xref="UniProtKB/TrEMBL:A4F657"
FT                   /protein_id="CAL99531.1"
FT                   /translation="MLSAILGIVVGLLGLLAAVAVPLAPVVAREVTVTWPEAAAPARST
FT                   LAFFVPYRPVSVDVDVPCRVVRSGQALGRPATLVSSRLPGQPTQGFAVTTANGTALVLV
FT                   GGREALRAPIGRDCAISLHSDASGSTARIGDRTATLPGVRVEDVVAFATDLPPDDAAGM
FT                   RVTARAANPFENEPTAEKALLVWGQFLLAGLAFVLLAVRTRGIRAVGVAATTAPLPVQP
FT                   GPPATNGNRARTNADGTALLAGDGTALLAGDGTTHPNGDGFAPEETRLGAWRRAVSGLV
FT                   DLLVVGVVGGWWVFGPNTPDDSFASVTITNALNTGDVGNYYRWENASEAPFLLAQQLLE
FT                   LVAGLSAAPLAMRVPSVIAALLTWQLLSRGVLSAVIPEHSRKPSVRALAALSFLAWWLP
FT                   FGLGVRPEPFVALGVAATLAFTLQGVRQQRLGLLGAAALWAGLSMAVNPMGITAIAPFI
FT                   VLAGRLRRMLRVPDMVLLAGITSTGLVAMFADQSLAGAREATRMHGFYGPNVPWYLEIQ
FT                   RYQFLLGFDLQGDVARRAPVLLTAVVLLFTALLLSRGARWLPGMRMAGVPAGCLAIGLA
FT                   LMWLTPSKWTHYFGALAGVGAATLTAGVVLVVVTARRLAGERTVVLLGLLCTGLGVVAA
FT                   ALTFAGKNNWFLHSHYGVPWGDGPVSPLNNPLLWSLGVGALLVAAAVSGAVRRDRFAAR
FT                   RTLVRMPAVLGVTAVGTTVAVVLYSFAVAPLRQSGSYSVGGQNLASLTGQSCGIVDHVV
FT                   VTPDVPGGRLQVSGGDPEAVGFRRNGGFASPPPGGTAWSSFGGGPISTGQLTTGWFPLP
FT                   AELPDSRELAVDVAGRTGDGNRIALEFGTRNGVIGERVLDDTAFDGDERPAYPADHVIE
FT                   DKPQDNPSWRTLHSEVPDGATRVRIRAVDATTDGAGWLAVTAPRIREVVPMAQYLRGRS
FT                   PILVDWSMTWSAPCLQAMPEVGGGLAEPPAYLVNPPHGLGFGGRAAYERVIGGSFAGVR
FT                   EVGHQKEVPTRLLGVEDAPQYAEWGHLIEVDYPLSGNGFDVQSVPVSRWGWRGE"
FT   CDS_pept        212240..213247
FT                   /transl_table=11
FT                   /locus_tag="SACE_0180"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /function="Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /EC_number="2.4.1.83"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0180"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99532"
FT                   /db_xref="GOA:A4F658"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4F658"
FT                   /protein_id="CAL99532.1"
FT                   /translation="MAEAISHSVRVPVPQQQAAEEGSPSLVSYVLPVYNEVEGIRRFHE
FT                   ELTAVVATRPEFRYEFVYVNDGSVDGSLGILRDLAKNDSRVHVVDFARNFGHQIAITAG
FT                   LDHAAGDAVIIMDTDLQDPPRVSLELIDAWLSGAEIVSARRRTRQDSRFKRFTAHGYYR
FT                   LLRHCAEVDIPVDTGDFRLLDRRAAEELRGFRERSRFIRGMVASMGFQQAEVLFDRDER
FT                   VAGETKYPMRKMLRLAADGVTSFSTVPLRLITRIGFVSLALALLGIVYAVALRVFLPEV
FT                   TVSGWTMLMVAMLFLGGVQMLSLGVIGSYVGRIYNEVQQRPLYIVRKVIRYDQD"
FT   CDS_pept        213234..213647
FT                   /transl_table=11
FT                   /locus_tag="SACE_0181"
FT                   /product="dolichyl-phosphate beta-D-mannosyltransferase"
FT                   /EC_number="2.4.1.83"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0181"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99533"
FT                   /db_xref="GOA:A4F659"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:A4F659"
FT                   /protein_id="CAL99533.1"
FT                   /translation="MTRTDPGAPVVRERLVSRSLVLYALIGCSGVLLDYGLFLLLFNLA
FT                   GLHEQLANAISTTAGITNNFVLNALLNFRKRDRILVRFLRFYAVGVAGIGLTFVLLQVF
FT                   SGFLGVDPNLVKAGSLPLVLVFQYTINRKWSFG"
FT   CDS_pept        213644..214915
FT                   /transl_table=11
FT                   /locus_tag="SACE_0182"
FT                   /product="protoporphyrinogen oxidase"
FT                   /function="Protoporphyrinogen oxidase"
FT                   /EC_number="1.3.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0182"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99534"
FT                   /db_xref="GOA:A4F660"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4F660"
FT                   /protein_id="CAL99534.1"
FT                   /translation="MRLGIVGAGATGLTAAFDAVKAGHEVTVLEASDELGGLAASIEVG
FT                   GNSLERFYHHSFKTDRAVIELVHELGLGSKLRFHKPSIGIHLDGRMHDFGTPLEMLRFP
FT                   EFSMLDRARFAASSAALKLVRDGERFNSVRALDWMRRWAGPRVTETIWEPLLTGKFGSR
FT                   AGEISMAWLWARIHYRTFELGYVHGGFDQVYRALLEAVTDRGGKVEFGKPVSSIRQPGT
FT                   EVEVRAGDDGSSYTFDHLIVTVPQPVFAKAAGTASDDVLWRNQYLGATCFILECDRSLI
FT                   PYYWLNINDPAFPFLAVVEHTNMVDPAEYGGRHVVYVGNYVPRDDWRFTTEPEELLEAY
FT                   VPWLRKLNPGFDLSWVRDWHFSKAGFAQPVVTPQYRALIPPHRTSMRNVTLATMSQIYP
FT                   QDRGQSYAIQMAHDVVRSLGLDRP"
FT   CDS_pept        complement(214925..215677)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0183"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0183"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99535"
FT                   /db_xref="GOA:A4F661"
FT                   /db_xref="InterPro:IPR008628"
FT                   /db_xref="UniProtKB/TrEMBL:A4F661"
FT                   /protein_id="CAL99535.1"
FT                   /translation="MSRALTLPEELLLLAHRESGKLRESTRVAAACAVAELGELALRGR
FT                   LLVRFEESALPGLRFFRFEHAVIELLAAERTGLWWADHLLAELLQRREAGPIPLDYKWV
FT                   RRHHDALPRHRAALAHRGLLRVEPATGLTRFIARERHRPDTAVRDALIAELRAPTAGRR
FT                   ALDARLLFLSDLVAAVGLHGELGISDRAFPRRMNPRRGIGVVTFRPEAMRDTSFALASA
FT                   VPTRSGSDGGGGDGGDGGGDGGGGGGGD"
FT   CDS_pept        215822..217024
FT                   /transl_table=11
FT                   /locus_tag="SACE_0184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0184"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99536"
FT                   /db_xref="GOA:A4F662"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:A4F662"
FT                   /protein_id="CAL99536.1"
FT                   /translation="MVSEAPPRHPPALPERLRRVADGRLRLVLVVSAPALAGCLGTLVS
FT                   VYSFWGDFEVYRWGVHTWLAGGDFINTRAPVRNPDPLPWVYPPFALLPLAPFALVPSAV
FT                   GLGMLDAVDVLALGATIYLVTRHAWPAAGPRGALAVAATGLPLSFVLEPVHACFGQGQV
FT                   NIALMGLVALDCLAREPRWPRGLLVGIAAAIKLTPAAFLLLFLLRKDFRAALSAVATAA
FT                   LCTAIGFAVDFTASVDYWFRRGPAADVAGHALNSNQSVLGALARFDLPPSAQNAAWAVL
FT                   CLGILVLTARILPRVSAPAAFVTVGLFAVLVSPTSWSNHWVWVVPGLLLLGGNAIRRRH
FT                   GLLPVAVTALIAVTAPWHFLPGVGGAELSWTPVQHVVGNTYVLTAVVALVWTALVTRAG
FT                   R"
FT   CDS_pept        complement(217005..217865)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0185"
FT                   /product="hypothetical protein"
FT                   /function="uncharacterized protein potentially involved in
FT                   peptidoglycan biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0185"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99537"
FT                   /db_xref="InterPro:IPR013207"
FT                   /db_xref="UniProtKB/TrEMBL:A4F663"
FT                   /protein_id="CAL99537.1"
FT                   /translation="MQADPQAFTPIELRYWTEAGLRELLGNPVDTEYVEGDISYQHFQN
FT                   GWLYHSPATGVHELHGDIAQRFVRSGAHRVLGVPTTDEVATPDGVGRYNHFTRDASVYW
FT                   SPSTGAQTVAGTIRKFWSDKGWEAGRLGYPTSSTAGTPDGVGVYNHFVGGDGAGASVYW
FT                   TKATGAHSVQGAIRDLWAANGWENGFGYPSSDELTTLDGLGRQNEFTGKDNPPAAAYWH
FT                   PGSGAHFVTGAIMQRWHELRRELSYLGYPTSNPYEVGDGRTQVDFEGGYIALDQSTGAV
FT                   IDQPW"
FT   regulatory      217189..217236
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(218187..221186)
FT                   /transl_table=11
FT                   /gene="embB"
FT                   /locus_tag="SACE_0186"
FT                   /product="arabinosyl transferase"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0186"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99538"
FT                   /db_xref="GOA:A4F664"
FT                   /db_xref="InterPro:IPR007680"
FT                   /db_xref="InterPro:IPR027451"
FT                   /db_xref="InterPro:IPR032731"
FT                   /db_xref="InterPro:IPR040920"
FT                   /db_xref="InterPro:IPR042486"
FT                   /db_xref="UniProtKB/TrEMBL:A4F664"
FT                   /protein_id="CAL99538.1"
FT                   /translation="MGAVPPSDDGQTRIRRRHWTLAGLACLTLVFGVLAVLSPVRADAP
FT                   VVNWPKAGSAPTSTVLPLSPYRPLDIDATIPCQALNSVGADGGAALNTHPADGPGMNVT
FT                   ARSGTARFWVDGQEVLVDSLRTSCVYHVRADAGGVRIDRDGVLLLHRADLLPPQVSELS
FT                   TQAADTGGLAVQLHPDARYESTPTALKTVLLIAHGLSLFALLVLAWRVWRGTGPGMRFP
FT                   RFGAADAVVLLVSVAWIFLGPSNMDDGWYMMMARNAGENGYMGNFVYMFNVTENPFVLS
FT                   QYLLQVWGELGGWSLWWMRVVPTVCGLVTWMFLRVLLATLLGRAATLRAVPWALLAAHL
FT                   LWYLPYGTTLRPEPVIVMCAAATLVFAEAAVLRQSIGALAVATVCAALAVTASPSGVVA
FT                   VAPLLLCLPWLVQWLRAQPWAARVAAVLLAAASATVVVPVGFADATLADVVEATRVHQW
FT                   YYLSFSWYEEFQHYNTLLNTAGWARRLPVLLTLAVVVVVAIASGRGGMGRDPIRRLTLV
FT                   SVITTSVALVLIALSPTKWVNHFHAVAAAPTVLLAAVLLRSPLPRRAGLVVTGASVLLL
FT                   VGAVSLSFAGDNRWMPFTDAGQRFGEHLNLDSMTNNLEPHIGPLYLRNPLIWVGVAVAA
FT                   WLWARWRRRHGQVVRVGPDRAVLGAASFGAVLLMLALFVVAPIGQAPGWTVARSGVQAM
FT                   AGGCGLASDVRVQLPAGRLGPPGEAELSGDFATTAPPLPTSPWEEPTTIWHDERPDGSS
FT                   TGTGRLATGWYPIAEPAPHVTVPVAGRLDGQVLEVEFATPAGVVTETLHPELRRSALRE
FT                   WQQLSVEVPAGASALRAVVVDQVTGARTWLAVAEPKLTDDRPVTELTRGRAVLANHINA
FT                   PLWPCVDQVGIRDGITDTPVVRLTADEGLPPEWLDNISNLEWGGAWVGTTREWVQTRLH
FT                   AELPGGPPRAPWGNVFVIRYLHPVGQYDLRVPTEIRSSLERFPTLADNDYPDIERNAGT
FT                   QQSESDSEAR"
FT   CDS_pept        complement(221317..221733)
FT                   /transl_table=11
FT                   /gene="ohrA"
FT                   /locus_tag="SACE_0187"
FT                   /product="organic hydroperoxide resistance protein"
FT                   /function="predicted redox protein, regulator of disulfide
FT                   bond formation"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0187"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99539"
FT                   /db_xref="GOA:A4F665"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A4F665"
FT                   /protein_id="CAL99539.1"
FT                   /translation="MNVLYTAEATVTGQGRSGHIRSSDGTLDTGLSMPRELGGAGGAGT
FT                   NPEQLFAAGYASCFHSALHLVAGRAKVSSEGSSVTAHVSIGKDREGFGLAAELVVDLPG
FT                   VERERAEELVAQAHEVCPYSRATRDNIEVRVKVA"
FT   CDS_pept        221935..222444
FT                   /transl_table=11
FT                   /gene="ohrR"
FT                   /locus_tag="SACE_0188"
FT                   /product="transcriptional regulator, MarR-family"
FT                   /function="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0188"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99540"
FT                   /db_xref="GOA:A4F666"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4F666"
FT                   /protein_id="CAL99540.1"
FT                   /translation="MSASDAGRESYLTLDRQVCFALYSASRAFTNLYRPFLADLGLTYP
FT                   QYLVMLVLWEREPVSVKDLGAALRLDSGTLSPLLKRLESAGLVTRVRSAGDERSVEVAL
FT                   TGDGRDLRRRAEHVPASMLCATGMPVDELDALRDTLDRLTAQVDAAAEQARSTLTDAES
FT                   PARRGK"
FT   CDS_pept        complement(222494..223693)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0189"
FT                   /product="two-component system sensor kinase"
FT                   /function="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0189"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99541"
FT                   /db_xref="GOA:A4F667"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4F667"
FT                   /protein_id="CAL99541.1"
FT                   /translation="MRVRTKLAVSIAGIAAAASLALGLTVHEVTQRTRQDQARQVLAER
FT                   LELAARAYGDTGSLTLGTRLDDPGLPAPLRTAAHSGQLATYLDEAADGSELWAATSVLG
FT                   RVMSAHTSFESEQAGIRELDRTIMVAGTATVITTTLLAIMIAASLGRRLSTAAATAREV
FT                   AGGALDARTGFSRTRRPRDEVTDLAGALDGMAAALQARIEAEQRVTADIAHDLRTPVAG
FT                   LVTAAELLPPSRGTELVRDRVAVLRTLVEDVLEVARLDADVEVADNDHVSTAELGKRCA
FT                   AASGAELRVLKDAQVSTDPRRVERIVSNLVANGLAHGEPPVVITVDGPVLRVRDRGPGY
FT                   PPELLETGPRRFRTAAPARGRGHGLGLTIATGQAGVLGASLTFANHEDGGAIATLRLPD
FT                   "
FT   CDS_pept        complement(223695..224354)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0190"
FT                   /product="two-component system response regulator"
FT                   /function="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0190"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99542"
FT                   /db_xref="GOA:A4F668"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A4F668"
FT                   /protein_id="CAL99542.1"
FT                   /translation="MLLVEDDAVLREATQLALERYGYDVRTAVDGLAGWEEFQADAPQV
FT                   AVLDVMLPNLDGIELCRRIRGCSHVPVLMLSARTDPLDVVQGLEAGADDYVVKPFDTSV
FT                   LVARIRSVVRRLRREPAPASAVRTFGDLEVDLDSLEVRRAGRSVPLTPTELRLVLEFAA
FT                   QPGVVLTRSALLERVWDYAWGGDTRVVDVHVQRLRAKIGRERVETVRGFGYKLVPG"
FT   CDS_pept        224649..225080
FT                   /transl_table=11
FT                   /locus_tag="SACE_0191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0191"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99543"
FT                   /db_xref="UniProtKB/TrEMBL:A4F669"
FT                   /protein_id="CAL99543.1"
FT                   /translation="MRKISLVAAAITVATCTAGGIAWSDETPEPVKLMDRWQHAAEQPG
FT                   NFSITSHDGLQDLKWTRWGQEEAVAHGTLVLNPCEPDCAGAPPQYYPDATLRVDQVREV
FT                   GDGNYYSRYTVTADGLPPEKADQLANQPANLPEDVAVRY"
FT   CDS_pept        225111..225641
FT                   /transl_table=11
FT                   /locus_tag="SACE_0192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0192"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99544"
FT                   /db_xref="UniProtKB/TrEMBL:A4F670"
FT                   /protein_id="CAL99544.1"
FT                   /translation="MRGPRRLAGALAVAGAIATLPSCGHPALRVEGPAPVLTPPPADVR
FT                   PEQLANIRNVDIRRTLLTDPAVSQGVKETLEACGACGLADPVYTDLTADGEDDLVVRVD
FT                   SGGSGGMLAAYVYSVRESELRQVFAFEGLDFDVRVSDGKLEVVQAVFAPDDPHCCPSSH
FT                   ETRTYAWNGERLV"
FT   CDS_pept        complement(225781..226542)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0193"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /function="8 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0193"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99545"
FT                   /db_xref="GOA:A4F671"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4F671"
FT                   /protein_id="CAL99545.1"
FT                   /translation="MIDAVGNPQSLFILGGTSDIALATAEQYAAQRPLRIILAARPEEA
FT                   DLVEAAAERLRKTGSTVTTLPFEATDPQTHGEVVEKAFADGDIDVTLVAFGVQGDNEKG
FT                   WTDPAAARFVAEVNYVAPISLGVHLSNKLRKQGHGHIVMMCSPAGERARRSNFVYGSSK
FT                   AGADIFYTGLTYALAESGVKVTVVRPNFVKTKLTEGMKPAPMAQTPQQVGAAIIDAVRK
FT                   GRESIWVPVQMRWVMSVLRHLPRAIFRKLPF"
FT   CDS_pept        complement(226539..227873)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0194"
FT                   /product="FAD linked oxidase-like protein"
FT                   /function="FAD/FMN-containing dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0194"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99546"
FT                   /db_xref="GOA:A4F672"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR007173"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A4F672"
FT                   /protein_id="CAL99546.1"
FT                   /translation="MGWARTSPTTARVVSTPDVEVIARAVREADERGVIARGLGRSYGD
FT                   VSQNAGGTVIDMTALNRIHDIDRDKAVVDVDAGVSLDQLMRAALPHGLWVPVLPGTRQV
FT                   TIGGAIGCDIHGKNHHSHGSFGNHVVSMDLLTADGQIRTLTPDGEGSELFWATVGGVGL
FT                   TGIVLRAKVKMKRTESAYFIVDADRTKDLDETLELFSNGSDMNYDYSMAWFDAISTGPK
FT                   LGRSAFSRGSLAKLDELPPKLRADPLKFDAPQLLTFPDVFPNGLANKLTFSTLSEIWYR
FT                   KTPKQGRGQVQNLTAFYHPLDMFGEWNRAYGSKGFLQYQFIVPFEEDEALRRLVQRIAE
FT                   SGHVSFLNVLKRMGDSSRAPLSFPIPGWTITVDFPIKDGLHRFCEELDEMVLGAGGRLY
FT                   FAKDSRTTPEMVRQMYPRLDEWRQVRAAVDPEGIFNSDLSRRLSL"
FT   CDS_pept        complement(227900..229264)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0195"
FT                   /product="probable FAD linked oxidoreductase"
FT                   /function="FAD/FMN-containing dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0195"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99547"
FT                   /db_xref="GOA:A4F673"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR007173"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A4F673"
FT                   /protein_id="CAL99547.1"
FT                   /translation="MGSVKDELQTLTGWGRTAPTTARVISTPDVEVIAKAVREAGERGV
FT                   IARGLGRSYGDPSQNAGGTVIDMTALDRVHQVDVDNAIVVVDAGVSLDTLMRRLLPYGL
FT                   WIPVLPGTRQVTVGGAVGSDIHGKNHHSQGSFGSHVLAMDLLTADGQVRSLTPDGENSE
FT                   LFWATVGGMGLTGIILNATIRLKRVETAYFLVDNVQTKNLDELIEHFTDGSDDNYIYSV
FT                   AWFDSLARGDKLGRALLTRGNSARIEDLPKKLRKDPLKFNAPQLMTAPPIFPNGLVNKY
FT                   TITAFNEVWYRKAPTKFGMVQNITQFFHPLDLVGEWNRVYGPNGFLQYQFMVPFGQEAM
FT                   FRRSIDKISASGHVSFLNVLKTFGKGNDAPMSFPREGWTLTVDIPITPGLDRLCGELDE
FT                   MVLDAGGRLYLAKESRTTPEMIERMYPRIGEWRKIRASVDPEGVFHSDLSRRLSL"
FT   CDS_pept        229404..229853
FT                   /transl_table=11
FT                   /locus_tag="SACE_0196"
FT                   /product="GtrA-like protein"
FT                   /function="predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0196"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99548"
FT                   /db_xref="GOA:A4F674"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:A4F674"
FT                   /protein_id="CAL99548.1"
FT                   /translation="MAVAEPAAEQAANPEVKRLGVFNQLIRFVVVGGGCAIIDYGTYMA
FT                   LLAGLGWPAWVSKTISFILGTTASYLINRKFTFSGAGTGNAGAKAGAFAVLYTVTFFVN
FT                   VGTNQLLIWLTSPYANWQFTLIWVVAQGLGTLINFVMLKWVVFRD"
FT   regulatory      229871..229910
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(229908..230177)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0197"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99549"
FT                   /db_xref="UniProtKB/TrEMBL:A4F675"
FT                   /protein_id="CAL99549.1"
FT                   /translation="MTNNTRQNLVLHLSGAAQPLHVALDPAEADALVEQLPEFMAAGSA
FT                   RTLKTADGGRFSVNFAHVATAHVENSRGDANAYGAPSRGAGFVR"
FT   CDS_pept        complement(230408..233743)
FT                   /transl_table=11
FT                   /gene="embC"
FT                   /locus_tag="SACE_0198"
FT                   /product="arabinosyl transferase"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0198"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99550"
FT                   /db_xref="GOA:A4F676"
FT                   /db_xref="InterPro:IPR007680"
FT                   /db_xref="InterPro:IPR027451"
FT                   /db_xref="InterPro:IPR032731"
FT                   /db_xref="InterPro:IPR040920"
FT                   /db_xref="InterPro:IPR042486"
FT                   /db_xref="UniProtKB/TrEMBL:A4F676"
FT                   /protein_id="CAL99550.1"
FT                   /translation="MFTGQDDDSRKDDDGTPSGSSARAASNGHDAPATRLKLFAAITGL
FT                   LGTVLALALPFLPVNHEVTTLKWPTAQGTKPVSAPLVSFSPVWLNANVSCETARGLDAR
FT                   TDGRPGTLLSTNPPNSDYGNLTGLVLQVDNNMLTLLSKGQSLSTVPLPAGDCTISVHSD
FT                   AGGTTANVGDQQLASTRGDQRPQLTGVYSDLDESVDNVRDLSFEARVDNRYESSATVLK
FT                   LSAMALVVLAFIGSVVALRRLDVRAGRRPPRLVPPGWWKPTFRDVAVIGALCVWWVMGA
FT                   MTSDDGYILTIARARETAGYVSNYFRWFAVPEAPFGWFYELYSLWVQISTATPWVRLPA
FT                   LLMGIVSWLLISREVLPRLGRQVRRSNAAGWAAAAVFLAFWLPYNNGLRPEPVVVLFSL
FT                   LALCAVERAVATGRLMPAALGLVVAALAVGANPHGLVAVLPYIAALKPLLQIVRKRARE
FT                   FGWVPVLAPIAASGFVILTVVFSDQTLQSVLDATDLRTDLGPSQDWYQELSRYNLLFSQ
FT                   TPDGSMTRRIPVLLVMLCLTTCAVVLLRRGKIRGAALGPSRRLLAVAALSFVVLALTPT
FT                   KWTHHFGLFAAVGGALAALTALATSSTVLRSKRNRAAFFAGLMLVLAFGTTGPNAWWYV
FT                   SGWGVPWFDKPPLILGYSASTVFLLIAAITMIVAFVEHLRLDPHNPEVVDEKARGMEGQ
FT                   SRALRLGTAPLSIICALLVVFELANFAKVIQKQWGSYSLGADNVKQITGSSCGLSDYVY
FT                   VEANPQAGMLKVSANQPTTPAPPVSPDVPVPAKRLKDKESPEAYLKAKLEGFNRSGLPQ
FT                   GDGNDPDEPDWSPPHRFGGDNAPVWGSYDQTGTGIGELRTQWYDLPERAANGEVPVVVM
FT                   LAGANGGANSAYIEFGRDTDQGFQVMQRHYVPVSPGPEWRDHRVTVRGDAEGATKMRVV
FT                   ATDQSLGPNGWVAVSAPRAPQLRNMTDFVGDAPTFVEWTAALVHPCLQIPGIRNGIAEM
FT                   PKFRVSAGAEVRDIGQGWSSPDSGGPLGWLNITTSMRELPTYVKNDIHRDWGSLYRVDP
FT                   FVPDALPAEAAMEVHPETHWGTWTPGPLSKTVQLPGDVPNSDDRNDVQGFGDSAEEPQP
FT                   GQHP"
FT   CDS_pept        complement(233904..234851)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0199"
FT                   /product="glycosyl transferase"
FT                   /function="predicted glycosyltransferases"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0199"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99551"
FT                   /db_xref="GOA:A4F677"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4F677"
FT                   /protein_id="CAL99551.1"
FT                   /translation="MSTDSEQQPTPQVPEVPGGSVVAVIVTRHRRELLAESLKVIATQT
FT                   RVPDHLVVVDNGPDQPARDVVAECPIPSTYLASHRNLGGAGGFALGMLHALSIGAEWVW
FT                   LGDDDGRPGDDRALETLLDEARRRKLAAVSPVVVNIDTPDKLAFPLRRGLTWKRTPEEL
FT                   RTPGSDGDFLPGIASFFNGALFRASTLDVVGVPDYRLFFRGDEVELHRRVVRSGLPFGT
FT                   TLKTRFVHPDGSAEFKPMLGGRFHAQDPSDANKRYYTYRNRGYLLSQPGMRKIGALEIL
FT                   RFGLYFVGHRRDPKAFREWLRLLRQGRREHFFRR"
FT   CDS_pept        complement(234848..235666)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0200"
FT                   /product="putative ABC transport system, ATP-binding
FT                   protein"
FT                   /function="ABC-type polysaccharide/polyol phosphate
FT                   transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0200"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99552"
FT                   /db_xref="GOA:A4F678"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F678"
FT                   /protein_id="CAL99552.1"
FT                   /translation="MVSIDVWNAAVDFPIFDAKSRSLKKAVLGKAGGRIGTDSRVPIIE
FT                   ALHDINLSLRHGDRVALVGHNGAGKSTLLRLLAGIYEPTRGSARVVGKVAPVFDLGVGM
FT                   DPEISGYENIIIRGLFLGMNRKQMEARIDEIAEFTELGDYLEMPLRTYSTGMRVRLALG
FT                   VVTSIDPEILILDEGIGAVDADFLEKARDRLNDLVKRSGILVFASHSDEFLIELCNTAL
FT                   WMDKGGIKERGSLRSVLTHYKGHDPFENLSEETLARIGESAASIGSEEGS"
FT   CDS_pept        complement(235680..236384)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0201"
FT                   /product="ABC-type transporter, permease component"
FT                   /function="ABC-type polysaccharide/polyol phosphate export
FT                   systems, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0201"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99553"
FT                   /db_xref="GOA:A4F679"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A4F679"
FT                   /protein_id="CAL99553.1"
FT                   /translation="MIGPLWITISMAVTVTALGLLYSQLFNQELSVHLPYLAVGFIIWG
FT                   FIGNSINDGAEVFISNEGLIKQLPSPVSIHVLRLLWRQVLFFAHNLVVYFVLIAIFPKP
FT                   VGLGVLLAIPAFAVLAINGGWVMIVVGIISTRFRDIPPVTQSIVQLMFFMTPIVWNYDQ
FT                   FRASSNPAIAERAKLAEINPFMHFLEIIRRPMLGDPIVWRHWIVVGVITVVGWAAALLI
FT                   LRNFRARVSYWV"
FT   CDS_pept        236752..238575
FT                   /transl_table=11
FT                   /locus_tag="SACE_0202"
FT                   /product="probable cysteine desulfurase"
FT                   /function="Selenocysteine lyase"
FT                   /EC_number="2.8.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0202"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99554"
FT                   /db_xref="GOA:A4F680"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR011340"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4F680"
FT                   /protein_id="CAL99554.1"
FT                   /translation="MPRGWCGVSTSPVPAGRPRRICSSCALAAICWAKSAVCRPWKRPS
FT                   SQPTSWAWAIRSSASDGVASCAKGSDSRSSSSMSSGARPCSSSRIEDWWISLSLLRLAS
FT                   SSGAARTSSSSCLIIVPIRITFAGCSTSSLMSSPRSPPSLEPEAAPIGAPSSPTTKTWG
FT                   LPSLCSCSLWFMAPSWLARAGRGERGCDMGHPEARCIGVLRTVSRMAFDVAAVRGLFPA
FT                   LGDGWVHLDAPAGMQVPEQVATAVSTALRAPVSGPGGIFPASQRAEAIVDAARRAIADL
FT                   VGADPAGVVLGPSSAVLLQRLADALGDGWMIGDDVVVSRLDHPANVAPWQRAAQRSGGS
FT                   VRFAEVDIETCELPAWQYKELVTPRTKVVAITAASGAVGTRPDVRAAAEAAAEHDALVV
FT                   VDASAAAPFVPLDIASMGADVVAVNASAWGGPPVGALVFRNPAMLDQLPSVALEPGARG
FT                   PERMELGPHAYPLLAGVVSSVDYLASLDEAAIGPRRERLLTSLGSVKAYQAGLLANLTN
FT                   GLRRLRHVMVIGDAMRRVPSMAFTVSGVKAEDAIEHLAERGVCAFADPGTHGVFAVLGV
FT                   GEVGGAVRVGLAHYTNAFEVDQLVRAVAELG"
FT   regulatory      238624..238661
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(238814..239794)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0203"
FT                   /product="probable NADPH:quinone reductase"
FT                   /function="NADPH:quinone reductase"
FT                   /EC_number="1.6.5.5"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0203"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99555"
FT                   /db_xref="GOA:A4F681"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4F681"
FT                   /protein_id="CAL99555.1"
FT                   /translation="MYAIAIREPGDPDVLEWTEQPDPSPGAGEVLVKVAAAGVNRADLL
FT                   QRRGFYPPPKGASEILGLECSGTIAELGEGVTGWTVGDQVCALLSGGGYAEQVAVPAAQ
FT                   VLPVPSGVDLVEAAGLPEVTCTVWSNVVMEAGLRGGQFLLVHGGSGGIGTCAIQVATAL
FT                   GARVAATAGSPETLQLCRELGADPAISYRDEDFVEVVKGLGGADVILDNMGASYLDRNI
FT                   SALAPDGHLAVIGMQGGRKAELDMGKMLAKRARMSLLALRSRPVEGANGKAAIVTDVRE
FT                   RLWPLVEEGKVRPIVHGRIPMREAARAHSALDAGGVRGKILLTVD"
FT   regulatory      complement(239831..239890)
FT                   /regulatory_class="promoter"
FT   CDS_pept        239932..241473
FT                   /transl_table=11
FT                   /locus_tag="SACE_0204"
FT                   /product="probable aminopeptidase"
FT                   /function="predicted aminopeptidases"
FT                   /EC_number="3.4.17.21"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0204"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99556"
FT                   /db_xref="GOA:A4F682"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="InterPro:IPR041756"
FT                   /db_xref="UniProtKB/TrEMBL:A4F682"
FT                   /protein_id="CAL99556.1"
FT                   /translation="MRTITSGRVTTAVLASCAALAVAVAPASAAPSRDLGDRISGNAVN
FT                   RHLVALQRIADQNGGNRASGRPGYEASVDYVANKLRSAGFDVTTPKFEYQAYYLDKFGL
FT                   AVAGQPVEGDALEYSPATPQGGLTAPLSVLPPDPTPGCEATDYQGTDVSGTVVLIQRGT
FT                   CSFADKQRIASEAGAVGAIIYNNVDGALNGTLGDPADARIPTAGVTKQVGEALAGQAGA
FT                   EVHLDVQSRLETVKTRNVVAQTRTGRADNVVMAGAHLDSVPEGPGINDNGTGSAGLLET
FT                   ALRLGSTPKVNNAVRFAFWGAEESGLVGSTKYVQGLSFEQQLDIALYLNFDMIGSPNAG
FT                   YFAYDGDNSDGVGAGPGPQGSAQIERDLVDAMAANGVQTEGKDFDGRSDYGEFIAVGIP
FT                   AGGLFTGAEGIKTPEQAAKWGGEAGKAYDPNYHMPGDTLANVDRVALERNAKAVASVVQ
FT                   RYAASTEGVNGVQTRAQRAQLRGAEGALTAQRVATAEPEQHAHGADAHGCGRDRA"
FT   regulatory      241524..241550
FT                   /regulatory_class="terminator"
FT   CDS_pept        241628..242827
FT                   /transl_table=11
FT                   /locus_tag="SACE_0205"
FT                   /product="phytase"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /EC_number="3.1.3.8"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0205"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99557"
FT                   /db_xref="GOA:A4F683"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A4F683"
FT                   /protein_id="CAL99557.1"
FT                   /translation="MKRTVLAVSAVVAATASVTAPAVASPEPADIPGLVRFATFNASLN
FT                   RATEGELLADLSTPDDEQARKVAEVVQRNRPDVVLLNEFDHVPGGAAVDAFRANYLAVG
FT                   HNGAQPVDYPYAYTAPVNTGVPSGMDLDNDGSTGGPGDAYGFGQFPGQYGMVVLSKHPI
FT                   GDVRTFQNFRWTDMPGAMLPDDPATPEPADWYSPREKEALRLSSKSHWDLPIHVGGRTV
FT                   HLLASHPTPPSFDGPEDRNGVRNHDEIRFWADYVAGAGYVYDDAGRTGGLERGAPFVIA
FT                   GDQNADPNDGDSADRAATQLLNAQRVVDPRPGSFGAVEAARNQGGANTGHRGAPFFDTA
FT                   DFGDQSPGNLRVDYVLPSLPLVALRSGVFWPGGHDELSRLNDTSDHHLVWVDVLAAYHD
FT                   "
FT   CDS_pept        complement(242907..243677)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0206"
FT                   /product="ABC-2 type transporter"
FT                   /function="ABC-type multidrug transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0206"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99558"
FT                   /db_xref="GOA:A4F684"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A4F684"
FT                   /protein_id="CAL99558.1"
FT                   /translation="MTSVRAFTAVLGRDVFVTGRELPSFLAQVLVQPVAMLFIFGTVLG
FT                   QLGYTQPGYEQILLPGMIALNAFLVSLQNTSFPLVLDFSFSREIEDRLLAPLPISLVAV
FT                   EKMLFGALRGLFAALLMVPIGILMFGTVAWDLAGLPFAVLCMLLGSLSGAAVGLTVGAA
FT                   VPPRRINIMFAVILAPLMFTGATQFPWAQLDQLRWFQVLCAFNPLTYLSEGMRGALLPE
FT                   VPHIAPWICVLALVAATLLFGVLGVRFFLRRALD"
FT   CDS_pept        complement(243674..244657)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0207"
FT                   /product="daunorubicin resistance ABC transporter ATPase
FT                   subunit"
FT                   /function="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0207"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99559"
FT                   /db_xref="GOA:A4F685"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F685"
FT                   /protein_id="CAL99559.1"
FT                   /translation="MTSAVEVVDLVKRYPKSASNAVDGLSFEVSPGEVFGLLGPNGAGK
FT                   TTTVGILTTRVLLTSGTARVAGIDVAADPVAARGKVAVVPQRVNLDRSLNARQNLVWHA
FT                   NYHGVGRSERHRLADELLERMGLSGKAKARVDDLSGGQAQRLMIARALIHRPEVLFLDE
FT                   PSTGLDPQARLFVHDRVTELRADGVTVVLTTHDMDEAEKLSDRVGIVDHGKLLTLDTPE
FT                   KLIKSLPGSGTLAVTVLSAGVDEHELSELLCAVRGVERVESVSAGQTAEAEPELRLRLY
FT                   VEGEPSALLGPVAQALHQRQVPIIDLSPGSATLEDVFIELTGRELR"
FT   CDS_pept        complement(244641..245099)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0208"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0208"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99560"
FT                   /db_xref="GOA:A4F686"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4F686"
FT                   /protein_id="CAL99560.1"
FT                   /translation="MPLGRLVALTGQRLGRHWHQAVTAHTQLSGTALAALTALAEHDGL
FT                   THRDVARHCWVRPATLTPVVDALAADGLLSRKRDLSDRRAVRLCITAAGRQALREALEG
FT                   VGARFRAIAPPTTPEEEAVIRAYLLTILDGLDAVEATEAREGSSDVCG"
FT   regulatory      complement(245132..245191)
FT                   /regulatory_class="promoter"
FT   CDS_pept        245229..245708
FT                   /transl_table=11
FT                   /locus_tag="SACE_0209"
FT                   /product="transcriptional regulator, MarR family"
FT                   /function="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0209"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99561"
FT                   /db_xref="GOA:A4F687"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4F687"
FT                   /protein_id="CAL99561.1"
FT                   /translation="MKNVSDAEVSWLDGREMAAWRSYIVGSALLEHRLNRELQAAHGLS
FT                   IADYEILVRLSERPGMRMRMSELATEVAHSKSRISHQIRRLEAAELVRREDCPSDGRGV
FT                   FAMLTEAGERRLREAAPTHVAGVRDHMIDQIDPEDQEVLAKVFGKLTARLRSTDT"
FT   tRNA            245758..245845
FT                   /gene="tRNA-Ser (TGA)"
FT                   /locus_tag="SACE_8005"
FT                   /product="transfer RNA-Ser (TGA)"
FT   regulatory      complement(245850..245896)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(246108..246566)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0210"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99562"
FT                   /db_xref="UniProtKB/TrEMBL:A4F688"
FT                   /protein_id="CAL99562.1"
FT                   /translation="MTAFLHTPVKALRCASSPQREHPPLATTRPRPLLAADPRRRTTVL
FT                   LVFPPHGQQPRIDLRPAHLRTFLFDGVGHAPRLVPVQAPRLSRAQVLTFGGRRSSAAGS
FT                   AARQIRTPLLHFGHTRRPPTRHPVDLDVRHGERVRGVRSMAFAPLGHR"
FT   regulatory      246853..246912
FT                   /regulatory_class="promoter"
FT   CDS_pept        247054..247629
FT                   /transl_table=11
FT                   /locus_tag="SACE_0211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0211"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99563"
FT                   /db_xref="UniProtKB/TrEMBL:A4F689"
FT                   /protein_id="CAL99563.1"
FT                   /translation="MKRLIAPVAVALLLGLTGCAGSNGADTIAPADVAGESSGETQNQQ
FT                   SAGEQQASTGSGTVKFGESVEFAPEADTALKVTLQAPTDQSALETMVPAEGKYVYIAAE
FT                   AVLTDGIMGVVSGDEFTLVDGEGNRYEQAAATLDDMFLEMLAPNGEPGTGMIVYDVPEG
FT                   TDLSSLKVEWEATDSSDKPVGIGGTWTA"
FT   regulatory      247732..247782
FT                   /regulatory_class="terminator"
FT   CDS_pept        248109..248873
FT                   /transl_table=11
FT                   /locus_tag="SACE_0212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0212"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99564"
FT                   /db_xref="GOA:A4F690"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A4F690"
FT                   /protein_id="CAL99564.1"
FT                   /translation="MVGALVLTGCAGQPQLPGTPPPLVMVPDTIAAHELAALPESTTFG
FT                   DLAAAPSDPAPQSETTGVVVRVKQDLAVYDAPHGRAFARLPATQLANPTWVPAIAEREG
FT                   WAQVLLPSRPNGSTGWVWLGGPERTEKARSPYVVDVDVDKRRLVLRENGVETASWDVSV
FT                   GAPASPTPRGRTFIMAAIEETVTRYSPIILPLGTHSETFSTYGGGPGTVALHGWPDASV
FT                   FGQDRSDGCVRVPPDALRTLTSLPLGTLVLLR"
FT   CDS_pept        248919..249446
FT                   /transl_table=11
FT                   /locus_tag="SACE_0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0213"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99565"
FT                   /db_xref="UniProtKB/TrEMBL:A4F691"
FT                   /protein_id="CAL99565.1"
FT                   /translation="MHKRFLLGAVALSSGLLATASPALADSVDNDGVNVANGNNVSLLP
FT                   IQLCGNDIAIVGAVVEALSTTDTKCVNAPIVDHPSQETGDVNVVVPPKPKPEHEHHKPK
FT                   PKPKPEFPCAVKPPFLPGQLPCAPAAPGPAAPAPAPSAVSPVSQAQPQVQAAALPTAPA
FT                   PSAVLGHVAVTG"
FT   regulatory      249568..249604
FT                   /regulatory_class="terminator"
FT   CDS_pept        249825..251354
FT                   /transl_table=11
FT                   /locus_tag="SACE_0214"
FT                   /product="cationic amino acid transport protein"
FT                   /function="Amino acid transporters"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0214"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99566"
FT                   /db_xref="GOA:A4F692"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A4F692"
FT                   /protein_id="CAL99566.1"
FT                   /translation="MPGNGLLRTKSIERSIRDTDEPNSKLKKSLGAFDLTVFGVAVVVG
FT                   AGIFSVAASTAGNMAGPSVSLAFIMAAVTCGLAALCYAEFASTVPVAGSAYTFSYATFG
FT                   ELIAWIIGWDLVLEFAVAASVISKSWSSYLAEVLGLAGADLSPVTTVGPVTVDWGAMFI
FT                   AGLITVLLVAGTKLSSRVNQVITAIKVTVVLVVIVVGIGYVNPKNYTPFIPPAAPSAGA
FT                   DAGATGLDQSLLSLLFGGAGSTYGTFGLLAAASTVFFAFIGFDIVATAAEETRDPKRDM
FT                   PRGILGSLVIVTVLYVAVSLVVTGMSHYTTLKDRPDGSSATLATAFADHGVTWVAGFIS
FT                   VAAMIGLMTVVMVLIMGQSRVLFAMSRDGLLPKAASKTGERGTPARATAFVGVVVALVS
FT                   GLFDTNVLAELVNVGTLFAFAMVSVGVIVLRRTRPDLERGFRTPFVPVVPVLAVLACLW
FT                   LMINLTVFTWVWFFVWLVLGLAVYFAYGRRHSVLGRRQAEAGREEQPVEAG"
FT   CDS_pept        complement(251440..252348)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0215"
FT                   /product="possible lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0215"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99567"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A4F693"
FT                   /protein_id="CAL99567.1"
FT                   /translation="MNRTKRAVTGLAAATASLVIAATPALSAPQAPQVDPGITLGYTVV
FT                   DARSGETTLQSNEHEQFRSASVVKLLIALDYLEGLEPGAEIPAEDEALLQPMLRSSNDA
FT                   AASTFWVRGGQKAIVERMADKLDLDDTRPPAKEGMWGYTALSASDVAKTYRYVLDDTEP
FT                   EVRDFIMGNLRKHTTCADDGFDQSFGLAGAPGADAVKQGWSGFGAAPEPGEECRDSSDD
FT                   PAATARVLNSPEVARARQIAPGEDPDDAPEIDLKRPAMHTTGTVDDGDKIVVLLTLEPE
FT                   KTDWQTAAKRTTQIAKALALA"
FT   CDS_pept        complement(252463..253173)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0216"
FT                   /product="putative conserved alanine rich lipoprotein LppW"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0216"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99568"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A4F694"
FT                   /protein_id="CAL99568.1"
FT                   /translation="MDDISAGYLVVDAASGRVLSERDPRRRFRSASIVKILIALDHLLE
FT                   LGPGGDIPDDDRALLGPMLRASNDDAASTLWERAGQRAVIDRMAPALGLRDTEPPADEG
FT                   MWGYTAISAADVVRIYLHLLHDAPDDVGAFVLGHLRNHTQWADDGFDQSFGLPSALPDA
FT                   GAVKQGWSGFGSRARTDAGSGDGIDLKRPAMHTTGTTADDGTVIAVLTLHPDDTDWDTA
FT                   AKRVTELTRAIVRT"
FT   CDS_pept        complement(253240..254292)
FT                   /transl_table=11
FT                   /gene="hisC2"
FT                   /locus_tag="SACE_0217"
FT                   /product="putative histidinol-phosphate aminotransferase"
FT                   /function="Histidinol-phosphate/aromatic aminotransferase
FT                   and cobyric acid decarboxylase"
FT                   /EC_number="2.6.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0217"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99569"
FT                   /db_xref="GOA:A4F695"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024892"
FT                   /db_xref="UniProtKB/TrEMBL:A4F695"
FT                   /protein_id="CAL99569.1"
FT                   /translation="MTVRTRADLDQLPAYVAGRTVPGSIKLASNEVSAGPLPSVVETIT
FT                   RAAAEVHRYPDMGATKLTEALADKLHVAPERLAVGCGSVALCEQLVQATCSAEDEVVYP
FT                   WRSFEAYPIITRVVGARQIPVPLTGEHALDLDAMASAITSRTRLVFVCSPNNPTGPLVR
FT                   RAELEAFLDRVPSDVLVVLDEAYWEFVSDPEAPDGVEVARARENVASMRTFSKAYGLAG
FT                   LRVGYTYAPEHVAAALRKVCIPFSVNAVAQAAAVASLEAQDELKERCDSVVSERRRVRD
FT                   ELLGLGYEVPETQANFVWLPLGESTQEFNEHCLDNRVVVRAFVGEGARVTIGRPEENDT
FT                   FLAAARSYRR"
FT   CDS_pept        254870..255574
FT                   /transl_table=11
FT                   /locus_tag="SACE_0218"
FT                   /product="carboxymethylenebutenolidase"
FT                   /function="Dienelactone hydrolase"
FT                   /EC_number="3.1.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0218"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99570"
FT                   /db_xref="GOA:A4F696"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4F696"
FT                   /protein_id="CAL99570.1"
FT                   /translation="MTQTRTETLALTDGTELRLTVAEPDNVVRGGLVVLHEARGVTDRV
FT                   RHLVSSLAEEGWLTVAPHLYHRDGTDELDEQHTAEHVIDQVQRLSGESILADTDAAFVW
FT                   LADQGVHPDHLGVVGFDIGGTAALVVAASRRLGAAVTVGGPGILDPLSDALPALVEIAG
FT                   ELTCPWLGLYGAGDEDIAVEEVDKLREAAESAGVATDVVCFDDTDHRFDDDAEAASEAW
FT                   QRTRNWFDLHLR"
FT   regulatory      255575..255614
FT                   /regulatory_class="terminator"
FT   CDS_pept        255648..257630
FT                   /transl_table=11
FT                   /gene="acsA"
FT                   /locus_tag="SACE_0219"
FT                   /product="acetoacetyl-CoA synthetase"
FT                   /function="Acyl-coenzyme A synthetases/AMP-(fatty) acid
FT                   ligases"
FT                   /EC_number="6.2.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0219"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99571"
FT                   /db_xref="GOA:A4F697"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR005914"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A4F697"
FT                   /protein_id="CAL99571.1"
FT                   /translation="MTSSTTPELLWQPSPARIAESRMAAFRAWLRTERDLDLSDYRALW
FT                   EWSVADLEGFWGALADFFDVAYHDRPQRVLAEEVMPGARWFPGATLNYAEQALRGGAGK
FT                   ADDDLAVIFAREDGRGEEITFGELRARVAAARAGLVELGVERGDRVAALAPNSPETLVA
FT                   FLAAASLGATWSSCSPDFGLRAVADRFVQIEPKVLIAVNGYVYGGRSFDVRSTVDELRE
FT                   AIPGSPATVLVDYLGNGADLPGCVGWDDLLERHRGAELAFDAVPFDHPLWVLYSSGTTG
FT                   LPKGIVHGHGGMTLEHLKAVGLHCDLGPGDRFFWFTTTGWMMWNFLVGGLLTGTTIVLF
FT                   DGSPAHPDLSALWRLAERYRVNYFGTSAPYIQTCLKRELRPKEDYDLSALRTVGSTGAP
FT                   LTTDGFRWIADAVGEDVQIASISGGTDMCTAFVGASPDEPVYLGEISCRMLGAAVAAYD
FT                   EHGRELHEEVGELVVTKPMPTMPVFFWNDPDGSRLRDAYFDTYPGVWRHGDWVRITDRD
FT                   TLVIYGRSDSTLNRGGIRMGTAEFYRVVEGFDEVTDSLVIDTSGAGETDGELLCFLVLA
FT                   EGVALEDVQPKLKEALRGQLSPRHVPNRFIVVGEIPHTLNGKKLEVPVKKILAGADPER
FT                   AVSRDALQNPDALTPFVQISRHSGA"
FT   regulatory      257666..257726
FT                   /regulatory_class="terminator"
FT   tRNA            257748..257837
FT                   /gene="tRNA-Ser (GCT)"
FT                   /locus_tag="SACE_8006"
FT                   /product="transfer RNA-Ser (GCT)"
FT   tRNA            257877..257949
FT                   /gene="tRNA-Arg (ACG)"
FT                   /locus_tag="SACE_8007"
FT                   /product="transfer RNA-Arg (ACG)"
FT   CDS_pept        258342..258455
FT                   /transl_table=11
FT                   /locus_tag="SACE_0220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0220"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99572"
FT                   /db_xref="UniProtKB/TrEMBL:A4F698"
FT                   /protein_id="CAL99572.1"
FT                   /translation="MQRLARELSDQLEHAVAQAREPDEDQLRFNARPPRLR"
FT   CDS_pept        258851..259453
FT                   /transl_table=11
FT                   /locus_tag="SACE_0221"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0221"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99573"
FT                   /db_xref="UniProtKB/TrEMBL:A4F699"
FT                   /protein_id="CAL99573.1"
FT                   /translation="MDHHDAVATPRDALRSLAGFCNDRPDRATPPSPAGGVRRSDRSDV
FT                   GCTHAESCPLFPFLKASLRGWREHYCDSEDRWLECARYQVARTGQHVPISLLPNGRDAH
FT                   YLAMAAEESRTAVTEPVRASDLGRAHQHERAAHERAARPEPRSTETTEQFGAVAQPKPP
FT                   PRSPEEPPSEPREPARRRKPEKRGWWRRLADWMRGPA"
FT   CDS_pept        259450..260088
FT                   /transl_table=11
FT                   /locus_tag="SACE_0222"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0222"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99574"
FT                   /db_xref="GOA:A4F6A0"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6A0"
FT                   /protein_id="CAL99574.1"
FT                   /translation="MSNYWPWWAGAVGLALVTINYTLITDRSLGVSSAWDRVLHWRAER
FT                   RHERHEARFADEGALADALAAATAEEFGDRSSTQDRGDDVRAQYVGSSAVEATSAASMR
FT                   PVPVVTQAALLLAIFAGGWVAAVTAGRFEVRFDMGAGFRDLVTADPNAMIGLLFAGGLL
FT                   VGFGTRLAGGCSSGHGLSGCGRLRPVSLVATAVFFGTAVLVSFLLWKVV"
FT   CDS_pept        260088..260504
FT                   /transl_table=11
FT                   /locus_tag="SACE_0223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0223"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99575"
FT                   /db_xref="GOA:A4F6A1"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6A1"
FT                   /protein_id="CAL99575.1"
FT                   /translation="MRTRGAVLVANVITGLALGFTVTNIGFGDYAELNRMFTFQDPRML
FT                   FAFAGAVGIIVVVFAVVGARRTPGRIHAGVVPGGIMFGTGWAISGGCPAIPIIQVASGY
FT                   LPALVTIAGVMVGMWLCRWANARLFHLDRGSCGL"
FT   CDS_pept        260664..260906
FT                   /transl_table=11
FT                   /locus_tag="SACE_0224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0224"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99576"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6A2"
FT                   /protein_id="CAL99576.1"
FT                   /translation="MGLLQNKPQDLAAKAKQAYDDGRQRFAVRLLDLPSAKDDEVDSWS
FT                   RHIEAIEAAGWIVDHFSTVPSDRGWNHGYVLFMRR"
FT   CDS_pept        261040..261825
FT                   /transl_table=11
FT                   /locus_tag="SACE_0225"
FT                   /product="putative 3-oxoacyl-(acyl carrier protein)
FT                   reductase"
FT                   /function="8 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0225"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99577"
FT                   /db_xref="GOA:A4F6A3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6A3"
FT                   /protein_id="CAL99577.1"
FT                   /translation="MTKRLADLFRLDGRTAVVVGGGSGLGRSSALGLAEFGADVVVADL
FT                   DRDSAEGTVAAIGELGHKASWRELDIRDGDAIRELADEQDETAVLVITPGVNVRKRLLD
FT                   TVDDEFDRVVELNLKGTYRLVRDFGRNMARRGGGSIITFASFRADVVEPGQGIYAASKA
FT                   GVVQLSRALAAELGPQGVRVNAVAPGPFETPLTEQIKSDERWYGAYAQKTALKRWGAAD
FT                   EIAGAVVYLASDAASYVTGTVQYVEGGWTAIDGRFDPAL"
FT   regulatory      complement(261822..261871)
FT                   /regulatory_class="terminator"
FT   regulatory      261840..261877
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(261885..262082)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0226"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0226"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99578"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6A4"
FT                   /protein_id="CAL99578.1"
FT                   /translation="MRSLSRAVIVGAMTVPLALGFAGFAAAHGDSAVCNVKACNNHDWT
FT                   WDWFSVENTETPTMNIANIS"
FT   CDS_pept        complement(262460..262930)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0227"
FT                   /product="YbaK/prolyl-tRNA synthetase associated region"
FT                   /function="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0227"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99579"
FT                   /db_xref="GOA:A4F6A5"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6A5"
FT                   /protein_id="CAL99579.1"
FT                   /translation="MTNAVDDFSAHLRRLGATGEVVEFETEVPTAAAAAELLGCEVGAI
FT                   GNSLVFDVGEEPLLIITSGAHRVDTRHVSRTLGLGRIRRATPEFVLAATGQPVGGVGPV
FT                   GHPEPIRTLVDRHLENYPTVWAGAGTKHRMFPTSFGELLRITGGTAIDVSAG"
FT   CDS_pept        263328..264521
FT                   /transl_table=11
FT                   /locus_tag="SACE_0228"
FT                   /product="chloramphenicol resistance protein"
FT                   /function="Arabinose efflux permease"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0228"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99580"
FT                   /db_xref="GOA:A4F6A6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6A6"
FT                   /protein_id="CAL99580.1"
FT                   /translation="MPLRLLVLAVGTFVINTGSYLVAGVLPSIAGAVGVPVTTAGQLIT
FT                   MHALTYAVSAPVLSTLAGRWERRRLLWVSLGLFVLGNIATAVAPDFASLTAARVLGALG
FT                   ASMFTPTAVVIAADLVPLDRRGRAVSMVLSGLTLATVVGVPMGVLLEGMLGYRGLFWIV
FT                   ALLGVLASVALLALPRVPAPPAARFGERLSVLRDRTVVWVLAVSLLGSLADFAAYTYAS
FT                   PMLSALTGAGAGTLGALLFVYGVAGATGNAVVGRITDRFGSGVGIAGSLLALAAGLALL
FT                   PLAGSATWAVAGLLVLWGLGGWGIMPAIQHRLINLTPASAAVVIAFNSSALYLGMGLGG
FT                   ITGGAVAAAWGWAALGPASAVVSVLALVLFWRLPAPAARAAVPERARPEDVPVGASG"
FT   CDS_pept        complement(264665..265870)
FT                   /transl_table=11
FT                   /gene="cypA"
FT                   /locus_tag="SACE_0229"
FT                   /product="cytochrome P450-like enzyme"
FT                   /function="Cytochrome P450"
FT                   /EC_number="1.14.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0229"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99581"
FT                   /db_xref="GOA:A4F6A7"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6A7"
FT                   /protein_id="CAL99581.1"
FT                   /translation="MSIPADTWGIPASQFWLRGRRPERTVDYDAATGMWNVYGYPEIQH
FT                   VLSDPRTFSSDTTRLMPAKVAERTSALSEGSLLQMDPPEHTKLRKLVSHAFTPKVVADL
FT                   APRIADLANELLDDVGDRMEMVEDLAYPLPVIVIAELLGVPGSDRHLFKKWVDALLQRD
FT                   QQFSLVDESDEQVQQVEEAIAQVKHLTDYLGEHAAERRRAPREDLLTKLVQAEVDGHRL
FT                   SDTEVVNFANILLLAGHITTTMLLGNTVLCLDTHPRQRDAVRADRSLVPSAIEESLRFF
FT                   SPFAVLGRVTQREVEVGGQTIPQDQMLMLWIAAANRDPRQFADPDVFDVTRDPNPQIAF
FT                   GRGIHFCVGAPLARLEGKVALNILLDRFPHLRTDPDEGPTFLPAPTTTGVRKLPLLLTP
FT                   SA"
FT   CDS_pept        complement(265901..266599)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0230"
FT                   /product="putative HTH-type transcriptional regulator"
FT                   /function="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0230"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99582"
FT                   /db_xref="GOA:A4F6A8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6A8"
FT                   /protein_id="CAL99582.1"
FT                   /translation="MPKAEVRNTDRADRILDAAAELMLRLGYRKVTIEDVARQAGIGKG
FT                   TVYLHWRSKETLFRALLHRASIALTEQILERLETSPEEIRPHRFLRTAFVITMRDPILH
FT                   AMLLRDTEVLGDLRDSLTGSLESVVNERYFALMAERGFLLDMPHLSYAVSASMLGHYLI
FT                   DRFDPSVPSDLELRGEIVAHTVRASFEPAEGPDRATVVSTATEISTMLRDLLAHYRERI
FT                   YSHDPTREHG"
FT   regulatory      complement(266656..266715)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(267030..267992)
FT                   /transl_table=11
FT                   /gene="tyrA"
FT                   /locus_tag="SACE_0231"
FT                   /product="prephenate dehydrogenase"
FT                   /function="Prephenate dehydrogenase"
FT                   /EC_number="1.3.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0231"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99583"
FT                   /db_xref="GOA:A4F6A9"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6A9"
FT                   /protein_id="CAL99583.1"
FT                   /translation="MRAVCVIGLGLIGGSVLRAASAAGRPAWGATASRPDADAARAEGF
FT                   AVEDSAEDALRRAAAEDALVVVATPLTAVREVLRQVAWHAPEAWLTDVVSVKDPVEAEV
FT                   RSLLPGAKYAGGHPMAGLAESGWRAGSAELFSGASWAVTIEDGTTAPAWREAAALAVDC
FT                   GARVVPCSAAEHDSAVARVSHLPHVFAAVLAAVGADGGPLALSLAAGSFRDGTRVAGSA
FT                   PDLVRAMTEGNRVALLDAVDDALGRLGAARGSLASTGSLKSTVDAGHEARRALEAAPEP
FT                   RSLRVRLDEKGALDRLRDVGARGGRVVALDEDAATVEVP"
FT   CDS_pept        267550..268608
FT                   /transl_table=11
FT                   /locus_tag="SACE_0232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0232"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99584"
FT                   /db_xref="InterPro:IPR023869"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6B0"
FT                   /protein_id="CAL99584.1"
FT                   /translation="MPSSMVTAHEAPLNSSADPARQPDSARPAIGWPPAYFAPGSRLRT
FT                   SASTGSFTLTTSVSHASGACQATWRSTSRTAVSGVATTTSASSAAALRSASSALSSTAK
FT                   PSARAASASGREAVAPHAGRPAAEAARSTEPPISPSPMTHTARMATILPEPPPAGPRTR
FT                   MSGNPSPEGYERAIVLSGGVRTLYGVLMTDQEPVAGFAVAVVREDGRWRCSAMDSSVLA
FT                   GLDTAITELRGLRSTGAVFGMCNVDDEFFVLIRPVPGGVDLLLSDAAAALDYDIAADVL
FT                   DLLRIDPPDEDDDEVWPEGNLAILSDIGLPEGELLVIIEEVDLYPDEQLEMIAQRCGFG
FT                   EQFAGLMEKLDQ"
FT   CDS_pept        268605..269072
FT                   /transl_table=11
FT                   /locus_tag="SACE_0233"
FT                   /product="CMP/dCMP deaminase, zinc-binding"
FT                   /function="Cytosine/adenosine deaminases"
FT                   /EC_number="3.5.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0233"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99585"
FT                   /db_xref="GOA:A4F6B1"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6B1"
FT                   /protein_id="CAL99585.1"
FT                   /translation="MTAAGARDTELVRAALEVAPGALSTGDVPIGAVVAGPDGRVLARD
FT                   HNRREALHDPTAHAEILALRAAAGVLGDGWRLEGCTLAVTVEPCTMCAGALVLARVERV
FT                   VFGCWEPRTGAVGSLWDVVRDRRLNHRPEVVGGVLEAECSALLEAFFHGQR"
FT   CDS_pept        269255..269797
FT                   /transl_table=11
FT                   /locus_tag="SACE_0234"
FT                   /product="RNA polymerase sigma-70 factor, ECF family"
FT                   /function="DNA-directed RNA polymerase specialized sigma
FT                   subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0234"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99586"
FT                   /db_xref="GOA:A4F6B2"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6B2"
FT                   /protein_id="CAL99586.1"
FT                   /translation="MLAARAAAGDEQAFAVFVRRHSDGVFALALRMLGDRVEAEDVVQD
FT                   VFVTVWRRVGELADFGAARAWLFQIARRQCLIVLRRKRIRRTYPVGSVPEHRPAVGAAR
FT                   GVADPQRMAEAGAGVCALGRALAGLPTRQRDVWLLAEVDGLSYVEIGQRVGAGEEAVRG
FT                   RLSRARATLADAMRAWR"
FT   tRNA            269855..269943
FT                   /gene="tRNA-Ser (CGA)"
FT                   /locus_tag="SACE_8008"
FT                   /product="transfer RNA-Ser (CGA)"
FT   regulatory      269948..269993
FT                   /regulatory_class="terminator"
FT   CDS_pept        270196..272004
FT                   /transl_table=11
FT                   /locus_tag="SACE_0235"
FT                   /product="putative large secreted protein"
FT                   /function="predicted extracellular nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0235"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99587"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6B3"
FT                   /protein_id="CAL99587.1"
FT                   /translation="MGRNSTIAAGVVVACGALSIAPVATADAADRIHDIQGTGRLSPLA
FT                   GKHVADVPGVVTGVRAFGSSRGFWFQDPEPDKDPRTSEGLFVFTGQQTPQVAVGDAVTV
FT                   SGEVAEYYPTAEGETPQDTANQSVTELKNAQWQVTGKGAVRAEALTPESVPQAYAPKGE
FT                   LEKRELDPAEYALDFYESREGMSLAVSDARVVGPTDAYNALWVTSKPEQGANERGGSTY
FT                   TSYDDPNGGRLKVESLIPFAERPFPKADVGDRLAGATAGPLDYSRFGGYVLEAAVLGEH
FT                   QPGGLQRETTRDQAEDELAVATYNVENLAADDDQAKFDRLAQGIAGNLASPDVVALEEV
FT                   QDNTGAEDDGVVAADQTLRRFTDAIAAAGGPRYEWRQIDPQNGADGGEPGGNIRVAFLF
FT                   DPARVSFNDRPGGDATTPVRPVADGGGAALSVSPGRIDPANAAWENSRKPLVGEFTFRG
FT                   QRVFVVANHFNSKGGDQPLHGRFQPPVRGSEEQREAQAKAVRAFADQLRAVDDQARIVV
FT                   AGDLNDFGFSPVVRTLTADGALVDAAEGLPPAERYSYVYEGNSQALDHILTSPAAGTAD
FT                   YDVVHVNAEFADQASDHDPQIVRLKG"
FT   CDS_pept        complement(272048..272542)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0236"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99588"
FT                   /db_xref="GOA:A4F6B4"
FT                   /db_xref="InterPro:IPR025325"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6B4"
FT                   /protein_id="CAL99588.1"
FT                   /translation="MRFRPPFRHRLPDVSEHGLEAAADIYAQRLRAFYDSRARWHRRFY
FT                   RFSGILVIAVGAGLPILTTQQFPGQDLVISIAGVTVAVSAGLRAFYRWDQSWILLRRTE
FT                   IALTDAHWQWKAGLGADPVANAENTQRFLEELGSLRRQESDSFFQDLSFPGSAEASRPQ
FT                   H"
FT   CDS_pept        complement(272539..273294)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0237"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /function="Glycerophosphoryl diester phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0237"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99589"
FT                   /db_xref="GOA:A4F6B5"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6B5"
FT                   /protein_id="CAL99589.1"
FT                   /translation="MNDAGWLHDRPIAHRGRYDESAGVPENSLAAFRAAVELGTPFEFD
FT                   VQLTADGVAVVAHDANLRRVTGEDVLVAESTHARIRRLRTGCGGEPVPTLDDVLEVAGG
FT                   QVPVLVDVRRWGGHGGTDLERVVAASLRGYRGAVALQSFDPRAVLRLRRLTADHPVGQA
FT                   SGSLPSAAPPLRWIGRSMVSNVLTRPDFVSYELAALPCWFADRWRTRTRPLIAFTAHSR
FT                   AEAGRALQVADNYFYAGFTPDEHREEQRP"
FT   tRNA            273542..273627
FT                   /gene="tRNA-Ser (GGA)"
FT                   /locus_tag="SACE_8009"
FT                   /product="transfer RNA-Ser (GGA)"
FT   CDS_pept        complement(274405..275724)
FT                   /transl_table=11
FT                   /gene="int"
FT                   /locus_tag="SACE_0239"
FT                   /product="integrase (recombinase)"
FT                   /function="Integrase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0239"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99590"
FT                   /db_xref="GOA:A4F6B6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6B6"
FT                   /protein_id="CAL99590.1"
FT                   /translation="MPRKRRPEGTRAPNGSSSIYYSETDGYWHGRVTMGVKDDGSPDRR
FT                   HVKRKDEGECRRRVRELENERDSGKVRKPGRAWTVKKWLEYWVEHIAAPSVRETTMVGY
FT                   RASVYRHLIPGVGKHRIDQLQPEHLERLYARMQKNGLKAGTAHLAHRTIRVALNEAVRR
FT                   RHLLENPAKVAKAPRLDEEEIVPFTVDEARRILDAASNVRNGARFIIALTLGLRRGEAL
FT                   GIKWSDITIAWKHGCDKGSPCRRKQDAQRCGQRRGSGTLVIRRAIQQQVWKHGCPEEKP
FT                   CDHRYGAHCPQRHGGGVVVTDVKSRAGRRTVGLPQPVIEALEDHRAHQQFERERARDEW
FT                   EEDGWVFANRWGRPVHPTVDYDNWKALLRLANVRNARLHDARHTAATMLLVLKVPLPAV
FT                   MEIMGWSEASMAKRYMHVPHDLVTAIADQVAGLVWPDLDA"
FT   CDS_pept        complement(276265..276591)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0240"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99591"
FT                   /db_xref="GOA:A4F6B7"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6B7"
FT                   /protein_id="CAL99591.1"
FT                   /translation="MTPLDITGRALAMLAALALLTAAAAAVVLWRAVLPVILIAALAVT
FT                   SGMVRTLALGGFAALAGLRGLMLALDRAGTAVPTPRLRRSPPAWIPQTAGAGHEPGNEH
FT                   PATE"
FT   CDS_pept        complement(276588..277157)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0240a"
FT                   /note="Xis like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0240a"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99592"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6B8"
FT                   /protein_id="CAL99592.1"
FT                   /translation="MTTAAMSPSRPTPRVGGGAVPAVPAVPPQVSAGRQHALGRHEPSH
FT                   SCKPSQPDQHRDAWDGWDGYPPHPVLPDRGWPVNGPVSPAGASEYPLAIHLPGPLGATC
FT                   ANASPVGKWMPGGSGVDAPIQGGFPPTRPPTHSTTRHQPQPRPGGWVDLVDTPRGDAPA
FT                   RLCRGGPHRPPTRSNRPPSTTPGDPR"
FT   CDS_pept        complement(277154..277384)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0241"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0241"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99593"
FT                   /db_xref="GOA:A4F6B9"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6B9"
FT                   /protein_id="CAL99593.1"
FT                   /translation="MSTSTPASLPRPREAGDATRLLLTVEQAARRLSVGRTTMFKLIKS
FT                   GDVDSVRIGHARRVPAEALTAYINRLARNAA"
FT   CDS_pept        complement(277667..279133)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0242"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0242"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99594"
FT                   /db_xref="InterPro:IPR025048"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6C0"
FT                   /protein_id="CAL99594.1"
FT                   /translation="MSKPDTPAATPADQPRRLRLVSDSDQPTASPETPGTGTGPVLPPD
FT                   PETERQALAQIANARAELPARDEAMFETFLGDLVRQVQPTSEADPTNILASLLAGTGVY
FT                   LGARPHLRVGDDRHPLLVWPMVIGRTGIGRKGAGWSAAKRLLLAADAGFVASNIHSGLT
FT                   SGEGLTQAFADEDEGDGTEPGKGKPRPRALLPTGDRRLLAFEPEWASVMARMRREGNTL
FT                   SATLRAAWEGGNLSTLGVNARIVRDAHVGILTHITPGEFTAKLSSSDMAGGTYNRFLPV
FT                   FVAQTQFLPAGTGADPALIERLAVDLRARLDQGATLGQLGFSDEAAYLWRRLYVEFGGF
FT                   STEDGPIEQFLSRAAPNCLRVAGIHAALDGTATIQPPHLVAAAAFIRYAVDSARAVFRK
FT                   ADPVLAQLAAFIREAGPQGRTRTEITSDFFQGNAKKPRIDALLERLVADQTIARTQRRP
FT                   EGRKGGRATDIVIAHEHYELTNNAPDQDKP"
FT   regulatory      complement(279272..279313)
FT                   /regulatory_class="terminator"
FT   regulatory      complement(280010..280069)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(280123..280464)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0244"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99595"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6C1"
FT                   /protein_id="CAL99595.1"
FT                   /translation="MTASKVPVHGVVTVLYACPLTDAQLRDAEVSDLARFVALVHRTTP
FT                   RKVLGPLEQGLAVLAESGGPSFDRRRYALAQARADAIRALMPAPGRDTSAEPPPVHPVE
FT                   IEPDAIWPN"
FT   CDS_pept        complement(280464..280841)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0245"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99596"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6C2"
FT                   /protein_id="CAL99596.1"
FT                   /translation="MGVRLREYRKARCWSQNIACKHLIAVADRQGLRIHSWGTLLGLLS
FT                   EWERGVRVVSATYQELFAEVYGTTPEMLGIAGSWSRNHPVVTRADIDRGAPMTQVISSP
FT                   KDPLIGGLSGAERIELEGAAA"
FT   CDS_pept        complement(280845..281246)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0246"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99597"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6C3"
FT                   /protein_id="CAL99597.1"
FT                   /translation="MRLHTERAQGMVGDHHATFIPTHREDNDTPIVMQVSMSVPVSLED
FT                   VEAVFWILVNGGATLEPCELGDDQYAHAMVLETFLHEGSNRIYLVRQDIEDIKPGSGDY
FT                   ALLLMIRRRVAELYGRPDVPAPRRALTGV"
FT   CDS_pept        complement(281249..281494)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0247"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0247"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99598"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6C4"
FT                   /protein_id="CAL99598.1"
FT                   /translation="MYRVKAVAEMFDVSVNTIYRAIESGELDAMKLGTGKGTIRIPGWA
FT                   LSVYAEKCSQAAYEAFVTGTESAAADDRDETAGEVA"
FT   regulatory      complement(281623..281682)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(282076..282255)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0248"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0248"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99599"
FT                   /db_xref="GOA:A4F6C5"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6C5"
FT                   /protein_id="CAL99599.1"
FT                   /translation="MVQNGGGVLRKLAGWAVAVALVVVVVKYPSEAAGWVQTAASWLGF
FT                   VIDGLVTFFRQVGN"
FT   regulatory      complement(282377..282415)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(283817..284437)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0250"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0250"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99600"
FT                   /db_xref="GOA:A4F6C6"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6C6"
FT                   /protein_id="CAL99600.1"
FT                   /translation="MVTTFWESASEREEYAPLDQVAELIRRLHSLDAPSSLHLPEIRPL
FT                   AKLDAQIGDLANLDRADAQFLENRILSIRDQYERLEFDLTPGVIHGDANVGNVILDRAG
FT                   QPILIDLDSFATGPREWDLVQTALFYERFGWHTEDEYRTFVKVYGYDIMTWPGYRVLAD
FT                   YREVAMTLWLCGKAGTDMQAAAEVRKRVESLRSGGSRHDWAPF"
FT   regulatory      285452..285511
FT                   /regulatory_class="promoter"
FT   CDS_pept        285672..288122
FT                   /transl_table=11
FT                   /locus_tag="SACE_0251"
FT                   /product="putative DNA polymerase III gamma subunit"
FT                   /function="DNA polymerase III, gamma/tau subunits"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0251"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99601"
FT                   /db_xref="GOA:A4F6C7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6C7"
FT                   /protein_id="CAL99601.1"
FT                   /translation="MALALYRKYRPATFAEVVGQEHVTEPLRTALASGRINHAYLFSGP
FT                   RGCGKTSSARILARSLNCAQGPTADPCGECDSCVALAPEGGGSVDVVELDAASHGGVDD
FT                   TRELRDRAFFAPAQSRYRIFIIDEAHMVTTQGFNALLKIVEEPPEHLIFVFATTEPDKV
FT                   LTTIRSRTHHYPFRLMPPGVMRELLERICDQESVRVEPAVYPLVLRAGGGSARDTLSVL
FT                   DQLLAGAGEEGVTYERAVALLGVTDVALIDDMVDAMAAADGAAVYGTVDRLVEAGHDPR
FT                   RFASDLLDRLRDLVLLNAVPDADQRGLIQASGDELTKMQQQAEQLGAATLSRFAEIVHT
FT                   GLADMRGATAPRLLLELLCARMMLPTVSDSEVALLQRLERVERRMTIAPEGGAAEAPAG
FT                   QPADQDAGGRPRRVFQRPHERAAQAAEQPTQAGQGAQDGQAGQGSQAGQDSRAGQDSRV
FT                   GQGEQPSQAGRQAASDAQPGSPGGQPGPSAAQPGPSAAAGQQSPAGQPTPEASARPAGA
FT                   EAPAPAQPERPAAAEPPGRPAQRAPQARPGAPDAAARDAAAQQRPAAEQQAAQAGASAG
FT                   AHAGRDTADVRRLWTEVLRAVAERNRPTQALLLNATVQDIQSGTLVLSMPTSGLVKQFA
FT                   QQRRLDFVKDALRAVLGGEWEIRCVEAGAAPPAAPSRPAQPPRQAPQRPAEEAPQRKPS
FT                   ADWSANKPNPQQGQGGKPENSQAQRNASQGRQAGNGRRAPADDIPPPPEPPDEEPPPED
FT                   YVPPSRPARQAPPPPPPVDEEEDEEAMMADSTPADEVMASRPDPEEAAVELFASELGAR
FT                   RIDD"
FT   CDS_pept        288163..288393
FT                   /transl_table=11
FT                   /locus_tag="SACE_0252"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0252"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99602"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6C8"
FT                   /protein_id="CAL99602.1"
FT                   /translation="MGLAYRWLGTGPSTVGPGLSIGRGRARCERSRPVTEVIDDQCVER
FT                   DRLTALIDDLVESRRGLDELIDQTRADAATA"
FT   regulatory      complement(288358..288409)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(288411..290231)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0253"
FT                   /product="peptidase S9, prolyl oligopeptidase active site
FT                   region"
FT                   /function="Dipeptidyl
FT                   aminopeptidases/acylaminoacyl-peptidases"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0253"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99603"
FT                   /db_xref="GOA:A4F6C9"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR002471"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6C9"
FT                   /protein_id="CAL99603.1"
FT                   /translation="MRLDIVRLLGCTSRRAFDVDDSGRVLAGSDESGSVQLAEIAGGEV
FT                   SALTALPGAVSGRYLPGERAVVVQHDTDGDERSQLSLLTLDVPRTGPATMRDLRPLVHD
FT                   SRYVHRLLDVLPGRVVYATNRRNGVDFDVVVRSATSGAEEVVYDRGGMVLEAASSPDGR
FT                   YLAVTVPAEKPLSDQIILVDTMPVTADEEVTELTDADAHARHTGVRWLPDASALVVTTN
FT                   LDRDRTGVARIDPRTGERRWLVTSDEHDLTGWLAPDGSTLLVQANVEGAARLALHDAAT
FT                   GAVRRDVRLPGDGWCTYPLPAPVWSPNSRFAALSYSSTATPGDALLLDSGGEVRALTDS
FT                   AAQLGSARPVPPTAHRVPTPDGEQVPCFVYAPENPPPDVAGSSVLFVHGGPEAQSVQAF
FT                   NPIVQALVDQGHTVLVPNVRGSTGYGKRWYSADDVRRRLSAVDDLAALHDWLPSLGLDP
FT                   SRAALWGGSYGGYMVLAGLAFQPERWAAGVDIVGISSLLTFLENTAAYRRAHREREYGS
FT                   LRDDADFLREASPLTRADAISAPLFVLHGANDPRVPLSEAEQLAQAVRAKGIECELLVY
FT                   ADEGHGLAKRVNRLDAYPRALAFLLRHLRR"
FT   CDS_pept        290359..290709
FT                   /transl_table=11
FT                   /locus_tag="SACE_0254"
FT                   /product="hypothetical protein"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0254"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99604"
FT                   /db_xref="GOA:A4F6D0"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4F6D0"
FT                   /protein_id="CAL99604.1"
FT                   /translation="MQPGGQPNMQQIMEQAQKMQQQLMTAQQELAEAEVSGSAGGGLVT
FT                   AVVSGSGELKSVAIDPKAVDPDDTDTLSDLVVAAVRDANRAAQELQQEKMGPVTGALGG
FT                   GQGLGGLGLPGL"
FT   CDS_pept        290741..291313
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="SACE_0255"
FT                   /product="putative recombination and repair protein"
FT                   /function="Recombinational DNA repair protein (RecF
FT                   pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0255"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99605"
FT                   /db_xref="GOA:A4F6D1"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4F6D1"
FT                   /protein_id="CAL99605.1"
FT                   /translation="MIDELGRLPGIGPKSAQRIAFHLLAAEPADVTRLQEVLQKVKEGV
FT                   VFCDICGNVSEEPTCRICRDARRDPAVVCVVEEPKDVLAVERTREFRGRYHVLGGALDP
FT                   LSGVGPDQLRVRELLTRIGRDEITEVIIATDPNTEGEATATYLVRMLRDFPGLNVTRLA
FT                   SGLPMGGDLEFADELTLGRALSGRRAV"
FT   regulatory      291456..291513
FT                   /regulatory_class="terminator"
FT   CDS_pept        291661..292185
FT                   /transl_table=11
FT                   /locus_tag="SACE_0256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0256"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99606"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6D2"
FT                   /protein_id="CAL99606.1"
FT                   /translation="MRLVAVDGPSGSGKSVFARGLVAALRADGLRTALVPTDDFATWDE
FT                   PVGWWPRLAEGVLDPLRRGEPGRYQRTEWPGGEPVLGAWVDVEVPDVLVVEGVSSARRA
FT                   VADRLSLAIWVEVGDPALRLERAVARDGEWSRPHLLRWQEFERRWFAEDGAKHRADILR
FT                   QRSSPLSRQRR"
FT   CDS_pept        292407..294023
FT                   /transl_table=11
FT                   /locus_tag="SACE_0257"
FT                   /product="dipeptide ABC transporter substrate-binding
FT                   protein"
FT                   /function="ABC-type dipeptide transport system"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0257"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99607"
FT                   /db_xref="GOA:A4F6D3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6D3"
FT                   /protein_id="CAL99607.1"
FT                   /translation="MAVTLAACATSQRGENAGGEGGTLTFGAAGAPDLFDPFYASDGET
FT                   FRVTRQIMEGLVGFEPGTAEVEPELAKSWESTPDGKTWTFKLNEGVKFHDGTDFNAEAV
FT                   CKNFERWYHQTGAGQNQALSYYWIENFGGFADGQTPSLYSSCDSPDPATAVIHLTRATS
FT                   KFPDLLGLPSFSMQSPAAMEQYQANNVQAQGDSFSYPEYAKAHPTGTGPFKFSGYDEGN
FT                   QTIKLARNDQYWGEKAKIGELIFRIIPDETSRKQELEAGSIDGYDFPNAADLQALRDAG
FT                   HNVLVRDPFNIMYLGFTQKNNPALNDLRVRQAIAYALDRDNLVKANMPEGAEVATQFYP
FT                   DTVEGYAPDVQKYPHDPEKAKQLLAEAGQQNLTVNFYWPTEVTRPYMPDPQGIYNALAE
FT                   DLRAVGITVNPVSKPWNGGYIDDVDNARADIFLLGWTGDYNTPDNYIGTFFGTPTNRFY
FT                   TAGAPWGEQLAAELRAADSEPDEGKRQAMYQQINRKLLAEYLPAVPLSHSPPALVLNER
FT                   VKGLVPSPLTDEEFATVSLSE"
FT   CDS_pept        294180..295154
FT                   /transl_table=11
FT                   /locus_tag="SACE_0258"
FT                   /product="oligopeptide/dipeptide ABC transporter, permease
FT                   protein"
FT                   /function="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0258"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99608"
FT                   /db_xref="GOA:A4F6D4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6D4"
FT                   /protein_id="CAL99608.1"
FT                   /translation="MLVVAVLSVLLFAWLRALPGGPVSALLGDRATPESRAKLEAQLGL
FT                   DQPIFVQYWKFLERAVTGDFGTSTGVQRGAPALEVFLVRFPATLELSILALLLAVAVGI
FT                   PLGYLAARRRGSWLDNLSITWSLVGVAVPVFFLAFLLKFVFAVELGMLPASGRQDTGMD
FT                   ATRVTGFYILDGLLTREWDAAWNAFVHLVLPAIALSTIPFAVIFRITRAAVLDVMDDDY
FT                   VRTARAKGLSAMVIRTRHILHNAMLPVVTTVGLQTGALLAGAVLTERVFNIPGIGQAVA
FT                   VGFQRKDFPVLQVVILSAAMVYVLVNLIVDLSYAMIDPRLRTR"
FT   CDS_pept        295168..296094
FT                   /transl_table=11
FT                   /gene="appCC"
FT                   /locus_tag="SACE_0259"
FT                   /product="oligopeptide ABC transporter (permease)"
FT                   /function="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0259"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99609"
FT                   /db_xref="GOA:A4F6D5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6D5"
FT                   /protein_id="CAL99609.1"
FT                   /translation="MLNTRKARIDELAESTADSGVSLAASAWRRLRRSPVFLVGAAIIG
FT                   IFVVLAVTAPWLAPHDPALRVLEHQVSRATNTIPPPQDGFPLGGDQYGRDLFSRLLLGS
FT                   QQTLLVAVLATVIGLGGGLVLGVTAGAFGGWVDSVVMRIVDVMLSVPSLLLAVSIGALF
FT                   ASQTQFTVILAVAIVQVPIFGRLLRGTMLAQRASDHVLAARALGVRETAIVFRHMLPNA
FT                   LGPVVVQATLVLAVAIIDAAALSFLGLGAADDSIPEWGQMLGGAQTVIDSHPQLAFWPA
FT                   GCIILVALGFTLVGESLRDALDPKRRR"
FT   CDS_pept        296112..297104
FT                   /transl_table=11
FT                   /locus_tag="SACE_0260"
FT                   /product="oligopeptide ABC transporter ATP-binding protein"
FT                   /function="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0260"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99610"
FT                   /db_xref="GOA:A4F6D6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6D6"
FT                   /protein_id="CAL99610.1"
FT                   /translation="MALLEVRDLSVVFARKGEPPVTAVDGISFDVEPGRTVGLVGESGC
FT                   GKSVTSLAIMGLLPPRGAEVSGSITFDGTELLGLSRQELDKRRGRDLSMVFQDPLTSLN
FT                   PVVSIGVQVAEVIERHRGLPRKKAMPEAEELLAKVGIPDPRRRLREYPHQLSGGMRQRA
FT                   LIAMALACRPRLLIADEPTTALDVTIQAQILNLLTKLVAETDTALIMITHDLGVVAGLC
FT                   DEVNVLYAGRVVERAARHELFARPRHPYTAGLLSSIPRLDATRGQKLTPIRGSISDNIP
FT                   WDAGCAFCPRCPNALEVCQQQTPEVSVDVGARLLRCHNPVRESSSMEVS"
FT   CDS_pept        297225..298331
FT                   /transl_table=11
FT                   /locus_tag="SACE_0261"
FT                   /product="oligopeptide ABC transporter ATP-binding protein"
FT                   /function="ABC-type oligopeptide transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0261"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99611"
FT                   /db_xref="GOA:A4F6D7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6D7"
FT                   /protein_id="CAL99611.1"
FT                   /translation="MTEQLLVEVDDLAVHFPIKRGVVLDRTVGYVYAVDGVSLRVRKGE
FT                   TYGLVGESGCGKSTLGRALLRLEKPTGGRVVFDGTDLSAMKGERLRRMRRRMQMVFQDP
FT                   LASLDPRQSVESLLVEGIRAHGLDKGRESTAKRLRELLSAVGLPSTSLRKYPHEFSGGQ
FT                   RQRIGIARALAVGPDLLVADEPVSALDVSVQAQVLNLLEDLQDEFGLTYLVIAHDLAVV
FT                   RHIADRIGVMYLGGIVEESESDDLYTEPLHPYTRALLSAVPVPDPVVEDQREQILLSGD
FT                   LPSPAAPPTGCRFHTRCPWKQQTRCDTERPVLREISPGHRVACHYAEEIRSGAIAKHDV
FT                   EAEAVAPDDFGGIAVGSTSPASTTEALG"
FT   CDS_pept        298358..298561
FT                   /transl_table=11
FT                   /locus_tag="SACE_0262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0262"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99612"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6D8"
FT                   /protein_id="CAL99612.1"
FT                   /translation="MRRSAIGRHDGVMGFKLRKSFRIGPLVLHVTQRGLSSWGLKVGRW
FT                   SWNAKTRKHTFDTPGPGYWQSK"
FT   CDS_pept        complement(298598..299494)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0263"
FT                   /product="probable amino acid metabolite transport protein"
FT                   /function="7 Permeases of the drug/metabolite transporter
FT                   (DMT) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0263"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99613"
FT                   /db_xref="GOA:A4F6D9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6D9"
FT                   /protein_id="CAL99613.1"
FT                   /translation="MALFVVLLWGVNFIAIDFGLQHFPPLFFGGLRFALIALPTILFVP
FT                   RPKVRWQWLVGYGLGFGTLQFAFLFVAIEVGMPTGLASLVLQASAPFTVILGALLLRER
FT                   LNALQGLGIAIAVLGMVAIGWNRAQDAALLPVVLTLLGALGWAFGNLCNRKANPQNPLH
FT                   LALWMSVVPPLPMFALSAFVEGPVVGWQAVWTSFTTQTGLYALCGLAYIIVFATVIGSG
FT                   VWTALMGRNPASSVAPFTLLVPVVGFTSAWLVLNEQPDPFELVAGAVVVGGVLLGSIRR
FT                   GKPVELPEPEPVLTPAR"
FT   regulatory      299510..299569
FT                   /regulatory_class="promoter"
FT   CDS_pept        299589..300485
FT                   /transl_table=11
FT                   /locus_tag="SACE_0264"
FT                   /product="probable transcriptional regulator, LysR family"
FT                   /function="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0264"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99614"
FT                   /db_xref="GOA:A4F6E0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6E0"
FT                   /protein_id="CAL99614.1"
FT                   /translation="MDVRRLRLLRELADRGTVTAVAKALAYTPSAVSQQLRALQAEVGV
FT                   TLTEPAGRGLRLTDAGRALAARADEVLAVLDRAEAELNTYRSTPRGTVRVALFPSGALL
FT                   LLPGLLRRMSAIREVSLECRDVDMTPPEVQALVADFDIVVAHRDDQAQPFDSERMEITP
FT                   LLREPLDVALPRGHPLASRDRVELTELAGEPWVSVDIGFPVDDVLRSLAVRTGTRPKVV
FT                   QRINDFRVIEALVADGFGVALLPRYTVDDPRLVLRPLAGVRAGRNVEAVSRRGASERPA
FT                   VRAVFDALLAEAASVTG"
FT   CDS_pept        complement(300493..302007)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0265"
FT                   /product="two component system histidine kinase"
FT                   /function="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0265"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99615"
FT                   /db_xref="GOA:A4F6E1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6E1"
FT                   /protein_id="CAL99615.1"
FT                   /translation="MRIVVALMVVTTTATVAMAFAAYRLQATGTTDRFNAAASAGFLSD
FT                   LSQAQARYRTAAEPKDRIKTVADYMIGRKGLHWSVVDFMPSANGPAPGPVWLLEGPDYY
FT                   YGPQLRPEHVDASSLRFEGFPEPAFVATTTPWVNRTAGLVARARTGGTTTETVPVEGGG
FT                   QLLAFASRVGPDLVLVEFYDMQPLHSELSQLRNALAVVALGVSALGVVLALLAAASVQR
FT                   PVRKVAAAAHRIGEGAFDTRLPVRGKDEIAELTSAFNTMAQRLGDSIEELRVKDRQQQR
FT                   FVADVAHDLRTPTASLVAAADSLEHPDPESRSRAVALVSTQARRLARLVDDLLEISRFD
FT                   SGAAELRPEGVDLRELVREAIELVTCDADVRLDATADTTLVGDPRRLHTIVCNLLANAV
FT                   HHGAEPVTVAIDGTDPGQVVLRVADSGPGVPEELTRILFDRFVRGDRARSATDGSGLGM
FT                   AIAQQNALVHGGRITVHNDGGAVFTLTLPRGDRSATGSDAPGPSTA"
FT   regulatory      300576..300628
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(302031..302699)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0266"
FT                   /product="two-component system response regulator"
FT                   /function="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0266"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99616"
FT                   /db_xref="GOA:A4F6E2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6E2"
FT                   /protein_id="CAL99616.1"
FT                   /translation="MEDDNALAEALALALGGLGHDVRVAASGEQALGLMSDDAATDVVL
FT                   LDVMLPGIDGFEVCRRIRAASTVPLILLTARGDPVDVVVGLEHGADDYVVKPTEPRVLD
FT                   ARMKAVLRRSAPSPAGSRPGMRFGSLEIDPLAMTVTRNGEELQLTATELRLLLEFADHP
FT                   GQVLSRQVLLKQVWDYGYVGDSRMVDAAVARLRAKIEEDPAHPVLLRTVRGLGYRWERP
FT                   "
FT   regulatory      complement(302769..302795)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(302802..302996)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0267"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99617"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6E3"
FT                   /protein_id="CAL99617.1"
FT                   /translation="MIDTPTGWRKSSRSGQKSACVEVGRAADGAAVRDTKDRAAGYFTT
FT                   TAPQWSAFITGIKAGRFDR"
FT   CDS_pept        complement(302993..303844)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0268"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0268"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99618"
FT                   /db_xref="GOA:A4F6E4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6E4"
FT                   /protein_id="CAL99618.1"
FT                   /translation="MGGNTGRTPKARALGAELRELRQSHGISQRELARLVTISNASMSR
FT                   YETGDRIPTPEDVASIVTALGEGGELREKLIEMARDAAQPNWLSTGAAGGHNELTTLIE
FT                   FERTATHIAEVAPMIVPGLLQTSDYARAIMADLPAAEMEPFVTLRVGRRDVLTRRRPVD
FT                   FEAFIAEHVLRMPIGGHEVMADQLSHLLKFAELPNVSVRVLPTTLQRWSLVLEGAFILF
FT                   RFPKAAPIVNLQHYRSSAFLYDTADVKDYVDAVDALREAALSPAASAELIASCVEEMED
FT                   IE"
FT   CDS_pept        303960..304256
FT                   /transl_table=11
FT                   /locus_tag="SACE_0269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0269"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99619"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6E5"
FT                   /protein_id="CAL99619.1"
FT                   /translation="MFADEGSARCGTVLPTAYRSDVVFWIVPVGEDVRHGTTTRPGALP
FT                   AGSEVLVLCARRFKLPTSTPWPDVPKTKSVTRQCEDCVAEYERLGRPATVWDF"
FT   CDS_pept        complement(304282..305922)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0270"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99620"
FT                   /db_xref="GOA:A4F6E6"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6E6"
FT                   /protein_id="CAL99620.1"
FT                   /translation="MGFIDTDLSFDPKDPYFPAPGTYGVEWGVQVFTEDNGYAIHAGCA
FT                   YVHETDRVTVHSDRFALFGQQTTVDAGVVDAEVVNRDGVLEWSIKVRHTEAVKAVKLML
FT                   RGLPPEQLRAGWWTPNTGRGWAHGVNGHRIQLEYPGPDMATAWLAVGDEAECSTLSIRD
FT                   PRVRRQIVHVRHPQYSPLPIVEVVHVTSADDRSQTYRVPPVRLRVRASSAVADQDLDDH
FT                   LAFAEKAHGLRPWETRPDVPDWMRRVALVVTLHGQHWTGYVFNTFPQMEEALRFVTQHI
FT                   EGHRVLAYLPGWEGRYYYAYPQYRPGPDLGGDEGFAALAGTARELGVRLMPMFGGHGAN
FT                   VKQYPKWEDAVLRNDTNRYVELLNRPDWDTDRVGEGNQVFLNPGEPGFRAHLVESISAM
FT                   VREFGVDAAFLDTLGYWFNDPRYDVMDGCRLLRAELLQRHPDLLLAVEGWWDALSALFP
FT                   LGQHWFGTDRDIRKPRVLTRYARTTGHLAEGTPGPGSTGVHEKGFVPRPPDTSREGHIP
FT                   VLGIVDDTLPTHAEEVAAICRWARDNGPR"
FT   regulatory      304391..304431
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(305898..306059)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0271"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0271"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99621"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6E7"
FT                   /protein_id="CAL99621.1"
FT                   /translation="MTVLVMGDRVAVVVPPAQILVFEPDEADDLAALLDNAAELAGEES
FT                   AWASSTPI"
FT   CDS_pept        306896..307582
FT                   /transl_table=11
FT                   /locus_tag="SACE_0273"
FT                   /product="integral membrane protein"
FT                   /function="uncharacterized membrane-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0273"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99622"
FT                   /db_xref="GOA:A4F6E8"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6E8"
FT                   /protein_id="CAL99622.1"
FT                   /translation="MIEWLESIPPVAIYLAVGLIIGLESVGIPLPGEILLVSASVAASQ
FT                   GMVNPVLLGCIAATGAIIGDSVGYAVGKKYGRGLLTRLGRRMPKHFGPKRIAAAERAFD
FT                   RWGAWAVFGGRFVALLRILAGPLAGILGMQYRKFLLANATGGIAWAGTVTTVAYLFGVV
FT                   AEHWIKRFSWVALLITVLIGVAITLYVRHRTERAVEAEEAAEADGAADAASPEEAAEAL
FT                   SGTEKA"
FT   regulatory      complement(307712..307764)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(307788..309578)
FT                   /transl_table=11
FT                   /gene="leuA"
FT                   /locus_tag="SACE_0274"
FT                   /product="2-isopropylmalate synthase"
FT                   /function="Isopropylmalate/homocitrate/citramalate
FT                   synthases"
FT                   /EC_number="2.3.3.13"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0274"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99623"
FT                   /db_xref="GOA:A4F6E9"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="InterPro:IPR039371"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6E9"
FT                   /protein_id="CAL99623.1"
FT                   /translation="MSIPPEPQTPISNRVRKPSRPAPADQQPWNPQLGSSMPFHRYRPF
FT                   HELVEDVSLPDRTWPDNRITRAPLWCAVDLRDGNQALIDPMSPARKRRMFDLLVRMGFK
FT                   EIEVGFPAASQTDFDFVREIIEDGAVPDDVRIQVLTQCRPELIERTFASLEGAAKAVVH
FT                   IYNSTSILQRRVVFREEREGIKKIATMGAEMALEFAGKYPDTDFRFQYSPESYTGTELS
FT                   YAAEVCDAVTEIWQPTPERPVILNLPATVEMATPNVYADSIEWMHRNLSRRDSVLLSLH
FT                   PHNDRGTGIAAAELGYQAGADRIEGCLFGNGERTGNVDLVALGMNLFSQGIDPQIDFSD
FT                   LDYIKRTVEHCNQLPVHERHPWGGELVYTAFSGSHQDAINKGLNALREEAAKAGAEVDA
FT                   HPWEVPYLPIDPKDVGRSYEAVIRVNSQSGKGGVAYIMKTEHQLDLPRKMQIEFSKLVQ
FT                   ARTDSEGGEVTPDQMWAVFSDEYLGARTPLELVRQRLDGEAGDETITATVVVDGDEREI
FT                   TGSGNGPIAAFVDALSTVGFDVRVMDYSEHALTAGDDALAAAYLECAVGDDVLWGVAID
FT                   SSTVKASLHAIVSAVNRAGR"
FT   CDS_pept        309847..310128
FT                   /transl_table=11
FT                   /locus_tag="SACE_0275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0275"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99624"
FT                   /db_xref="GOA:A4F6F0"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6F0"
FT                   /protein_id="CAL99624.1"
FT                   /translation="MAAKRGRSGVATLINGAGFVIAAMLVLHIVFVLTGFPTENGLAGS
FT                   VRQAAEPLALFFPGMVDAGDEVLQVMADFGLAAVFWVLVTGLLARVFG"
FT   CDS_pept        310397..310771
FT                   /transl_table=11
FT                   /locus_tag="SACE_0276"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0276"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99625"
FT                   /db_xref="GOA:A4F6F1"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6F1"
FT                   /protein_id="CAL99625.1"
FT                   /translation="MSESDSAAGTHEVGGGRRRRHRSFDAARARVRVAGALIAVVRWIG
FT                   TLAAALLALHVVLTLGGANPDNSIARFVADWAQPLALGFSDLFVPQDPQLAILLNYGIA
FT                   ALFWLVATSIAVRILRLIAR"
FT   CDS_pept        complement(310696..311115)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0277"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0277"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99626"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6F2"
FT                   /protein_id="CAL99626.1"
FT                   /translation="MGGSGPHGDGRAETGAADHRAVDADVVEQVDHVVGVPGPGVPGGV
FT                   GADRPAVTAHVGHDHRVAVGEEAGERQQAAVVRSSAVEQDDRGPGTDGGRVQEHSVVGA
FT                   VAELAQSAPLAQRAISRRMRTAMEVATSQNSAAMP"
FT   CDS_pept        311373..311585
FT                   /transl_table=11
FT                   /locus_tag="SACE_0278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0278"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99627"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6F3"
FT                   /protein_id="CAL99627.1"
FT                   /translation="MEEVSAVTAPTLVFPGIDERHPTALAARLVEVMPRARLVPTAFSA
FT                   GLRTADDLAAAVAPAISEFLADLHR"
FT   CDS_pept        complement(311600..312751)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0279"
FT                   /product="probable kynureninase (kyurenine hydrolase)"
FT                   /function="Kynureninase"
FT                   /EC_number="3.7.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0279"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99628"
FT                   /db_xref="GOA:A4F6F4"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010111"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6F4"
FT                   /protein_id="CAL99628.1"
FT                   /translation="MWTSTRPAATALDSADALAGLRVRYELPPGLIRLDGNSGGAAPSR
FT                   TSARLRKFAEHRWMESCARRFAPDWELEARTCAAKLARLIGAGECELTVAETTSVNLFK
FT                   ALVAASRLRPEHSALAVGRDCFASDHYLARSAAAYTGTELLLFDDLAELPFDRVAVVAL
FT                   SHTDVRSGAVRDPVATTAALHEQGVLVLWELSESAGALDVDLHAWNADLAVGCGHRYLG
FT                   GGPGAPAYWFVAERHQRELGGRDRGCDGVLSQAASGFSGAPSTLALSELRHGLSMLDGV
FT                   SGAELEAKTGGLVSLFVDRLLRAPGVEIVPPRRGRRRGPQVSLRHPRAQLVVAELFARG
FT                   VVVDFVDPDLLRFSFAPSWLRYIDVWEAAEVVREVLEQLDRES"
FT   regulatory      complement(312783..312842)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(312924..313580)
FT                   /transl_table=11
FT                   /gene="tdsD"
FT                   /locus_tag="SACE_0280"
FT                   /product="nitroreductase family protein"
FT                   /function="Nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0280"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99629"
FT                   /db_xref="GOA:A4F6F5"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6F5"
FT                   /protein_id="CAL99629.1"
FT                   /translation="MTADERAHARTGEPASPIAAEGAAKPADSSVPLHPLIAERWSPRA
FT                   LDPAVELTDEQFTALFEAARWAPSWGNTQPARYIAGRRGEDTFDRIHATLSRGNRGWTE
FT                   PAAALAIGVARVVGDEGEPMPYGEYGLGLASQNLVLQAVAEGLVAHQMAGFDRDAARAE
FT                   FAIPGDFEPMVAIAVGGYGSPAELPERLQAKEAAPRARKPLSELVFTDTWGKALF"
FT   CDS_pept        complement(313597..314817)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0281"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0281"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99630"
FT                   /db_xref="GOA:A4F6F6"
FT                   /db_xref="InterPro:IPR007315"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6F6"
FT                   /protein_id="CAL99630.1"
FT                   /translation="MDPQRCNTAETVRNQQKRPGDHRLAAVREALREHRRGLLLVAPGV
FT                   VYLAIRFFGLLVLAWLSAANDESLSDNLGAWDGEWYLEIAEHDYGGVDPGMVDGFGNRY
FT                   PETPLAFFPGYPLLVRLFGLLPGVSALGAAITVSLLCGVVAAYGLARLGKRIGGSEGTG
FT                   LLLVVLFAAAPMSVVLSMAYSEALFCALSIWALIGVVERKWLLAGLCCAAAGLVRPTAA
FT                   ALIAVVGLAALIAIVRRRELWRPLLAMLLAPIGMLAYVGWVGLQTGKLGGYFELQQRGW
FT                   SSAFDGGVRTTEFVVETLTADKSVLETFTAWIVLAALVLFVLCLRYRMPWPLVLFAAAV
FT                   LVLDLGSDGLMYSKVRLMLPAFPLLVPVAIGLANRRTTTAVCTAVLLVCFGSWFGAYSL
FT                   TAWPYAM"
FT   CDS_pept        315127..316392
FT                   /transl_table=11
FT                   /gene="lysC, ask"
FT                   /locus_tag="SACE_0282"
FT                   /product="aspartate kinase"
FT                   /function="Aspartokinases"
FT                   /EC_number="2.7.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0282"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99631"
FT                   /db_xref="GOA:A4F6F7"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6F7"
FT                   /protein_id="CAL99631.1"
FT                   /translation="MALVVQKYGGSSLESADRIKRVAERIVETRKAGNDVVVVCSAMGD
FT                   TTDELLDLAQQVNPAPPERELDMLLTAGERISNALVAMAIEALGAEARSFSGSQAGVIT
FT                   TSAHQNARIIDVTPGRVQEALKQGQVVLVAGFQGVAQDTKDITTLGRGGSDTTAVAVAA
FT                   AMNADVCEIYTDVDGVYTADPRIVSDAKHLDRITYEEMLEMAATGAKVLHLRAVEYARR
FT                   YGVPLHVRSSYSPKSGTIVSGSVEDLSVEQAMITGVAHDRSEAKVTVRGVPDNPGIAGR
FT                   IFRVIADAEIDIDMVLQNVSGTASGRTDITFTVARSNGALAVTELEKIKDELGFDQVVY
FT                   DDHVGKVSLVGAGMRSHPGVTATFCEALSHAGVNIEIINTSEIRISVLIRDTQLEDAVA
FT                   ALHAAFELGGDEEAVVYAGSGR"
FT   CDS_pept        316392..317468
FT                   /transl_table=11
FT                   /locus_tag="SACE_0283"
FT                   /product="aspartate-semialdehyde dehydrogenase, USG-1
FT                   related"
FT                   /function="Aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0283"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99632"
FT                   /db_xref="GOA:A4F6F8"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6F8"
FT                   /protein_id="CAL99632.1"
FT                   /translation="MAEQNARPTVAIVGATGAVGTVMIDIINNRPSVPWGEIRLIASPR
FT                   SAGKKITVRGEERTVVALAPEAFDGVDIALFDVPDEVSAQWAPVAAERGAIAVDNSGAF
FT                   RLDPDVPLVVPEVNAAKVHERPKGIIANPNCTTLSMMAALGALHREFGLRELVVASYQA
FT                   ASGAGQEGVDRLYAEVSAVAGKQVGVRGGDVAEALSAAGLPEETPFKAPLAMNVVPWAG
FT                   SRKDDGWTSEELKVRNESRKILGIPDLKVSATCVRVPVLTTHSLAVHATFEREVTVDQA
FT                   HKVFGSQPSIVLQDDPDNGVFPTPAAVVGGDPTYVGRVRQALDFPNTLDFFVCGDNLRK
FT                   GAALNTYEIAETLAAGGE"
FT   regulatory      317508..317561
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(317602..318531)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0284"
FT                   /product="probable thioredoxin-disulfide reductase"
FT                   /function="Thioredoxin reductase"
FT                   /EC_number="1.8.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0284"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99633"
FT                   /db_xref="GOA:A4F6F9"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6F9"
FT                   /protein_id="CAL99633.1"
FT                   /translation="MDATRYDAVVVGGGAAGLSAATLLARSRRRVVVVDAGEPRNAPSA
FT                   HLHNFLSRDGMAPAELLAAGRRELAGYGGEVVEALATSIERAEHGFAVRLASGAELTTR
FT                   GVLVATGLRDELPDIPGLRDRWGDTVLHCPYCHGHEVRDQPLGVLGGDNRPFTVHQAAL
FT                   VRLWSDDVAFFPNRIALEAGERERLTAWGVRIVDGEVARLSSGDGLTVELADGRQVRRQ
FT                   AVFAGPRFVPNDRLLTGLGCEVGDNGWVATDASGRTSVAGVWAAGNVVDSPAQLISAAG
FT                   AGSTAAIALNHHLLAQDVERAATALSRA"
FT   regulatory      318537..318596
FT                   /regulatory_class="promoter"
FT   regulatory      complement(318587..318646)
FT                   /regulatory_class="promoter"
FT   CDS_pept        318634..319125
FT                   /transl_table=11
FT                   /locus_tag="SACE_0285"
FT                   /product="MarR-family transcriptional regulator"
FT                   /function="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0285"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99634"
FT                   /db_xref="GOA:A4F6G0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6G0"
FT                   /protein_id="CAL99634.1"
FT                   /translation="MLPLQARTVELWRERNPGLDTSPMEVVALVKRVRVLLDRAVEDLY
FT                   DGAALTSAEVELLVPLRHADEPVTAARLAARLGMSRAGISKTLAKLEKRGLITRAANPA
FT                   DRRAALIRMTPEGEEVIDDLFPRELEAHGKLLAGLGADRRRVVDALTRFAEAMEAQLEE
FT                   "
FT   CDS_pept        319260..319814
FT                   /transl_table=11
FT                   /locus_tag="SACE_0286"
FT                   /product="protein of unknown function DUF820"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0286"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99635"
FT                   /db_xref="GOA:A4F6G1"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6G1"
FT                   /protein_id="CAL99635.1"
FT                   /translation="MSWPGHLLTLEEFDQLPEDNSRRYELQEGVLLVTPKAATLHQRVV
FT                   RALGSVLVAQLPAEWEAVPDVEVVLKHKWPPTVRIPDVLIAPTELIDKNPNRLQAADVA
FT                   VAVEVISPGSRQMDQVTKRYEYAAAGIQGYWVLETDDVVKLTASRLIGEVYEVDFCGGG
FT                   MFKTAHPFELTLDLDTLIKRA"
FT   CDS_pept        complement(319930..320421)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0287"
FT                   /product="starvation-response DNA binding protein"
FT                   /function="DNA-binding ferritin-like protein (oxidative
FT                   damage protectant)"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0287"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99636"
FT                   /db_xref="GOA:A4F6G2"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6G2"
FT                   /protein_id="CAL99636.1"
FT                   /translation="MATKTAAKAPITSALNDSDRDVTGKALQGTLLDLIDLHLVAKQAH
FT                   WNVVGKFFRDVHLQLDELIDTARAFADDVAERASAIGVSPDGRSSTVASGSGMPKFDAG
FT                   WKNDREVIEYIVSALSELISRVRMRIDETDKTDLVTQDLLLSIASELEKSHWMWQAQLA
FT                   "
FT   CDS_pept        complement(320497..321054)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0288"
FT                   /product="NADPH-dependent FMN reductase family protein"
FT                   /function="predicted flavoprotein"
FT                   /EC_number="1.5.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0288"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99637"
FT                   /db_xref="GOA:A4F6G3"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6G3"
FT                   /protein_id="CAL99637.1"
FT                   /translation="MTLTVVGIGGSVRPDSQSERAMRAALAGARDAGAKVRAITGSDLA
FT                   LPFYDPQVPERTENAIELVEALRTADGVVISSPGYHGTISGLIKNALDYVEDLRGDERV
FT                   YLDGRAVGCIGVAYGWQATVTTLQALRSVVHSLRGWPTPLGAAVNSAETQLGPEGESED
FT                   EKVTRTLRTIGQQVVDFANSRR"
FT   CDS_pept        321213..322412
FT                   /transl_table=11
FT                   /locus_tag="SACE_0289"
FT                   /product="transposase, IS891/IS1136/IS1341"
FT                   /function="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0289"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99638"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6G4"
FT                   /protein_id="CAL99638.1"
FT                   /translation="MRRAYKCRAYPDREQAAMLSRTFGCVRLVWNKTLAERHRRYHAEG
FT                   KRLSYKETDAALTRWKRTEELAFLSEVSSVPLQQTLRHQHTAFANFFAGRSRYPRFKSR
FT                   NGRQSAHYTRSAFRMRDGNLYLAKTTTPLEFVWSWPDIDITTLNPTMVIISREPDGRWY
FT                   VTFAVDTDDPVPEPETGHTVGVDLGVKDFAVTSDGERIANPRHLERKARNLARYQRMMA
FT                   RKQRGSVNRRKAKQRVARAHRKVHNTRQDFLHRTSTRLVRSADVIAVEDLAVKNMVGNK
FT                   RLARVISDCGWGEFRRQLEYKTERAGKTLVVVDRWYPSSKTCSYCGHLLGHLKLSVRAW
FT                   TCPNCRTRHDRDHNAAKNILAAGLAVAACGADVRRGELARARSATKQETQPARVGTPRL
FT                   "
FT   CDS_pept        322562..323638
FT                   /transl_table=11
FT                   /locus_tag="SACE_0290"
FT                   /product="alpha/beta hydrolase fold-3"
FT                   /function="Esterase/lipase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0290"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99639"
FT                   /db_xref="GOA:A4F6G5"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6G5"
FT                   /protein_id="CAL99639.1"
FT                   /translation="MPKAIERVALQAQALALRTALALPSPVRRAIAGPPIRIDGGELAL
FT                   DAQLLLKLQHLSGHRNLSAPTVELARAAMLQSTHLLPKAPVSGVSVGERRVPGATGELA
FT                   ARLYRPLQLTEPGELLVFYHGGGFVIGDLESHDDMCRFLAKHAGIRVLSVEYRLAPESR
FT                   FPAAFDDALAAYRYAVDNAAALGSSPEAIAVGGDSAGGNLAAVVAYHAARSGLPKPSLQ
FT                   LLLYPAVDATKRRRSRELFGEGFLLTDRDMDWFMDHYAPDVGERGDDRLSVLLAEDLTG
FT                   LSPAYVVTAGFDPLRDEGRAYAERLAEDGVPVIERCFDDLIHGFASLRRAGGRFGEAMF
FT                   EIAGTLRAALALRVDQQR"
FT   CDS_pept        complement(323751..324230)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0291"
FT                   /product="cytidine/deoxycytidylate deaminase, zinc-binding
FT                   region"
FT                   /function="Cytosine/adenosine deaminases"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0291"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99640"
FT                   /db_xref="GOA:A4F6G6"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6G6"
FT                   /protein_id="CAL99640.1"
FT                   /translation="MTDDDLRHLRRAIELSARARESGDEPFGSLLVGPDGAVLAEDVNT
FT                   VRTDRDISAHPELKLAVWAARHLDPATSAATTMYTSCENCAMCSAAMVSSGVGRLVFAL
FT                   DGRRLASFRGEQRPGLDLPAADVFARASRTIAVEGPLLAEEALVPHEGFWSHAQG"
FT   CDS_pept        complement(324327..326795)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0292"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /function="DNA-binding HTH domain-containing proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0292"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99641"
FT                   /db_xref="GOA:A4F6G7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6G7"
FT                   /protein_id="CAL99641.1"
FT                   /translation="MNHPTNPQAASAAGVHAAGLRAAIAAEPAAPVVAGIQGAGGYGKS
FT                   ALLSQLAGIYQAAGIPVSSSPDASRDGAHLVDDAHLLDETSLYALRAIAEKPGARVVVA
FT                   YRPGPRSHALSELIATLGAPVLLTGLGRDEVARGLPGPASREWIDWLIEQTGGVPRFVG
FT                   RVTGTIDPSQLGDRTLPRLALEQFRHDFDQLGEHARACVTAMSVGAAPHPEVLASVLEL
FT                   DPGHVAGALASVRSGGLVDDHDMPWPIVRAAAQLLTPLEVRLGIVRRLVDAQLAHGGPV
FT                   LPLVRPLLGARVALLPEATLSAAFEKGGDEALAEAPELAGRLFDAAVSAGVPESRVAAR
FT                   RARAAAAAGRLDEALRLADRVIVDPAVPDRALGVQVAASVLAHRGLLAQSADLCAWSVD
FT                   NLRWSGDTAYAAVGLVGTGRLREADELLSSRRESGPPTSLSGAAAKLAGGVRESVTGAA
FT                   TSALSTLVRAAALADPVGPGVMLPDSPAAIAATVALHCGELDVAESSLAKAVESGSGGP
FT                   LLEVRHRLLAAWVPLMRGDTVTARQALGSVPSELAARDRLLATALHAGIAGRDNDMTAL
FT                   TAIRGQARQAAAEHSPDLFCLLPLGELVVATARLHDQDWLTPYLHEAQALLSALGNPPL
FT                   WTSMLTWKCLQAAVVVEDMDSAARHAADLGETAHHNPMSAAMAEAARMWLRVLDGQVDQ
FT                   DEAERAARGLHAAGLTWDGARLAGQAAIRTTDRKAMLSLLECARALQGKQPRPRAMSAN
FT                   AGEGELLSDREREVAQLVLAGLTYKQVGKRLFISAKTVEHHIGRIRQRLGCQSREELLD
FT                   RLRELVGSEA"
FT   CDS_pept        complement(326975..328237)
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="SACE_0293"
FT                   /product="chaperone protein HscC"
FT                   /function="Molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0293"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99642"
FT                   /db_xref="GOA:A4F6G8"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6G8"
FT                   /protein_id="CAL99642.1"
FT                   /translation="MLCRAQDGSYLAGEQAQRQELTHHQWVARGFTRRVGEDAPLLVGN
FT                   DFVQPHALAATMIEWVADAVAHRQGHPPEHIAVAHSANWGPHRTHVVHQALAQLGISDV
FT                   TLLPEPVAVAMDYASKQRVDDGGAIAVGNIGGTGFDATVLRRRTPGFEVVGPPLDSPHP
FT                   GGQDLDDALFEHIRAELGGLAGLDVTDFNVRATLAQLRGDCVHARETLSFHPGATLRIH
FT                   LPKVNTDFAVSRSRFEKLARTHLERVPELVLQAVQSANLTPGELDAVVLAGGVARTPLL
FT                   KQLVQERLERQPLVDGAPELVAACGAAVSAVKAVSTEGDQAASMAETSVLMRIEAPDDD
FT                   PNLLDPLDDDVAESPRPPVEVEPMHIEPPDEKRQRLFKILKLTLAALLVIAGLIMTFYG
FT                   TPSTGGLLGGAGGPAPQQQQR"
FT   regulatory      complement(328428..328487)
FT                   /regulatory_class="promoter"
FT   CDS_pept        328646..330109
FT                   /transl_table=11
FT                   /locus_tag="SACE_0294"
FT                   /product="PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0294"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99643"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6G9"
FT                   /protein_id="CAL99643.1"
FT                   /translation="MPHSQPEGRAETFASSPGTQSGADQPTLHEFLTRLVSDPAARSAF
FT                   DADPHATLDQAGLGGMTATDVLQAASLVLDYAPVEVVQEYDRSLQSSVEKFAASTQHVA
FT                   INQLHPVHPLEQEELTMLHNSSPQAPDFSQGGDVDKLMPAPEAKGGDVNVDIEQNDSHN
FT                   LISVHHIASDNNIGNIAAVGNVVGDVVGDTANTVVGTVGDVAYGSVSQVTNTVDNSVDV
FT                   GGDLVAGAGSALIGGDVNIQPVNEVTNVVGDVTGVAGDLTGGDVTDVAGNVTGVAGDLP
FT                   VVGDVAGTVGGVAGGLPVVGDVAGAAGSGELPVVGDVAGTVGGVAGGLPVVGDVAGAAG
FT                   SGELPAVGDVAGTVGGVTDLAGGVTGGLPVVGDVAPAISDPAALPVVGDVAGELPVDDV
FT                   AGALPVDDVADTVGGVTDTVGGVTSSLPVDDVTSHLPVEDVTSNLPVNDVTSHLPAPSD
FT                   LPVVGPVAGGAVEQIAGEATSALPLDGLL"
FT   regulatory      330222..330248
FT                   /regulatory_class="terminator"
FT   CDS_pept        330334..332145
FT                   /transl_table=11
FT                   /gene="iniA"
FT                   /locus_tag="SACE_0295"
FT                   /product="isoniazid inductible gene protein IniA"
FT                   /function="predicted GTPases (dynamin-related)"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0295"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99644"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6H0"
FT                   /protein_id="CAL99644.1"
FT                   /translation="MIETALVELIDRATAECAEQQRADLHGRLRQIRTRVLDPAQLVLI
FT                   VGESKQGKSELVNAIVNAPVCASGEDVTTVVPTLVRHSDEPTAMLVEHEPARGPAALER
FT                   HPVPIERIRENLGRAVELGRPLTRGEVGLPRAVLEDGLVLMDTPGVGSVSSTLTTTTLA
FT                   VAAEADALLMVSDATQELTTSELAFLKQVTALCPNVAVVQPKIDVTPHWRRVMEVNRKH
FT                   LANAGVTTKIFPVSSVVRMRAMQTKDGQLNAESGFPALLEYLRNEMAGKHAQLTRRLVA
FT                   HNLAEVINQLTTSLKAELAAQNPRTAAETLVELETAQRRAEDLRRMASRWQKTLSDGIS
FT                   ELFADIEFDFRERTWAVMHQVNETFDEADPKEVWDEFIDWLTERLTDAIVQSFEWLDMR
FT                   RERLAEQVADELRREYGDSLPDVERIRPPDPFDAVPKPKEPKSSDYPGLDQVLTSLRGS
FT                   YGGVLMFGLITTMAGLPLMNVVSISAGLLLGSKSLKEEKDSRLRRRQTEARASVQRYVE
FT                   HVVFQVNKEAKDAIRSVHRRLHEHFSQLTEEAQMEVSREIQNIKRSAERSAVDRDRRAR
FT                   EIKKKLEELAVLRQRASLLTQNRITAA"
FT   CDS_pept        332142..333608
FT                   /transl_table=11
FT                   /locus_tag="SACE_0296"
FT                   /product="isoniazid inductible gene protein IniC"
FT                   /function="predicted GTPases (dynamin-related)"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0296"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99645"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6H1"
FT                   /protein_id="CAL99645.1"
FT                   /translation="MSERLLEHARALMVRAMTFYRDDTRTSTWLRGRMERLDQPLRIAV
FT                   SGRVKSGKSTLINALVGEELAPTDAEERTQVSTFYQYGPEPKVLVHTPSGAVQNVPVPS
FT                   LDTGTIRDLQRWRPDEVARLVIESPSPGLQAITLIETPGVASSAVQETGRSALAQILSE
FT                   ADAVLYLTRHPHQTDLQFLQSVHELQIARYAPINTIIAFSRADETGSGGVDALDAAERI
FT                   AQRYRDDPTVRSFSQHVIPVVGLLGQAASTMTAEEFASFVGLARLSQSDLEALLLSADR
FT                   FANSTVPESVPAAVRAKLLERFGRYGIARAMTCLRDGSVTDLKGLRTALLEDSRLNDLQ
FT                   EAVHLQFVERQDALRARSILLAVDMVLRANPRPGVQRLLGEFEHLMVNAAHEWDELRLL
FT                   SSLASGQVRFPRSLQSEAHRMLGAYGHDARSRLGGDDNAMEADLADEAAATLARWREQA
FT                   VNPLHDRAHREAVQTVVRSCERLIASQMRG"
FT   CDS_pept        complement(333791..335005)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0297"
FT                   /product="monooxygenase, FAD-binding"
FT                   /function="2-polyprenyl-6-methoxyphenol hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0297"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99646"
FT                   /db_xref="GOA:A4F6H2"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6H2"
FT                   /protein_id="CAL99646.1"
FT                   /translation="MKVIVVGAGMAGLSLANRVSTLGGEVVLLERATGPRAQGYMMDFF
FT                   GPGYDAIEAMGLLPAVEDVAYHIAEATFVDEHGRRRAGVRPRQFANGPLLNLMRPDLER
FT                   VLREHLPPEVDLRFGTGPTAVTDHNDGVRVTLADGTRLDADMLVGADGIHSTVRHLVFG
FT                   REAEFLRYLGFHTAAFCFDAPEVEAIVRDRACLTDTVGRQMGFYSLRDGRVAAFGVHRT
FT                   ADPTLPEDLRTAVRDAFAGLGWVAPRALDRCPPPSEIYYDQVAQIEMPRWSRGRVVLVG
FT                   DACYAVSLLAGQGASLSIAGAYLLADRLAHARTIEQAVAEYEQLWRPVVREKQQVGRTG
FT                   ARWFLPESRWQLRFRRAVLRLARLPVLDRYLAALLAGKSSALVRNLRQGGGPSELTGGR
FT                   QATPR"
FT   CDS_pept        complement(335026..335553)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0298"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99647"
FT                   /db_xref="GOA:A4F6H3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041583"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6H3"
FT                   /protein_id="CAL99647.1"
FT                   /translation="MRQRLLTAAAELIPERGWTAVSTRVLAERAGVTPSVVHYHFPSLP
FT                   ALLNEAVVGLMRQMLADVDAFLSAAATPADAVDAMLESVDRYTGADPMSLLFVEACLAA
FT                   TRDEQLRGEIGAVVEEFRQRVGRWLGEHGVSAPAETAAALIAVVDGLLLHRGLGVGPDT
FT                   GSAARVLRRLVA"
FT   CDS_pept        complement(335945..336091)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0299"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0299"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99648"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6H4"
FT                   /protein_id="CAL99648.1"
FT                   /translation="MCGRELAADNSQHAWFWGTCPDCNREAHRLAASRQEAQSRVQKCG
FT                   RRK"
FT   CDS_pept        336341..337198
FT                   /transl_table=11
FT                   /locus_tag="SACE_0300"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0300"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99649"
FT                   /db_xref="GOA:A4F6H5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6H5"
FT                   /protein_id="CAL99649.1"
FT                   /translation="MPVDTSGVTPRARALSAAIRSIRERSGVSGRELSKRLGLSHGTVS
FT                   HWETGRRVPTPEDVASLLTAAGITGDEKQRVVELARHASEPNWLTVGMPGIPQQLAGAV
FT                   ECERAASSIAEWAPMGLPGLLQTADYARTISKASGLATADVEQRVMLRIARREVLTRRD
FT                   PVRFLALIGEDALRDRIGEPEVMEEQLRYLLDLGLHDNVTVQVVQPRIGWHPGLAGPFV
FT                   LYDFPDAPSVVHFEHFSSGAFVPDADDVQAYQCAVDNIRRVALSPAQTTERITEILKEL
FT                   RHEA"
FT   CDS_pept        337188..337376
FT                   /transl_table=11
FT                   /locus_tag="SACE_0301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0301"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99650"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6H6"
FT                   /protein_id="CAL99650.1"
FT                   /translation="MKPENWRKSSRSQPNGNCVEVGGSAAGAAVRDSKDRDAGYFTASR
FT                   AQWSAFVGAVKAGRFDR"
FT   CDS_pept        complement(337478..338932)
FT                   /transl_table=11
FT                   /gene="katA"
FT                   /locus_tag="SACE_0302"
FT                   /product="catalase"
FT                   /function="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0302"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99651"
FT                   /db_xref="GOA:A4F6H7"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR040333"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6H7"
FT                   /protein_id="CAL99651.1"
FT                   /translation="MSSARFTTTNAGIPVGSDDHSLSAGANGPLLLQDHYLIEKNAQFN
FT                   RERVPERVVHAKGGGAFGFFEVTEDVSQFTKAAVFQPGTRTEALIRFSSVAGELGSPDT
FT                   WRDPRGTAIKFYTSEGNYDLVGNNTPVFFIRDAIKFPDFIRSQKRRADNHLRDHDMQWD
FT                   FWTNCPESAHQVTWLMGDRGIPKTWRHMNLYGSHTFMWQNAGGEKFWVKYHFKTEQGHD
FT                   FLTQAEADQLAGTDADHHIRDLWNTIKAGENPEWTLYVQVMPYADAADYRFNPFDLTKV
FT                   WPHGDYPLIKVGRFVLNRNPENYFAQIEQAAFEPSNLVPGIGPSPDKMLQGRLFSYPDA
FT                   HRYRIGTNYAELPVNRPVSEVNSYSKDGAMRFSNTQDPVYAPNSYGGPHADTERFADDV
FT                   AAAGIEQEILRTAYTLRSEDDDFGQPGTMVRNVFSDEERARFVDNVAGHLNGGVSAPVL
FT                   ERALAYWRNVDKATGDRIAEKVQAAG"
FT   CDS_pept        complement(339416..339979)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0303"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0303"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99652"
FT                   /db_xref="GOA:A4F6H8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6H8"
FT                   /protein_id="CAL99652.1"
FT                   /translation="MTRTDESRRRRELLSKLLEYSADHGLSEVSLRPLAAAVGSSPRML
FT                   LYFFGSKEGLVREVHRHAREAQLALLADALGDRLATGSRADALRALWEWLSDPAHHNVV
FT                   RFFFESYARSLHAREDAWEGFGEASVREWLPHIRRALGSSDAEATLVLAALRGLMLDLL
FT                   ATGDTERVRAGFESLVAGLPVEPA"
FT   CDS_pept        340018..340521
FT                   /transl_table=11
FT                   /locus_tag="SACE_0304"
FT                   /product="transcriptional regulator, MarR family with
FT                   acetyltransferase activity"
FT                   /function="Histone acetyltransferase HPA2"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0304"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99653"
FT                   /db_xref="GOA:A4F6H9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6H9"
FT                   /protein_id="CAL99653.1"
FT                   /translation="MGGIEIRTGPRPGDLGTVLAMHGRLYAREYGFDERFEAHVARGLA
FT                   AFAAALGDARDTGAEPGVLWVAERGDDPVGTVALTGEGGGVAQLRWFLVAPSARGTGLG
FT                   RELLRTLLDHARGRGYAHVKLWTVDGLDAAARLYTEAGFRRTERNPVRQWGHDLTEARY
FT                   DLDL"
FT   CDS_pept        complement(340543..340950)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0305"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99654"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6I0"
FT                   /protein_id="CAL99654.1"
FT                   /translation="MINVLAGVVGALLGFSGALLGAWIKSRGEHRKWLREQKLAGAAEM
FT                   VSAGTNIYEFRSGSKAWLESFEPSELREWQSQLQKGRAAIHLLCTRETRDRADAFVRSC
FT                   WHAKDDKENLAEAVQALRAFTASLRKEVGSD"
FT   CDS_pept        complement(341064..342848)
FT                   /transl_table=11
FT                   /gene="bga"
FT                   /locus_tag="SACE_0306"
FT                   /product="beta-galactosidase"
FT                   /function="Beta-galactosidase"
FT                   /EC_number="3.2.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0306"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99655"
FT                   /db_xref="GOA:A4F6I1"
FT                   /db_xref="InterPro:IPR001944"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019801"
FT                   /db_xref="InterPro:IPR026283"
FT                   /db_xref="InterPro:IPR031330"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6I1"
FT                   /protein_id="CAL99655.1"
FT                   /translation="MGGTNRVLAQAGKPAGLTVRGNEFLLDGEPFRIIAGEMHYFRTHP
FT                   DQWRNRLDRMRALGLNSVDTYVAWNFHEPRRGEVDFTGWRDVVRFVETAAEAGLKVIIR
FT                   PGPYICAEWDFGGLPAWLLESGNPPLRCSDPAYTELTLRWFDELLPRLAPLQATRGGPV
FT                   LAFQVENEYGSYGNDQTHLEQLRAGMLERGIDSLLFCSNGPSDYMLRGGNLPDTLATVN
FT                   FAGDPTAPFEALREYQPEGPLWCTEFWDGWFDHWGEEHHTTDPVETAGHVDRMLAAGAS
FT                   VSLYMAVGGTNFGWWAGANYDTSKDQYQPTITSYDYDSPIGEAGELTEKFQRIREAIAR
FT                   HAPVPEPPLPAPPPRLRPQTARPEATTGLLESLDVLSSPVRSATPAHMEKFGQPYGLIH
FT                   YRTTVQGPRQTAGLRVSGLADRALVFSDGKYLGALDRNTPDLTIDVAVPGRTGRLDLLV
FT                   DTGGRVNFGHQLSDPKGITDRVLLGMQALHGWEIRPLPLEDLSGLRFGGGTSAGPVFHR
FT                   ARMSIAEPADGFLALPGWEKGMVWLNGFLLGRYWSVGPQVTLYAPSPLWKQGENEIVVL
FT                   EMHEAGQDIELRSEPDLG"
FT   CDS_pept        343192..343725
FT                   /transl_table=11
FT                   /locus_tag="SACE_0307"
FT                   /product="hypothetical protein"
FT                   /function="SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0307"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99656"
FT                   /db_xref="GOA:A4F6I2"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6I2"
FT                   /protein_id="CAL99656.1"
FT                   /translation="MLDIGAHDLDDLTDYRNVCLLALAGATGPACERAKSMRLPGAEVE
FT                   DGELDTLRFPQNSFDVVVLRFSLCRAAKPEQTIAEVGRVLRPNGHLVFLEHTRASGIVG
FT                   NAQDRADEIMRGSGRCHFNHEVLQGMHRAGLVLCRAEWFWPSAHLRAPLVAGVASHPDP
FT                   QYQRELRWLSGEQE"
FT   CDS_pept        343728..344255
FT                   /transl_table=11
FT                   /locus_tag="SACE_0308"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0308"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99657"
FT                   /db_xref="InterPro:IPR009409"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6I3"
FT                   /protein_id="CAL99657.1"
FT                   /translation="MTRKVADCRNYPSEMNCTLTISGEEDEVVRAAAEHAISVHGHDDT
FT                   PELRDDIRRLLEDEAPAAAAAGTGAGAPAGDGMHFVQLIEFRTTKRDEVNQLIDEWENA
FT                   TGGKRTASRAVLTADHEQPNSYYEFVEFPSYDEAMRNSALPETEALSRRMRELCDGEPT
FT                   FHNLDVVRAEKL"
FT   regulatory      344263..344305
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(344489..346318)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0309"
FT                   /product="peptide hydrolase"
FT                   /function="Dipeptidyl
FT                   aminopeptidases/acylaminoacyl-peptidases"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0309"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99658"
FT                   /db_xref="GOA:A4F6I4"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6I4"
FT                   /protein_id="CAL99658.1"
FT                   /translation="MSTYPAAKVPEKLFEDPAAEQRWRARFSAPRVSLPDWARDAPQRS
FT                   LYVSNVSGTWEIYAWDRERETHRQVTDRPNGTFHGTLSADGEHIWWFNDTDGDEFGSWV
FT                   VQPFGSDSHEPALPGTHPGYPSGLELGAKVRGLAMSTDDGVTVWIARDGGVPEVIYQHE
FT                   QDGGLSALSWDETVLVISHSEHGDSRHPALRVLRVDGSEVAEKWDGPGKGLEALDFAPV
FT                   TGDQRLLVLHERRGREELLIWDVESDTETEITLDLPGEVSADWYPDGSALLIAHTHHAR
FT                   TTMHRYDIASGTLTDLPTPAGTVGGAAVRPDGSVEYSWSSAATPSLVRSLSAGGEDRVL
FT                   LSPPGERAPGSQPVADVFVEVPYGPNDTVHALVSRPEGDGPVPTVFNLHGGPHAADEDR
FT                   FSAYRAAWLDAGFAVVEINYRGSTGYGSAWRDAIEGRPGLTELEDVARVQDWAIREGLT
FT                   TPELSVVAGASWGGYLTLLAMGTQPERWAGGVAGVPVADYVSAYADEMEPLRAYDRALF
FT                   GGSPDDVPDTYRDCSPITYVDQVRAPILVLAGDNDPRCPIQQILNYLDRLAARDVPFEF
FT                   YRYDAGHGSLVIAETLRQVSAEIAFARNVVGRP"
FT   CDS_pept        complement(346388..347203)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0310"
FT                   /product="methyltransferase"
FT                   /function="SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0310"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99659"
FT                   /db_xref="GOA:A4F6I5"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6I5"
FT                   /protein_id="CAL99659.1"
FT                   /translation="MTDVQERLELRDRMYGENDLSKLELFAGGYLNFGYWRDIDARGGL
FT                   TVEHRVASQEAMYRLAADALGIRDGDRVLDVGCGRGKGTALVAEEYPVREIYGTDLLEV
FT                   QVDRAKNANAAAIAAMPGRLHYVAGAASRLPLPERSMHRVFSVEAAQHFEDIPGFAAEA
FT                   HRVLAPSGVLAVATFFATAAGRGPALAERLDTFASGVDLATGVEEFRGTLAAAGFAGVT
FT                   SESIGEHVFPGLDRWLARTAYASTWAREWLGCYRDGLVDYYLITATRAG"
FT   regulatory      complement(347445..347496)
FT                   /regulatory_class="terminator"
FT   tRNA            complement(347498..347574)
FT                   /gene="tRNA-Pro (CGG)"
FT                   /locus_tag="SACE_8010"
FT                   /product="transfer RNA-Pro (CGG)"
FT   CDS_pept        complement(347625..348587)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0311"
FT                   /product="metallophosphoesterase"
FT                   /function="predicted phosphohydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0311"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99660"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6I6"
FT                   /protein_id="CAL99660.1"
FT                   /translation="MNTLGRILLTGGALGAATFGYAAGIERRHWTLRHVTLPVLAEGAP
FT                   RLRVLHVSDLHMMPNQHSKQRWVAALDELEPDLVVNTGDNLAHPQAVPAALRALGPLLD
FT                   RPGVFVFGSNDYYGPKPKNWARYLMPSAKQKRIHGVPLPWRDLRAAMTERGWVDVTHQR
FT                   HGLDVAGLRLHVAGLDDPHLHRDKYSKIAGEVPSDTHLNLGVTHSPEPRVLDAFADDGY
FT                   DLVLAGHTHGGQLRLPGYGALVTNCELDRSRARGASTWGEHMRLHVSAGLGTSPYAPVR
FT                   FACPPEATLLTLVPRSQEVGATSMNTLGGAPFGAGSNVR"
FT   CDS_pept        348673..349143
FT                   /transl_table=11
FT                   /locus_tag="SACE_0312"
FT                   /product="GatB/YqeY"
FT                   /function="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0312"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99661"
FT                   /db_xref="GOA:A4F6I7"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6I7"
FT                   /protein_id="CAL99661.1"
FT                   /translation="MAELKSKLRADLTAAMKERDNTVTGVLRMALAAVNVEEVSGKQAR
FT                   ELTDEEVLRVLGKEAKKRDESAEAFAAAGRDEQAAAERAEGEILRRYLPKQLDDAELAQ
FT                   LVQDTVAELTAELGEKPGMKQMGQVMKAVNAKVAGRAEGGRVAPLVKSALAG"
FT   regulatory      complement(348948..348976)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(349209..349910)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0313"
FT                   /product="FAD-binding 9, siderophore-interacting domain
FT                   protein"
FT                   /function="Siderophore-interacting protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0313"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99662"
FT                   /db_xref="GOA:A4F6I8"
FT                   /db_xref="InterPro:IPR007037"
FT                   /db_xref="InterPro:IPR013113"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="InterPro:IPR039374"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6I8"
FT                   /protein_id="CAL99662.1"
FT                   /translation="MVRVTLGGEELADFVSSGSDQRIKLCLPQPGQPTPLGRDRAEVFA
FT                   LPREQQPKQRTYTVRWFSAQRLELAIDFVVHDHDGPGSTWASRVRPGEQIVAVGPSPSY
FT                   EPNPEADRLVLAGDETALPAMAAILEELPAEAKVRVFAEVADAAERQDIASAADVEWTW
FT                   LHRDGVPAGESDLLVEAVRSADLGPVPYVWVGAEADAVQALREHCQRTLGLDRRRVYAL
FT                   AYWRRGGAATS"
FT   regulatory      complement(350031..350083)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(350116..352626)
FT                   /transl_table=11
FT                   /gene="pon1"
FT                   /locus_tag="SACE_0314"
FT                   /product="penicillin binding protein (class A)"
FT                   /function="Membrane carboxypeptidase (penicillin-binding
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0314"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99663"
FT                   /db_xref="GOA:A4F6I9"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6I9"
FT                   /protein_id="CAL99663.1"
FT                   /translation="MTLSHDLTPPYAERVRVRDGVLKLFGLCVLAGVLVAGLMFPVAGS
FT                   LGVVSNRASDAVNNISAELMSQDPPLVTTVTDRAGTPIAYLFDQNRTPAAPDEIADTMK
FT                   AAIIAIEDRRFYDHRGVDWAGTVRAALTNQMSGEIAQGGSTLTQQYVKNYQVHVVAAGD
FT                   PVKQAKAIEQTPARKLREIRIALQLERRLGKEQLLARYLNVVPFGNQAYGVAAAARTYF
FT                   NTTPDQLTIAQAALLAGMVNSPSALNPENNPAEALGRRNLVIDAMLAQHRITPEAAEEA
FT                   RTSPLGLARPLRGIPNGCIGAGPSDGFFCQYVIDYLGRSGFTEDQLKRGGYTIRTTLDH
FT                   KATAAAKAAAERHVPKKTKGIANVMSVVEPGKEKHRVRALVANRDFGLDGTKGETAYAL
FT                   PSGIAKFGAGSVYKVFTAAAALERGMGIQTVIPSPPNYTSRVYKNGTAPYTVGNAEGVT
FT                   PGPRTLQKALATSPNTAFVALQERVGLSETVDMAARLGMRQTLLAADKAGDPVPEGGTV
FT                   QTQGEWMKQANIGAFTLGFAPTSPLELSNVAATIISGGTWCPPTPIEQILDRHGNPVSI
FT                   TEDSCEQAVDEALANALAVGMSMDDKPGGTAAAAASGAGWTRPMLGKTGTTEAHQSASF
FT                   LGATPQFAGAVLTFSDGTSPQGICDSTPPTLCGANGGNIYGGKVPARTWYDAMNGVHEG
FT                   LPVVPLPPTTKRYETGGSEAQVPNVVGHTAQRATEILQKAGYRVQEKSVNSQRRQGTVT
FT                   SQTPRGFALPGELVTIAISTGYVPPPSVVTPPPLPTPGRGEPGRSGEPGFPEQPGQPGQ
FT                   PGEQWLPGLPGLPGGRQGEPGLPG"
FT   CDS_pept        352895..353134
FT                   /transl_table=11
FT                   /gene="wblA"
FT                   /locus_tag="SACE_0315"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0315"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99664"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6J0"
FT                   /protein_id="CAL99664.1"
FT                   /translation="MFVRGAEQRKARMVCFGCPVRTECLGEALDNKIEFGVWGGMTERE
FT                   RRALLRRRPDVRNWRELLEAARQNYADFEEYQVS"
FT   regulatory      353195..353251
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(353252..354391)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0316"
FT                   /product="putative anion-transporting ATPase"
FT                   /function="Oxyanion-translocating ATPase"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0316"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99665"
FT                   /db_xref="GOA:A4F6J1"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6J1"
FT                   /protein_id="CAL99665.1"
FT                   /translation="MNQPHRPDPVDVDALLDDPATKVVVCCGSGGVGKTTTAAALAVRA
FT                   AERGRKTVVLTIDPARRLAQALGLRELGNQPKQVVLEGFEPAGDLNAMMLDMRRTFDDM
FT                   VRAHAGPERTEQILSNPFYQTISTSFSGTQEYMAMEKLGQLAASGTWDLIVVDTPPSRS
FT                   ALDFLDAPQRLSTVLDGRLIKMLSSPARAGGKGLRRIAAASFGMFSKAVSTIIGGQLLN
FT                   DAAAFVQAFESTFGGFRERADSTYRLLRSPGTAFLVIAAPEPDALREAAYFVERLAGDG
FT                   MPLAGLIANRTHPVVADLPGPRAVSAAEELETAGASPLAAAVLRIHADRVAVAEREKRM
FT                   LARFTRAHPEVPLAGVPALPSDVHDLEGLREIGRLLAGG"
FT   CDS_pept        complement(354388..355389)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0317"
FT                   /product="probable anion transporter ATPase"
FT                   /function="Oxyanion-translocating ATPase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0317"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99666"
FT                   /db_xref="GOA:A4F6J2"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6J2"
FT                   /protein_id="CAL99666.1"
FT                   /translation="MTDWDGELNHARLHVVSGKGGTGKTTVAAALALALATGGRKVLLV
FT                   EVEGRQGIAQLFDTAPLPYSEESIAAAPGGGELRALAIDAEPALLEYLSMFYNLGFAGR
FT                   TLRKMGAIEFATTLAPGLRDVLFTGKIKECVGRTDERGRYVYDHVVVDAPPTGRVVKFL
FT                   DVTRAMADLAKVGPIRGHSDGVVRLLHSSDTVVHLVTLLEDLPVRETLEAVAELDAADL
FT                   RPGAVLFNRVRPGRLPARSATAAAAGRVDTGRLRGGLESAGLRADDELVGALAHQAVEH
FT                   AIRAQEEQAAREQVSELDLPSVSLPDLIAGIDVAELYELAELLNDHGVGSPQ"
FT   CDS_pept        complement(355446..355697)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0318"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0318"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99667"
FT                   /db_xref="GOA:A4F6J3"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6J3"
FT                   /protein_id="CAL99667.1"
FT                   /translation="METWRIVATALITAVGGFMVLGIMSTVRARRDRAPGEVGRVALHG
FT                   GLVVVVLAALAATVLPPAVCWGLVAAGVLITVGVMITG"
FT   CDS_pept        355821..355955
FT                   /transl_table=11
FT                   /locus_tag="SACE_0319"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0319"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99668"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6J4"
FT                   /protein_id="CAL99668.1"
FT                   /translation="MPLLSHATKQILDQWGEDGWELVAVLPGPTGEQMVAYMKRPKGD"
FT   CDS_pept        355957..356415
FT                   /transl_table=11
FT                   /locus_tag="SACE_0320"
FT                   /product="endoribonuclease L-PSP"
FT                   /function="putative translation initiation inhibitor, yjgF
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0320"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99669"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6J5"
FT                   /protein_id="CAL99669.1"
FT                   /translation="MGRWTDRLAEAGIQLPGVAAPVAAYVPAVRTGSYVYTSGQVPIVE
FT                   GKLAAAGKVGAEISADEAKQHARTCALNALAAVDALVGIDSVVRVVKVVGFVASAEGFT
FT                   GQPGVVNGASELLGEIFGEAGQHARSAVGVAELPIGAPVEVELIVEVE"
FT   regulatory      356432..356482
FT                   /regulatory_class="terminator"
FT   CDS_pept        356787..357362
FT                   /transl_table=11
FT                   /locus_tag="SACE_0321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0321"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99670"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6J6"
FT                   /protein_id="CAL99670.1"
FT                   /translation="MLLRLAGRLPDRHLWRYRDWLAGGAADVLARMLPGTLVRERIPLG
FT                   DGDFRLLRDALFPLGADPALVNAILPAKQTRPAHTFVATSHTDDSGDPAILVLGATLRG
FT                   RQGVREVRSSWRRGDGLPLKRVLLVTASADVVGLTSEIQRILRALGEPEPCVEVLPPDV
FT                   EPTAYHRAALAESALVCEGADELAGHRG"
FT   CDS_pept        357437..358621
FT                   /transl_table=11
FT                   /locus_tag="SACE_0322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0322"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99671"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6J7"
FT                   /protein_id="CAL99671.1"
FT                   /translation="MDVAEGAGPVDRLHNLLLAMTGRVDDDAVNSARELLGTGQLDAAA
FT                   EFLAGCLVAGRIPVTSTEQYQLRRVLDEARSQQRLADRLHVLDTVPDEGHRFSDQDQSD
FT                   DEVVAALAPVTSRLAGVRALWCSWRVTPAGVTYGAVPRRVLLAEVGSDGSVAAAGYQLL
FT                   EALRRAGVGCSVEVFSSGSDLPEYHRNALAAAHRVHLDMPPAAIAQQNGMSRARAPRVS
FT                   SGGEPAGGHDLPAEPAPAPRAERPVERPVERPAPEPQPEPEPVTPPAVSEPAPAQVAAP
FT                   AEPAQQAAAPAEPAPQQHQNAPENQGKADSQGNMRVPAAVDAKLTDRERNLLRKLHEEL
FT                   AQREQDRSGPAQGGQGQRQPESWNSTMPGGTGGFPPIGAHPSPVSNQSYNKQRP"
FT   regulatory      complement(358442..358485)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(358670..360172)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0323"
FT                   /product="hypothetical protein"
FT                   /function="predicted dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0323"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99672"
FT                   /db_xref="GOA:A4F6J8"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6J8"
FT                   /protein_id="CAL99672.1"
FT                   /translation="MTQFDHGRSRSERSTRPAPARNPASESSRDTSAARTSAKAAVSLT
FT                   TVPGSAPARSTPDSSNVSRTAAHTSARASSSVHPSCLAHHCGEGPFHATEVSASRGSTP
FT                   PPGNTVMPPANGMPFTRRWRKTSGPAVPSRSSRTVAASFGVTGGSGGDSGTNPSGSASS
FT                   SGSCTMPVTLSRDDAENRDPGPEITASPQVPPSAGPPLRRRHDVGMSETLRVGVVGAGP
FT                   WAGRVHAPGLEAHPGTRLAAVWSRRREAAEELAGSRDVLVATGFDELLASVDAVAFAVP
FT                   PDVQAKLAPVAARAGKHLILEKPLATDLAGAQAVADAAQESGVAAVMMLTRRFAPEVRS
FT                   WLAGLDGVRGGAGRWLAGALLSGDYAASRWRQEEGALVDAGPHAIDLLDAALGRIEQVH
FT                   YASRDAANDLWHVVFGHEGGATSTLTLSLRVPVQPALVDISVYGENGHTQLSGRRTAAQ
FT                   DCYAVLLDEFLELVREGKTEHVCDVRRGLHLQRVLADVQAAV"
FT   regulatory      358716..358755
FT                   /regulatory_class="terminator"
FT   CDS_pept        359892..360500
FT                   /transl_table=11
FT                   /locus_tag="SACE_0324"
FT                   /product="NUDIX hydrolase"
FT                   /function="NTP pyrophosphohydrolases including oxidative
FT                   damage repair enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0324"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99673"
FT                   /db_xref="GOA:A4F6J9"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR039121"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6J9"
FT                   /protein_id="CAL99673.1"
FT                   /translation="MAWNGPSPQWWARQLGCTEELARALVCAAVRETFEESGVLLAGAD
FT                   PGTVVSDTAAFADVRAALVSRELSLAGFLAGAGLVLRSDLLRPWSNWVTPEAEPRRYDT
FT                   RFFVAALPEGQRADAATSEASDAYWRTPRAALDDWRQGRCGLLPPTWVTLTEIAECGSV
FT                   AEALSTERVLTKVVPKLARRDGRWHVLMPGEPGHDGEGQ"
FT   CDS_pept        360500..361327
FT                   /transl_table=11
FT                   /locus_tag="SACE_0325"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /function="Zn-dependent hydrolases, including glyoxylases"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0325"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99674"
FT                   /db_xref="GOA:A4F6K0"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041516"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6K0"
FT                   /protein_id="CAL99674.1"
FT                   /translation="MEHPAYGAVRPVTAYASVLLARNPDVMTLDGTNTWLVGSPDSADR
FT                   IVIDPGPADRDHLALAAERPVSVVLLTHHHPDHTAGARDFAGLTGAPVRALDPALCAGA
FT                   EPLTDGETVEASGVRLRVLATPGHTADSVCFTVDDPAEPAVFTGDTVLGKGTTVVAHPD
FT                   GHLGSYLESLRLLGDLPEGTRVLPGHGPELPDIRAVSRAYLAHRGQRLGQIRTVLREHG
FT                   PDITARGVVEIVYADVDPAVWPAAEWSVQAQLTYLRELEAPDGASSGPQGPSA"
FT   CDS_pept        complement(361337..362158)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0326"
FT                   /product="hypothetical protein"
FT                   /function="uncharacterized Fe-S protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0326"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99675"
FT                   /db_xref="GOA:A4F6K1"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR005303"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6K1"
FT                   /protein_id="CAL99675.1"
FT                   /translation="MARIADLIYYPIKGCAGTPLLDAVMTPAGLAHDRSFMVVDEQGVF
FT                   RTQRRHPRLALVRPDLSPDGERLTLRSPGVEAVSTAVDAAGPRRDVNLFGAAYKGIDQG
FT                   DVVAEWLSEVVAAPCRLVRVPPEHDRVTDGEVPGTSGYADSSAVHVLSLASLDQLNERL
FT                   VERGAPAHPMSRFRPNIVVTGWEPHTEDLVRRVTIGGSELGYTKLAVRCAVTTVDQDSG
FT                   RRSGPEPLRTLAGYRRAEGGIVFGAKFAVLETGKLSVGDEVVVTARAERIR"
FT   CDS_pept        complement(362216..363310)
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="SACE_0327"
FT                   /product="DNA polymerase III beta subunit"
FT                   /function="DNA polymerase sliding clamp subunit (PCNA
FT                   homolog)"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0327"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99676"
FT                   /db_xref="GOA:A4F6K2"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6K2"
FT                   /protein_id="CAL99676.1"
FT                   /translation="MDLDVTAPTRALAAAAADLVRLLPGRLLDPVLAGMVLTATPQGLE
FT                   LAGTDRERGIRLSRRARTHAEGRILVPARPLAETLRNLDSVEVRLVVEGAKLALRTRNA
FT                   RFALPLLDLAAHPGVRAAPPRAGALDAALLPAVAVVAAATSRDDALPVFTGVHVKQRGE
FT                   RLVLAGTDRFRMAVATLPWRPGTDDLDVLVPSGLLTEVAKQASGDEVMLRADADRVGLS
FT                   WADAEVSTTLLDAPFPDESRHLLPEVDCAVEVRADEVAGAVRRVSPYAGAHGAVVLDVG
FT                   DAEVRVRAADPQFGDAQEAVKATVTGDRFSPAFQPRYLADALQAFAGRTVRMGLRSGLR
FT                   RSTVISDVDAPEADLRYVLMPKRI"
FT   CDS_pept        complement(363781..364962)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0328"
FT                   /product="ABC transporter integral membrane protein"
FT                   /function="77 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0328"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99677"
FT                   /db_xref="GOA:A4F6K3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6K3"
FT                   /protein_id="CAL99677.1"
FT                   /translation="MLTSLLARLPIAMVGLSLMLYVQRETGSFAAAGLVSAGALVGVAC
FT                   GSVVQGRVMDRIGPTLPLYVMSGVFAALVAAEIAVIEAHAPVAVLVALAFAVGISEPMT
FT                   GPASRALWNVLLPPGPARDAAFSYEAISMEVFFILGPGLAGLLVAMPWPGTGVVAGAAC
FT                   MIVGSVGFASTRAARSQRPERPERTGRGRSNMLGALASPGMRTVALAALGFGALIGFIE
FT                   VGVPAAAELAGHPTAGGLLLSLLSVSSVLVGVLYGMRPWPRAMHLRLPALLFGFAALIT
FT                   LLAVPTTLWGLALALLLAGSLITPQSTAHSVSLEIAAPAGTATEAFGWVVTSVTLGAAF
FT                   GQSVSGQIVETAGPPAAFLAASAVGALAALVLWLRRGTLRPEPAAASPQLAGV"
FT   regulatory      complement(365806..365867)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(365903..366472)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0329"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /function="cAMP-binding proteins - catabolite gene
FT                   activator and regulatory subunit of cAMP-dependent protein
FT                   kinases"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0329"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99678"
FT                   /db_xref="GOA:A4F6K4"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6K4"
FT                   /protein_id="CAL99678.1"
FT                   /translation="MIFAEGEPGDRLYIIQSGKVKLGRKSPDGRENLLAIMGPSDMFGE
FT                   LSIFDPGPRTSTATTVTEVRALTMDRTALRQWIGTRPEIAEQLLRVVARRLRRTNGMLA
FT                   DLIFTDVPGRVAKALLQLAQRFGSQEAGLLRVTHDLTQEEIAQYVGASRETVNKALADF
FT                   AHRGWLRLEGKSVLILDPERLARRAR"
FT   CDS_pept        complement(366669..366884)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0330"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99679"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6K5"
FT                   /protein_id="CAL99679.1"
FT                   /translation="MFFTLFMERVEARLRHVAVQENEVEELLENARPDEVRALFRQGIG
FT                   RALELFQLRRVGRAGKLRTRRSRDQS"
FT   CDS_pept        367141..367878
FT                   /transl_table=11
FT                   /gene="nth"
FT                   /locus_tag="SACE_0331"
FT                   /product="putative endonuclease III"
FT                   /function="predicted EndoIII-related endonuclease"
FT                   /EC_number="4.2.99.18"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0331"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99680"
FT                   /db_xref="GOA:A4F6K6"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6K6"
FT                   /protein_id="CAL99680.1"
FT                   /translation="MLRALAEAYPEAHCELDFNTPLELAVATILSAQCTDKRVNEVTPA
FT                   LFKRYPTAESYAGADRAELEEMIRSTGFYRNKASSLMGLGAQLVERHGGEVPARLDELV
FT                   KLPGIGRKTANVILGNAFDVPGITVDTHFGRLVRRWKWTAEEDPVKVEHAIGELIPRKE
FT                   WTMLSHYVIFHGRRVCHARKPACGACLLAADCPSYGDGPTDHLVAAKLVRGHEAPHLLA
FT                   LAGIVDEIPERTIEKVAETEPHA"
FT   CDS_pept        367875..368513
FT                   /transl_table=11
FT                   /locus_tag="SACE_0332"
FT                   /product="redoxin"
FT                   /function="Thiol-disulfide isomerase and thioredoxins"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0332"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99681"
FT                   /db_xref="GOA:A4F6K7"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6K7"
FT                   /protein_id="CAL99681.1"
FT                   /translation="MSGLREYRNEIRWTIVVVVLAVLGIVALWPRGAEQPAEPGAPAPA
FT                   PVAAQRGADPALRASAALEPCPSGPPTGPPGATGTCLADGRPADLAAMVGGRTTLVNVW
FT                   ATWCQPCRTELPALQEYSRRPGAVPVVGVQVQSDEDDGLALLRELGVRYPNVHDPDNRI
FT                   RAALNVPAVLPMSYVVTASGEVRRVDPPVAFESADEVRTAVQRTAGGAG"
FT   CDS_pept        368537..369226
FT                   /transl_table=11
FT                   /locus_tag="SACE_0333"
FT                   /product="NUDIX hydrolase"
FT                   /function="NTP pyrophosphohydrolases including oxidative
FT                   damage repair enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0333"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99682"
FT                   /db_xref="GOA:A4F6K8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6K8"
FT                   /protein_id="CAL99682.1"
FT                   /translation="MDPDDVPEWLRTLVKRTADLDGGRLGWPRTDPPADARPAAVLVLF
FT                   GEGEAETGPDVLLLRRADNLNSHPGQVAFPGGAVDPGDDGPVGAALREATEEVGVLAGG
FT                   VRPVAVLPELHVAHSGFRVTPVLAHWRTPSPVAPVDPAETAAVARVPVSWLTDPANRIR
FT                   VRYAERQLGPAFLVPGMLVWGFTGGLLAGVLDLAGWARGWNRDDVRELGAAWRAAEEAD
FT                   DVGFGTH"
FT   CDS_pept        369326..370507
FT                   /transl_table=11
FT                   /locus_tag="SACE_0334"
FT                   /product="putative membrane-associated serine protease"
FT                   /function="Trypsin-like serine proteases, typically
FT                   ,contain C-terminal PDZ domain"
FT                   /EC_number="3.4.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0334"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99683"
FT                   /db_xref="GOA:A4F6K9"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6K9"
FT                   /protein_id="CAL99683.1"
FT                   /translation="MNWVDLLVVLLALLAAASGARSGLITALFSFLGVIAGAVVGLKLA
FT                   PLLLERLDSPSARIAFGVGIVVLLVAFGETFGMWAGRELRDRITSSKLTGVDNVLGAVL
FT                   QCVAVFVVAWLVALPFTSASALPGLASAVTRSTVLRTVDSVMPDAAKQLPSELREMLGM
FT                   SGFPEALEPFSETPVAAIDPPDPALASSEAVRDARTSVVKVRGRAVSCARALEGTGFVI
FT                   APHRVMTNAHVVAGTDKVAIEIGRGEFDAEVVLFDPNTDLAVLSVPALDADAMSFKQDA
FT                   HPGDSVIALGYPLDGPYTASPGRIRERIRLRGPDIYDSTTVVREVYTLRGKVQSGNSGG
FT                   PLIDPRGDVVGVVFGAAVDDPETGFVLTADEVADEVASAPSLHTPVSTGDCTG"
FT   regulatory      370539..370566
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(370545..371057)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0335"
FT                   /product="protein of unknown function DUF1469"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0335"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99684"
FT                   /db_xref="GOA:A4F6L0"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6L0"
FT                   /protein_id="CAL99684.1"
FT                   /translation="MRYVNSAEKNPNGSRDGAGWSAVTSIPLSEEGTGPDNGQSIGALV
FT                   RDATTHLSTLVRSEMELAKAELAGEVKKGVKGSVYFILALSVLGFSMFFLFFTLAEGLA
FT                   QLGLWRWAAFGIVFLFMLLVAGVFALLGYRRVRKIRAPKRTIESLKDTAQITRRHGEDK
FT                   AVEKTSA"
FT   CDS_pept        complement(371135..372373)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0336"
FT                   /product="putative sodium/proton antiporter"
FT                   /function="Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0336"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99685"
FT                   /db_xref="GOA:A4F6L1"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4F6L1"
FT                   /protein_id="CAL99685.1"
FT                   /translation="MSKSARNRTRRNPDGQQGSARSFDFAEYLRTETVGGMVLLAAAAL
FT                   ALVLANSPAEELYRTVRDFTVGPHFLHLDLTIGEWAKDGLLAIFFFVAGLELKRELVVG
FT                   ELADRKTATLPVVAALGGMVVPAVLAFAIGHGAPGAHAAWAIPVATDIAFALGVLSLTG
FT                   SWMPTAARVFLLSLAVVDDLGAIVVIAVLFTSGLSVLALLAAAALCAVYWYAQKRRITT
FT                   PFLYVPLAVATWIAVHSSGIHATIAGVALGLLTRVRRDLHETASPAMRLEHRLQPWSAG
FT                   LIVPVFALFAAGVPVDGEALVAMTHDRVAIAVVVGLVVGKLVGIFGSSYLAVKIGIGAK
FT                   PRGLRWRDLSALAMLGGVGFTVSLLIAELSLEGAAAERAKAAVLIASALASLLAAVMLL
FT                   RRGRKVRNGDASA"
FT   regulatory      complement(372503..372546)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(372561..374543)
FT                   /transl_table=11
FT                   /gene="acsA"
FT                   /locus_tag="SACE_0337"
FT                   /product="acetyl-coenzyme A synthetase"
FT                   /function="Acyl-coenzyme A synthetases/AMP-(fatty) acid
FT                   ligases"
FT                   /EC_number="6.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0337"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99686"
FT                   /db_xref="GOA:A4F6L2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6L2"
FT                   /protein_id="CAL99686.1"
FT                   /translation="MSEPDGQSNTLDNLLTESRTFPPSGEFAAQANATSELYAQADADR
FT                   EAFWADQARHLHWDTEWEQVLDWSGAPFAKWFVGGKLNVAYNCVDRHVEAGNGDRVAIH
FT                   WEGEPGDSRAITYAELAREVSRTANALASLGVGAGDRVAIYLPMLPEAVYSMLACARLG
FT                   ALHSVVFGGFSSEALRTRINDAQAKVVITADGQYRRGKAMPLKTNVDEAVAATPSVEHV
FT                   LVVQRTKTDVEWNDGRDQWWHDVVEGRPASHTPEFFDSEHPLFILYTSGTTGRPKGILH
FT                   TSGGYLTQAAYTHRTVFDLKPETDVYWCTADIGWVTGHTYIVYGPLANGATQVIYEGTP
FT                   NTPHEGRHWDIVQKYGVTLYYTAPTTIRTFMKWGAEIPARYDLSTLRVLGSVGEPINPE
FT                   AWMWYREHIGGNRAPIVDTWWQTETGAIMISPLPGVTATKPGSAQVPLPGIAAKVVDES
FT                   GEQVGHGGGGLLVLDQPWPAMLRGIWGDDDRYRETYWSKFADKGYYFAGDGAKYDDDGD
FT                   IWLLGRVDDVMNVSGHRISTTEVESALVSHPTVAEAAVVGASDPTTGQGIVAFVILRGG
FT                   ADDQASGEAAIKALRDHVAHEIGPIAKPRQIMVVPELPKTRSGKIMRRLLRDVAENREI
FT                   GDVSTLADSSVMDLISAGLGKSTED"
FT   CDS_pept        374760..375518
FT                   /transl_table=11
FT                   /locus_tag="SACE_0338"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0338"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99687"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6L3"
FT                   /protein_id="CAL99687.1"
FT                   /translation="MNAQESLLPLLELDGVAEAVTSARAAIDEVHRHPANRRGWPTTAA
FT                   EASVRAARASAAVAGGATEIPETGEVSDPLLAGALRIAEGMGPLLPTWQRAPLQALARL
FT                   HVLAAADLVEDKESLGRPRADREVSERLDLLARIVADSSGKSQGVIPGPVLAAVVHGEL
FT                   LALSPFGLADGVIARAAARLTVIGSGLDPKGLVVPEVAYFRRQGDYSAAADGFANGDPE
FT                   GVGEWLHYCCRALEAGAREAKSIADAVQDA"
FT   CDS_pept        375649..376584
FT                   /transl_table=11
FT                   /locus_tag="SACE_0339"
FT                   /product="inosine-uridine preferring nucleoside hydrolase"
FT                   /function="Inosine-uridine nucleoside N-ribohydrolase"
FT                   /EC_number="3.2.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0339"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99688"
FT                   /db_xref="GOA:A4F6L4"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6L4"
FT                   /protein_id="CAL99688.1"
FT                   /translation="MTKKLLLDCDPGIDDALAIGLAHGIPDLELVGLTTVGGNVELEHT
FT                   TDNALRLVDFYGMDVQVARGAGRPLVREPKTAADVHGATGLGGAVLPEARSALVDAHAA
FT                   DFIIDTLAAAPGEISLAAVGPLTNIALALRKEPRIAEWAAEFVIMGGSYTRGNTTPAAE
FT                   FNVHADPEAAAVVFGGAWRTVMIGLDLTHQARATAQVRSRFAGLGRLEAELLTPCLDFY
FT                   GEHDGSHGRGPAIHDACAVAYVANPALVRTAPARVDVEVHGTFTAGMTVTDFGGAPNAD
FT                   VATELDVPAFWDLFDDAYRRVAEQLLHPAG"
FT   CDS_pept        complement(376592..377053)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0340"
FT                   /product="possible lyase"
FT                   /function="Lactoylglutathione lyase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0340"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99689"
FT                   /db_xref="GOA:A4F6L5"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6L5"
FT                   /protein_id="CAL99689.1"
FT                   /translation="MITGLSIATVWVLDQESAKRFYTEKLGFELRTDSAMGDFRWVTVG
FT                   AEDQPGLEITLMEAAAPSLDPESAEQVRSLLAKGVLGAGVLSTDDCHATYRELSARGVE
FT                   FVQEPTNRPYGIEALLRDDSGNWFSLTQRHEEMDPTAEWDPCVEGGSRN"
FT   CDS_pept        complement(377090..377539)
FT                   /transl_table=11
FT                   /gene="ptlR"
FT                   /locus_tag="SACE_0341"
FT                   /product="AraC-family transcriptional regulator"
FT                   /function="AraC-type DNA-binding domain-containing
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0341"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99690"
FT                   /db_xref="GOA:A4F6L6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6L6"
FT                   /protein_id="CAL99690.1"
FT                   /translation="MTRTAPDLDHLRSLRQAKDLMDRDWARPLDVDAVAARAGYSRNHF
FT                   VRSFRAAYGQTPGRYLSGRRIERAQDLLRNANLTVTEICFLVGFSSLGSFCTRFKEQVG
FT                   ITPAEFRRASPPAAVPGCFALMHAGGFNPRRKPVISEKPGTGARA"
FT   CDS_pept        complement(377628..378974)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0342"
FT                   /product="mandelate racemase/muconate lactonizing enzyme"
FT                   /function="L-alanine-DL-glutamate epimerase"
FT                   /EC_number="4.2.1.40"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0342"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99691"
FT                   /db_xref="GOA:A4F6L7"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR017653"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR034598"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6L7"
FT                   /protein_id="CAL99691.1"
FT                   /translation="MNTTTTQQSPVVTGMRVVPVAGRDSMLLNLSGAHAPHFTRNLLIL
FT                   TDSAGNTGVGEVPGGEGIRATLTDATDLVVGAPIARYHSVLTHVHRRFADRDSGGRGAQ
FT                   TFDLRVAVHAVTAVEAAMLDLLGKHLGVPVAELLGDGQQRESVPVLGYLFFVGDRNRTD
FT                   LGYRSGAEESDDWLRLRDEEALTSDAVVRLAEAAQARYGFHDFKLKGGVLPGREEAEVV
FT                   TALAERFPEARITLDPNGGWLLSDAIELGRDLYGVLAYAEDPCGPEGGYSGRETMAEFR
FT                   RATGLPTATNMIATDWRQLGHAVRTDAVDIPLADPHFWTMGGSVRVAQLCDAWGLTWGS
FT                   HSNNHFDVSLAMFTHVAAAAPGDITAIDTHWIWQDGQRLTREPFRISDGRIEVPTAPGL
FT                   GVELDMEQVEAAHALYLTEGLGTRDDAVAMRYLVPGWTFDSKRPALDRP"
FT   CDS_pept        complement(378997..380574)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0343"
FT                   /product="aldehyde dehydrogenase (NAD+)"
FT                   /function="NAD-dependent aldehyde dehydrogenases"
FT                   /EC_number="1.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0343"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99692"
FT                   /db_xref="GOA:A4F6L8"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6L8"
FT                   /protein_id="CAL99692.1"
FT                   /translation="MPTGNMIIAGTPVFGGGKRVRAVDPSTGAELEPEFGHGGAAEVEQ
FT                   ACAAAHEAFAVYRETGGEQRARLLEAIADGIEAIGPALVDRAHAETGLPTARLTGERAR
FT                   TTGQLRLFAEVAREGSWAGARIDPALPDRTPLPRADIRQRKVALGPVAVFGSSNFPLAF
FT                   SVAGGDTASALAAGCPVVVKAHDAHPGTSEMVGRAVAQAVAACGLPAGTFSLLFGSGPG
FT                   LGTALVTDPRIQAVGFTGSRSGGLALAAAAAARPRPIPVHAEMSSVNPVFLLPGALAER
FT                   AGQLGAEFAGSLTLGSGQFCTNPGLVIAVDGPGLDAFLESAAEAVARTEPTTMLTPGIA
FT                   SAYDEGVSALAAQEPVSVLARGRESAQPNGCRAALLSTSAKSFLDSDALQQEVFGSCSL
FT                   VVRCADVAQVLAVAEALEGQLTATVHATEQDHEQVADLLPVLEQRAGRILFNGWPTGVE
FT                   VGHAMVHGGPFPSTSDSRTTSVGTLAIERFLRPVAYQDVPPALLPRAVADGNPDGIWRR
FT                   VDGELGKH"
FT   CDS_pept        complement(380576..381505)
FT                   /transl_table=11
FT                   /gene="dapA"
FT                   /locus_tag="SACE_0344"
FT                   /product="5-dehydro-4-deoxyglucarate dehydratase"
FT                   /function="Dihydrodipicolinate synthase/N-acetylneuraminate
FT                   lyase"
FT                   /EC_number="4.2.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0344"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99693"
FT                   /db_xref="GOA:A4F6L9"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017655"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4F6L9"
FT                   /protein_id="CAL99693.1"
FT                   /translation="MSSYPPHEVAQRLASGLLSFPVTHFRADLTFDEPAYREHIGWLGQ
FT                   FGAAGLFAAGGTGEFFSLTPAEVETVVSAAVREVPDGLPVIAPAGYGTAMAVELARAAE
FT                   RAGAHGILLLPPYLTEADQEGLAAHVRAVCAATGLGVILYSRANAVYTETTVARLAEDC
FT                   PNLVGFKDGVGDIERMTRLYARLGDRLTYVGGLPTAETFALPYLELGVTTYSSAMFNFV
FT                   PRFALDFYDAVRRRDHAEVRRRLNDFVLPYCDIRNRRAGYAVSIVKAGMKVIGRPAGPV
FT                   RSPLTDLDDAELAMLADLVKSMPATGEA"
FT   CDS_pept        complement(381505..382869)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0345"
FT                   /product="anion/cation symporter, MFS superfamily"
FT                   /function="77 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0345"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99694"
FT                   /db_xref="GOA:A4F6M0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6M0"
FT                   /protein_id="CAL99694.1"
FT                   /translation="MTFTPARPDALSSAIGKIFRRVVPLFVVMLVCNQLNRSNIGYAET
FT                   YLEADVGIGATAYGFGAGLFFIAYALFELPSNVMMEKFGARVWLTRIMVSWGLVSAAMA
FT                   FVNSPEMFYVLRFLLGAAEAGFFPAVIFYFTRWLPDSHRGRATALFVAGSSIAAAISGP
FT                   LSGPLLSMHGFLGVRGWQWLFGLEGALSVVVGVVAYFFLDSKIRDAKWLTEDEKTALIS
FT                   RIDEEDAAKTAETRGGSRWRLLLDGKLLLFCWIYFAIQLSIYANTFWLPSIVRRIEGTN
FT                   DITVGLLSSLPWICAVVAMYVSGRAGDRAGDRRPLLVAALITAAVGTWLAAVVSPWPAL
FT                   AFLCVAAMGFKSASPLFWSIPQRSLSPVVVAPAIAVINSLGNLGGFVAPFGFGFVKEQT
FT                   GEVTYGLYALALASLLAAASVLLIRQRRAGTPVAGETAGQRDEPRASAMNEENHR"
FT   CDS_pept        383024..383899
FT                   /transl_table=11
FT                   /locus_tag="SACE_0346"
FT                   /product="probable transcriptional regulator, LysR family"
FT                   /function="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0346"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99695"
FT                   /db_xref="GOA:A4F6M1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6M1"
FT                   /protein_id="CAL99695.1"
FT                   /translation="MFTLNQLAGFVAVAEELHFGRAAQRLRMTQPPLSRQIQQLEKELK
FT                   VRLFDRAGRAVRLTPAGRAFLADARRLLHEAENATLSVRRTNSGQAGIVRIGFTATSAY
FT                   GVLGGLLGTARDRLPHVDVVLRELVTRDQVEQLSSGALDLGLARPTAAGPGIQSRRIRS
FT                   EPLLAAVPQEHPLARGEGPLELARLDGADVVTYSPTDATYFYDLLISVFRAAGVRPHYV
FT                   QHVSQVHTVLALVQVGLGIALVPSTAARLRVEGVEFREVDLPDPEPVELHLMWRRANDN
FT                   PALHALLDLL"
FT   CDS_pept        383981..384466
FT                   /transl_table=11
FT                   /locus_tag="SACE_0347"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0347"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99696"
FT                   /db_xref="GOA:A4F6M2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6M2"
FT                   /protein_id="CAL99696.1"
FT                   /translation="MTELPRDEAPVVVDDARHDDAGQLTALVRASAAYAGEYQAMVVGD
FT                   TITTDYLDANLVRVARGGDGAARGFYAMLTPGRGEPGEGELDYLFVGDDQQGRGLGRLL
FT                   FEDMRAQAVRRGLRAVHIVSHPPAEEFYRARGARRVGEVPPRGSITWSRPHLLLTLA"
FT   CDS_pept        384525..385433
FT                   /transl_table=11
FT                   /locus_tag="SACE_0348"
FT                   /product="probable transcriptional regulator, LysR family"
FT                   /function="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0348"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99697"
FT                   /db_xref="GOA:A4F6M3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6M3"
FT                   /protein_id="CAL99697.1"
FT                   /translation="MVDPRYIRMFHEVVATGSYSAAARSLGYSQPAVSRQMRALERCVG
FT                   TPLFVRVGRAMRLTEAGEVLARHAESVTADLAAAQNQISAIADLRAGTIRICAFPSASA
FT                   TIVPAATASATRAHPGLRIRLVEDEPPGSLETLRRGECDIALAFTYPGFGERPCDDVIG
FT                   IEVLEDPVVAVLPTGHRLSRRRSLDLAELRGERWIAGCPRCRDHFVRACAAAGFEPDIA
FT                   FTTDDNLAVQSLVAAGTGIALMPRLVLSFLKHPRIVGRRVRRVHHRSISAYVLRDHRRI
FT                   PATALMLETFRRVGEQMRREP"
FT   CDS_pept        385521..386045
FT                   /transl_table=11
FT                   /locus_tag="SACE_0349"
FT                   /product="cysteine dioxygenase type I"
FT                   /function="predicted metal-dependent enzyme of the
FT                   double-stranded beta helix superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0349"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99698"
FT                   /db_xref="GOA:A4F6M4"
FT                   /db_xref="InterPro:IPR010300"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6M4"
FT                   /protein_id="CAL99698.1"
FT                   /translation="MTPQQIHLVQAIRDVVRREERAERTAELVAEALRPFLAVPDLLRE
FT                   DQRTGDPGSYTQHVLHVEPDGSFSVVALVWLPGQRTPVHDHVAWCVTGVYEGVEHEQRF
FT                   TVHDGSSLVPTQQVTNPAGDVCGFAPPGDIHLVRNACTTKAISLHVYGADIGTLGTSVR
FT                   RTYDLPVRAAV"
FT   CDS_pept        complement(386052..386840)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0350"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99699"
FT                   /db_xref="InterPro:IPR025734"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6M5"
FT                   /protein_id="CAL99699.1"
FT                   /translation="MSERWRLPPLWFELCWEVGGFGDRPIPVGGSTDEWTPQERVVLRQ
FT                   RALAGMRAAGLLSGDVLAPALAQALAQIARPCLWIDGAWLPVAGSPPARLLSVVAGSGT
FT                   VLLVSGGADAQDVDISVHPRTSISAAAARGIPQAPPGLRAFVSVPASAFEPWEEDSESV
FT                   GGGPGDAGGGGPGSEPTLREMIDAPHFREGRFTANLRARSGRTHRSQPLNWFDAFQPDG
FT                   RYRLRHGLGRRNELGLTPLSPADITHALDRRIAAVVRAGG"
FT   regulatory      386112..386147
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(387070..387915)
FT                   /transl_table=11
FT                   /gene="estC"
FT                   /locus_tag="SACE_0351"
FT                   /product="esterase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0351"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99700"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6M6"
FT                   /protein_id="CAL99700.1"
FT                   /translation="MSHTFVLVHGSNCNSFTWAPMQRELALLGHRSLAVDLPGHGFAAG
FT                   WHPSYQAPQDPAALASAPSGQAGRTVAECVEHVVEVVRRAAAHGPVTLVGHSRGGLTLT
FT                   GVGNAVPELVDRLVYVSAWCCVDSTVAEYVASPENADSVLGEAAGVMVGDIAALGAIRM
FT                   NWRTADAGLLATLKTAMLADGTDEEFLAFLNTLEPDESLDAGGIGVQADAATWGRVPRS
FT                   YVRLTRDRSLPVALQDRFIAEADALTPGNPFDVHSVEGSHVGFLVHPQEVAGILAELAA
FT                   "
FT   CDS_pept        complement(387958..388875)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0352"
FT                   /product="putative phophosugar-binding protein"
FT                   /function="predicted sugar phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0352"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99701"
FT                   /db_xref="GOA:A4F6M7"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005486"
FT                   /db_xref="InterPro:IPR005488"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR040190"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6M7"
FT                   /protein_id="CAL99701.1"
FT                   /translation="MRDTERAVRVESPTERSNPRTKDIDLLPTLDILHLLNSEDRTVPA
FT                   AVGRALPELARAVDMAVSALRGGGRVHYVGAGTSGRLAVLDAAELIPTFNVPPNWFVAH
FT                   QAGGAGAFQRAVENAEDNADAGAATIEAEATGADFVLGLAASGRTPFVMGALDAARRMG
FT                   AGTGLVSANPESAASSPAEVVIAVDTGPEPITGSTRMKAGTAQKLVLTSFSTSVMIRLG
FT                   RTYSNLMVSMLATNAKLRGRTISILREATNAPEADCEAALTAADGDLKTALVHLLTGVD
FT                   VERASAALAVSDGHVREAMRSLNA"
FT   CDS_pept        complement(388872..389798)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0353"
FT                   /product="RpiR-family transcriptional regulator"
FT                   /function="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0353"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99702"
FT                   /db_xref="GOA:A4F6M8"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6M8"
FT                   /protein_id="CAL99702.1"
FT                   /translation="MVTDDTLPESGEASPLIRIRSLLPGLARAEQRVANIVLADPASVA
FT                   RRSITEVAEAAGTSETTVTRFCKAIGVGGYPDLRIALAADTARTSSRDRDLGSDIGPED
FT                   DVRKIIEKVSYADAKAVEETADQLDAETLRSLVDAVARARRIDVYGVGASAFVALDLQQ
FT                   KLHRIGLTCFAWSDTHNALTSAAVLREGDVAIGISHTGATTETVEALQEAGKRGATTAA
FT                   LTNFARSPITEVADHVLTTAVRETTYRSGAMASRIGQLTVIDCLFIGVAQRHLDQTKAA
FT                   LEATYEAVGAHRLGARPDRRRQKEDGR"
FT   CDS_pept        389982..391610
FT                   /transl_table=11
FT                   /locus_tag="SACE_0354"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0354"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99703"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6M9"
FT                   /protein_id="CAL99703.1"
FT                   /translation="MPPELFCAAGWSPKRVLEHEEFLLQQHEAGALRLHDRGELGGAGP
FT                   PLRRWRMSWPRDGATVHAVLATIDIPGHDDAAKVWFGAHCELGWGWDAPSPLIRPGLGQ
FT                   QVLVDPANALAATGSSMFSGEDALEQPLAVIRDRATRMPVLFRHGREAGAHRARTFRGA
FT                   TLGAVGMVGLDDDAARRLAAELPAERRIPERGARLVLPSWWEPHQPDICVPADEIDDDA
FT                   AWRALADAALRAARWRPDGPMPVDDEWWRALFEGAWNDERVAAPSGSGGARWYAVRDGA
FT                   DKAQLRQRIQGVGDSVAELRSARTRRESALAELESDIERHREELRALTRSRTALARGVL
FT                   RLRAERDAARAELDGTSLGAALRRTKAAQRLVRARSAELHRREEMLADLHRPADGADAS
FT                   AEALGDHAESSGHDTGDVVRGDLDEQPARRVAAAPPVATVVLAPGVEDEVERLDDARRR
FT                   RCRRVLHLLGSAGGDVARHLRDAGVSPLRLGTTADPGAALTFRTADGDWRPFAHHVLLD
FT                   HSGHHVLHYRRDGDVVHVGYVGPAL"
FT   CDS_pept        391607..393388
FT                   /transl_table=11
FT                   /locus_tag="SACE_0355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0355"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99704"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6N0"
FT                   /protein_id="CAL99704.1"
FT                   /translation="MTPEPLPPTSFCAAGHASASLLEHERTLVALHESGALRLIDGGRE
FT                   GSGRRWRMSWGHGSSAVRAMVGVRESATDDGEVTFWVHAEARRPWSIRDQRNPVERMGL
FT                   LDHGLKDPSSAYSLTQQNPLFGLREVGFLEHTFSRDMRDSPVLVYHDEPGARPSQEMRR
FT                   FRNATRGMCGLLPVDDAVRERVNDLVPADRRIPHRAVRLYVPPWWAGHEEDITVEVSRL
FT                   DRPGVWRRIVDTVIRVSSWRGGGKIRATAREWSALLDDPMNDVRIVPATRGGDVRWLPA
FT                   PDDSGKRILRRRLDAVTEQARTARDEADSAAESVARRRATLDALTAQVALARRSRRRLA
FT                   ELTLRLRQERDSAEAALRTGSVAAAWREAREAELEAELYAEELDRVDDEVVAQRSRARA
FT                   AAGGGAARGAEPAEPDGGGARAARSAPSFTGFGELLAAAERELAGLRLGPQTAVAVELD
FT                   GHLRSALWRRRTWDVLELLSAYALRRRAADGGEPCLRGFSYYVREFGGTRGISPSLVAS
FT                   GESEMVANTPRFRNARTFAVPPEVHRSGWEFFGAHVKIDRGGGVAPRLHYFDDTRGPTG
FT                   EVHIGYLGPHLPSPESN"
FT   regulatory      complement(393160..393208)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(393264..393836)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0356"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0356"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99705"
FT                   /db_xref="GOA:A4F6N1"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6N1"
FT                   /protein_id="CAL99705.1"
FT                   /translation="MTTDHDNRTAPFRADDPAQHAAAYVAAFNSGDREALDQVYEDAAV
FT                   LVPVPGHPVTGAERAAAAEHLLGLGLPIQAAPRHVYVAGDIALLIVDWSIRGTAPDGTE
FT                   VDMAGTATDVARRGADGRWRYVIDNPHGTAWRTFARSAIPEPEGSFSCSPGWGGGGRGS
FT                   RCGPRRSGRGCRRSSAAAGRPHRPGRS"
FT   regulatory      393428..393462
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(393881..394384)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0357"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99706"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6N2"
FT                   /protein_id="CAL99706.1"
FT                   /translation="MDPAPFRTDVSLHRNGTGRPTLRFERHYRHPKEQVWRALTEEAEL
FT                   AAWFPCAARIDATPGGTATFTFPGAPPQSGEVLAAEPPRSLDFTWHGETLRWRLADAPG
FT                   GCLLRLDIENQDPAHAAQSAAGYDLCLDQLATLLDAGSVRRVEMPPPREIVQHYADAFS
FT                   VPDA"
FT   regulatory      complement(394418..394477)
FT                   /regulatory_class="promoter"
FT   CDS_pept        394422..394964
FT                   /transl_table=11
FT                   /locus_tag="SACE_0358"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0358"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99707"
FT                   /db_xref="GOA:A4F6N3"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6N3"
FT                   /protein_id="CAL99707.1"
FT                   /translation="MLLTSMPEETAMAVEEPAARLDTRYSVEGAAPTSWARARQVLEDA
FT                   EVYWLSTVRPDGRPHVTPLLAVWLDAALHFCTGPEERKARNLERNAHCVLTTGRNSLWE
FT                   GLDVVVEGDAVRVVDDARLRRLADAYESKYGAEWHFDGRDGAFRHPTGGEVLVFEVAPT
FT                   TAFGFRKGEYSQTRWTF"
FT   CDS_pept        complement(395016..395408)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0359"
FT                   /product="pyridoxamine 5'-phosphate
FT                   oxidase-related,FMN-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0359"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99708"
FT                   /db_xref="GOA:A4F6N4"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019920"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6N4"
FT                   /protein_id="CAL99708.1"
FT                   /translation="MAVIPQDREDILNKRAFAHVATIGPRGEPQSSPVWIGWDGTHIKF
FT                   SQTKTRQKYRNLQRDARISMSLHDPDQPYRYLEVRGEVVRVEDDQDDAFINSMAKKYLG
FT                   EDTYPWARPGEERIVLYVEPRHCTKQ"
FT   CDS_pept        complement(395736..396272)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0360"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99709"
FT                   /db_xref="InterPro:IPR007061"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6N5"
FT                   /protein_id="CAL99709.1"
FT                   /translation="MPTLVRAVADDRDGLIAFLEEQRASLRRAVHGLDDEQAAARPVPS
FT                   SELCLGGLVKHVANAERNWVDVVAGRPSPARDWSSEFGMAPEETLADLLTRYRKISDET
FT                   AAVFAGISDLDRPLDIGPLSALIPSGTERTPRWVLSHLIQETARHAGHADILREALDGS
FT                   TAADLLQATGTPLFG"
FT   CDS_pept        complement(396330..398039)
FT                   /transl_table=11
FT                   /gene="blaA1"
FT                   /locus_tag="SACE_0361"
FT                   /product="beta-lactamase"
FT                   /function="Beta-lactamase class C and other penicillin
FT                   binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0361"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99710"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6N6"
FT                   /protein_id="CAL99710.1"
FT                   /translation="MSVAALTAGSASASPVGGGRFDRPWEGFAPASTELRDGDPSDAGL
FT                   RSKPIDQAVGQIEAWTETVPGREHPMYAGAVGLVVHNGVVVSRSEAGYEVRYADGQGTE
FT                   LPADQWEPVDRDTIFDVASISKLFTSIAVLQQVEAGAVDLDSPVARYLPEFGANGKQTI
FT                   TVRQLLTHTSGLPAEVKLWTLPPQDRIPTVMALQPKSPPGTAYTYSDPNMITLGVLVER
FT                   VTGDRLDEVVAEGITEPLGMRDTGYNPDRGELRRIAATEFQADPPRGMVRGQAHDENAW
FT                   SLGGVAGQAGVFSTADDLAILGQTLLNGGAYAGERILGEHSVEQMLTNFNSAFPGNSHG
FT                   LGFELDQRWYMAGLSGPHTAGHTGYTGTSLVIDPASRSIVVLLTNRVHPSRSWGSNNPA
FT                   RQALAQGLAEAMSVRPVRGSKSWFAPPQGPATLTTDSLGSVTGAAQVTFDAFVDTQMDG
FT                   DGVDALAVEASGDEGATWQPVPLTATGPGAPEGPQQSLAGAGHRSWWRVQGSVPESSKP
FT                   LRLRWRYAPDDQYVGRGVNIDGISVADRAGVLLDGERDDERLTPEGWFQTPR"
FT   CDS_pept        complement(398078..399316)
FT                   /transl_table=11
FT                   /gene="ybbC, yzbB"
FT                   /locus_tag="SACE_0362"
FT                   /product="unknown"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0362"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99711"
FT                   /db_xref="InterPro:IPR008302"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6N7"
FT                   /protein_id="CAL99711.1"
FT                   /translation="MDRRSFLTTSALSASMLGLTTGAACAAPPTPAPNRSGVLTGADVL
FT                   AAENWRPITGRRIGVVTNPTGVLGSMQHVVDAMHAGGDVDVVAVFGPEHGFRGTSQAGG
FT                   SEGDYADPRTGLPVYDAYGADADKLAGMFRKAGVEQVVFDIADVGVRFYTYIWSMYIAM
FT                   QAAAKVGASFLVLDRPNPIGGTQVAGPQLDPRFASGVGLLPIVLQHGMTVGELARMFAR
FT                   EHLPGTPEPEVVKVQRWHGRSPGTGLPWIPPSPNMPTPDTAMVYPGTGLFEGTTWSEGR
FT                   GTTRPFEIIGAPGVDWRWADELNAAGIPGVRFRETYFVPTFSKHTGVTCGGVQIYRDGE
FT                   IDSILVAVTMIVTARKLYPFAWREDGMIDKLFGSDRLRTMVDAGADVREIVGSWQDELA
FT                   EFRRRREAYLLYS"
FT   CDS_pept        complement(399346..401079)
FT                   /transl_table=11
FT                   /gene="nagA"
FT                   /locus_tag="SACE_0363"
FT                   /product="beta-N-acetylglucosaminidase (putative secreted
FT                   protein)"
FT                   /function="Beta-glucosidase-related glycosidases"
FT                   /EC_number="3.2.1.52"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0363"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99712"
FT                   /db_xref="GOA:A4F6N8"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6N8"
FT                   /protein_id="CAL99712.1"
FT                   /translation="MAVVSASLTAIGNAAPAGDAHSWATRTMRGMTLEEKVGQLFVTYA
FT                   YGRTADTPHQANRDEFGVATPAEVVQKYHLGGIIHFNWTDSIYEPKQIAELSNGLQRAA
FT                   VTSGAKIPLLISTDQEQGQITRIKEPATQLPGNMALGAGRSPADAERAAVITGQELRAM
FT                   GLAQNFAPSGDVNVNPANPVIGVRSFSSDPALAAELTAAQVRGYQGYGAVTASVKHFPG
FT                   HGDTNQDSHEELPVIEHDRQQWEALDAPPFRAAIDAGTDTVMSAHIVVPKLDDSGEPST
FT                   LSRNVLTGMLREELGFRGVVVTDSLQMEGVRHKHPDAEIPVLALEAGADQLLMPQHLQV
FT                   AIDGVIGAVRSGRLTEKRIDQSVERILRMKAGRGVIDRPFVDVSKVDRIVGSPRNLEAA
FT                   QKITDRTTTLLRNDAAVLPLRQPPGRVLVTGAGASPTKALAGSITARGSQATALETGMK
FT                   PTPQQIDQAVQAAGQNDLTVVLTNAAWNEANASQRDLVRALQRSGKPVVAVAVRDPYDA
FT                   AHVDEVPTWLTTYSDKAVAMESLARTLFGEIAPVGKLPVPVPDPTRPGTDRYPFGHGLS
FT                   W"
FT   CDS_pept        complement(402437..403276)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0365"
FT                   /product="HAD-superfamily subfamily IB, PSPase-like
FT                   protein"
FT                   /function="Phosphoserine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0365"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99713"
FT                   /db_xref="GOA:A4F6N9"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6N9"
FT                   /protein_id="CAL99713.1"
FT                   /translation="MLGGVTEPANHPVAPQPRVAAFFDLDKTVIAKSSTLAFSRPFFQE
FT                   GLINRRAVLKSAYAQFVFMLAGADADQMDRMRAHITSLCTGWDVEQVNAIVEETLHDIV
FT                   DPLVYKEATQLIAEHKEQGHDIVVLSASGQEVVAPIAKLLGATHSSGTRMVVSDGRYTG
FT                   EVDFYCSAENKAAAARELAEEYGYDLSQCHAYSDSVTDLPLLESVGHPTVVNPDRGLRK
FT                   EAVQRGWPTLAFDHPVSLRARIPTPSRAAVTAAGVGMGAVAAAGAAWWGVRYWRRHR"
FT   CDS_pept        403784..404944
FT                   /transl_table=11
FT                   /gene="minD2"
FT                   /locus_tag="SACE_0366"
FT                   /product="septum site determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0366"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99714"
FT                   /db_xref="InterPro:IPR022521"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6P0"
FT                   /protein_id="CAL99714.1"
FT                   /translation="MSAATSLPSSTPPTAPAGPRPLLITCDAELAEDVLRLAAAAGCDL
FT                   DRAPDPLSVGDRWRTAPLVLLDGPAAEAGVANGLPRRPRVLVLARAPGGDLYRAAFHIG
FT                   AEQEVILPAHEGHLIELLAEAVDRSAPRSGRVLAVIGGSGGAGASVLATGVAVTAARRG
FT                   QRSLLLDCDPLGGGLDLAVGAESTDGVRWSGLSVSGGRVAAGALHDALPQRRVGSGSLA
FT                   VLACDRDGPSSGLTPQAVGAVVDAGRRAGQTVVCDLPRHLSEAALAGLRKADLTLVVVA
FT                   AEVRACAAAARLVAEIRDRTAGRLRLVVRGPASSGLRVSDVGRAVGVEVLTAVRPQTGL
FT                   STALDRGGFCATRAGLRRTVERAASEVLRALGRTGTAPEHALVGAA"
FT   CDS_pept        404965..406098
FT                   /transl_table=11
FT                   /locus_tag="SACE_0367"
FT                   /product="type II secretion system protein E"
FT                   /function="Flp pilus assembly protein, ATPase CpaF"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0367"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99715"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR022399"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6P1"
FT                   /protein_id="CAL99715.1"
FT                   /translation="MRNRLAGSGVPLTSSAVATAVRAEAGGLVGDADVLDRLRQVQREF
FT                   LGAGALEPLLRDPAVTDVLVTAPDAVWVDQGDGLRRCTETFADEDAVRRLAQRLALASG
FT                   RRLDDAQPWVDAWLPRATGAVRLHAVLPPVADSTCISLRVLRPAVHGLDSLHGKDMFDA
FT                   PTAELLRSIIATRLAFLVVGGAGAGKTTLLAAMLGEVSPAERIICVEEASELQPDHPHV
FT                   VRLLTRPPNIEGAGEIQVRDLVRQALRMRPDRLVVGEVRGGEICELLAALNTGHEGGGG
FT                   TLHANSPREVPARMEALAALGGLSRAALHSQLAAAVQVVLHVQRTRQGRRLAAVGVPFR
FT                   VGDHIEVRPAWEQHSGWGPGAEALAAMLSARGGALPC"
FT   CDS_pept        406092..406895
FT                   /transl_table=11
FT                   /locus_tag="SACE_0368"
FT                   /product="type II secretion system protein"
FT                   /function="Flp pilus assembly protein TadB"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0368"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99716"
FT                   /db_xref="GOA:A4F6P2"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6P2"
FT                   /protein_id="CAL99716.1"
FT                   /translation="MLTFLLLALSLLCWPDLRAQRRLGALTSTTSWSSGAMVVRVARIG
FT                   WIPVAAALGALLAGVGGLFAAVALAVLGRRYVRSRRSFRVGVERSAELSGGIRLLVAGL
FT                   RAGAHPAVAAEGAAADSAPAISGVFRDLASAAKLGGDIPTVLDNGGHPAELRQPLARLG
FT                   RAWRLAERHGVALADLLDAVRRDVDHRVAFIRDLESKMAGPRATAAMLAGLPLLGLLLG
FT                   EAVGAAPLAVLTGQAFGQAVLVVGVALLCAGLFWTLRLTEGAISP"
FT   CDS_pept        407768..408199
FT                   /transl_table=11
FT                   /locus_tag="SACE_0369"
FT                   /product="type II secretion system protein"
FT                   /function="Flp pilus assembly protein TadC"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0369"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99717"
FT                   /db_xref="GOA:A4F6P3"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6P3"
FT                   /protein_id="CAL99717.1"
FT                   /translation="MLAAGWDLLAAGMRAGLPVPVILRAVAAEFDGAPAGVLDEVARLL
FT                   ALGADAVAAWEPALRHPDTEELARAARRTARTGTGLADVAADLAADARASVGARAQAHA
FT                   QRATVWVALPLGLCFLPAFLCLGVLPVVAGMLNRIVATW"
FT   CDS_pept        408255..408491
FT                   /transl_table=11
FT                   /locus_tag="SACE_0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0370"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99718"
FT                   /db_xref="GOA:A4F6P4"
FT                   /db_xref="InterPro:IPR025338"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6P4"
FT                   /protein_id="CAL99718.1"
FT                   /translation="MQSNLIVRSQVSTRTSRSRLLLRRLRFLLRGDDGMSTAEYAIGTL
FT                   AAAALGAILYTAVNSDTIKGAVTALLERGFAGI"
FT   regulatory      408688..408729
FT                   /regulatory_class="terminator"
FT   CDS_pept        409366..409728
FT                   /transl_table=11
FT                   /locus_tag="SACE_0371"
FT                   /product="membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0371"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99719"
FT                   /db_xref="InterPro:IPR021202"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6P5"
FT                   /protein_id="CAL99719.1"
FT                   /translation="MTTRASLAGDRGAATVFSALLSIALVAVLALALQLASGVVTRHRA
FT                   EGAADLAALAAAAHVVQGPEFACGRADWVARGMDIAITSCRLEGANARIEARADSPVLG
FT                   SFAVITARAHAGSAGG"
FT   CDS_pept        410726..411382
FT                   /transl_table=11
FT                   /locus_tag="SACE_0372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0372"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99720"
FT                   /db_xref="InterPro:IPR015330"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6P6"
FT                   /protein_id="CAL99720.1"
FT                   /translation="MDWSADEWQDAIGGVRALQAGLLNNRIELRVEAIGFASRGWPVLP
FT                   GTYPVGTRWIGRDGGEADGPMPVHQDWEERLGTNPDQVAAWWSGRPHSLLLATGTAVNA
FT                   VEVDAALGYRAAVALRTLGFPVPIVAVPNGRWYFLTSGGDRLAPELADLTEVRLHGAGS
FT                   WVPMPPTTYPHGAAHWRVKPEVCGWTLPSLDFVQDALVQGLNQDHNVADLVAAGG"
FT   CDS_pept        complement(411499..413871)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0373"
FT                   /product="DEAD/DEAH box helicase-like"
FT                   /function="Distinct helicase family with a unique
FT                   C-terminal domain including a metal-binding cysteine
FT                   cluster"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0373"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99721"
FT                   /db_xref="GOA:A4F6P7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR022307"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6P7"
FT                   /protein_id="CAL99721.1"
FT                   /translation="MTAESKDRGRHLLDRVLAGVPSAESPLRHVKHLPERSARTAEWPS
FT                   WVPAEVVDAYAARGVREPWVHQVEGADAVRSGQHVVVATGTASGKSMVYQLPVLSRLLE
FT                   DRTATALYLSPTKALGADQLRAVEELGLGGIRAAGYDGDTPKVDRDWVRAYGRWVFTNP
FT                   DMLHLGVLPAHSRWARFFRSLRYVVVDECHTYRGVFGSHVALLLRRLRRIAHHYGADPV
FT                   FVLASATVSDPGDLGERLTGARCRAITDDGSPRGARTVALWEPPLLEEVIGENGAPVRR
FT                   SAGSETARIMTELVIEDARTLAFIRSRRGVEVAALSAQRALAEVDSSLPDRVKAYRGGY
FT                   LPEDRRALERALLAGDLRAVATTNALELGVDIAGLDAVIVAGYPGTLASFWQQAGRAGR
FT                   DGEGALVVFVARDDPLDTYLVHHPPAVLERPVEATVLDPANPYVLEPHLACAASELPLK
FT                   EECFDAFGGAPAAEAVHALTADGVLRRRPHGWYWTERERPHRSVELRGSGGSQVAVVEG
FT                   DSGRMLGTVDPDSACATVHPGAVYLHQGESFVVDELDLNTDLALVHAESPDWTTSARES
FT                   VDISVLRTVEHRQVGPDVAVCLGDVEVTSQVVGYLRTLPSGRVLDQVPLDLPARKLVTR
FT                   AVWYTISPELLCGSAPGGAGLDPARIPGALHAAEHAAIGLLPLFATCDRWDIGGVSTAM
FT                   HADTGEATVFVHDGHPGGAGFADRGFAALFPWLAATREAIASCECPAGCPSCVQSPKCG
FT                   NGNEPLDKAGAVAVLDAVSTAGRLAGSAGLHERRQRD"
FT   CDS_pept        414082..414582
FT                   /transl_table=11
FT                   /locus_tag="SACE_0374"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0374"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99722"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6P8"
FT                   /protein_id="CAL99722.1"
FT                   /translation="MTRHFAGSRGGWTGRCGSGGDARTRSRSRPRFSTPCWRPCPKRYT
FT                   ARGRRVGIGWTRGCPWRHAVRVRRIGIGWPTTAPGAPHRRGRRTDNRCASAPPVAPRRS
FT                   GPSYRRRLANDGARSAARRAAASPSIASACAAAIRHRGAMRRALGAGCPRQTLPPHPYR
FT                   EPA"
FT   regulatory      414660..414688
FT                   /regulatory_class="terminator"
FT   CDS_pept        414999..417374
FT                   /transl_table=11
FT                   /locus_tag="SACE_0375"
FT                   /product="putative inorganic proton pyrophosphatase"
FT                   /function="Inorganic pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0375"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99723"
FT                   /db_xref="GOA:A4F6P9"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6P9"
FT                   /protein_id="CAL99723.1"
FT                   /translation="MSLLTPVQQGWAQGTAPPSSSHRMDLAQHATGIELATADYAVVGA
FT                   VMVIALAALAFGYVLIREVLAAGQGTAKMQDIAKAVQEGASAYLNRQFRTLAIFAVVVF
FT                   LLLFALPAESTGEAVGRSIFFLFGAAFSAVIGYLGMWLSTRANVRVAAAAREKEAGREK
FT                   AMRVAFRTGGVVGMITVGLGLFGAALVVMVYAGGAPRVLEGFGFGAALLAMFMRVGGGI
FT                   FTKAADVGADLVGKVEQNIPEDDPRNAATIADNVGDNVGDCAGMAADLFESYAVTLVAS
FT                   LILGTAAFGLQGLLFPLIVPAIGVVTAVIGVYITKARAGESALTAINRSFFISAAISAV
FT                   LCAGAALLYLPSSFSGLTGVSDEIRATGGNPAVIALVAVIIGIVLAAVILKLTGYFTAT
FT                   EHRPVRDVGKSSLTGAATVILSGMSVGFESAVYTALVVGAAVFGAFLLSGSLAVALFAI
FT                   ALAGCGLLTTVGVIVAMDTFGPVSDNAQGIAEMSGDVEGEGAQILTELDAVGNTTKAIT
FT                   KGIAIATAVLAATALFGSYRDAINQALASAGGALAEMEFIVFAPNVLVGVAIGAAVVFF
FT                   FSGLAINAVSRAAGAVVYEVRRQFKDMPGIMDGSQRPEYGKVVDICTRDSLRELATPGL
FT                   LAVLAPVAVGFGLGVGPLAGYLAGAIATGTLMAIFLANSGGAWDNSKKLVEDGHHGGKG
FT                   SEAHAATVIGDTVGDPFKDTAGPAINPLLKVMNLVSVLIAPAVVTFGVGATDSPAIRFS
FT                   IAGVAVVVIVAAVVVSKRRSTAIADAPANDEEGKIATA"
FT   CDS_pept        417544..418128
FT                   /transl_table=11
FT                   /locus_tag="SACE_0376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0376"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99724"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Q0"
FT                   /protein_id="CAL99724.1"
FT                   /translation="MDQLSFFSAEARHPRIADLAGLLCGPGQAVGFGRGTAARLSVVVD
FT                   DAWRARSLVLACADRGVDAELGRSDEGRPLVRTAFRADLTELARHWLRGAVKSVPADFA
FT                   PDGCALRLWALTAGRLEPGGYLLGLDPHAPETHEPLVAALARSGLPARFIGARAGGPAL
FT                   RVTGKRRIARLAELVGPVPDGAIERTWPLVS"
FT   regulatory      418212..418244
FT                   /regulatory_class="terminator"
FT   CDS_pept        418496..421264
FT                   /transl_table=11
FT                   /gene="topA"
FT                   /locus_tag="SACE_0377"
FT                   /product="DNA topoisomerase I"
FT                   /function="Topoisomerase IA"
FT                   /EC_number="5.99.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0377"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99725"
FT                   /db_xref="GOA:A4F6Q1"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Q1"
FT                   /protein_id="CAL99725.1"
FT                   /translation="MVIVESPAKARKIASYLGSNFVVESSRGHIRDLPSGAADVPAKYK
FT                   GQPWARLGVDVDNDFEPLYLVTPDKKATVTELKDALKEVDELYLATDGDREGEAIAWHL
FT                   METLKPKVPVRRMVFHEITESAIQSAAANPRELDRDLVDAQETRRILDRLYGYEVSPVL
FT                   WKKVMPKLSAGRVQSVATRIVVERERERIKFVPAEYWDISATMDAGPDAEPRRFGARLV
FT                   SVDGAKLATGRDFGPDGRLKNDDVRLLNEAEARRLATGLTDARLSVSSVEEKPYTRKPY
FT                   APFMTSTLQQEASRKLRFSADRTMRTAQRLYENGYITYMRTDSTTLSETAITAARNQAR
FT                   DLYGDEYLSPQPRQYNRKVKNAQEAHEAIRPAGESFRTPGQVAAELDTDGYKLYELIWQ
FT                   RTIASQMADAKGTTLSVRITGTSADGEECTFAASGRTITFAGFLKAYVEAVDSEAGGVA
FT                   DDAESRLPRLAQYQAVTAPELSPDGHSTNPPPRYTEASLVKALEELGIGRPSTYASIIS
FT                   TVQDRGYVWKKGSALVPSWVAFAVVGLMEKHFGRLVDYDFTAALEDELDRIAEGRQQRT
FT                   KWLSGFYFGGEVGPDDSIGRAGGLKKLVGSSVEEIDAREVNSIPMFTDDDGRTVYVRVG
FT                   RYGPYLERPLSDSESQRANLPDDLPPDELDIQIAEKLFATPMEGRSLGTDPETGHEVLA
FT                   KEGRFGPYVTEVLPEGSKGKPRTGSLLKSMSLDTVTIDDALKLLALPRVVGTDPESGTE
FT                   ITAQNGRFGPYLKRGSDSRSLDTEEQIFTVTLEEALKLYAQPKQRGRRAAAAPLRELGD
FT                   DPDSGKPLVIKDGRFGPYVTDGETNASLRKGDSVEELTIDRAVELIAERRAKAPAKKKT
FT                   ASKSKSTASKSTSSKTTASKSSSSKSSSSNGSKTTKSGTTRKRTTSSSKQS"
FT   CDS_pept        421334..421684
FT                   /transl_table=11
FT                   /locus_tag="SACE_0378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0378"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99726"
FT                   /db_xref="GOA:A4F6Q2"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Q2"
FT                   /protein_id="CAL99726.1"
FT                   /translation="MRDALSGPDGTQPLAPPPTYPDVLGGGEIVRSHIRPAQPVAPPRL
FT                   TEHERAAAVRPRRAARHPAKQTEVRVEPASDQRAGGVAGKVVGCLTMLVVLGGIALGVV
FT                   HRLLVEYGILGP"
FT   CDS_pept        421727..422938
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="SACE_0379"
FT                   /product="DNA polymerase III, delta' subunit"
FT                   /function="ATPase involved in DNA replication"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0379"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99727"
FT                   /db_xref="GOA:A4F6Q3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Q3"
FT                   /protein_id="CAL99727.1"
FT                   /translation="MDVTPELTTGVWADVVGQPEAVRTLRAAVRAADLLARGEPAPAGA
FT                   MTHAWLFTGPPGSGRSVAARSFAAALQCTSGEGCGHCSACRTVQAGTHADVRVVVPEGL
FT                   SISVSEMRSLVQASARRPTTGQWRVVLIEDSDRLTEGASNALLKAVEEPPDRTVFLLCA
FT                   PSDHPEDVSVTIRSRCRVVQLKTPRPDAIAEVLAERDGIEPRMAQWAASVSGGHIGRAR
FT                   RLATDGEARERREAVLSVPLGLRRFSDVFTAAGGLVKASETDAVAANEDRNEAEKEELR
FT                   TAMGAGGTGKGTAAATRGANAAIRELEKRQKSRATRSQRDALDLALVDLAGFYRDVLVV
FT                   RSGSTAALNHPDFARSVSKAAAEWTSESTLRRLEAVLACRLALTQNVKPIIAVEAMAAA
FT                   LHRG"
FT   regulatory      422944..422991
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(423057..423815)
FT                   /transl_table=11
FT                   /gene="kduD"
FT                   /locus_tag="SACE_0380"
FT                   /product="2-deoxy-D-gluconate 3-dehydrogenase"
FT                   /function="8 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /EC_number="1.1.1.125"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0380"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99728"
FT                   /db_xref="GOA:A4F6Q4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Q4"
FT                   /protein_id="CAL99728.1"
FT                   /translation="MSTELFRLDGRTAMVTGARTGIGRAIAVGLAAAGADLVLVGHRDD
FT                   LGEVAEEAGSHGAAVEQVAVDLLQPRTAAEALHPVFAARDIDVLVNNAGIVHRGPVAEL
FT                   GLDDWQRVLDIDLNSVFALSGLAGRQMLARGSGKIINIASLLSFQGGVLVPAYAAAKHA
FT                   VAGLTKSMANEWAPHGVQVNAIAPGYIATGFTAALREDAERDEEITRRIPAGRWGRPDD
FT                   LVGAAVFLASAASDYVNGHVLVVDGGWLAR"
FT   CDS_pept        complement(423996..425381)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0381"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0381"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99729"
FT                   /db_xref="GOA:A4F6Q5"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Q5"
FT                   /protein_id="CAL99729.1"
FT                   /translation="MRRLAVCTTASLAVAGLSLPAALAPEALLSDALAQESTLPTTPRP
FT                   SPHDPTQPPESVPVPQPGPIVADAGTGIGMIRILPKTVPTGTILDNPAFEESLPKQALA
FT                   ELGMGLASAQANSGAYLAHERAVADAQPFGFAVQGKAPRSPLSLSQTAVPDHAEPTVNE
FT                   LQPPASPLDGLVKLGVLEGSAHARWDKVLGPCVEPIADARTSLAGVSAGNALPSFPAEL
FT                   TGLTGAAGGASLLNVPNAMQAHSNVRLVDVPGQRGKAVRATSRMSVASVRLFAGTDREL
FT                   RIDVISEPTLTATSTGDPMTSTVEYQAPVLRISQGGEEIGTIDAAKPRMDLPFDPRKLD
FT                   LGVVRLSIGELRQDVVGSEVRAGARMFDLHILPADRLGIPTSLAQISFGEQVARAGAPE
FT                   GGVVCEAAPATNPDPAPIAEGPKAPPLALTSGAYSAVPLFWTGTAMLLLGTILVAAMPR
FT                   RRN"
FT   regulatory      425590..425649
FT                   /regulatory_class="promoter"
FT   tRNA            425592..425665
FT                   /gene="tRNA-Thr (CGT)"
FT                   /locus_tag="SACE_8011"
FT                   /product="transfer RNA-Thr (CGT)"
FT   regulatory      complement(425607..425666)
FT                   /regulatory_class="promoter"
FT   CDS_pept        425817..426584
FT                   /transl_table=11
FT                   /gene="cpdA"
FT                   /locus_tag="SACE_0382"
FT                   /product="cyclic nucleotide phosphodiesterase"
FT                   /function="predicted phosphohydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0382"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99730"
FT                   /db_xref="GOA:A4F6Q6"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="InterPro:IPR042281"
FT                   /db_xref="InterPro:IPR042283"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Q6"
FT                   /protein_id="CAL99730.1"
FT                   /translation="MTMAIAHLSDPHTTTGAQGDESVERLRRGLDCVRALDRLPDCVVI
FT                   TGDVADGGHRQEYEAVRAVIADFPVPVHLTTGNHDDPRGLAEVFGGTDVLGGAREARYA
FT                   VDYPGFTLVALDSHMPGSPGGRLGADQLAWLDDVLARRPDVPAVVCVHHPPVAVGIPYL
FT                   DGMGMEDAAEFAGVIARHRNVARVLAGHVHRAVVADFAGATLTTAPSTHIQIGFTTGED
FT                   VPPLHADPASFLLHLIDGASAVTHTLPIPPATG"
FT   CDS_pept        complement(426590..427030)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0383"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99731"
FT                   /db_xref="InterPro:IPR011944"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Q7"
FT                   /protein_id="CAL99731.1"
FT                   /translation="MTAVDEVLTEMARAWNAGDGTAWAANFAEDADFVDVVGRVQRGRE
FT                   VIAAEHQKIFDTIYQGSHLEIRQVGSRPLDDRTLLVHTASTLRVPAGPRAGEWHAIQTK
FT                   VFRDGRILAFHNTGRVDLADFAHHDEALADRAPQEWGQIASG"
FT   regulatory      complement(427064..427123)
FT                   /regulatory_class="promoter"
FT   CDS_pept        427102..427713
FT                   /transl_table=11
FT                   /locus_tag="SACE_0384"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0384"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99732"
FT                   /db_xref="GOA:A4F6Q8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Q8"
FT                   /protein_id="CAL99732.1"
FT                   /translation="MPADLPGIVRLRDRREALTLRTILTAARGLFAERGYARTPIRLIA
FT                   KEAGVAPQTIYAHYGSKAGVLTGLVDLLDDEAGIPDLMAEADAMADPEALIGLLARVSR
FT                   QVRERCGDIVAIMGSGAAVDADIAATQAEAQRRNRLGVEMIVDRVRESGLRVDPRAADI
FT                   AVALMSAGVHDSLVTEAGWSYDDYESWLRNTLLAALLGRD"
FT   CDS_pept        complement(427778..429781)
FT                   /transl_table=11
FT                   /gene="mrcB"
FT                   /locus_tag="SACE_0385"
FT                   /product="membrane carboxypeptidase, penicillin-binding
FT                   protein"
FT                   /function="Membrane carboxypeptidase (penicillin-binding
FT                   protein)"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0385"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99733"
FT                   /db_xref="GOA:A4F6Q9"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Q9"
FT                   /protein_id="CAL99733.1"
FT                   /translation="MSDDATTVLVPAARRRRRLRRALRASVFTATALLLGAVGAFAVGY
FT                   AVWEVPDPRAVATGTQQSIVLQYADGTEMTRIVPGTGNRTMIGSLHEVSPAMRQATLAA
FT                   EDASFYSNGGFDVLGIVRAAYAQLTDSPGGGSTLTQQYIKLATGEDEHTYTRKFKEIVL
FT                   SAKMTNEQPKDEIFKAYLNTAYYGRGAWGVHAASNAYFGKLPRDLDASEAAVLAGAVQK
FT                   PTENDPRVNAAQAAKRWEYVADQMLANHMITGEQRRRMAVPPTRERFAWRGEEMSGPLF
FT                   HIRERVLEELERDGLTARDMHRDGNTVVTNIDRDAQRAAEEAVAAMTEGRSQNLRSALV
FT                   SIEPGTGAIRAYHSGDREIGGFDWARAAQPPGAAMQPFVVAAGLMRGHGLAETYDGTSP
FT                   HEIMGATYRNSGVDCSRTCTARMAMAEASETAFVNMAAKFGPAAVLDAAQRAGMRVDTG
FT                   DDGRRVGLGIATGDYPVSTVDVARGYATLAAGGADHEPRFVRRVLDRTGNEVRSFEPEP
FT                   RTAFGDDPEMSRDVSGNVTESLSWSAWGTNWALDGKRPVAVKSGIAQFGGSPDEAVTAW
FT                   TAGYTPQIATAVSLSASDERGRPQPVVDATSSQAGDVLTGPTWQRFMNAYLADEPVEPF
FT                   PDFGPVGRYAEPSGVPFPPVTTSVPLPPLADR"
FT   CDS_pept        430020..430838
FT                   /transl_table=11
FT                   /locus_tag="SACE_0386"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0386"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99734"
FT                   /db_xref="GOA:A4F6R0"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6R0"
FT                   /protein_id="CAL99734.1"
FT                   /translation="MDQVDAAGIIGSGVITENPRAQDWERRIAERSEQLYRSGLVKRFL
FT                   LVWACAANPCLIASTVWWFALSGPRPLPVAAAVATLISVVLSARLLYTQHLRVRGMEQE
FT                   VRAMELAFREQLLDEFGSEDLLGVRKHYRAHLPEVIERYRAEARGHRRRDGAFQGVVIA
FT                   GSVVAACTTALSVSIVDMRWGAVALSLVVAIAAALAGHGRFRERGAVLQQTADSLEREY
FT                   ESVELRVGRYRRFDDEALAYAEFADTVEALRAEHGVTSPPRIDVLGALGQ"
FT   regulatory      430903..430962
FT                   /regulatory_class="promoter"
FT   regulatory      430913..430953
FT                   /regulatory_class="terminator"
FT   CDS_pept        431003..431719
FT                   /transl_table=11
FT                   /locus_tag="SACE_0387"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0387"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99735"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6R1"
FT                   /protein_id="CAL99735.1"
FT                   /translation="MKRSLSAAAAVLAGGAGVAGLAGAATAAEMPEFGIDMPVQGKDTV
FT                   LATSNFTGALQSAHKMVGDVVPASPTASRSDTPHPLGPAGELNSTDPVGGVLNPLVGQV
FT                   ATPKTASPFDIVGGVLPHGQQLPVNMPAGRTSPNPVNGVIDPLMGEGGGSPLGGPVGGA
FT                   VDALGTSNGSTPVVGDALNQSTPVQHPMGRSTAGPLVAVAHTLADATGQSPDATGVHKA
FT                   AGNVLANGPLSGNIGA"
FT   CDS_pept        complement(431903..434569)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0388"
FT                   /product="pyruvate, water dikinase"
FT                   /function="Phosphoenolpyruvate synthase/pyruvate phosphate
FT                   dikinase"
FT                   /EC_number="2.7.9.2"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0388"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99736"
FT                   /db_xref="GOA:A4F6R2"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6R2"
FT                   /protein_id="CAL99736.1"
FT                   /translation="MAPTGGRRRHEEAAMSTVETTTGQVLDLSRIDAGMGEVVGGKAAN
FT                   LGELLAAGVRVPPGFCLTTRAYDEVCAAAVGDALDGLPSTAAEIRDRLTGVEMPAALAD
FT                   TVTTAYAALGDDVPVAVRSSATAEDLPHASFAGQQDTYLNVIGASALLDAVRRCWASLW
FT                   TDRAVAYREANGIDHRAVKLAVVVQRMVDAQVSGVLFTANPVTGNRGETVVDANTGLGE
FT                   SVVSGAVNPDHFVVDTATGAVLTRQLGDKAVSVRPKPGGGTETVAGNGSPTLDDDALRA
FT                   LTAAGAAVQRHYGAPQDIEWAVDAAGTLWVTQARPVTTLFPLPAERRDGVRAYFSVNVA
FT                   QGVYRPLTPMGAAVLRGLGVGFMRRVGLPVDRDSPPVWRQAGGWVFFDITDVVRHPVGR
FT                   RVLPKLLAMMEVRTGKVVDGMLDDPRFAVRRGSSLPLLRRFAGIAARLRVPVAVARTLA
FT                   SPASARAHASRVADEIRRELARPHPSGTAERLAHARRVVPDVVVPRVAGLIPKLFTGMS
FT                   LSKLMPSVLGPDVTAEEAQILLRGIPHNVTTEMDLELWRLAQSVEPGTTAEELAERYRE
FT                   GRLPGSVQAALESFFDRHGHRAVAEIDAGMPRWADDPTQVLGLVANYVSSAGGGHAADE
FT                   QYRLGVAEAEAKAAEVVGRLRRTSPLRARAAAFTIDRIRGIVGIREMPKYCMVLGVAHV
FT                   RRALRAVGADLVASGRLDAVDDVFFLDFDEVEEAVTGADLRGLVTTRRGTHERELRRRH
FT                   LPRLLLSDGTEPEAAMLTETADGVLTGTSASAGTITGPAKVVRDPVGVELAPGEILVAP
FT                   STDPGWTPLFLTAGGLVMEMGGPNSHGATVAREYGIPAVVGVPAATERIRTGDRITVDG
FT                   SAGTVELPGAAEESAAT"
FT   regulatory      434723..434782
FT                   /regulatory_class="promoter"
FT   CDS_pept        434829..435371
FT                   /transl_table=11
FT                   /locus_tag="SACE_0389"
FT                   /product="probable transcriptional regulator, MarR family"
FT                   /function="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0389"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99737"
FT                   /db_xref="GOA:A4F6R3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6R3"
FT                   /protein_id="CAL99737.1"
FT                   /translation="MDALGSGEERERLLADASGVADALGRLARASGHLEAHASRHGADR
FT                   VGYILLKLLATEGPLRSNALAEALHADPSTISRHVSQLVRNGLVERTVDPDDKRACPLA
FT                   ITAKGGERLADMRRRRDETLARLLESWPGAERAELARLLGRFVDEYERALPQLLTAVLE
FT                   QRPFVGHAPETAPRGEN"
FT   CDS_pept        435371..436987
FT                   /transl_table=11
FT                   /locus_tag="SACE_0390"
FT                   /product="multidrug transporter, MFS superfamily"
FT                   /function="77 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0390"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99738"
FT                   /db_xref="GOA:A4F6R4"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6R4"
FT                   /protein_id="CAL99738.1"
FT                   /translation="MSETAERAAPAPPGVRLTHRQILTVLTGLMLGMFLGALDQTIVSS
FT                   AIRVIADQLHGQTAQAWVTTAYLITATITTPLYGKLSDIYGRKPLYLAAISLFLLGSVL
FT                   CGLANSIYELAAFRAIQGLGGGGLMSLALTIIADMLPPRERSRYQGYFMAVFGVSSVVG
FT                   PVIGGLFAGMDSFLGFAGWRWVFLVNVPVGLIALVVVAKVLNVETERVRHRIDYWGAAA
FT                   LVVMLVPLLTVAEQGREWGWGSATSLAMYAIGAVGLVLFVVSERRMGDEALLPLRMFRL
FT                   PSFRMGNVLNFIVGVGMFGGLMSMPLYLQIVKGLDPTAAGMLMLTMTAGIMISTTIAGR
FT                   AISKTGRLKPFPVIGSGIMTVALLLFSRLTADTSLVQVGLIAVVMGLGLGLLMQTLTLV
FT                   VQADATRTDLGVATASVNLFRQTGGTVGAAVFLSVLFSTVGGRIADAMRAAAVSPEFTA
FT                   ALRDPAVLADPANRDFLAGMRGGAPPDLNDTSFLYHLDPRLARPVLEGFASAMGTVFFV
FT                   GACVVGVAFVLTWFLRDTRLD"
FT   regulatory      437007..437055
FT                   /regulatory_class="terminator"
FT   regulatory      complement(437070..437120)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(437146..437634)
FT                   /transl_table=11
FT                   /gene="ppa"
FT                   /locus_tag="SACE_0391"
FT                   /product="putative inorganic pyrophosphatase"
FT                   /function="Inorganic pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0391"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99739"
FT                   /db_xref="GOA:A4F6R5"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6R5"
FT                   /protein_id="CAL99739.1"
FT                   /translation="MDFDVTIEIPKGNRNKYEVDHETGRIRLDRTLFTATQYPADYGFI
FT                   DDTLGEDGDPLDALVLVQEPTFPGCLIKSRAIGMFRMRDEKGGDDKVICVPSDDPRQEH
FT                   LRDIHHLAEFHKLEIQHFFEVYKDLEPGKSVEGATWVGRTEAEAEIKRSYERAKTQGH"
FT   CDS_pept        437872..441666
FT                   /transl_table=11
FT                   /locus_tag="SACE_0392"
FT                   /product="hypothetical protein"
FT                   /function="D-alanyl-D-alanine carboxypeptidase
FT                   (penicillin-binding protein 4)"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0392"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99740"
FT                   /db_xref="GOA:A4F6R6"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6R6"
FT                   /protein_id="CAL99740.1"
FT                   /translation="MPDPQTTRGEVSEPEAEPQADATGAGASDATASGASSAKTQTRTG
FT                   TLDDVTADAAGGEAAGAEEDGGDDAEKSADEGESSGTTGGDDDRTAADDDAAEGEAAGA
FT                   GDQGADSEAGESGSANGGGQLRGRFKGQFTAGGPMNGQLTGQLTGRMDGPMSGRIDGQI
FT                   DTEKSEEAGKSEQADASGESDDAVESDQAGKSGEAAERGSDEATTEPEDSGDEADDSGA
FT                   DSAEAAEDAETDEPAEAAEAAESAADAGESADASEEQPTESAASEDAGSAEDGEADESS
FT                   AGEREDAQTAAGEDADAADQSVTADDSTADETEAADDEAGESETSSTDTVALGTVQPES
FT                   DEDGETSESGTAEWEAESEAGETEASETGPAEDESSEAEVADEAEAAEEAEAADTAAEP
FT                   ETADSAAAETTSATESDSPEPESESSEPESDEAETAEPTPDSEAAEDEPAQAEAAPSPE
FT                   EPEAVADEDAETEAAGTETAAEAGTAAERDADEWPTDEHERVEAEPETREPVEQAEEAE
FT                   ESAEPAAEEPAQAAVEEPGLTAPGEPEAAPAEPEQATAPEAEQAAPAEPEQSEQAPEES
FT                   EQAADQQAPAVEPEQQRPAAPPERSVEQTQQFRPVEQTQWIPRIEQTQQIQRIEPEREE
FT                   PAEATSGEDAGPPTDPGPSKPSPQLDQGPPTMRIPAVGAAPSVDGPPTQRIPLVPPPGS
FT                   AEQTQQFARPDFSSPPRSAQPQDFDTSSARTAQPHDFAGLTGPAPAPAAPQVPQPPDVT
FT                   RQAPAPTHQPPPAPAQQSYVPGATQPVAKPAPEASPEPHPAEPPAEPSAAAPAKRRKRR
FT                   GTLITVALLLVVGLGAGIAFGPALVRALTEAQIAEPPAPVRLQPSIKPLDDGAPLPRQQ
FT                   RVSAALAGPLANPALGTFGGTVIDAQTGAPVWQQSPGQALTPASTGKLLTMSAALLALD
FT                   HQQRFSTKVVRGPEPGSVVLVGGGDPTLSTLGPGEDTVYTGAARIDDLAEQVRKATGGS
FT                   VSRIYVDVGRYSGPKMAPGWLPEDVQAGYVAPMEPLMLNGGRADPTKDTSPRTQTPALQ
FT                   AGQRLASKLGTGSVQEGNAPVNAQVLGEVKSPPVQDMAEIVLQHSDNVLAEALAREVAI
FT                   ATGNEPSFAGASKAVREVLQRNGFDLSGNTMVDGSGLSLDDRVTPQLLGSLLAAATAPA
FT                   GPEGGLEPKSAKLRALLPGLPVAAGSGSLHDRYTDSSGRGWVRAKTGTLDGANSLAGTV
FT                   VTENGRLLVFALMSNGTMSAQARPALDDLAIALRDCGCD"
FT   CDS_pept        441855..442823
FT                   /transl_table=11
FT                   /locus_tag="SACE_0393"
FT                   /product="hypothetical protein"
FT                   /function="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0393"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99741"
FT                   /db_xref="InterPro:IPR018766"
FT                   /db_xref="InterPro:IPR022454"
FT                   /db_xref="InterPro:IPR042271"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6R7"
FT                   /protein_id="CAL99741.1"
FT                   /translation="MRSLRRYSVEAETHVRELTGLGTHLPVLEGDVVDRPDWVRGAAHG
FT                   LAELTDAALSNAHGVQREGLDLLGGISTRGAGVQAGIVLAYLGGKVLGQYDPFGPTASG
FT                   QPGRLLLVAPNIVAAHQALEVPGEDFRMWVCLHESTHRLQFTAVPWLRDHFAASLGTLL
FT                   SEMEGTTSDLLGRLPAVVREVRSGRGGDSSPGVLGVIELLQTPRQRAALDRIIAISTLL
FT                   EGHADHVMDAVGPRVVPSVATIRQRFTERRKGGGLLDRILRSLLGVDAKIHQYAQGAAF
FT                   TRHVVDQVGMEGFNAVWAAPDHLPTRAEITAPATWLRRVHG"
FT   CDS_pept        443116..444108
FT                   /transl_table=11
FT                   /locus_tag="SACE_0394"
FT                   /product="cell cycle protein MesJ"
FT                   /function="predicted ATPase of the PP-loop superfamily
FT                   implicated in cell cycle control"
FT                   /EC_number="6.3.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0394"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99742"
FT                   /db_xref="GOA:A4F6R8"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6R8"
FT                   /protein_id="CAL99742.1"
FT                   /translation="MPPTAAVTATRAAVRRLLGSAEASPSAPLGAVAVACSGGADSLAL
FT                   AAATTHVARRRDIAVHGLVVDHGLQEGSADVASRAAEQLEELGCDVVRVLPVEIGREGG
FT                   PEAAARRARYAALDAARPAGAPVLLGHTRDDQAETVLLGLGRGSGARSIAGMRPVDLPW
FT                   LRPFLDVTRDTTLAACEALGLRPWQDPHNSDAKFTRVRLRAEVLPLLEEVLQGGVASAL
FT                   ARTAVQLREDADALDEVAADVRKRVEDGDALDAAALSAGPPAVRRRVLRGWLLDQGVRE
FT                   VSDAHLRAADALVGHWKGQGPHALPGGFVLRRTHGTLRVEVAVKQPPDY"
FT   CDS_pept        444192..444749
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="SACE_0395"
FT                   /product="hypoxanthine-guanine phosphoribosyltransferase"
FT                   /function="Hypoxanthine-guanine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0395"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99743"
FT                   /db_xref="GOA:A4F6R9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6R9"
FT                   /protein_id="CAL99743.1"
FT                   /translation="MYEGDIASVLITEQQINDKVVELAKQVDEDYQGGRGGDLLLVGVL
FT                   KGAVMFMTDFARALPQPAQLEFMAVSSYGSSTSSSGVVRILKDLDRDIAGRNVVIVEDI
FT                   IDSGLTLSWLLKNLASRNPASLEVCTLLRKPDAVQVDVPVRYVGFDIPNEFVVGYGLDY
FT                   AERYRDLPYIGTLDPKVYTSGA"
FT   CDS_pept        444999..447386
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="SACE_0396"
FT                   /product="putative cell division protein"
FT                   /function="ATP-dependent Zn proteases"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0396"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99744"
FT                   /db_xref="GOA:A4F6S0"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6S0"
FT                   /protein_id="CAL99744.1"
FT                   /translation="MTAFLLIYAFSVLFDETRNYREVSTSQALEQIAQGKVKEATIEDK
FT                   EQRVRLTLKDGQTFENSSELIAQYPAGATDQVVQEIRNGQVPSWNTKVTQDSFWVQMLF
FT                   YLVPIGLLVLLLMWMMNNVQGGGNRVLNFGKSKAKQLTKDMPKTLFGDVAGADEAVEEL
FT                   HEIKDFLQNPGRYQALGAKIPKGVLLYGPPGTGKTLLARAVAGEAGVPFYSISGSDFVE
FT                   MFVGVGASRVRDLFEQAKQNAPCIVFVDEIDAVGRQRGAGLGGGHDEREQTLNQLLVEM
FT                   DGFDSRGGIILIAATNRPDILDPALLRPGRFDRQIPVSAPDLRGRRAILGVHSKGKPLA
FT                   QDADLDGLAKRTVGFSGADLENVVNEAALLTARENGQLITAAALEESVDRVIGGPRRKS
FT                   KIISERDKKITAYHEGGHALAAWAMPDLEPVYKLTILPRGRTGGHALVVPEDDKDMMTR
FT                   SEMIARLVFALGGRSAEELVFHEPTTGASSDIEQATKIARAMVTEYGMTARLGAVKYGK
FT                   EEGDPFLGRSAGQQPNYSLEVAHEIDEEVRKLIEAAHTEAWEILNTYRDVLDELVLELI
FT                   EKETLVRKDLERIFTKVEKRPRITAFNDFGGRTPSEKPPIKTPGELARERGEPWPPVTE
FT                   QPPAPAPTPVGAGQQQGDASQSNGVGQYGQHPGTVQFPNPGHQQGQQGGYQQPGQGQYG
FT                   QPVPQAVPPNYGAPPGWTPATSPSGSAPSGAPVPSGAEQGGNQYNWVPSWERSQQPQTG
FT                   PSQPGGGDSNGTPGAQPAQGEGQSGQSPDSTDENGNGTSTNR"
FT   regulatory      447411..447450
FT                   /regulatory_class="terminator"
FT   CDS_pept        447460..448101
FT                   /transl_table=11
FT                   /gene="folE"
FT                   /locus_tag="SACE_0397"
FT                   /product="GTP cyclohydrolase I"
FT                   /function="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0397"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99745"
FT                   /db_xref="GOA:A4F6S1"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6S1"
FT                   /protein_id="CAL99745.1"
FT                   /translation="MTSTVGEPVGPEEDSGPGRSAFHNPVFDQERAEAAIRELLLAAGE
FT                   DPDREGLRETPARVARAYRELFAGLYTDPDQVLDRTFDEAHEELVLVREIPMYSQCEHH
FT                   LLPFHGVAHVGYIPNEKGRVTGLSKLARLVDLYAKRPQVQERLTSQVADALMRRLEPRG
FT                   VIVVIEAEHLCMGMRGIRKAGSMTTTSAVRGIFRSSASSRSEALSLIRGT"
FT   CDS_pept        448140..448949
FT                   /transl_table=11
FT                   /gene="folP"
FT                   /locus_tag="SACE_0398"
FT                   /product="7,8-dihydropteroate synthase (partial match)"
FT                   /function="Dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0398"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99746"
FT                   /db_xref="GOA:A4F6S2"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6S2"
FT                   /protein_id="CAL99746.1"
FT                   /translation="MGVLNVTPDSFSDGGRYLDRAAAVAHGVEMHRAGADIVDVGGEST
FT                   RPGSERVDAETEIDRVLPVVTELVAQGVPVSVDTTRARVAAATVRAGATVINDVSGGLA
FT                   DPDMAKVAAETGVPWVLMHWRGHSKNMNSLAVYTDVVTEVRDELRRQVDVALEAGVSED
FT                   AIVLDPGLGFAKTGADDWLLLQRLEVLVDLGFPVLVGASRKRFLGRLLADADGNPRPPA
FT                   GRETATAVVSALAADRGAWGVRVHDVVASLDAVAVTAAWNSGGELGG"
FT   CDS_pept        448942..449331
FT                   /transl_table=11
FT                   /gene="folX"
FT                   /locus_tag="SACE_0399"
FT                   /product="dihydroneopterin aldolase"
FT                   /function="Dihydroneopterin aldolase"
FT                   /EC_number="4.1.2.25"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0399"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99747"
FT                   /db_xref="GOA:A4F6S3"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6S3"
FT                   /protein_id="CAL99747.1"
FT                   /translation="MADRITLTGLKVRGNHGVFDHEKRDGQDFLVDITVWIDLAGAAAD
FT                   DDLAQTLHYGEMAERAAAIVGGPSRDLIETVAAEIADDIMTDGRAHAAEVTIHKPSAPI
FT                   PLSFADVAVTIRRSRRGGRGNVVPA"
FT   CDS_pept        449353..449856
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="SACE_0400"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /function="7,8-dihydro-6-hydroxymethylpterin-pyrophosphokin
FT                   ase"
FT                   /EC_number="2.7.6.3"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0400"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99748"
FT                   /db_xref="GOA:A4F6S4"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6S4"
FT                   /protein_id="CAL99748.1"
FT                   /translation="MSRAVLSLGSNLGDRLAHLRLAVEGFSDVLVAASPVYETAPWGVT
FT                   DQPDFLNAVIVVESAGVDEWGWLRRGQELERAAERVRERRWGPRTLDVDVVSVDDVRSD
FT                   DPELLLPHPGTPSRATVLIPWHSIDPEAQLPGRGPIAALLAALPEDEVSGVRLRADLDL
FT                   RPSG"
FT   regulatory      complement(449872..449905)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(449915..450859)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0401"
FT                   /product="MerR-family transcriptional regulator"
FT                   /function="predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0401"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99749"
FT                   /db_xref="GOA:A4F6S5"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6S5"
FT                   /protein_id="CAL99749.1"
FT                   /translation="MDDTRLYTIGELARRTGLPVKTIRFYADSGVVPPTDRTHSGYRLY
FT                   DVSAISKLELVRTLRELGAGLDEVRSVLERETTLPKLAEAHLALLEQQMRLLRTRRAVL
FT                   RAVVKLRRTTEEVRLMHKLAKMSDSERNRLIDEFWDEMTEGLNINPDFAEWMRSAKPNL
FT                   PEDPSTEQVEAWIELAELVADPDFRHLVRSASQEHSDRRDAGETMSGPAPEDAHKWWEV
FT                   TDQARQAAEAGTSPEGPEAAALVARIVELSTEEYGKPDSAEFRNWLADYYQQHDERLSR
FT                   YWELMATINGWPQHPNTEASSKWLAAALRASAE"
FT   regulatory      449957..450002
FT                   /regulatory_class="terminator"
FT   CDS_pept        450977..451441
FT                   /transl_table=11
FT                   /locus_tag="SACE_0402"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0402"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99750"
FT                   /db_xref="GOA:A4F6S6"
FT                   /db_xref="InterPro:IPR021517"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6S6"
FT                   /protein_id="CAL99750.1"
FT                   /translation="MSFTKPRQLVAAALVAAVLVYLLVRMAYGVLPQLPTFAGATLLLI
FT                   ALIDVVFALTMRPRLKRKPGTEPVDPLTAARAVALAKASSLAGAIMGGVWVGLLAYLLP
FT                   ERGTVQAAGADTVAAVIGLVSAAALVAAGLWLEHCLRNPDEPEEPLDDED"
FT   CDS_pept        451624..452868
FT                   /transl_table=11
FT                   /locus_tag="SACE_0403"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0403"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99751"
FT                   /db_xref="GOA:A4F6S7"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6S7"
FT                   /protein_id="CAL99751.1"
FT                   /translation="MVRMSDRGSTESASRDGRATALWVGAVFLAAAATAVLVLSDDSRL
FT                   LKLGLVAALWAALIAAFAVARLRGRAAEDAERAAEQQRIYELELEREVAARREFELEAE
FT                   AEARRRVAEESDSEIQALKTELRNLRESLEQMLGGDVLFERVALRAESTRVRSLTENGA
FT                   TGAQSTSIQQSWGRELTSGPGGHVNGRLTGGVITQAGGTAGPAAPAGSVPPTTVNGTVS
FT                   ANGPGTPNSAGSAAAGGAAPVQGAAPGNGAGTTPAGGKRGGAGGGSTPVTDPIPAAGGA
FT                   SGQSGGAQNTELISRLGGEPPRDEQRRRPSRPPRPKPQPARNETHAAHPAPARREKPQY
FT                   ERPDPAGARSGQQARSGREAPAAESTRKVQAPKAAEEPSPQVDAGAHAEGTSVDELLAA
FT                   YGGSGGTKRRRRRKE"
FT   regulatory      452883..452918
FT                   /regulatory_class="terminator"
FT   CDS_pept        452922..454628
FT                   /transl_table=11
FT                   /locus_tag="SACE_0404"
FT                   /product="putative integral membrane protein"
FT                   /function="predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0404"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99752"
FT                   /db_xref="GOA:A4F6S8"
FT                   /db_xref="InterPro:IPR026898"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6S8"
FT                   /protein_id="CAL99752.1"
FT                   /translation="MSTPDLREPAPDLSGARRLQTRKHHVVGWPIAGLIVLGICGLVMV
FT                   GVTTSRVGSLPALVGAVAALLPVGVVFAAIVWIDRWEPEPPLLLLGAFLWGAGGATACA
FT                   LMLNDAVTGLGDLLLGANDHRFFSLAVMAPLVEEAAKALFVVGLWFRRRAEFNGMVDGI
FT                   VYAALTAAGFAFTENILYFGKAFAEGGLGGVSGGVVAVFILRGVLAPFSHPLFTAMVGI
FT                   GIGLASRTTNGRMRVLWPVFGFLAAVVLHAVWNASTLLGGVEFLNIYFLFMVPIFFGTG
FT                   WIVLWQRKREQRIVAEQLPVLQRAGLIVRSEVEMLASLAGRRGWLRKVRRSAGGDAAKA
FT                   VRDYQIAVTELAFLQHRASEGRTTSAVRRARREKLIEDLKHARRSAAGSQQAIQTARIK
FT                   IHELTQLNLKRPRRSEGPVRPKRSTPVGPPIHGTPPAQGQGPVPAQERGPHHASPDHGP
FT                   FPSQDQGRFPSQDQVPPFPSQDQVPPFPSQDQAPFPSQDQGRFPSQDQVPPFPSQERGP
FT                   HQPQAQGRARDHRQVPPPQERGPGQAPRGAVPPEHGSRRPPENGPVPPPGG"
FT   regulatory      454674..454715
FT                   /regulatory_class="terminator"
FT   CDS_pept        454857..455687
FT                   /transl_table=11
FT                   /locus_tag="SACE_0405"
FT                   /product="NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase-like protein"
FT                   /function="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0405"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99753"
FT                   /db_xref="GOA:A4F6S9"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR018931"
FT                   /db_xref="InterPro:IPR019665"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037108"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6S9"
FT                   /protein_id="CAL99753.1"
FT                   /translation="MLGAALHRAGHQVVAVSGVSAASLRRAEELLPDVPVLPPDDVAAQ
FT                   ADLVLLAVPDDAIAGLTRGLVATGSLRAGQIVVHTCGAHGAGVLSAATEIGALSLALHP
FT                   AMTFTGRAEDVERLATACMAVTAVGEDEAGWSVAEALALELGMEPVRVPEQARGLYHAA
FT                   LTHGANHLITLVNDCADLLRDAGVEIPDRVMAPILSASLDNALRFGDRAITGPVMRGDA
FT                   GTVRAHLAALNDDDPDAVPGYRALAKRTAERAVRSGVLRADMASDVRDALEGEP"
FT   CDS_pept        455758..456666
FT                   /transl_table=11
FT                   /gene="panC"
FT                   /locus_tag="SACE_0406"
FT                   /product="pantoate--beta-alanine ligase"
FT                   /function="Panthothenate synthetase"
FT                   /EC_number="6.3.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0406"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99754"
FT                   /db_xref="GOA:A4F6T0"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4F6T0"
FT                   /protein_id="CAL99754.1"
FT                   /translation="MTAPERVGAGPGFAPGALTVHHHPDELAKVTRALRATGRRITLVP
FT                   TMGALHEGHLELIRRARRDSNSVVVVSIFVNPLQFGPGEDFTSYPRTFETDVEACRAEG
FT                   VELVFAPDRDDVYGPDPQITVHPGPLGDELEGASRPGHFAGVLTIVAKLLGIVRPDLAL
FT                   FGEKDYQQLVLIRRMARELNIDTAIQGIPIVRAPDGLALSSRNVYLSEEERGAALALSA
FT                   ALAAGAHAGREGAEAVLRAAREVLATEPLVRLDYLELRDTELGAAPAEGEARLLVAAKV
FT                   GETRLIDNALVLLGDQGDSRP"
FT   CDS_pept        456719..457210
FT                   /transl_table=11
FT                   /gene="panD"
FT                   /locus_tag="SACE_0407"
FT                   /product="aspartate 1-decarboxylase precursor"
FT                   /function="Aspartate 1-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0407"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99755"
FT                   /db_xref="GOA:A4F6T1"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4F6T1"
FT                   /protein_id="CAL99755.1"
FT                   /translation="MFRTMLKSKIHRATVTQADLHYVGSVTVDADLMDAADLLEGEQVA
FT                   IVDVTNGARLETYVITGERGSGVIGINGAAAHLIEPGDLVILISYGVMDELEARSVRPK
FT                   VIFVDADNRIVERGQDPGHAPAGSGLAGTAASVTSAITEAAAETDDAAKLDALLQQPEH
FT                   "
FT   CDS_pept        457267..458064
FT                   /transl_table=11
FT                   /locus_tag="SACE_0408"
FT                   /product="putative Bordetella pertussis Bvg accessory
FT                   factor family"
FT                   /function="putative transcriptional regulator, homolog of
FT                   Bvg accessory factor"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0408"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99756"
FT                   /db_xref="GOA:A4F6T2"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4F6T2"
FT                   /protein_id="CAL99756.1"
FT                   /translation="MLLAIDVGNTNIVLGLYADEPAEGADPVLVRDWRMRTEPRMTADE
FT                   LALTVRGLLGSYADRITGISALSTVPSLLRELRVMLGRYWTDVPRVVVEPGVRTGVPLL
FT                   VDNPKEVGADRVINTLAAHHLHATNCVVVDFGTSTNIDAISAKGEFLGGAFAPGIEISL
FT                   DALASRAAQLRKVELVRPRSVIGKNTVECLQSGILYGFAGQVDGLVRRIVAELESTHGG
FT                   PTTVIGTGGLAPLVVTESDTISHHVPDLTLLGLRLVYDRNFGS"
FT   CDS_pept        458154..459677
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="SACE_0409"
FT                   /product="lysyl-tRNA synthetase class II"
FT                   /function="Lysyl-tRNA synthetase (class II)"
FT                   /EC_number="6.1.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0409"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99757"
FT                   /db_xref="GOA:A4F6T3"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6T3"
FT                   /protein_id="CAL99757.1"
FT                   /translation="MTDQDRSIPTAADAEGVDDLPEQLRVRREKRERMLAGGVDPYPVN
FT                   LPITHTLAEVRAAHPDLAPDTYTGDQVGVAGRVMFLRNTGKLCFATLRGGDGTELQAML
FT                   SLKQVGEDALASWKSDVDLGDHVFVHGEVITSRRGELSVMADEWRLAAKTLRPLPVAHK
FT                   ELGDETRVRQRYVDLIVRKQAADTVRTRATVQRSLRDSFQRRGFIEVETPMLQTLHGGA
FT                   AARPFVTHSNAFDMELYLRIAPELYLKRCVVGGIEKVFEINRNFRNEGSDSSHSPEFAM
FT                   LEFYQAYSDYDGMARLTRQLVQEAAEALTGSQVVTWFDGTEYDLSGEWSSVTMYGSLSE
FT                   ALDSEITPETPVEVLRKHADSVGLQTDPAHGHGKLVEELWEHLVGDHLYAPTFVRDFPL
FT                   ETAPLTRQHRSEPGVAEKWDLYTRGFELATGYSELVDPVVERARLEEQARLAASGDEEA
FT                   MHVDEDFLRALEYGMPPSGGVGMGIDRLLMALTGLGIRETILFPLVRPE"
FT   CDS_pept        459845..460195
FT                   /transl_table=11
FT                   /gene="lsr2"
FT                   /locus_tag="SACE_0410"
FT                   /product="probable iron-regulated LSR2 protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0410"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99758"
FT                   /db_xref="InterPro:IPR024412"
FT                   /db_xref="InterPro:IPR042254"
FT                   /db_xref="InterPro:IPR042261"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6T4"
FT                   /protein_id="CAL99758.1"
FT                   /translation="MAQKVTVTLVDDLDGGQADETVEFALDGVSYQIDLSNDNATELRD
FT                   ALANYVSSARRAGGRKKPGPRPGAGRSAGGSTSADREQNQAIREWARKRGLKVSDRGRI
FT                   PADVVEQYHKAN"
FT   regulatory      460210..460261
FT                   /regulatory_class="terminator"
FT   CDS_pept        460677..461747
FT                   /transl_table=11
FT                   /gene="fepD"
FT                   /locus_tag="SACE_0411"
FT                   /product="putative ferrichrome transport system permease
FT                   protein"
FT                   /function="ABC-type Fe3+-siderophore transport
FT                   system,permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0411"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99759"
FT                   /db_xref="GOA:A4F6T5"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6T5"
FT                   /protein_id="CAL99759.1"
FT                   /translation="MSRSAIVGDPPEAAREPAAGGRLAARRRRRLVGIGVLAVLLLLSC
FT                   LLSVLLGAKPMSLEAVWSALFAPTGTENDLIVRELRVPRTIVGVLAGVALGLAGALMQG
FT                   HTRNPIADPGILGITHGAALGIVLSVYVFGITSLFGFIWFGFGGALLGALAVFAIGSIG
FT                   RGGPTPVTLALAGMAIGYLLQAITSALVLVDQQSLETYRFWKVGSIAVTDTSVIWQVLP
FT                   FLAVGVVVALANASGLNALSLGEDVARSLGHRVQWSRRLGIAAIAVLVGGAVAICGPIG
FT                   FVGLIVPHVARFFTGADYRWLLPFAALMGASVVLLADVLGRLVARPAEIQVGVMLAVVG
FT                   APFFIGLVRRRKLVRL"
FT   CDS_pept        461744..462829
FT                   /transl_table=11
FT                   /gene="fepG"
FT                   /locus_tag="SACE_0412"
FT                   /product="Fe(3+) enterobactin transport system permease
FT                   protein"
FT                   /function="ABC-type Fe3+-siderophore transport
FT                   system,permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0412"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99760"
FT                   /db_xref="GOA:A4F6T6"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6T6"
FT                   /protein_id="CAL99760.1"
FT                   /translation="MTRTVQAPKVAGRRSVRVGPVSGVLRLRPALVLLAGLVLLLLLFV
FT                   LNVGLGEYQISPAEVLTTLVGGGDRAEQVIIWELRMPRSLTGLLVGAALGAAGAIMQAI
FT                   ARNPLASPDMLGITWGAGTAATAVIVLGGSVGTVTGALESVGLPLVALAGGLLVGLAVY
FT                   VLSYRNGVDSYRLVLVGVGMSALAGNATYWLLSVGDVNDAGRAMVWLTGSLNARGWEHV
FT                   VPVAIVLALLVPLTLVGAHVLGALQFDDDTVRGLGIRMDAARGGLLIAAVLLAAVATAA
FT                   AGPIQFVALAVPQIALRLARTAMPPLLTSMVLGAALVVGSDLISRTAFGGIEMPVGIVT
FT                   SVLGAPYLIYLLVRRYREVRA"
FT   CDS_pept        462826..463680
FT                   /transl_table=11
FT                   /gene="fepC"
FT                   /locus_tag="SACE_0413"
FT                   /product="Fe(3+) enterobactin transport ATP-binding
FT                   protein"
FT                   /function="ABC-type cobalamin/Fe3+-siderophores transport
FT                   systems, ATPase components"
FT                   /EC_number="3.6.3.30"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0413"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99761"
FT                   /db_xref="GOA:A4F6T7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6T7"
FT                   /protein_id="CAL99761.1"
FT                   /translation="MTPGVSTQTTGTAVAEDGRQRLHARDLKLAYGERVVVDGLDVDVV
FT                   DGTITAVIGPNGCGKSTLLRALGRLLQPQRGSVLLDGKRIHKMATKDVAKVLGLLPQSP
FT                   QAPEGLTVADLVARGRHPHQSWYRQWSSDDEAAVAEALGMTGIEDLAERTVDELSGGQR
FT                   QRAWLSMALAQGTDLLLLDEPTTYLDLSHQVDVLDLIGRLHDDSGRTVVMVLHDLNLAA
FT                   RYADRLVAMKDGAIVAEGAPGEVLTEELLAAVFGLKARVIDDPVVGTPMVVPVGGRRTA
FT                   NGR"
FT   CDS_pept        463959..466520
FT                   /transl_table=11
FT                   /gene="clpC"
FT                   /locus_tag="SACE_0414"
FT                   /product="putative ATP-dependent Clp protease"
FT                   /function="ATPases with chaperone activity, ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0414"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99762"
FT                   /db_xref="GOA:A4F6T8"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6T8"
FT                   /protein_id="CAL99762.1"
FT                   /translation="MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVA
FT                   AKALESLGIALEGVRQQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIG
FT                   TEHILLGLIREGEGVAAQVLVKLGADLNRVRQQVLQLLSGYQGKEPAEAGGRGEGTPSS
FT                   SLVLDQFGRNLTQSARESKLDPVIGREKEIERIMQVLSRRTKNNPVLIGEAGVGKTAVV
FT                   EGLAQKVVKGEVPETLKDKQLYTLDLGSLVAGSRYRGDFEERLKKVLKEIKTRGDIILF
FT                   IDEIHTLVGAGAAEGAIDAASILKPMLARGELQTIGATTLEEYRKYVEKDPALERRFQP
FT                   IQVGEPSLEHTIEILKGLRDRYEAHHRVSITDGALVSAATLADRYINDRFLPDKAIDLI
FT                   DEAGARMRIRRMTAPPDLREFDEKIADVRRDKESAIDAQDFERAARLRDEEKQLLGQKD
FT                   EREKQWKAGDLDVVAEVDDEQIAEVLANWTGIPVFKLTEEETTRLLRMEDELHKRIIGQ
FT                   DDAVKAVSQAIRRTRAGLKDPKRPSGSFIFAGPSGVGKTELSKALAEFLFGDDDALVQI
FT                   DMGEFHDRYTASRLFGAPPGYVGYEEGGQLTEKVRRKPFSVVLFDEIEKAHQEIYNTLL
FT                   QVLEDGRLTDGQGRTVDFKNTVLIFTSNLGTQDISKAVGLGFSAGTDSESNYERMKSKV
FT                   NEEMKKHFRPEFLNRIDDVIVFHQLTEAEIIQMVDLLGARVEKALKGKDMSLELTTLAK
FT                   KLLAKRGFDPVLGARPLRRTIQREIEDRLSEKILFGEIEPGQIVIVDVEGWDGEGSDDK
FT                   AHFTFRGETKPSLVPDAPPVDLAGSTGSSTDDKSEGTSDQE"
FT   regulatory      complement(466481..466511)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(466585..467742)
FT                   /transl_table=11
FT                   /gene="tnp"
FT                   /locus_tag="SACE_0415"
FT                   /product="transposase, ISlxx5"
FT                   /function="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0415"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99763"
FT                   /db_xref="GOA:A4F6T9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001598"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6T9"
FT                   /protein_id="CAL99763.1"
FT                   /translation="MGINERTAKDWDYGVRKSRNARTYPNGVRVDYATGTSTIVDVNSP
FT                   APKLSALDKQLHPRLLTLAERERIRDLRAEGHSLRDIGSALGRSASTISREIRANSTHG
FT                   AYRPYAAHRAAAARRPRPKQRKLIAQGPLRQFVADGLRERWSPEQICHALGKEHPGDQR
FT                   MRVSVETIYQALYFQARGGLKREVQAAIRTGRTRRKPRRNPNQRTARFIDPMVMISDRP
FT                   AEAADRAVPGHWEGDLIIGAGNQSAIGTLVERTTRYTMLVHLPNGHDAETVRDGLVATI
FT                   TTLPTHLRGSLTWDQGAEMARHKQFTMATDMPVYFCDPASPWQRGTNENTNGLLRQYFP
FT                   KGTDLSVYGPEDLEHVAQQLNGRPRKTLGWDSPAERLAMLLTKAS"
FT   regulatory      466616..466655
FT                   /regulatory_class="terminator"
FT   CDS_pept        468235..469068
FT                   /transl_table=11
FT                   /gene="ORFL4"
FT                   /locus_tag="SACE_0416"
FT                   /product="transposase, ISlxx1-degenerated"
FT                   /function="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0416"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99764"
FT                   /db_xref="GOA:A4F6U0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6U0"
FT                   /protein_id="CAL99764.1"
FT                   /translation="MEDWAEIRRLHRCEGMPIRAIVRKLGVGRNTVRRALASEGPPRYQ
FT                   RPSKGSVVDAVEPQIRALLAEWPTMPVPVIAERIGWQRGLTVLKDRVRELRPLFLPPDP
FT                   VSRTVYQPGELAQCDLWFPPVDIPLGFGQVGRPPVLVMVSGYSRVIAARLIPSRQGPDL
FT                   LAGHWALLSGWGRVPKTLVWDNESAVGFRKAGRPVLTEAMNAFRGTLGIAVIQCRLGDP
FT                   EAKGLVERANGYLETSFLPGRRFTSPADFNTQLADWLVRANQRHHRILGCRPADR"
FT   CDS_pept        469506..470273
FT                   /transl_table=11
FT                   /gene="tpase1"
FT                   /locus_tag="SACE_0417"
FT                   /product="transposase, ISlxx1"
FT                   /function="DNA replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0417"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99765"
FT                   /db_xref="GOA:A4F6U1"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6U1"
FT                   /protein_id="CAL99765.1"
FT                   /translation="MAAEIAYLARALKAPSLAGAVERLAERARAEDWSHEEFLAACLQR
FT                   EVAARESHGGEGRIRTARFPSRKSLEEFDFDHQRSLKRDTITHLGTLDFIAGKENVVFL
FT                   GPPGTGKTHLSIGLGIRACQAGHRVSFATAAGWVARLAEASHAGRLQQELVKLGRIPLL
FT                   IIDEVGYIPFEAEAANLFFQLVSARYERASLIVTSNKPFGRWGEVFGDDVVAAAMIDRL
FT                   VHHAEVISLKGDSYRLKDRQDLGRVPAATNTND"
FT   regulatory      470380..470409
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(470606..471682)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0418"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /function="NADH dehydrogenase, FAD-containing subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0418"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99766"
FT                   /db_xref="GOA:A4F6U2"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6U2"
FT                   /protein_id="CAL99766.1"
FT                   /translation="MPATVAVLGGGYGGMTVAKALDDVADVVLVEPRDAFVHNVAALRG
FT                   VVDREWTDRLFYRYDRLLERGRVVHDRAVRVSGTEIALGSGQTIEADYVVLATGSSYPF
FT                   PAKIDVLDSAAAKDRLHATRDSLERADRVLLLGAGPVGLEFAGEIRAAWPEKAVTIVDP
FT                   AGDVLPAFPVEFRSELRRQLEVLRIELVMGTSLRDQPPSEPGEHKTFTATTGTGAEITA
FT                   DIWFRCFGVEPATGYLAGDLAAARTAGGHVEVTGDLRLPGQERVFAIGDITALPEAKMA
FT                   KSAGDHANVVAANIRTLINGGGEALTTYEPAPPMIALPLGPKGGVSYTADTGVLGPDVT
FT                   SEIKGADLRAGYYAEMLG"
FT   CDS_pept        471780..472283
FT                   /transl_table=11
FT                   /locus_tag="SACE_0419"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0419"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99767"
FT                   /db_xref="GOA:A4F6U3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6U3"
FT                   /protein_id="CAL99767.1"
FT                   /translation="MTETLAEPDRGPDRAADRGPDRGAECEIETGLAAGLVRLTHLVQH
FT                   VFAEVNRDFDLTPQQAQLLCMLIDGPIGMGELSRLLHLEKSSLTGLVDRVERRSLVERV
FT                   RDDRDRRACRIALTAEGVRLGNESHSAVGARLEEMGSALPSAERKRLADAIGRILAGNG
FT                   VPGA"
FT   CDS_pept        complement(472469..473254)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0420"
FT                   /product="hypothetical protein"
FT                   /function="uncharacterized membrane-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0420"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99768"
FT                   /db_xref="GOA:A4F6U4"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6U4"
FT                   /protein_id="CAL99768.1"
FT                   /translation="METFMPLPATATAEPTGFTGWVIGVMEALGGPGAGLIIALENLFP
FT                   PIPSELILPLAGFTASRGGMTVGGAIFWTTLGSLLGALALYALGAKLGRQRTHAIAAKM
FT                   PLVKLEDVDRTEAWFAKHGVKAVFFGRMIPLFRSFISLPAGVDRMPVSTFALFTTLGSL
FT                   VWNSIFVLAGFYLGENWHLVEQYAGVLSKAVLVAVAAAVVWFVVKRVRQEGRTKHEAEA
FT                   PTEEFAAVGVGADYLEGATSRIPALEPSEAPTVQFRRVR"
FT   CDS_pept        473417..476542
FT                   /transl_table=11
FT                   /locus_tag="SACE_0421"
FT                   /product="putative transcriptional regulator"
FT                   /function="predicted ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0421"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99769"
FT                   /db_xref="GOA:A4F6U5"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6U5"
FT                   /protein_id="CAL99769.1"
FT                   /translation="MLGPFRLCAADGHPIDVGGARVRMLLARLALDAGRTVATETLIDD
FT                   LWGANQPSGALNALQSLVSRARRALPDDLVLQSAATGYALKADAADVDAHRFARLAADG
FT                   RGLLRDGRFAAAARTLREALRLWRGGALVDFVDAPFAAAQAARLEELRLGALEDRIDAD
FT                   LRAGRDGEPVELVELVAELDGLCARHPLRERFTGLRMRALYSAGRQADALGAYEALRRR
FT                   LADELGVDPSQELRDLHGAVLRGEPREHRDRPPVLPSRLSSFVGREAEIEQVRTAMARS
FT                   KLVTLFGPGGAGKTRLATETAAGVDDRRVWFVELASVRQGEDLPSAVLASVGVRETRLL
FT                   DTAPADAMTRLVDGLSGAPALLVLDNCEHVIGAAAQFVQDLLTWCPQLGVLATSREPLA
FT                   LTGEELLPVGPLGLPDGEAPLEADAVRLFADRARSARPGFVLDDATIGDVVEVCRRLDG
FT                   MPLAIELAAARLRAMSVRQVAARLDDRFRLLTSGNRASLARHRTLRAVVEWSWDLLGEP
FT                   ERLLARRLSVFAGPARAESAAAVCSDARLPAEDVFYVLSSLVEKSFVEAVDGDRYRMLE
FT                   TVRAYCDDRLAESGERDRVRTAHAEHFVELAETASPRLHRVEQVEWLERLDADHDNLMT
FT                   ALRWAISSQNADLGVRMGAALAWYWSMSAHGELASRLEALTPIPGDAPSEGRAVLEFIQ
FT                   AMLCQTTSWTERIGAAAARLRDTGAGRRYLYVTIMEPMAWMFVGDRAEMDAAVRRNLEH
FT                   PDPWGRAAALFSRAFGAEHGGDAAGGEEHMRAAARAFREQGDRWGIAQSMGSLAGFRSL
FT                   RGDHAGAIEALEESAETLRELRSDEEVAPTMVRIGMEHVRAGDIAEGRRCLEQADELAA
FT                   ASFAEFARLGSLTALGEAARRAGDVERARAYFAQARELLAGTPMAPPPLHQVALATEAR
FT                   VDIDELRLDDARARLRESLDSSGEIPMMPTIAMIAEQTALLRFAAGDHRQASYLLGVAV
FT                   ALRGMLDEGDPDIRAVLPALDAPDLRSERDRGAALTHEAALAVLREVLGPRG"
FT   CDS_pept        476902..477138
FT                   /transl_table=11
FT                   /locus_tag="SACE_0422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0422"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99770"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6U6"
FT                   /protein_id="CAL99770.1"
FT                   /translation="MAAAVVAGAPAFAADAGAAAAAAAQNGNGGDGGNAGNSTNALSCL
FT                   VEVGVANPNSPGGCNPNSNGGAGGAATAAQQED"
FT   regulatory      477177..477217
FT                   /regulatory_class="terminator"
FT   regulatory      complement(477334..477391)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(477438..478268)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0423"
FT                   /product="multidrug ABC transporter permease"
FT                   /function="ABC-type multidrug transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0423"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99771"
FT                   /db_xref="GOA:A4F6U7"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6U7"
FT                   /protein_id="CAL99771.1"
FT                   /translation="MTTTLEPTPGATSAAPAPAAERVGPLRAVRHGLTLAGRSILKIRK
FT                   SPAGLLDVTLQPILFLVMFVYLFGGAISGDTGTYLQITLPGVLAMNMVFASLGTGMQLN
FT                   TDITKGVFDRFRSLPVARSAPLIGAVLGDIVRYVVSIAVLLVFGTIMGFRIQTDAVSAL
FT                   LAVVVVIAFSLAMCWISVFLGMLIRSQQALPGVAMSFMFPLTMGSNVFVPLETMPGWLQ
FT                   AWNGINPVTKLADTARGLMIGGPVAGPLTATLIWMVVLVAVFFPLAMWAYRRRV"
FT   CDS_pept        complement(478265..479233)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0424"
FT                   /product="probable ABC transporter, ATP-binding component"
FT                   /function="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0424"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99772"
FT                   /db_xref="GOA:A4F6U8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6U8"
FT                   /protein_id="CAL99772.1"
FT                   /translation="MSFAIQAEGLVKRFGSTTALAGVDLEVPAGSIRGVLGPNGAGKTT
FT                   AVRILATLLRPDAGRAVVAGHDVLRHPVAVRNRIGLAGQYASVDEELTGTENLVLIGRL
FT                   LEMTRRDARARAAELLDRFGLTDAGGRAIKTYSGGMRRRLDLAASLVGRPEVLYLDEPT
FT                   TGLDPRSRNQVWDMVRALSGEGVTVLLTTQYLEEADQLADRISVIDRGRVVADGRADEL
FT                   KRRTGGQTLQVRPSALADLATVRTILAELTGAQPKVDDDSGLLTAPVDDPVLLSTLVRR
FT                   LDDAGITADELALRLPSLDEVFLAITGESSDRDDEEEGTAA"
FT   CDS_pept        479363..480370
FT                   /transl_table=11
FT                   /locus_tag="SACE_0425"
FT                   /product="endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0425"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99773"
FT                   /db_xref="GOA:A4F6U9"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6U9"
FT                   /protein_id="CAL99773.1"
FT                   /translation="MERTLDDVEADEDREPGRRKSPAVTALLVLAALGFLGWAALPLTG
FT                   YDSNRYAAALVALTQYAVPVGLLLVVLALVLRRWLTTLVVGLVTAALVASVAPRAIPDP
FT                   PTPVQGTPLNVMSANLYFGEADAARIVELVRSNDVDVLSLQELTPALAAALDRAGLAQV
FT                   LPHRVFEAHPGAEGTGIASRYPLRSLALVPPTTMRQPSALVDLPGSRDVEFVAVHPVIP
FT                   VGSDTVGDWRREITVLPHTPAEGRPPRVLAGDFNATLDHSPLRGLLGRGYADAAEVAGA
FT                   GLAPTWPRAGAWLPPPVTIDHVLVSEGVVVQDYRTFEVAGADHRAVVAHLVVAG"
FT   CDS_pept        complement(480442..480948)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0426"
FT                   /product="MarR-family transcriptional regulator"
FT                   /function="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0426"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99774"
FT                   /db_xref="GOA:A4F6V0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6V0"
FT                   /protein_id="CAL99774.1"
FT                   /translation="MERTPDLIDTARSQWREVHPDLDTTSIDVVGRVLRASAVLRQRLD
FT                   AAFAEEGLNRAEFDLLCALRRSDAPVTPGRLNSLTVSSGAATTKRIQQLAERGLLERAV
FT                   DARDRRSARIALTEQGREVIDRAFRRNLEAERHLLSGLDPGRRQELVTGLADLLGALEG
FT                   PGPLG"
FT   CDS_pept        480996..482618
FT                   /transl_table=11
FT                   /locus_tag="SACE_0427"
FT                   /product="integral membrane protein"
FT                   /function="predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0427"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99775"
FT                   /db_xref="GOA:A4F6V1"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6V1"
FT                   /protein_id="CAL99775.1"
FT                   /translation="MPTTVLTRRLGDTFRLRRGGPVVWPATRAFVSVLAPMAVLLQLHR
FT                   LDLAAGAVFGALTSVYGRSEPYRQQARTLAAVAVTMVLAVAAGDLIAVFGAGHAWHEAL
FT                   ALLGTAVVGAVTTAAATAAKVGAPGGLIFAFATGACAHLALEPADLGPHLAVAAASAAF
FT                   AWAVSTAGAVVSGLGPQRRAVAAALEATAAHLESGGDLATRHRAAVAVETAWNSVALVG
FT                   RRHRETRAHLDLVRAVETCEALLVESGDADVDALRAAATAVGAGRPLPLSGRSAATVVP
FT                   PAPQSRWVLVRGVMRAALRPKRHGSSWLLPYAARVGVAALLAGALADLAGIGHAYWAAV
FT                   SAVSVLQATSTSTSVPRMIQRVLGTVFGVFVGVAVLAAQPGPWVLVAVLAVLQWGAEMT
FT                   VMANYALGLFFATPVALLVSGLATPAEPAELASNRFWATLLGGAIAVGVAWLAPRGPWL
FT                   GRVHRALARVRDLSAETPPRPKALRAALVELHDAYDVAQGEVRDAELPTEELLEVSHRA
FT                   YALADSAPPATGHPTPTPAAPPT"
FT   CDS_pept        complement(482689..482988)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0428"
FT                   /product="antibiotic biosynthesis monooxygenase"
FT                   /function="uncharacterized enzyme involved in biosynthesis
FT                   of extracellular polysaccharides"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0428"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99776"
FT                   /db_xref="GOA:A4F6V2"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6V2"
FT                   /protein_id="CAL99776.1"
FT                   /translation="MKINAIEVPEGKGPELEKRFASRHGSVDSAPGFLGFELLRPVNGE
FT                   NRYFVYTRWETEEDFQNWAQGPAKEAHAGEHKNPVATGSSLLEFEVVQESKPQG"
FT   regulatory      482741..482767
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(483015..484955)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0429"
FT                   /product="ABC-2 type transporter"
FT                   /function="predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0429"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99777"
FT                   /db_xref="GOA:A4F6V3"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6V3"
FT                   /protein_id="CAL99777.1"
FT                   /translation="MKAIRLARLEFLRFRGPVRRWVPLVLILVPLLYGGLYLWSNWDPY
FT                   GRLGAVPVAVVNNDRPVLHDRELIDAGGQFVGQLKAARTFDWHFTDGADARRGLEQGRY
FT                   YFTIEVPRDFSAKLASAADAEPKRAELLVTKNDANGFIVGIMADTVKSQLQNQINAAAH
FT                   ASYARALYGELDQAREKLQMASEASKELVKGSELGEQGTAALTKGLSGVRDGAGRISRG
FT                   VSDISSATAQLDAQIGDLTDVATEKLPDAVGSVVGASGVAVRTLDEISTATAAVRDGSA
FT                   TGVTDLQELARKHPAVGDDPVYRRALDNARRLSATATATSDAAERALGTAQDADSRARA
FT                   LQKEVEPLREQVRESTGPMETLTKGTGELEAGSRGVTSGLSTLVANSGVLQTGADQLNT
FT                   GAKRIEGLIAGGLDQIPPTNPGRVAQAADVLASPARIETANLNPASVYGRGLAPFFFSI
FT                   ALWVFGLFAYLLLRPLNSRAVAGRVGATTITLAGYLPAAALGVVGGLLLYGAVDLGLGL
FT                   QPRHMWWTIGLVALAVAAFVAIDHLLRTAFGAVGGLLSLVLLMVQLTACGGLYPVETTP
FT                   GPFQVIHPYLPMTYLVDGLRVTISGGLTDVLVRSAVMLAGFLVVALAMTTAVVMRQRMW
FT                   TVGRLHPQVAL"
FT   CDS_pept        complement(484952..485629)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0430"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /function="ABC-type cobalt transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0430"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99778"
FT                   /db_xref="GOA:A4F6V4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6V4"
FT                   /protein_id="CAL99778.1"
FT                   /translation="MDIDGADFFARGITALGPEGIVFENVDLRFRPGDLGVVTGPGGSG
FT                   RTALLYALAGRLRTVAGYLEVSGYVLPARARAVRKLVLPARLRPGFELEDKYRVREAVT
FT                   EQRLIFGVSELDVEKSLAAVGLDPDPWALVCELHPAERLLLSIALAVAADPAAIVVDDV
FT                   DVGLPRGSRARVWSALRAVAQTGMTVVAGSTDAPPGDAVVVHLPLFQFGEPTEVLSWNG
FT                   GLR"
FT   regulatory      complement(485656..485703)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(485788..486315)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0431"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99779"
FT                   /db_xref="GOA:A4F6V5"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6V5"
FT                   /protein_id="CAL99779.1"
FT                   /translation="MAHALGLFFDDSAEDAVRALWKRLEAAGVPSLASRGHRRHRPHVT
FT                   LAVAGRIPEGARHDLRAELSLLSVPDLWLYTLGTFPSDESVLLLGAVVDTELIAVHSAV
FT                   HDVLAGKVSAPSAYYFPGAWIPHCTLAIGITGAELAKGFTELCPPEPIRAPVSEIGVID
FT                   TRTGDVETVLAL"
FT   CDS_pept        complement(486319..487227)
FT                   /transl_table=11
FT                   /gene="mutY"
FT                   /locus_tag="SACE_0432"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /function="A/G-specific DNA glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0432"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99780"
FT                   /db_xref="GOA:A4F6V6"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6V6"
FT                   /protein_id="CAL99780.1"
FT                   /translation="MKIGAERDAATSPLNPVELIDWFAATARPLPWRAPGTTGWGVLVS
FT                   ETMLQQTPVARVQPIWEEWMARWPRPSDLAAAGQAEVLRAWGKLGYPRRALRLHEAAGT
FT                   IAAEHGDVVPSDVDTLLALPGIGAYTARAVAAFAYGRRAPVVDTNVRRVVARAVHGAGD
FT                   AGPPSTRRDLADVEALLPDTDAEAARLSAALMELGQVVCTVRSPACETCPIAHDCAWQH
FT                   AGRPAYAGPPKKVQKFAGTDRQVRGKLLDVLRGTDGPVTRDQLDAVWADAGQRDRCLDS
FT                   LLVDGLLEQTDDGRFALPGEH"
FT   CDS_pept        complement(487286..487819)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0433"
FT                   /product="plant-type carbonic anhydrase"
FT                   /function="Carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0433"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99781"
FT                   /db_xref="GOA:A4F6V7"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6V7"
FT                   /protein_id="CAL99781.1"
FT                   /translation="MTACDEIVHRNELHVRDARDPGLPAQPSLRVAVVTCMDCRIDLGA
FT                   SLGLSTGEAHVIRNAGGAVTDDVIRSLAVSQRKLGTREVMLIHHTGCGMATFTEGEFKG
FT                   ELEAETGQRPSWSVETFADAEQDVRQCMARVRRSPFLGLTTSLRGFVADIGTGALTEVF
FT                   ETAADASAPTGARG"
FT   CDS_pept        487955..488572
FT                   /transl_table=11
FT                   /locus_tag="SACE_0434"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0434"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99782"
FT                   /db_xref="GOA:A4F6V8"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6V8"
FT                   /protein_id="CAL99782.1"
FT                   /translation="MSVASGTLGSAGATFSRVMDPMGPLPSAVYWRRRAVALSAAALAV
FT                   VLSGWAVVAVTGGEPRPRAASAPPPPPPTACPDRALRIVAEPLKPEFRLGDGVGLRIVV
FT                   INDGDRACLRDTNRELRELRVTTPDGEHVWGSNDCYRESTNEVPLLRPGQSVHNDVLWT
FT                   GERSAPECPPTAEVAPAGEYLLVARLGGLTSRPVPFRLIGQS"
FT   CDS_pept        complement(488625..489737)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0435"
FT                   /product="protein of unknown function DUF147"
FT                   /function="predicted nucleic-acid-binding protein (contains
FT                   the HHH domain)"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0435"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99783"
FT                   /db_xref="GOA:A4F6V9"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6V9"
FT                   /protein_id="CAL99783.1"
FT                   /translation="MNEKLRATLAWLAPGTALRDGLERILRGRTGGLVVLGYDEVVESL
FT                   CDGGFHLDVEFSATRLRELSKMDGAVVLSSDATRIVRANVQLVPDASIRTDESGTRHRS
FT                   AERTAIHTGYPVVSVSQSMSIISLYFQGHRHLLIGSPDILSRANQALATLERYTARLAE
FT                   VAQTLSALEIEDYVTLRDAMTVVQRLEMVRRIADEIEVDVVELGQDGRLIELQLDELVG
FT                   AERDTRGTGKRGRTLDRVDVDRELIVQEYLPTGGPMPTSEEVAEALAKLDGTELLDLTA
FT                   IAKAFGYPGTPEVLDQHLQPRGYRLLARVPRLPAVARKQLVEHFGSLQNLLAATAEDLS
FT                   VVESVGESRARQVREGLSRLAEASIMDRYA"
FT   CDS_pept        complement(489734..491116)
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="SACE_0436"
FT                   /product="DNA repair protein"
FT                   /function="predicted ATP-dependent serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0436"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99784"
FT                   /db_xref="GOA:A4F6W0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6W0"
FT                   /protein_id="CAL99784.1"
FT                   /translation="MPAKNARTARPGFRCADCGHEVAKWVGRCPSCQAWGTIDEAAAAR
FT                   PALAKVAAGAPATPARPIAEVDLDSARAVSTGIGELDRVLGGGIVPGAVVLMAGEPGVG
FT                   KSTLLLEVAHRWAATGGGGPSLYVTGEESAGQVRLRAERTDSVHPQLYLGAESDLGSVL
FT                   GHVDSVKPGLLIVDSVQTVQSPEAEGSPGGVTQVRAVTSALVALAKERGLPVLLVGHVT
FT                   KDGAVAGPRVLEHLVDVVLHFEGDRHSSLRMLRGVKNRFGPSDEVGCFEQRDDGIAEVA
FT                   DPSGLFVNRQETQVEGTAVTVMVEGKRPLLAEVQALVTPTQMTMPRRAVSGLDSARVSM
FT                   MLAVLDKHGGVKTGDQEVFAATVGGMKVSEPAADLAVALAVASSRRGVPLPSNVIAVGE
FT                   VGLAGEIRRVNAVGRRLAEAARLGFDHALVPPDSGPLPRGVRTTVVPDIRAALRVLKRA
FT                   RT"
FT   CDS_pept        complement(491341..491955)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0437"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99785"
FT                   /db_xref="InterPro:IPR036182"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6W1"
FT                   /protein_id="CAL99785.1"
FT                   /translation="MASAALGLGAVVALGGCSAGQVTETDTQVAAVSGGNGTVKEIAVR
FT                   DAQMTFPEHGSLYRAGSSAPLKLVLSNDGAVDDRLVQVSSTYAANAEIAGTTDLPAGTA
FT                   LHADGAQQESGHATTQHEPTSSNAPTASNAPTAQPSAQGGPSDQREIRITLNGLTQDIT
FT                   PGVTIPVTFVFEKAGSVTVQVPIGPDHKPRPEHGTPHGSGH"
FT   CDS_pept        492295..492783
FT                   /transl_table=11
FT                   /locus_tag="SACE_0438"
FT                   /product="CarD family transcriptional regulator"
FT                   /function="Transcriptional regulators, similar to M.
FT                   xanthus CarD"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0438"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99786"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6W2"
FT                   /protein_id="CAL99786.1"
FT                   /translation="MVFKVGETVVYPHHGAALIEAIETRVIKGEEKQYLVLKVAQGDLT
FT                   VRVPADNAEIVGVRDVVGQEGLDRVFDVLRAPHTEEPTNWSRRYKANLEKLASGDVNKV
FT                   AEVVRDLWRREKDRGLSAGEKRMLAKARQILVSELALAEGTDEGKAETLLDEVLATAV"
FT   CDS_pept        492811..493485
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /locus_tag="SACE_0439"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   synthase"
FT                   /function="4-diphosphocytidyl-2-methyl-D-erythritol
FT                   synthase"
FT                   /EC_number="2.7.7.60"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0439"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99787"
FT                   /db_xref="GOA:A4F6W3"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4F6W3"
FT                   /protein_id="CAL99787.1"
FT                   /translation="MSVVALVPAAGRGVRLGAGVPKALVPVAGESLLSRAVRGLHDSGR
FT                   VRHVVVAAPADEVPAVEAELASLRSFVHVVPGGAERTDSVRLALAEAERVVPDARVVLV
FT                   HDAARAFTPPSVVRDVVRAVEEGAPAVVPVLPVADTIKQVDEAGDVETTVDRSRLRTVQ
FT                   TPQGFAIDVLRQAYAAAGDIATDDAGLVERIGGKVSTVPGHPHALKITTAFDLAIAEAV
FT                   LA"
FT   CDS_pept        493482..493958
FT                   /transl_table=11
FT                   /gene="ispF"
FT                   /locus_tag="SACE_0440"
FT                   /product="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /function="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0440"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99788"
FT                   /db_xref="GOA:A4F6W4"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6W4"
FT                   /protein_id="CAL99788.1"
FT                   /translation="MIPRIGQGVDVHPVEAGRECWVAGLLWPGEDGCAGHSDGDVASHA
FT                   LCDALLSAAGLGDLGAVFGTGDDRWAGAHGAELLTEARRRVTEAGFGIGNAVVQVVGNR
FT                   PRIGKRREEAQRVLSEVVGAPVSVSGTTTDGLGLTGRGEGIAAVATALVFPVES"
FT   CDS_pept        494095..494244
FT                   /transl_table=11
FT                   /locus_tag="SACE_0441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0441"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99789"
FT                   /db_xref="GOA:A4F6W5"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6W5"
FT                   /protein_id="CAL99789.1"
FT                   /translation="MVAWPCSWFLWSSGGGVNLAVAVVLLWASALGSVVAIVAPMRRQE
FT                   ARRC"
FT   CDS_pept        494455..495138
FT                   /transl_table=11
FT                   /locus_tag="SACE_0442"
FT                   /product="HAD-superfamily hydrolase subfamily IA, variant
FT                   3"
FT                   /function="predicted hydrolase (HAD superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0442"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99790"
FT                   /db_xref="GOA:A4F6W6"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6W6"
FT                   /protein_id="CAL99790.1"
FT                   /translation="MSARAVFFDFSGTLFRLEQDESWFAGVTDSGGAPLDAEAQAELMR
FT                   RMTAPVGPVVGVDAEHQHAWENRDLDPELHRKIYREFLRRSGVAVAEQVDSLYRRLVDP
FT                   GSWTPYPDTAEVLSRLHSDGVRIAVISNIAFDIRPAFERLGVTGLVDEFVLSYLEGVIK
FT                   PDPKIFLRAAERVGVEPGDALMIGDHADVDGAAAAVGCRVAIVDPAPTSERPDALLTAV
FT                   AEHGF"
FT   CDS_pept        495307..496665
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="SACE_0443"
FT                   /product="Cysteinyl-tRNA synthetase"
FT                   /function="Cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0443"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99791"
FT                   /db_xref="GOA:A4F6W7"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4F6W7"
FT                   /protein_id="CAL99791.1"
FT                   /translation="MREFHPRLAGVASIYVCGATVQGVPHIGHVRGGLNYDVLRRWLVH
FT                   NGYDVRLVRNVTDIDDKILTKAADAGRPWWEWATAHERAFESAFDRLGCLPPSALPRAT
FT                   GHITQMIELMQRLIDKGHAYAAGGDVYFSVASYAEHYGRLSGQRLDEVQQGESTASGKR
FT                   DPRDFTLWKAAKPGEPSWPTPWGDGRPGWHLECSAMSTYYLGSEFDIHGGGLDLVFPHH
FT                   ENELAQSTAAGDGFARYWMHNAWVTMSGEKMSKSLGNTVAIPAILQRAAAPEIRYYLVA
FT                   PHYRSTIEYSEPALAEAISAYRRIDSFVNRVRQRTGEVGHGTVPAEFAAAMDDDLSTPQ
FT                   AIAVVHNAIRESNAALDRGDDRAANEAAASVRTMTDILGLDPLSEQWADTRGADDAAHH
FT                   ALSELVGSMLQQRQQARAERDFATADAVRDRLQACGIAVEDTPDGPLWTLKDG"
FT   CDS_pept        496671..497636
FT                   /transl_table=11
FT                   /locus_tag="SACE_0444"
FT                   /product="tRNA/rRNA methyltransferase"
FT                   /function="rRNA methylases"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0444"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99792"
FT                   /db_xref="GOA:A4F6W8"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6W8"
FT                   /protein_id="CAL99792.1"
FT                   /translation="MAGNDRRRGAIRKPGSKKGMVVGSGGQRRRGLEGKGPTPKAKDRV
FT                   SHPAKRKADAAKARAEQQRTRHRQKERSDNAEVIAGRNPVAECIRAGVPASGLYVAQGI
FT                   DADDRVTEAVRGAGSRGISVVEVQRAELDRMTGGAMHQGLALQVPAYEYAHPEDVLTEA
FT                   HNSGLPPLIVALDGVTDPRNLGAVIRSAAAFGAHGVILPQRRSAGLTAVAWRTSAGTAA
FT                   KLPVARAVNLTRTLKDLKSEGLMVVGLDADSDITSDELELATGPLVVVVGSEGRGLSRL
FT                   VRETCDQTVSIPMAGSVESLNASVAAGIVLAEVARRRRAR"
FT   CDS_pept        complement(497658..498710)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0445"
FT                   /product="conserved hypothetical protein (putative membrane
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0445"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99793"
FT                   /db_xref="GOA:A4F6W9"
FT                   /db_xref="InterPro:IPR005552"
FT                   /db_xref="InterPro:IPR018929"
FT                   /db_xref="InterPro:IPR025659"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6W9"
FT                   /protein_id="CAL99793.1"
FT                   /translation="MSAPPPPGWYPDQADPRYVRWWDGRQWTPHAQPAQPQPAAQQQPQ
FT                   PAAQPQPMAQPGPAAQPQQPGPPQPMPPQAPAAQPLAPGQPMPPGTPAPGQPVQQPGRP
FT                   FQQGPHQSPMPQAEDSSSIELALGGTGDSASVQQQVQQRAGVGGHVGGGGGTLFTEPVL
FT                   VVNQKAKLIEMANEYAVYDQTGRQIGSVVQTGQSGAQKALRLLTKLDSLMTVTLEIRDV
FT                   AGQPVLRLTRPATMWKSTVHVQRPDGSPVGDIRMENVWGKVRFAFEAGGQRVGGIHAEN
FT                   LRAWDLRVLDRDEQQVGQISKTWQGLAKAAFTTADNYVLQIFRPLPEPLNSLVVASALT
FT                   VDTVLGQAQR"
FT   regulatory      497781..497817
FT                   /regulatory_class="terminator"
FT   CDS_pept        498892..500325
FT                   /transl_table=11
FT                   /gene="algI"
FT                   /locus_tag="SACE_0446"
FT                   /product="alginate O-acetyltransferase"
FT                   /function="predicted membrane protein involved in D-alanine
FT                   export"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0446"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99794"
FT                   /db_xref="GOA:A4F6X0"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR024194"
FT                   /db_xref="InterPro:IPR028362"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6X0"
FT                   /protein_id="CAL99794.1"
FT                   /translation="MSFASPLFLWYFLPLVLVAVLVAPRRARNAVVAAASLLFYASGAG
FT                   GTTLLLLACIVVNFVAGRFLEPDQWSAGQGRRKLLLIGTVTFDLLILALWKYAGFATEQ
FT                   AAVLASWFGGGFPVLQLALPIGISFYTFHHISYVVDIYRGERPALRDPVSFVTYIAMFP
FT                   QLVAGPIVRYREIADQLPQQRTHRLDDIAAGFPRFAWGLTKKVVIADTLAPMVDTAFAT
FT                   PAEDMTFAIAWLGAIGYAMQLYFDFSGYSDMAIGLGRMLGFRLPENFARPYSSVTVTEF
FT                   WRRWHMSLSRWFRDYVYIPLGGNRHGVAKTYRNLAIIFVLTGFWHGAAWTYLVWGLFHG
FT                   LMLVVERATGLDRAPSAPAARIGRRALTMLLVVVGWVFFRAPDLGTAFTMLGHMLVPDL
FT                   GGLGDIVSASVTNQRMFFLLVALVVVFLPANSGTGPFLESVRSRPANVLRVSVLTAGLA
FT                   YSGLLVATGSFSPFLYYQF"
FT   CDS_pept        500354..500689
FT                   /transl_table=11
FT                   /gene="comA"
FT                   /locus_tag="SACE_0447"
FT                   /product="ComA"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0447"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99795"
FT                   /db_xref="InterPro:IPR001322"
FT                   /db_xref="InterPro:IPR036415"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6X1"
FT                   /protein_id="CAL99795.1"
FT                   /translation="MDSGQVKGTQADEYVEIQNRGPVAAEMSGWVLGADDSGQDFTFPP
FT                   GTVLQPGQRIRVYTNEMHPGYGGFSYGIKRPIWNDKGDTARLKDANGHVVSKLPYGEKA
FT                   KVGAGKP"
FT   CDS_pept        complement(500869..501162)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0448"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99796"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6X2"
FT                   /protein_id="CAL99796.1"
FT                   /translation="MATHTQHTGHDHVHGEGCGHVAIPHQDHIDYVHDGHLHRAHGDHY
FT                   DECENGEHTTHEQHDHVHGEGCGHVSVPHGDHVDYLHDGCRHAPHGDHYDEH"
FT   CDS_pept        501452..501718
FT                   /transl_table=11
FT                   /locus_tag="SACE_0449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0449"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99797"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6X3"
FT                   /protein_id="CAL99797.1"
FT                   /translation="MSRTALRWTVAATAAAALTLGGGTAAFAQELTIRPANSNQPGSLL
FT                   VLLDLGREYHVHPAPQSTQAKQATNATATSNTTKPGTVSGSAI"
FT   CDS_pept        501876..503156
FT                   /transl_table=11
FT                   /locus_tag="SACE_0450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0450"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99798"
FT                   /db_xref="GOA:A4F6X4"
FT                   /db_xref="InterPro:IPR031811"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6X4"
FT                   /protein_id="CAL99798.1"
FT                   /translation="MPVNHPTELPAVHEAWLPREHPLHRPRHGRRQLTALVCAVLFFSA
FT                   PVLSWLFGARAEPLENRPLAAFPSITDGWGMLTGLNPWATENLPFRKNAVQSVDALSRG
FT                   VFGEPARLEGSSHTSPVGTGQVDAKPTLDETVFPNVIEGKHGWLYLGHDVSYRCVPKME
FT                   LDRVIAGLKRWRSVVEASGRRFQLVIAPDKSTVYPENMPDSYPGQDCSAKAQAEFWRRV
FT                   PAATGAIDMRGQLRQVAERNGRPIYHDIDTHWTHEGGVAMTYQLAERLRPGTTATWKVL
FT                   PSRQYDHSADIPDLLGQDRTVPIQAYSLAPDGGADNTRFQASNFHQPLHLSSPPKPGMV
FT                   DRPMRMVGDSFTQFASPYLAAAFTDVTIAHPDSVAENPQAMGTLLADGEIVTFELSERF
FT                   VVGGRYPMLDPAVADQVGAVLAQHPVR"
FT   CDS_pept        complement(503157..504035)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0451"
FT                   /product="ABC-type transporter, permease component"
FT                   /function="ABC-type Mn2+/Zn2+ transport systems, permease
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0451"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99799"
FT                   /db_xref="GOA:A4F6X5"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6X5"
FT                   /protein_id="CAL99799.1"
FT                   /translation="MNTLIDAMGKLFDFETTSSLLGYPFVQQALLAAAALGLVSGVLAP
FT                   LVVARKMSFAVHGTAELAFTGAAAALLIGVGVGVGALAGAVVAALLLGLLGQRGTERDS
FT                   VIGAILSFGLGLGVLLLWMNPERTSNKFSLLVGQIVGVDSSDVVLLTSCAAAVLLVLAF
FT                   VYRPLLFASVDPDVAAARGVPARVLTPLFAVLVGVATALGVYTVGALLVLALMVTPGAA
FT                   AARVTASPVKATLLAVVFAEVAVLGGIVLSLAPGAPVSAFVTIISFVIYLVCRVVGNLR
FT                   LRRLTRTPVPA"
FT   CDS_pept        complement(504032..504901)
FT                   /transl_table=11
FT                   /gene="fhuC"
FT                   /locus_tag="SACE_0452"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /function="ABC-type Mn/Zn transport systems, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0452"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99800"
FT                   /db_xref="GOA:A4F6X6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6X6"
FT                   /protein_id="CAL99800.1"
FT                   /translation="MTAKPEAGHSGHDSTAVADRAPSRAPAVQLRGAQLSYGTRVLWDG
FT                   LDLDVEPGEFLAVLGPNGSGKTSLLRVLLGLQPLSSGSVKVAGAPAHRGSARIGYIPQQ
FT                   RAVDATLTVRGRDLVGFGLDGHHWGMGIRQRRERRRRVDDALRAVDATAYAKMPLGLLS
FT                   GGEQQRLRVAQALVSDPAVLLCDEPLLSLDIAHQRKVSRLISQQARDAGAAVLFVTHEL
FT                   NPVLPLVDRVLYLVGGRFRIGTPDEVMNSETLSELYGTRIEVARVGGRLVVSGVDEEGC
FT                   HVHEAEQA"
FT   CDS_pept        complement(504930..506087)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0453"
FT                   /product="ABC-type transporter"
FT                   /function="ABC-type metal ion transport system /surface
FT                   adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0453"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99801"
FT                   /db_xref="GOA:A4F6X7"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6X7"
FT                   /protein_id="CAL99801.1"
FT                   /translation="MTPSRPKTRRLPRTCTALVGVTAAALAMTGCGAGQQGSSAADGKV
FT                   KVVASTSVWASVAQAVGGDHVEVEPLISDPNADPHSHESTPQDAAKVTDADLVILNGGG
FT                   YDEFVEQILAGQPKPTVEAVSVPEAPHGEPGEGEQPPAPGEPAPPADEHDHGAPGEQPA
FT                   PADEHGHAAPAPADEHEHGHDQPAPAPADDHGHAAPGEAHEHGHDHSGNEHVWYDLHLV
FT                   HGVADRIAQELGKLQPANAQAFTGSAARFAQDVHGLEGRVEQIAAAHQGKKVIVTEPVA
FT                   HYLIEDAKLTDITPPAFVNAIAAESDPSAAAVAEVQNAVRSGQAGALVYNPQTESPVTE
FT                   SVRKAAEENRIPVVEMTEVLPEGQTYVQWMDAQISALDAALNRKP"
FT   regulatory      complement(506203..506248)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(506265..507350)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0454"
FT                   /product="sugar ABC transporter, ATP-binding protein"
FT                   /function="ABC-type sugar transport systems, ATPase
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0454"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99802"
FT                   /db_xref="GOA:A4F6X8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6X8"
FT                   /protein_id="CAL99802.1"
FT                   /translation="MAEVAYVNASRVYPGSPPVRAVDELGLDVADGEFLVLVGPSGSGK
FT                   STALRMLAGLEDVDEGAITIGGNDVTHTPPKARDIAMVFQSYALYPHMTVAENMGFALK
FT                   LRKTPKQQIREKVTEAAKMLDLEKYLDRKPKALSGGQRQRVAMGRAIVREPSVFLMDEP
FT                   LSNLDAKLRVETRANIAALQKRLGTTTIYVTHDQVEAMTMGHRVAVLKDGLLQQCASPR
FT                   ELYENPANAFVAGFIGSPAMNLKTVPLSGGGAVLDGHTIPVPRGATDGLDEVTFGVRPE
FT                   ALELTSSSEDGLDMTVELVEELGADALVHGTIDVGGSAERFVVRTDGRTPPALGQRVRV
FT                   ALRDAGEVHLFHPETGARLAA"
FT   CDS_pept        507537..508637
FT                   /transl_table=11
FT                   /locus_tag="SACE_0455"
FT                   /product="transcriptional regulatory protein (probably
FT                   LacI-family)"
FT                   /function="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0455"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99803"
FT                   /db_xref="GOA:A4F6X9"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6X9"
FT                   /protein_id="CAL99803.1"
FT                   /translation="MARSTNARRPATLASLAAELGVSRTTVSNAYNRPDQLSPELRKRV
FT                   LDTARRLGYPGPDPVARSLRTRKAGAVGLLLTENLSYAFRDPGAISFLEGLSLACEDAG
FT                   HGLLLIPASPEREDVASVHRAGVDGFVVYSVPEDDPHLAAVLERPVPVVVCDQPRLDNL
FT                   DWVGPDDARAIKSMADHLIKLGHRRIGVSCMRLARGRNDGLASVQRQANASFHVQKSRL
FT                   TALAESFSEAGVDWTKVPVVERFDHTAASGASAARQLLDLDPDITAIVCTSDILALGAL
FT                   NEARSRGLRVPEDLTVTGFDGIADAERAGLTTVRQPVLEKGRAAGRLLLETSEPGRPRE
FT                   VVLETQLITGTTAAPPRSREERWFGP"
FT   CDS_pept        complement(508722..510314)
FT                   /transl_table=11
FT                   /gene="speE"
FT                   /locus_tag="SACE_0456"
FT                   /product="putative spermidine synthase"
FT                   /function="predicted spermidine synthase with an N-terminal
FT                   membrane domain"
FT                   /EC_number="2.5.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0456"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99804"
FT                   /db_xref="GOA:A4F6Y0"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Y0"
FT                   /protein_id="CAL99804.1"
FT                   /translation="MSVSTEPRDETEPAAAPRPRGRLARTAVLVAVFVCAACGLVYELA
FT                   LVALGSYLIGDTIGQASIVLSLMVFAMGVGALAAKPLQRWAAAAFALVELVLALLGGLS
FT                   VLLLYAAFAWVGLYLPALIVTALVLGALIGAEIPLLMVLLQRIRKQDAGSAVADLFAAD
FT                   YVGGLVGGLAFPFLLLPLFGQIQGALLVGMLNAAAGLGLVLTVFRRELSKRVRLVLVAA
FT                   SALVGGVLLVAYVFADDFEVTARQALYADPVVHAERTDYQDVVLTERVSLSGRGDTRLF
FT                   LNGDLQFSSVDEYRYHEALVHPAMAGPRSRVLVLGGGDGLALREVLRYPDVQQVTLVEM
FT                   DPAVLDLAREDPRVAGLNRHAFDDPRVRTVSADAFAWLRDNRERYDVVLVDMPDPDSTA
FT                   TAKLYSTEFYALVRHAMADGARVNVQAGSPYFAPQAFWCIEATTRAAGISTVPYEVSVP
FT                   SFGEWGFHLGTAGAAPPLELPAGAPPLRSLDAGTLRAAAEFPPDRRRIPGMEPSTLMHP
FT                   TILSYAQGEWTNY"
FT   CDS_pept        complement(510411..510836)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0457"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99805"
FT                   /db_xref="GOA:A4F6Y1"
FT                   /db_xref="InterPro:IPR007140"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Y1"
FT                   /protein_id="CAL99805.1"
FT                   /translation="MLQELLSGLLAAVAYGVIGVLMMALGYVLVDLATPGRLRDLIWVQ
FT                   RNPNAALLLVSGLTGVGVILTTAIAASADDLIAGLVGTLAYGLLGLVLMSLSFLLIDAL
FT                   TPGKLGDELASPNMHPGTWVSAVAHVVISVLIAAAIW"
FT   CDS_pept        complement(510883..511884)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0458"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0458"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99806"
FT                   /db_xref="GOA:A4F6Y2"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Y2"
FT                   /protein_id="CAL99806.1"
FT                   /translation="MSAGPNQSAGKKKTKAGTWILLAALALLLAIGAISSWAGDDDSPA
FT                   FTDEDTTTYSQSTSYSGPPIRRFTPADSQQLAQQLAVAEKQHGVCFGWKLTDGRDGRFD
FT                   QGSSRGPGVPADTCPRWAEVRTFVANPAGDLGAAGVEVAASPDFDRGALPGTSEYPLVG
FT                   VDAEALVENPVATTGHAALVLPLLLAERGELRAPPVADGEPGARPAKPLPAARSSDGAW
FT                   SIWLWIGGLGLVALVCVLVGVRASGRKKGEQGPPPGGPGPHPPAQGFPQQHAGPHPGGQ
FT                   QPQQQPPAQGFPPQQPGPRPQAPPPHGAPPPHGGPQQPPWPPQAPPPGGPRH"
FT   CDS_pept        complement(511881..512318)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0459"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0459"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99807"
FT                   /db_xref="InterPro:IPR025341"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Y3"
FT                   /protein_id="CAL99807.1"
FT                   /translation="MKPRLWFLLGGICAVLALVIALVMIFSTGTGPRGYVANHYQRAAH
FT                   LDLRGDDDNRAYTSPLTPSVVSREITSRWQPVAQAADTSGIYLRYKDDAVIVQPRDRGS
FT                   VIHVMDVDHAYHRYHSHVGGTWGWIGTHGESFRGRGPGAGK"
FT   CDS_pept        complement(512315..512944)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0460"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99808"
FT                   /db_xref="GOA:A4F6Y4"
FT                   /db_xref="InterPro:IPR025235"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Y4"
FT                   /protein_id="CAL99808.1"
FT                   /translation="MKVVLAIVVVILAIMAVAAVVYLVYTRRGGGDQRAAAPRDPFHTG
FT                   DEDSLRGDPRALKAGDIVEIRGHSYTVRGSLRLSEGGWKWSEHLLDDAKGGQVWLSVEE
FT                   DPDLVLAQWLPAADAGEPGASTIEFGGRTYRSDESGSASFRSEATTGLDEQGTVGYHDY
FT                   EASDGSLLSFERYGDAGWEASTGEQLSRYDVLIYPTAGGTGQEGGR"
FT   regulatory      complement(513059..513113)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(513124..515670)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0461"
FT                   /product="probable trehalose-phosphatase/glycoside
FT                   hydrolase"
FT                   /function="Glucoamylase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0461"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99809"
FT                   /db_xref="GOA:A4F6Y5"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Y5"
FT                   /protein_id="CAL99809.1"
FT                   /translation="MTAEALPAELRRVIVQLARTPRLLVACDYDGTLAPIVADPNMAKP
FT                   LPESVHALRSLAALPATTTAVISGRALRDLATLSRLPAEVHLVGSHGSEFDVGFVHELA
FT                   PEATQLRTDLQRALQETVSGHGGVSLENKPASVAVHVRRAEPDTAQIVLDAVRSGPATW
FT                   DGVEVTEGKEVIELAVVQTDKGNALDTLRHQVGATAAIFIGDDVTDEKAFARLHGPDVG
FT                   LKVGPGESLADYRVEDTTEVATVLAFLMEERRTWLYGEQAPPIERLTMLSNERTVALLT
FT                   PDARLTWMCHPGPDSAAVFADLLGGPGAGHFSIRPSTGNGAPRNPLPLGQRYVPGTMTV
FT                   ETRWSRLLVTDYLEHGVDSHRTDLIRVISGSTQAAIEFAPRPEFGQVPVRLTAEAGGLR
FT                   VQGTAEPMVLHSPGVQWEITSDGMHESAHAVVEPTDTRPVVLELRCGTEDLAPSPMSES
FT                   QRRAAADAYWAEWAGKLRLPELERDLVQRSALTLRGLCNSDTGGIMAAATTSLPEEIGG
FT                   VRNWDYRYCWLRDGAMTAQALVTVGSTKEAEAFLDWLHRVLETLPGPERLHPLYTLAGT
FT                   GLGPEAVIDSLPGYAGSRPVRVGNLADQQVQLDVFGPVVELVAHLAEATGRIRDADWDL
FT                   VKAMAEAVSHRWFEPDHGIWEERDVPRHHVYSKVMCWVTLDRALKLAKTYERAPEPSWE
FT                   PLREQIAQDVIKNGWHPDVQAFTTAYEGSDLDAASLHVGLSGLIDPSDERFTATVTAIE
FT                   AELRSGSTVYRYRRDDGLPGDEGGFHLCAAWLIEAYLLIGKRTEAEELFQQIVDTAGPT
FT                   GLLAEEYDPIAERSLGNHPQAYSHLGLIRCAQLLSA"
FT   CDS_pept        complement(515828..517267)
FT                   /transl_table=11
FT                   /gene="otsA"
FT                   /locus_tag="SACE_0462"
FT                   /product="trehalose-6-phosphate synthase"
FT                   /function="Trehalose-6-phosphate synthase"
FT                   /EC_number="2.4.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0462"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99810"
FT                   /db_xref="GOA:A4F6Y6"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Y6"
FT                   /protein_id="CAL99810.1"
FT                   /translation="MSKGSTPQRADFVVVANRLPVDLERLEDGTERWKHSPGGLVTALE
FT                   PFLRARRGAWVGWPGVADTEVEPFTDEDMHLHPVPLSSAEFRDYYEGFSNATLWPLYHD
FT                   VVVPPVFDRSWWDAYQRVNRRFAEAAARVSAEGATVWVQDYQLQLVPAMLRELRPDLRI
FT                   GFFLHIPFPPVELFMQLPWRTEIVRGLLGADLVGFHRPGGAQNFLWLARRLAGFEPSRG
FT                   QVGVRSRPGVVQVGDRTVRVGAFPISIASAELDRLARSKEVQQRAREIRRELGEPRRIM
FT                   LGVDRLDYTKGIDVRLHAMHELLADGHIKAEDVAMIQIATPSRERVEHYKQMREDIERE
FT                   VGRINGEFGRVGHPAVHYLHTSVDRKDLVAFYCAADVMVVTPVRDGMNLVCKEYVACRH
FT                   DLGGALVLSEFAGAAAELTSAFLVNPHNLDGVKDALLAALDIDEAEGRRRMRALRRQVL
FT                   THDVDRWARSFLEALGTPHAE"
FT   CDS_pept        complement(517594..519045)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0463"
FT                   /product="possible amino acid export carrier protein"
FT                   /function="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0463"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99811"
FT                   /db_xref="GOA:A4F6Y7"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Y7"
FT                   /protein_id="CAL99811.1"
FT                   /translation="MGITQRARGVLRRREPAVSAGNRNVVYGPALPDESAVHLVLDLGL
FT                   RIGEIQMSSGAGASDVTATIIAVANAYGLPHCEVDVIYTSITVSCYRGTESLPITSLRV
FT                   VRNRSLDYTRLSETEALVRRITANELSAADAYAELNRISTAPHPFPRWVATLAWAGMAA
FT                   SLAVLLGGGADWRLPLIAAATAALIDRVGRVLNRRALPFFFQQAVGGAVATTIAMGCFA
FT                   TGLLPNPALAVAASIIVLLSGMTVVGSMQDAITGYNVTAAGRITELALMSAGLIAGVVV
FT                   ALYAGLRIFGSDALGGANFDEAMLQNFGRAQVTSPVLLPLVQLAAGASTSACFALASYA
FT                   PPRPLVVAGVGGAVAAFVHAVLTLADVHTVLAGAVATTIVGFIGGIIARRLRIPALVIA
FT                   VSGVAPLLPGLATYRGLYELSVLGSPTGVSTLMLAVAIGLALGSGVVLGEYLAQPVRTR
FT                   LGRLERRFAGPRMSGPLRPTRRRLE"
FT   tRNA            519360..519435
FT                   /gene="tRNA-Thr (TGT)"
FT                   /locus_tag="SACE_8012"
FT                   /product="transfer RNA-Thr (TGT)"
FT   misc_recomb     complement(519391..519436)
FT                   /standard_name="pSE101 AttB2 site"
FT   CDS_pept        complement(519500..520846)
FT                   /transl_table=11
FT                   /gene="int"
FT                   /locus_tag="SACE_0464"
FT                   /product="integrase (recombinase)"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0464"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99812"
FT                   /db_xref="GOA:A4F6Y8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Y8"
FT                   /protein_id="CAL99812.1"
FT                   /translation="MPRKRRPEGTRAPNGASSIYYSETDGYWHGRVTMGVRDDGKPDRR
FT                   HVQAKTETEVIDKVRKLERDRDSGNARKPGRAWTVEKWLTHWVENIAVHSVRYKTLQGY
FT                   RTAVYKHLIPGIGAHRMDRIEPEHFERFYARMQAAGASAGTAHQVHRTAKTAFNEYFRR
FT                   QRITGNPIAFVKAPRVEEKEVEPFTPQEAKSIITAALKRRNGVRYVVALALGCRQGEAL
FT                   GFKWDRLDRGNRLYRVRQALQRQAWQHGCDDPHACGARLHRVACPDNCTQHRNRKSCIR
FT                   DEKGHHRPCPPNCTRHASSCPQRHGGGLVEVDVKSKAGRRSFVLPDEVFDLLMRHEQAQ
FT                   QRERKHAGSEWQEGGWVFTQPNGRPIDPRRDWGEWKDILGEAGVRDARLHDARHTAATV
FT                   LMLLRVPDRAVQDHMGWSSIRMKERYMHVTEELRREIADQLNGYFWDVN"
FT   CDS_pept        complement(521245..521859)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0465"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99813"
FT                   /db_xref="GOA:A4F6Y9"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Y9"
FT                   /protein_id="CAL99813.1"
FT                   /translation="MNGPVSPAGASGYPLAIHWPGPLGTACENAPQVGKWMPGGSGVEA
FT                   AIPGGFPPTRPPTHSTTRHQAQPRPGGQVDRVNTPPGNTSARRCRAVRTVHPPRSNRPP
FT                   TTTPGRPTMTPLDITGRVLAVLAALALLTAAAVAVLLWRAVLPVILIAALAVTLGMVRT
FT                   LALGGFAALAALRGLMLALDRAGTAVPTPRLRTARPSAHTR"
FT   CDS_pept        complement(521856..522134)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0465a"
FT                   /note="xis-like"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0465a"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99814"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Z0"
FT                   /protein_id="CAL99814.1"
FT                   /translation="MTTAVTSPSRPNIGVGGGAVPAVPAVPPQVSAGRQHALGRHEPSH
FT                   RPQRRALLGRHEPSHACKPSQPDQHWDAWDGWDGYPLTPYRRAARGQ"
FT   CDS_pept        complement(522131..522361)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0466"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0466"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99815"
FT                   /db_xref="GOA:A4F6Z1"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Z1"
FT                   /protein_id="CAL99815.1"
FT                   /translation="MSTPAPASLPRPRESGDATRLLLTVEQAARRLSVGRTTMFKLIKS
FT                   GDVDSVRIGHARRVPVEALTAYIDRLARGAA"
FT   CDS_pept        complement(522644..524110)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0467"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0467"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99816"
FT                   /db_xref="InterPro:IPR025048"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Z2"
FT                   /protein_id="CAL99816.1"
FT                   /translation="MSKPEHPAATPAEQPRRLRLVSDSDQPTASPEAPGTGTGPMLPPD
FT                   PETERQALAQIASARAELPARDEAMFETFLGDLVRQVQPTSEADPTNILASLLAGTGVH
FT                   LGGRPHIRVGDDRHPLLVWPMVIGRTGIGRKGAGWSAAKRLLTAADSGFVASNIHSGLT
FT                   SGEGLTQAFADEDEGDGTEPGKGKPRPRALLPSGDRRLLAFEPEWASVMARMRREGNTL
FT                   SATLRAAWEGGNLSTLGVTARIVRDAHVGILTHITPGEFHAKVSHSDMAGGTYNRFLPV
FT                   FVAQTQFLPAGTGADPALIERLAVDLRARLDQGATLGQLGFSDEAAYLWRRLYVEFGGF
FT                   STEDGPIEQFLSRAAPNCLRVAGIHAALDGTPTIQPAHLVAAAAFIRYAVDSARAVFRQ
FT                   ADPALAQLAAYIREAGPQGRTRTEITAGFFQGNARKTRIEALLDQLIADHTIAKTQRRP
FT                   EGRKGGRATEIFIAYEHHELTNNAPDQGKP"
FT   regulatory      complement(525089..525147)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(525201..525536)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0468"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0468"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99817"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Z3"
FT                   /protein_id="CAL99817.1"
FT                   /translation="MTVPKVTVHGVVTVLYACPLTDAQLRDAEVYDLARFVALVHRKTP
FT                   RKAIERLENGLAVLAASGGPTFDRRRYALAQARADAVRAVTRPPAPGRDTPAVHPVELE
FT                   PDAIWPN"
FT   CDS_pept        complement(525536..525913)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0469"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0469"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99818"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Z4"
FT                   /protein_id="CAL99818.1"
FT                   /translation="MSVRLRQYRTARGWSQKTACQHLAEAARSRGIRAHSPGTLLGLLG
FT                   EWERGVRVVSSTYQQLWAEVYGTTPGMLGIAGAWSRNHPVVTRADIERGAPTPQVVSSP
FT                   KDPLIGGLSGAERIELEGVAA"
FT   CDS_pept        complement(525919..526320)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0470"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99819"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Z5"
FT                   /protein_id="CAL99819.1"
FT                   /translation="MRLHTERAQGMVGDHHATFIPTHREDNDTPIVMQVSMSVPVSLED
FT                   IEAVFWIAVNGGMLLDERELGNDQYAHEMVLETFLHEGSNRICLAREEIEDIKPGSGDY
FT                   ALLMMIRRRVAELYGRPGVPAPRRALTRA"
FT   CDS_pept        complement(526323..526568)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0471"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0471"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99820"
FT                   /db_xref="GOA:A4F6Z6"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Z6"
FT                   /protein_id="CAL99820.1"
FT                   /translation="MFKVKAVADLLNISKATIYRAIESGKLDALKLGTGKGTLRIEGSA
FT                   LNIYLEQCGQAAYEAFVTGTESAAADDRDETAGEVA"
FT   regulatory      complement(526695..526754)
FT                   /regulatory_class="promoter"
FT   CDS_pept        526899..527141
FT                   /transl_table=11
FT                   /locus_tag="SACE_0472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0472"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99821"
FT                   /db_xref="GOA:A4F6Z7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Z7"
FT                   /protein_id="CAL99821.1"
FT                   /translation="MADEYGVAINTARSALEILRQEGLIAVRHGQGSYVLSQPESGGAD
FT                   AENADVPSVAAVHQQLAEINRRLAAIEERLNELAR"
FT   CDS_pept        complement(527153..527332)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0473"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0473"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99822"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Z8"
FT                   /protein_id="CAL99822.1"
FT                   /translation="MAKQSFPMMKTGGGVLPKLFGWAVLIVVVVMVVQQPTESAEFVKT
FT                   TFGALKTFFGAVAG"
FT   CDS_pept        527632..528612
FT                   /transl_table=11
FT                   /locus_tag="SACE_0474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0474"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99823"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Z9"
FT                   /protein_id="CAL99823.1"
FT                   /translation="MYTEWEQGRVLPTDWRDELCEVFALPPAALGFVDTAPPPSALDIP
FT                   SALEITRIDAEIVEMLEQQTDHYRLMDRKVGAAIIPQTVAHVEHMEKLLRTALPGKHSH
FT                   LAAVALAEGAALAGWQALDAGDVTKAWNLHDVAKAAARQGEDPAVFAHVTAQQAYALLD
FT                   AGRATEAVELVQYAHTPEIARRVPARLRAWLAAAEAEFLAAAGQHRQALTMLDQAADAL
FT                   PEGDTDPELPFLMLNSTHLARWRGHCLARLGADEAVDDLTRALEGSQVLSSKRAESGLR
FT                   VDLALALRKRGDIEGSKTHAQRAAELAGSTGSARQRARIAKLLVD"
FT   CDS_pept        complement(528614..528802)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0475"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99824"
FT                   /db_xref="UniProtKB/TrEMBL:A4F700"
FT                   /protein_id="CAL99824.1"
FT                   /translation="MLRNPHHVFLGRGAELVGDATEVNEGKFEWVPVANVPNLIREGKV
FT                   KNSGTLVGLLHYLALGR"
FT   regulatory      528635..528682
FT                   /regulatory_class="terminator"
FT   CDS_pept        529484..529735
FT                   /transl_table=11
FT                   /locus_tag="SACE_0476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0476"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99825"
FT                   /db_xref="UniProtKB/TrEMBL:A4F701"
FT                   /protein_id="CAL99825.1"
FT                   /translation="MGSFVGRACSEVLCHLISGNRSAGCHVGESFAEVPYELGVGEHFD
FT                   RFSQPIDLARRHDVGNVLAMRDDGHALATFGTLDGFVP"
FT   misc_recomb     complement(530248..530293)
FT                   /standard_name="pSE101 AttB1 site"
FT   CDS_pept        complement(530505..530738)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0477"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99826"
FT                   /db_xref="InterPro:IPR028037"
FT                   /db_xref="UniProtKB/TrEMBL:A4F702"
FT                   /protein_id="CAL99826.1"
FT                   /translation="MSIMDKLKEFVGKSPDKFHRGIDKAASAADEKTGGKHSDKINRGA
FT                   EQARKYVDRQGEQGGPEQGGAGRPPGGGPGQP"
FT   CDS_pept        531115..531393
FT                   /transl_table=11
FT                   /locus_tag="SACE_0478"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0478"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99827"
FT                   /db_xref="GOA:A4F703"
FT                   /db_xref="InterPro:IPR021449"
FT                   /db_xref="UniProtKB/TrEMBL:A4F703"
FT                   /protein_id="CAL99827.1"
FT                   /translation="MRRTRREVALITDAAPSLTEEQRGRKRTYSVLMVLHLAGLTLAAL
FT                   LVDVPWLALGILVLTGPLLWVATVLANSRPPPERRRRAPPPCRALGG"
FT   CDS_pept        complement(531399..531524)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0479"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0479"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99828"
FT                   /db_xref="UniProtKB/TrEMBL:A4F704"
FT                   /protein_id="CAL99828.1"
FT                   /translation="MRTGEVVELTADLGAGRRLELAADIGSCAAIPVLLDPVLRP"
FT   CDS_pept        complement(531497..531994)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0480"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99829"
FT                   /db_xref="UniProtKB/TrEMBL:A4F705"
FT                   /protein_id="CAL99829.1"
FT                   /translation="MSKRWSSWNTGTKLSAIGALLALLTLLGSSISWLADGLSVRDRLW
FT                   GKEEPPPATRTTASASADTPAPTTPVAEPESDEVNLLDADAVEGGDYVAVGRATVAGRN
FT                   PERALVHPGTSVTTYNADGMRELRARAALDDHSQSCAVTFEVRSTARCASAAPCAPARS
FT                   WN"
FT   CDS_pept        532118..532477
FT                   /transl_table=11
FT                   /locus_tag="SACE_0481"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0481"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99830"
FT                   /db_xref="UniProtKB/TrEMBL:A4F706"
FT                   /protein_id="CAL99830.1"
FT                   /translation="MAISSTVWPTTTFSLCTRAVDLHVEGDRAARGAVLQPDQGAEGPH
FT                   ARVDVVGHRARGAVEQQPGEGGDVVGRVVAVVVGRARWLVEAVVLGAVLGVAGGAATVT
FT                   VGADAAWDPCCRSMR"
FT   CDS_pept        532918..533646
FT                   /transl_table=11
FT                   /locus_tag="SACE_0482"
FT                   /product="hydrolase"
FT                   /function="Trypsin-like serine proteases, typically
FT                   ,contain C-terminal PDZ domain"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0482"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99831"
FT                   /db_xref="GOA:A4F707"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:A4F707"
FT                   /protein_id="CAL99831.1"
FT                   /translation="MSIARTLAGAVGAALAMATFAAPAQAAEPTPPPDMRPMIIDGSEV
FT                   DSAPWAARLFVNGQENCSATIIAPEWVLTAQHCVDGAGDGVSFNIGNVDQTQGEKANAK
FT                   PGGVHVHDTADLALVNIDHAVQTEYAPLGSTGDVNVGDTAQTYGWGATCTDKPEIQCQS
FT                   QILKVANVNVTDIACQDYRGGTAVCATRGDGIPAGGDSGGPMFANNVQVGVASTSDRAE
FT                   NTAYTNITEYRDWIKQLAGV"
FT   regulatory      533665..533715
FT                   /regulatory_class="terminator"
FT   CDS_pept        534156..534557
FT                   /transl_table=11
FT                   /gene="ectA"
FT                   /locus_tag="SACE_0483"
FT                   /product="putative L-2,4-diaminobutyric acid
FT                   acetyltransferase"
FT                   /function="Histone acetyltransferase HPA2"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0483"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99832"
FT                   /db_xref="GOA:A4F708"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR012772"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017255"
FT                   /db_xref="UniProtKB/TrEMBL:A4F708"
FT                   /protein_id="CAL99832.1"
FT                   /translation="MWCRDFAQTSAVARVDGEVVGFVTGFIRPDASDTIVVWQIAVDAS
FT                   QRGGGVAGKLLSHLLDRVVPRGVRYLETTITPDNTASIKLFSALARDRGAELVSSELFT
FT                   AELFPDAHLGEDLYRIGPFAAAPAAAGGA"
FT   CDS_pept        534691..535938
FT                   /transl_table=11
FT                   /gene="ectB"
FT                   /locus_tag="SACE_0484"
FT                   /product="diaminobutyrate--pyruvate aminotransferase"
FT                   /function="4-aminobutyrate aminotransferase"
FT                   /EC_number="2.6.1.76"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0484"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99833"
FT                   /db_xref="GOA:A4F709"
FT                   /db_xref="InterPro:IPR004637"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR012773"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4F709"
FT                   /protein_id="CAL99833.1"
FT                   /translation="MNNIFESLESEVRSYCRTWPAVFDVAKGSYLYAEDGTAYLDFFAG
FT                   AGALNYGHNNPVLKRKLLEYLERDGVTHGLDQATKAKREFLETLDEKLLKPRGLDYKVQ
FT                   FPGPTGTNSVESALKLVRKITGRESIISFTNAFHGMTLGSLSVTGNSMKRGGAGIPLVH
FT                   ATPMPYDDYFDGQVPDFLYFERMLEDSGSGLNEPAAVIVETLQGEGGINSSRPEWLRGL
FT                   YELCQKHGILMIVDDVQMGCGRTGPFFSFEEAGIQPDIVCLSKSIGGYGMPLALTLIKS
FT                   EHDVWDPGEHNGTFRGNNPAFVTATEALKEYWSDDRLEKSTIAKGERVGEVLDELVAKY
FT                   DGALAKGRGLARGLGFEDPEIAGKVSKAAFDRKLILETSGPDSEVIKIMPPLTVSDEEL
FT                   EQGLQIIRESVHSVLA"
FT   CDS_pept        535970..536377
FT                   /transl_table=11
FT                   /gene="ectC"
FT                   /locus_tag="SACE_0485"
FT                   /product="putative ectoine synthase"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0485"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99834"
FT                   /db_xref="GOA:A4F710"
FT                   /db_xref="InterPro:IPR010462"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4F710"
FT                   /protein_id="CAL99834.1"
FT                   /translation="MIVRTLEEIEDTDADIKTENWRSKRIVLAREKVGFSVHETTLYAG
FT                   TVNDFWYANHIEAVFVFEGEGEITDKATGETHQLKPGSLYLLNNHDKHQVRPKTDMRTV
FT                   CVFNPPVTGREVHDENGVYPVIVEDEEEAAS"
FT   CDS_pept        536598..537500
FT                   /transl_table=11
FT                   /gene="ectD"
FT                   /locus_tag="SACE_0486"
FT                   /product="ectoine hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0486"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99835"
FT                   /db_xref="GOA:A4F711"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="InterPro:IPR012774"
FT                   /db_xref="UniProtKB/TrEMBL:A4F711"
FT                   /protein_id="CAL99835.1"
FT                   /translation="MTVADLSTQDRYPTRVSSEPALIERQDPTVWPGVDSGPATTDELA
FT                   AHDAKGFHTVEGLLSPAEVQTYWQELNRLTNDPRVRADERTVVEKQSNEVRSIFEVHRI
FT                   SDLIAELVSDPRVLDRARQILGSDVYVHQSRINYMPGFRGSGFYWHSDFETWHAEDGMP
FT                   AMRAVSMSIALTDNYPFNGGLMIMPGAHRTFVSCVGETPDDNYKSSLKEQKVGVPGEHE
FT                   ITKLGYEHGIEQFTGPAGSALWFDSNCMHGSGNNITPFPRSNIFVVFNSVENTLVEPFA
FT                   AESRRPEFVAARDFTPVRR"
FT   regulatory      complement(537675..537705)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(537818..538852)
FT                   /transl_table=11
FT                   /gene="draG"
FT                   /locus_tag="SACE_0487"
FT                   /product="ADP-ribosylglycohydrolase"
FT                   /function="ADP-ribosylglycohydrolase"
FT                   /EC_number="3.2.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0487"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99836"
FT                   /db_xref="GOA:A4F712"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR036705"
FT                   /db_xref="UniProtKB/TrEMBL:A4F712"
FT                   /protein_id="CAL99836.1"
FT                   /translation="MPPSSTVVDRAVGCLLGGALGDSLGSPVEFRQLPDIRAEYGEHGI
FT                   TEPPPQALLGDATQMSLFSGEGYLHAWTSGNNGGPWRPVESVANAYRRWLITQQEDKPQ
FT                   PGATGLLAETELYSNRAPGLTSLRALGEPELGSPDRPRNSSKGCGGVDRSAPIGFAPSA
FT                   EMAYQLGCQCAALTHGGPGGWASAGAMALIVHLVAVQGRRLPAAVDQATGRVLRDDGET
FT                   AVALAEASTLARLGASVGHVERLGQGWIGPEALAIGVYCALALPKPEQFADAVRLAANH
FT                   SGHSDSTAAITGSLLGARHGTEVLPRAWLGRLELADVIERIGHDLGASCSGESFNQRRY
FT                   LGLG"
FT   CDS_pept        539135..542020
FT                   /transl_table=11
FT                   /locus_tag="SACE_0488"
FT                   /product="transcriptional regulator, SARP family"
FT                   /function="DNA-binding transcriptional activator of the
FT                   SARP family"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0488"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99837"
FT                   /db_xref="GOA:A4F713"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4F713"
FT                   /protein_id="CAL99837.1"
FT                   /translation="MSPQESPARAPSTGFEFRVLGPLEVLADGELIPIGSSSVRGILAC
FT                   LLLEPNQIVPMDRLIDTLWADAPPASARTIIHGYISRLRKLFAEHAGDGSGNPEIVTRP
FT                   PGYVLQVDADRVDAHRARALVNHAYGLEPAERSRVLTEALRLWRGPVLADISASPLHRM
FT                   VGPNLDELRLLALEERVAADLDMGRHHHLVVELSTLVEQYPLRERLTGQLMLASYRAGH
FT                   RAEAQARYHVLRRRLSGELGIDPGPELRNLYERLLRDDDTLLSPQQRQAATGTAQVRVG
FT                   RPIPAELPPAVVGFVGRDRECAALDRLLAQRERGSANPLAVLTGTAGVGKSALAVTWAH
FT                   RVARSFPDGQLYASLRGFDSDRAPLAPGEALTSMLKTLGVAADAIPVDLDDRTALYRSL
FT                   LADRRVLVLLDNARDSEQVRPLLPGNSESLVLVTSRRRLDGLVVRSGAYVLPLETLPTE
FT                   TAVELLDRAGTPGKSASEPMAARELAELCGGLPLALRIAAARLAANPARGVADLVHELT
FT                   DERNRLHALDIDDADTSVRRAFDISYRNLHPVHASTFRLLGLIPGHTFTGHAVAALCGT
FT                   DPPSARRRLRALALAHLITEPGSDRFGMHDLLRVYARDLLGATDGQQTISRGELSPDDD
FT                   AALRRLLHYYLVTADHARRFLRPARDELDFSGDDTPRPEITGRAEALEWFDAEWSNLVA
FT                   AVRVANGEGMHELAWPLARLQFNYLMVRCPWEDWVQIYSDGLDSARAIGDGVGKLLMSA
FT                   GLGVAYSRSGQPEAALTHYAESHAEAQSTGDPALLALTQVNMGAVLFRLGRYEEAQVHC
FT                   REALQAYRTLGDRYREAGALNNLAQVEQVNGNLEEALAHLREAEAMYREADDLETLAMV
FT                   LNNCGEVSIELGRVEEGERYHHEALDVAQRCGSLERQAAAYRGLGEAASSRGDRSVART
FT                   RWETALTIFETVGSHRAEEVRERLRDLPTTS"
FT   CDS_pept        complement(542553..543395)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0489"
FT                   /product="lipolytic enzyme, G-D-S-L family"
FT                   /function="Lysophospholipase L1"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0489"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99838"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A4F714"
FT                   /protein_id="CAL99838.1"
FT                   /translation="MGGWERSSAVDATSLGSYVALGDSFTEGMEDARPDGGYRGWADRL
FT                   AERLAARNPGLRYANLAVRGKLIRQIVDDQVPEAIGLRPGLVSFTAGGNDIIRPGSDPD
FT                   AVAELFESAVAELSATGARLLIGTGFDTRDTPVLRHVRGKVGTYNSHLRAIADKYDCGV
FT                   IDLWSMQVLQDPRAWSADRLHLSPEGHRRVALRAAEALGLPVTEDWREPWPPRPEQSWR
FT                   TQRIQDIQWAREYLAPWIGRRLRGQSSGDGRAPKRPKLERLCGAQSSASASPSEAERC"
FT   regulatory      complement(543637..543670)
FT                   /regulatory_class="terminator"
FT   CDS_pept        545858..546325
FT                   /transl_table=11
FT                   /locus_tag="SACE_0491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0491"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99839"
FT                   /db_xref="UniProtKB/TrEMBL:A4F715"
FT                   /protein_id="CAL99839.1"
FT                   /translation="MQPPPGEQHPVHQQPGPGPQPGPSQQQPGPGPQQPGPAQQPGHGQ
FT                   QPPAKPAQKPAPRPPKPAARADGGFGPIGSGGWQQSSRGSNYDRSPTKWGAEEVKDEYR
FT                   DAEYRAPRQGETGDAPQFLIEADDLYDEDYGESRLVAPPVLGEAPSSYRDF"
FT   CDS_pept        546325..547056
FT                   /transl_table=11
FT                   /locus_tag="SACE_0492"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0492"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99840"
FT                   /db_xref="InterPro:IPR025734"
FT                   /db_xref="UniProtKB/TrEMBL:A4F716"
FT                   /protein_id="CAL99840.1"
FT                   /translation="MVETIALPVHAADVLGEQLDLNVRQYPFEIPRLGESPDDRERITN
FT                   QIWAELESAGLARSGRPEPEVEDALYLLSTSEVSIAAAGLLDLRSGQRLAARVVATGEV
FT                   GVVGAIEGRVLRMSFMAPDDLPRACVDLLPDAPPGQGEQVRASADRTNGPPQDADIEGL
FT                   HELEAVTNRQKFRLGHFVVTSTDRRGRRGRLPALNWFDTDRGRYTLVGERAEGHDVITC
FT                   GPADKQRIAAQVHAMLERTRD"
FT   CDS_pept        547199..547822
FT                   /transl_table=11
FT                   /locus_tag="SACE_0493"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0493"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99841"
FT                   /db_xref="GOA:A4F717"
FT                   /db_xref="InterPro:IPR016566"
FT                   /db_xref="UniProtKB/TrEMBL:A4F717"
FT                   /protein_id="CAL99841.1"
FT                   /translation="MRLLGGRTTAIDASLPPVVFGLGWFAFGESIAAGGAAAVGVGALI
FT                   AAWRLRKGDRPVAVLVSLLAVMFGAIIALHTGHAADFFLIRLVTNAASGLAWMVSIVVR
FT                   WPLLGAVVGTVLGQGRRWRRDPALLRAYGRASWVWVCQYLVRLVVFIPLWTANAVVALS
FT                   VAQVVLTWPLVAVCVAVSWWVLRRALPEDHPGLRHPQDARATSA"
FT   CDS_pept        547999..548394
FT                   /transl_table=11
FT                   /gene="gcvH"
FT                   /locus_tag="SACE_0494"
FT                   /product="glycine cleavage system H protein"
FT                   /function="Glycine cleavage system H protein
FT                   (lipoate-binding)"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0494"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99842"
FT                   /db_xref="GOA:A4F718"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:A4F718"
FT                   /protein_id="CAL99842.1"
FT                   /translation="MVNIPQGLKYTQDHEWVEARSGDTVRIGITDHAQRELGDIVFVEM
FT                   PEVGRRVSGAEALGSVESVKAVAEFFAPLGGEVVEVNSQVSDEPELVNTDPYGDGWIVA
FT                   IKVADRSELDSLMSAEQYGEFVAEANE"
FT   CDS_pept        complement(548417..549406)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0495"
FT                   /product="ATPase, BadF/BadG/BcrA/BcrD type"
FT                   /function="predicted N-acetylglucosamine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0495"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99843"
FT                   /db_xref="GOA:A4F719"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="UniProtKB/TrEMBL:A4F719"
FT                   /protein_id="CAL99843.1"
FT                   /translation="MRSQEPVLVLGLDIGGTTSRALVGDLSGRALGTGSAGGGNPNSHP
FT                   PERAAAQVAAAAADALRGLDPASVRAGVLGMAGASKMTDPAVAELFRNEWSALGLTCPM
FT                   RVVGDVEVAFAAGTPEPGGTVVIAGTGSVAARIEDHRLVASAGGHGWLLGDEGSAFWLG
FT                   REAVRATLHALDRGRTDGDLVTAVLDELVDDRSRDEPPAVRNRLITAVNSAPPIRLAEL
FT                   APLVTRTAGSGDEAATAIVRSAARLLADTASITRPPGDTSPVVLAGGLVGAGNPVGDAL
FT                   RAELAERFGAEPRTAGPGAAGAAWLAAVGLAAPADLPTLHKQFLSAQG"
FT   CDS_pept        549586..550347
FT                   /transl_table=11
FT                   /locus_tag="SACE_0496"
FT                   /product="3-oxoacyl-[acyl-carrier protein] reductase"
FT                   /function="8 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0496"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99844"
FT                   /db_xref="GOA:A4F720"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4F720"
FT                   /protein_id="CAL99844.1"
FT                   /translation="MGEFDGLVAAVTGGASGIGLATARLLAERGAAVAVLDLRPHDVGE
FT                   SLLGVRCDVTDDGEVRSAVEAVRERFGGLDVLVNNAGIGAQGDISANDDAEWHHVLDVN
FT                   VVGIARVSRAALGLLRASEHAAIVNTCSIAGIAGLPQRALYSASKGAVRALTLAMAADH
FT                   VREGIRVNCVAPGTVDTPWIGRLLDSAADPGAERAALEARQPTGRLVSAAEVAHAIVHL
FT                   ASPAAAGTTGTVLNVDGGMSGLRVRPAEGER"
FT   CDS_pept        550344..551186
FT                   /transl_table=11
FT                   /locus_tag="SACE_0497"
FT                   /product="hypothetical protein"
FT                   /function="predicted metal-dependent hydrolase of the
FT                   TIM-barrel fold"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0497"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99845"
FT                   /db_xref="GOA:A4F721"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A4F721"
FT                   /protein_id="CAL99845.1"
FT                   /translation="MTVDTHHHLWDLDVRDQPWMTGPEMQPLRRDFRPADLVAALRGTT
FT                   VDSTVLVQTVSDPDETPEMLVLADSCDRIAGVVGWTDLTARDVRERLGHLLSNPSGRWL
FT                   KGIRHQVEDEPDPDWLTRPEVLSGLAAVEDAGLLYELLVRPHQLPAAIKAVGQFPQLTF
FT                   VLDHCAKPPVASGELEPWESRIRALAAHPNVVCKLSGLVTEDDWSAQPDAGRLRPYAEV
FT                   VLDAFGPARVMFGSDWPVCLLAAEYGEVFRLAWELTSGLGDAARQAVFDTTARQVYEL"
FT   regulatory      551325..551367
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(551392..552441)
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="SACE_0498"
FT                   /product="glucosamine-fructose-6-phosphate
FT                   aminotransferase"
FT                   /function="predicted phosphosugar isomerases"
FT                   /EC_number="3.5.99.6"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0498"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99846"
FT                   /db_xref="GOA:A4F722"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:A4F722"
FT                   /protein_id="CAL99846.1"
FT                   /translation="MSEATAQPGARMTAEIAEQPHVFGELLAHRAEIAEVATRIAERRP
FT                   RFALLAARGSSDHAALYAKYLIEVLLQLPVGLVSPSTTTLYGARPDLTDVLLLSVSQSG
FT                   GSPDLLEVTEAGRKAGATTVAVTNTAESPLNRAAEMSVGIRAGQEQAVAATKTYSATLL
FT                   ALYLLVDAVRGGNAEHARALPELARTTLDTTEQAVAEAVHRYRFADRMVTTGRGYSLAT
FT                   ACEAALKLAETSYLSARAYSGADLLHGPVAAVDAETAVLALCSAGKGGASTREVLEAVH
FT                   ERGADICAIGSAAADVPAAHRIGVPDCAEELAPVLEVLPVQRLALGLALERGGDPDNPR
FT                   GLKKVTRTR"
FT   regulatory      553129..553164
FT                   /regulatory_class="terminator"
FT   CDS_pept        553254..554009
FT                   /transl_table=11
FT                   /locus_tag="SACE_0500"
FT                   /product="putative GntR-family transcriptional regulator"
FT                   /function="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0500"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99847"
FT                   /db_xref="GOA:A4F723"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4F723"
FT                   /protein_id="CAL99847.1"
FT                   /translation="MLETSVPSGAENPARTQREPKYWGLKQHLLDMLRSLPPGSPIPTE
FT                   RALAAEFDVSRTTVRQALAELTVEGRLLRVQGKGTFAAKPKVAQRLQLTGYTEDMLAQG
FT                   RQPTSRLLEVIEEPADQELASLLGTRPSATVLRLRRLRLADGEPMAIETTHLPLSRFRG
FT                   LTGRLESGGSLYQVLRESFGVEMGYAEETIETALASPEEAELLGADVGLPMLLLSRHSF
FT                   DTEGRPVEWVRSIYRGDRYKFVARLNPPA"
FT   regulatory      554032..554088
FT                   /regulatory_class="terminator"
FT   CDS_pept        554241..555269
FT                   /transl_table=11
FT                   /locus_tag="SACE_0501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0501"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99848"
FT                   /db_xref="GOA:A4F724"
FT                   /db_xref="UniProtKB/TrEMBL:A4F724"
FT                   /protein_id="CAL99848.1"
FT                   /translation="MAEEKDEDSKDKRKERKLDLSAANVCGTALASVTAAYLGSYLGAV
FT                   GTMWGAALTSVVVTVGGKLYQRSLERTKEQAAAAKEKAALLRAKKTTAFAQQSLRFDAE
FT                   GEDGTTKLQQPEAPNGAEQRTRFIEPLSPGHSGMHWPGGEQVVEDPNATRQVGAAEQAD
FT                   DATRDLGGMPAPSPADEAATVKWNPAPDRDAVQPSRVRWRRWGLVAASSAIAFALCMLV
FT                   ITGFEGITGRSLSGDGGTTIGQALRRPAPPAPQQPVPEQDEPVESSSEPEPSSQVEPSA
FT                   EPSREQSAVPSTPVPEQPTGGQTATQGPTSLPEPTQGESPGESTGVVPPTAQPSLRNGA
FT                   PN"
FT   CDS_pept        complement(555377..556786)
FT                   /transl_table=11
FT                   /gene="tnp"
FT                   /locus_tag="SACE_0502"
FT                   /product="transposase, ISlxx5"
FT                   /function="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0502"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99849"
FT                   /db_xref="GOA:A4F725"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001598"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="UniProtKB/TrEMBL:A4F725"
FT                   /protein_id="CAL99849.1"
FT                   /translation="MGVARTVACEGDRAELKQRFLDRLDAVGSVTVAARELGLNRNTAF
FT                   GWARQAGRRSIRARQRHPRRDEYEQLRAEGVPRRRAAERVGINERTAKDWDYGVRKSRN
FT                   ARTYPNGVRVDYATGTSTIVDVNSVAPKLSALDKQLHPRLLTLAERERIRDLRAEGHSL
FT                   RDIGSALGRSASTILREIRANSTHGGYQPYAAHRASAARRPRPKQRKLIAQGPLRQFVA
FT                   DGLRERWSPEQICHALGKEHPGDQRMRVSVETIYQALYFQARGGLKREVQAAIRTGRTR
FT                   RKPRRNPNQRTARFIDPMVMISDRPAEAADRAVPGHWEGDLIIGAGNQSAIGTLVERTT
FT                   RYTMLVHLPNGHDAETVRDGLVATITTLPNHLRGSLTWDQGAEMARHKQFTMATDMPVY
FT                   FCDPASPWQRGTNENTNGLLRQYFPKGTDLSVYGPEDLEHVAQQLNGRPRKTLGWDSPA
FT                   ERLAMLLTKAS"
FT   regulatory      555408..555447
FT                   /regulatory_class="terminator"
FT   CDS_pept        557601..558734
FT                   /transl_table=11
FT                   /locus_tag="SACE_0504"
FT                   /product="serine protease precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0504"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99850"
FT                   /db_xref="GOA:A4F726"
FT                   /db_xref="InterPro:IPR001316"
FT                   /db_xref="InterPro:IPR004236"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR035070"
FT                   /db_xref="InterPro:IPR037295"
FT                   /db_xref="UniProtKB/TrEMBL:A4F726"
FT                   /protein_id="CAL99850.1"
FT                   /translation="MKRRLAARVTGSVIFAAGTIAALTVPATANPTAPAPVAAEAATLM
FT                   EAMQRDLGLTAEQAAERLADEAAATRADQSLRGTLGSAFGGSHYDAALGKLVVGVTDAG
FT                   LLDEVRAAGADGELVQHNVQQLDGVADGLDAQSARAPQSVTGWYVDSSSNSVVLTTAPG
FT                   TAGQATDFVRASGVDAGAVRVVESAEQPRTYADVIGGDAYYIGSGSRCSVGFSVQGGFV
FT                   TAGHCGNQGDSTSQPSGTFEGSSFPGNDYGWVRTASGENPVPLVNDYQGGTVGVAGSSE
FT                   AAEGASICRSGSTTGWHCGTVEAKNQTVRYPQGTVEGLTRTNVCAEPGDSGGSWLSGDQ
FT                   AQGVTSGGSGDCTSGGTTYFQPVNEILQAYGLTLLTQ"
FT   CDS_pept        complement(558802..559473)
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="SACE_0505"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /function="Thiamine monophosphate synthase"
FT                   /EC_number="2.5.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0505"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99851"
FT                   /db_xref="GOA:A4F727"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4F727"
FT                   /protein_id="CAL99851.1"
FT                   /translation="MPGLDGFGIRARLEEALLYLCTDARTERGDLAEFADAALDGGVDI
FT                   IQLRDKSAGGAPLEARHELAALEVLAEACVRHGALLAVNDRADVAMAADADVLHLGQDD
FT                   LPVELARRIVGDQVVVGRSTHDVVQADSAATEQGVDYFCTGPVWTTPTKPGREAAGLEL
FT                   VRHTAEHRGHGRPWFAIGGIGMDNIDEVVQAGARRVVVVRAITEAEDPRAAAAALRTKL
FT                   G"
FT   CDS_pept        559679..560809
FT                   /transl_table=11
FT                   /locus_tag="SACE_0506"
FT                   /product="amino acid oxidase flavoprotein ThiO, putative"
FT                   /function="Glycine/D-amino acid oxidases (deaminating)"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0506"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99852"
FT                   /db_xref="GOA:A4F728"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR012727"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4F728"
FT                   /protein_id="CAL99852.1"
FT                   /translation="MTAEHVVVVGGGVIGLSVAWCAARAGHRVTVVDPAPASGASHVAG
FT                   GMLAPVAEAWPGEEELLELGAASLHRWPDFADRLARDAGMPSGLRPEGTLVVGVDSADR
FT                   TELDNLADYLARLGRSVTRHNGRELRRMEPSLGPSVRAGLSVPGDLAVDNRVALAALRA
FT                   AATAAGAEFVTARARAVRAGEVELEDSALRCDVAVIAAGARSGDLHPLLSGAIRPVKGE
FT                   ILRLRARTTALPPPTRTVRGPVHGRQVYLVPRDDGGLVVGATQYEVGFDTEVTVGGVRD
FT                   LIADAEQVLPGIAEYALVEAIAGLRPGTGDNLPLLGWLEPGVIAATGHHRNGFLLAPVT
FT                   AEAVVALLSGRTPPEEVKAADPGRRISPENGGQQCR"
FT   CDS_pept        560800..561000
FT                   /transl_table=11
FT                   /gene="ThiS"
FT                   /locus_tag="SACE_0507"
FT                   /product="thiamine-biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0507"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99853"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A4F729"
FT                   /protein_id="CAL99853.1"
FT                   /translation="MQVVVNGESRQVPEDATLEAVLREFGVPERGVAVALDGAVVPRAA
FT                   WPATGLRAEATVEVLTAVQGG"
FT   CDS_pept        561006..561770
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="SACE_0508"
FT                   /product="thiamine synthesis, thiazole moiety"
FT                   /function="uncharacterized enzyme of thiazole biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0508"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99854"
FT                   /db_xref="GOA:A4F730"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:A4F730"
FT                   /protein_id="CAL99854.1"
FT                   /translation="MDDPLVIAGREFGSRLITGTGGAANLAVLERALIASGTELTTVAM
FT                   RRADAGGRTGVLDLLRKLGIEALPNTAGCRTAAEAVLTAQLAREALGTNWVKLEVVADE
FT                   DTLLPDPVELLDAAEQLVDQGFVVLAYTNDDPVLALRLEETGCAAVMPLGSPIGTGLGI
FT                   RNPHNIEMIVSRASVPIVLDAGIGTASDAALAMELGCDAVLLATAVTRAQDPERMAAAM
FT                   RAAVDAGRLASQAGRIPQRFWAQASSPGRPTG"
FT   regulatory      561841..561884
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(561869..563854)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0509"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99855"
FT                   /db_xref="GOA:A4F731"
FT                   /db_xref="UniProtKB/TrEMBL:A4F731"
FT                   /protein_id="CAL99855.1"
FT                   /translation="MAGSVLKRVRARLATEAGAPDPRQRQYAVLVAVAVVGATALGWIF
FT                   DLHTPGIVAGVTAVFALVATSGQALRSDLHRFVWFTPALALVMTLGPVLSNVPVLAGIA
FT                   VASVVFGAGMLPAMGEHYRVGGQTLAAATLFSTTTGIGSDQSVLVLLASSVAGVAFALL
FT                   LRVLVGLGDPTRATRIAVAGTLLEPGPGVVELAASAWRADGASTWLGQVLAGAARFRAA
FT                   RETLLAQAQQVGRLEAERLREIVAEADRVAAQLAIAVRSRACSGLPASARLDPAEVVLR
FT                   RGGRQDLPDAARGLNQGLDRIRAAVVERDETPATPPAPGGRRERAMGAVRAHLSMRSSL
FT                   FRHALRCTLAVGVGMVIVLLLNDPSESGLLLALYVVLQPAARDSMNGALERTGGAVLGV
FT                   VALAALITLLPGAYLLVPLVVAAMLVNIDRLRTDYRTLLGALIVITVVDQAMQLDRPLV
FT                   NVAISFAANSAIGAAIALSVGYVSYLVLPSSALPDVRGAIRSTVWSVSELLRSVRAAGQ
FT                   GANLRQALHSAHVLAMRRTQDLLGMPALLDGNDEETEDERVTRDAAVALDALRQDVATL
FT                   AFRPETERAIAVPALRAVDDLLAGKTSAKIPDVAENTAPATELLASSLVENALHARAAI
FT                   DRTFGYDSPWKSYTISFVRPERLHIK"
FT   CDS_pept        complement(564036..564902)
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="SACE_0510"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /function="Hydroxymethylpyrimidine/phosphomethylpyrimidine
FT                   kinase"
FT                   /EC_number="2.7.4.7"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0510"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99856"
FT                   /db_xref="GOA:A4F732"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A4F732"
FT                   /protein_id="CAL99856.1"
FT                   /translation="MHETPAGHEIQPANDPAPPTALTIAGSDSGGSAGMHADLRTFFAC
FT                   GVHGMTAVTAVTVQNTVGVTGLVEIPPETVAAQVDAVASDIGVDAAKTGVLASAATIEA
FT                   VMAVCDNHGIGRGGRTPFVVDPVAASRSGEPLLRPDALDALRNEAFPRATLVTPNLDEV
FT                   RLLTGFDARTRADLLDAAKAIYDFGPQWVLIKSGHLPDDPECVDLLYDGSQATPLPGPR
FT                   YSTVHTHGAGDAFASSITAALAKGASMPDAVRLGKRFVTRSVEHAYPLGAGIGPVSTFW
FT                   RVSPRSF"
FT   CDS_pept        complement(565000..566643)
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /locus_tag="SACE_0511"
FT                   /product="putative thiamine biosynthesis protein"
FT                   /function="Thiamine biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0511"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99857"
FT                   /db_xref="GOA:A4F733"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:A4F733"
FT                   /protein_id="CAL99857.1"
FT                   /translation="MADVRPNLSSDHHSVTTGPISGSRKVHHTTESGLKVPFRRIELSN
FT                   GEHLDVYDTSGAYTDDDVQVDVHSGLHRLRAGWTDGREHRTQLGWAKAGVVTREMEFIA
FT                   AREGVSPEFVRDEVASGRAVIPANRCHPESEPMIIGKNFLVKVNANIGNSAVTSSVEEE
FT                   VEKMVWATRWGADTVMDLSTGKRIHETREQILRNSPVPIGTVPIYQALEKVNGDPEKLT
FT                   WEIYRDTVIEQCEQGVDYMTVHAGVLLRYVPLTAQRVTGIVSRGGSIMAAWCLAHHRES
FT                   FLYTHFSELCEILRDYDVTFSLGDGLRPGSIADANDRAQFAELETLGELTHIARDMDVQ
FT                   VMIEGPGHVPMHKIVENVKLEEELCGEAPFYTLGPLTTDIAPAYDHITSGIGAAVIAQA
FT                   GTAMLCYVTPKEHLGLPNRDDVKVGVITYKIAAHAADLAKGHPRAQDWDDALSKARFEF
FT                   RWNDQFNLSLDPDTARAYHDETLPAEPAKTAHFCSMCGPKFCSMKITQDVRKYAEERGL
FT                   TSVEAIEAGMREKSDEFSESGGKVYLPVVG"
FT   regulatory      complement(566767..566826)
FT                   /regulatory_class="promoter"
FT   regulatory      566795..566854
FT                   /regulatory_class="promoter"
FT   CDS_pept        566926..567495
FT                   /transl_table=11
FT                   /locus_tag="SACE_0512"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0512"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99858"
FT                   /db_xref="GOA:A4F734"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A4F734"
FT                   /protein_id="CAL99858.1"
FT                   /translation="MSVAPVSPLMGWEDLVHTWQDLDVPEGWRAEIIEGRIVMTPPPGH
FT                   SHNLIASRLTKALVPAMSDDWEIFQTSGVQIPLRGNLFIPDLMIMRGQDVPAGSDPIPA
FT                   DKALLVVEITSRGNADVDRKTKLWSYAHAAVPLYLLIDRYGPDGEWVSLHSNPESGVYQ
FT                   DVHRVPFGKPIDLPVPFRLTLDTDRL"
FT   CDS_pept        567567..568151
FT                   /transl_table=11
FT                   /locus_tag="SACE_0513"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0513"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99859"
FT                   /db_xref="GOA:A4F735"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A4F735"
FT                   /protein_id="CAL99859.1"
FT                   /translation="MVYTPSGQQAPPLWANWEYLVGAWQGLNIPEGWRLELIEERLVPV
FT                   SPPEYRHGQIVDVLHRDFAARSPRDAAVFRTVSVVIPSRRSLFIPDLLVAAESRAASDA
FT                   VSVEAEKTLLVAEISGKAESAGDRELKLWSYAHAGAPLYLVVDPWAKGGSVVRLYSEPH
FT                   NAAYLRCAEVRFGEVIEVPEPFGFSLDTAEF"
FT   CDS_pept        complement(568180..568755)
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="SACE_0514"
FT                   /product="putative polypeptide deformylase"
FT                   /function="N-formylmethionyl-tRNA deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0514"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99860"
FT                   /db_xref="GOA:A4F736"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:A4F736"
FT                   /protein_id="CAL99860.1"
FT                   /translation="MAVHPIRIVGDPVLHNPTRLVENFDDELRTLVDDMFETMAAASGV
FT                   GLAANQIGVDLRLFVYDCPDDEGVQHRGVVVNPVLETTEVPESMPDPEEDWEGCLSVPG
FT                   ESFPTGRADWAKVTGSDVDGNPVEVEGTGFFARCLQHETDHLDGFLYLSRLVGRHARAA
FT                   KKTVKRNGWGVPGMSWDPSEHGDPFADE"
FT   CDS_pept        568914..569381
FT                   /transl_table=11
FT                   /locus_tag="SACE_0515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0515"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99861"
FT                   /db_xref="InterPro:IPR021678"
FT                   /db_xref="UniProtKB/TrEMBL:A4F737"
FT                   /protein_id="CAL99861.1"
FT                   /translation="MDAAQMLTVQEIARQCEQLARTVQQREQLSEASGRHLRLAEPLTE
FT                   PIARITDALPEQAAPEHDRVDPLPSDGELGEREWSILAFERQWWKSAGRKDQAIRELFD
FT                   MSSSRYYQLLNALLDNPAAFRADPMLIKRLRKVRTSRQRGRSARDLGIELH"
FT   CDS_pept        569381..570016
FT                   /transl_table=11
FT                   /locus_tag="SACE_0516"
FT                   /product="possible glycoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0516"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99862"
FT                   /db_xref="GOA:A4F738"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:A4F738"
FT                   /protein_id="CAL99862.1"
FT                   /translation="MTTGEPSSGPSRTKLAGFGLIGVGVVAAVVGVSTAVSGDPRDTAQ
FT                   QTPPADPPVASSVQNPPPVPPQEPPAPSTPAPPPAPSTQPQSPPPLPPAQETQPPKPSP
FT                   EVPGDVAQVRIVVRVYNNSTIAGLAHRASEDFRRAGYDVPEVGNYSAGRIYTTTVYFRP
FT                   GTEEEQQAKVVASQFGARMEPRFPGIETASPGVIAIVTNDYKGPAQGK"
FT   CDS_pept        570089..570346
FT                   /transl_table=11
FT                   /locus_tag="SACE_0517"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0517"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99863"
FT                   /db_xref="UniProtKB/TrEMBL:A4F739"
FT                   /protein_id="CAL99863.1"
FT                   /translation="MAAQRWVREVLLGEHSFVFLVELADAGEADRFRDACAANQWTTRV
FT                   VEDAERRLPLAPADQAEVYRKLQLATRVWGRSFAPHQRPR"
FT   CDS_pept        570420..570905
FT                   /transl_table=11
FT                   /locus_tag="SACE_0518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0518"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99864"
FT                   /db_xref="GOA:A4F740"
FT                   /db_xref="UniProtKB/TrEMBL:A4F740"
FT                   /protein_id="CAL99864.1"
FT                   /translation="MAAVPSVAGRIAGAVAERAEDRLARSLWRSHLVLEGAGFAALYVG
FT                   RGGQVGVRRGTWLVERLSGFWGVSLLALVPLCGLFGRIAVRSIGRERLRRALGWGVPLL
FT                   LTAILPVFGDWLLDTYLSPFALDSTDVKAGLTDSVHRVDTPTAAMRCGTRWPSGRAA"
FT   regulatory      570930..570986
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(571045..573282)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0519"
FT                   /product="cell division control protein 48 (cdc48), AAA
FT                   family"
FT                   /function="ATPases of the AAA+ class"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0519"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99865"
FT                   /db_xref="GOA:A4F741"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A4F741"
FT                   /protein_id="CAL99865.1"
FT                   /translation="MPSLTLTARLSPSALDTRRGVVRLHPEVLDALGLRPWSAVELTGS
FT                   RVTVALAAAAPPGGPTGVVLLDDVALTNLGLSEGAEVGVSPAEVRTAHRLRIAGSRMAT
FT                   ATVSADTVRMALTGKVFRTGDTVSLLPQDVAPAPGSDAGEVRRKLSAAIGMTWTNELIT
FT                   ITATDPDGVVAVKPSTVVEWRADAFAPAATDDGVAPQPAAVQPAPEAPAAPAESAVAVS
FT                   DLAGAKDSANRLDEWLRLSFEQPELLRRLGATPHLGVLVSGPSGVGKATMARAVAASVG
FT                   ARTVEVGAPSIAALEARTAAQRFQDALGRASTAAAGDGGCVLLITDVEDLLPASDPPPL
FT                   ATVVLDALKGAIATERLAVVVTSAHPQSVDPRLREPGLVDRELTIGLPDAATRTDLLRV
FT                   LLRNAPLEADVRLAEVAERAPGFVAADLVALCRESAVVAALRHRGEPGAEDARIRQQDL
FT                   LDALSSVRPISMSTSDDLQTGGLTLDEVGDMAEVKQSLTEAVLWPLQYPDSFTRLGVQP
FT                   PRGVLLYGPPGCGKTFLVRALAGSGRLNVLSVKGAELMDKFVGESERAVRELFLRAANA
FT                   APALVFLDEVDALAPRRGQSSDSGVGDRVVAALLTELDGVEPMRDVVVLGATNRPELVD
FT                   PALLRPGRLERLVYVPPPDADAREAILRSAAKNTPLSSDVDLGALAGSLEGYSAADCAA
FT                   LVREAALTAMRESLAAAEVSAAHLDVARTAVRPSLDPAQLASLETYADSRR"
FT   CDS_pept        complement(573433..574374)
FT                   /transl_table=11
FT                   /gene="pssA"
FT                   /locus_tag="SACE_0520"
FT                   /product="CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase"
FT                   /function="Phosphatidylserine synthase"
FT                   /EC_number="2.7.8.8"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0520"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99866"
FT                   /db_xref="GOA:A4F742"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:A4F742"
FT                   /protein_id="CAL99866.1"
FT                   /translation="MSMRDTPGVRLLPNAITVLAMCAGLSAVMFALNQQPTGAIAAIGV
FT                   AAVLDALDGRIARLLDATTKMGAELDSLSDAMSFGVAPALTLYVWQLQDNRAGWVVALI
FT                   FAVCMVLRLARFNTLLEDTAQPPFAKEFFVGVPAPAAGLLALLPLTLTAHFEHLGWWSQ
FT                   QPVVMVWVIAVAALAVSRLPTLSLKTVRVPPKAVAPLLVAVALLASGIITFPLISLAIA
FT                   MVVYLLHIPYALYRYRWLASHPEAWEAAPRERRAIRRRTQRRLGLRPPLRRSVAGAPPR
FT                   MRLPRRGGRPEGPRRSWRRLGLRRNRDDSAPR"
FT   CDS_pept        complement(574371..575081)
FT                   /transl_table=11
FT                   /gene="psd"
FT                   /locus_tag="SACE_0521"
FT                   /product="phosphatidylserine decarboxylase proenzyme"
FT                   /function="Phosphatidylserine decarboxylase"
FT                   /EC_number="4.1.1.65"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0521"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99867"
FT                   /db_xref="GOA:A4F743"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033175"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4F743"
FT                   /protein_id="CAL99867.1"
FT                   /translation="MSTEQEPKTSPLTHLVALARDTVPPMHPAGRPFVLGAAVATLLLR
FT                   RRWRGAGVLGGILTAWCAWFFREPRRTAPTRDGIAVAPADGTVAHVEKAVPPAELGLGA
FT                   APMTRVSVFLTIFDVHVQRVPLSGEVTKVSYRAGKFLSADLDKASEDNERNSMLIRGAD
FT                   GTEVAVVQIAGLVARRIVCSASEGDQVLAGHTYGLIRFGSRVDLYVPADSRVLVEPGQR
FT                   TIGGETVIAELARA"
FT   CDS_pept        complement(576336..578306)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0522"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99868"
FT                   /db_xref="GOA:A4F744"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:A4F744"
FT                   /protein_id="CAL99868.1"
FT                   /translation="MRGPWRAAFALALHIGFFALPIGLVAGLLAIAVFTFGYDRGSGLR
FT                   VALVALVVGAVLGVGMRAVLRSRNRPRGVALSRSEHPQLWKAVDAICSAAHTAAPDEIR
FT                   VTSEPNAFVREDTALLGLRTRARYLEVGLPLLAGLTASELRAVLAHEIGHLAARGRLTA
FT                   MAYRASTSVERAASDLTGGPTKWLFGGYARLYSAAAGSTSPDLELAADAVAVRVTGKRA
FT                   AVTALRKATAIEFGWREYAESYLSMAVSVERTPDVLLGFRAFMENSVRKPKLAERAKQA
FT                   IAAESAGDSGHPTTRERIAAMKRMSGADKELDDRPAFALLRNPRKSVPVLEDRLLVDGL
FT                   GPRMPWPELARLAGAEHVAHQASLLSSAVAQSGITTDPAIGGVLQAVHRGEGPDLVNPV
FT                   LNPGLAPDRIAEAAVDTLTELLGGAVVDALVSAGRAHHELDWAGPSVVRLTNGRPLDPD
FT                   RLVRPAVADPRLVPGLHRALVDLGVPLNHSRPPAEEPEASVAGLVSPVELAGSRYDMVV
FT                   TDRGLVLLPTTASTAQRLLAGAVARAGRAERKQLAELAATPVAELRERRDAQWVDSRDV
FT                   ASARLLQERRGWTLVLDLYLDEYAVSSLDEGSVAPDADGAASAELRSTPDSMEHGDPYS
FT                   GLGELMGARMDIDDQRDLTEE"
FT   CDS_pept        complement(578372..579562)
FT                   /transl_table=11
FT                   /gene="moaA3"
FT                   /locus_tag="SACE_0523"
FT                   /product="molybdopterin biosynthesis protein MoeA"
FT                   /function="Molybdopterin biosynthesis enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0523"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99869"
FT                   /db_xref="GOA:A4F745"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:A4F745"
FT                   /protein_id="CAL99869.1"
FT                   /translation="MPEYQQRIAELLAPTPVEPRALEDCLGLALATDLTASIPLPPFDN
FT                   SAMDGYAVRSVDLAGADEQNPVVLPVPEDVPAGRVQNPPLQPGTAHRIMTGAQVPPGAD
FT                   AVIPVERTDGGVTEVRAYAQVQPGAHIRRAGEDVASGATVLSAGTSLTPPQLGVAAAVG
FT                   AERLPVHRPVRVLILSTGSELVAPGTPLEPGQIYESNGLMLASAVRAADADARLLRFVP
FT                   DDVHAFHAVLSPHLDSTDLIITSGGVSAGAYEVVKDALSGNGVEFTKVAMQPGMPQGCG
FT                   RYRGGPAVVALPGNPVSAMVSFEVFVRPVLRAAAGHSRTRREVRQATLTEELVAPAGKR
FT                   QYRRAVFDPATGEVRTQGGTGSHLLTAMAAANCLLEIPEETTTLPEGSTVDVLLVD"
FT   CDS_pept        579777..580460
FT                   /transl_table=11
FT                   /locus_tag="SACE_0524"
FT                   /product="hypothetical protein"
FT                   /function="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0524"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99870"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:A4F746"
FT                   /protein_id="CAL99870.1"
FT                   /translation="MQVRTRHTPSFGVARLLLAPGEPVQVESGAMLATSYGVTVESRAQ
FT                   GGFLKSLARAALGGESLYVSTYTAPQQGGWVDVAPNLPGDLNVIELDGRTGWCVTRGCW
FT                   LASASTAQMETQWGGFQNLFGGEGGFMTHVAGHGPVVVSCYGALDVMTLQPGEFVTVDT
FT                   GHVVAYADAVQTRLRQINQGIAQSLKSGEGLVFDFAGPGQVLTQTRNPRGLVSWLQANG
FT                   LGSRS"
FT   CDS_pept        580706..580909
FT                   /transl_table=11
FT                   /locus_tag="SACE_0525"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /function="Cold shock proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0525"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99871"
FT                   /db_xref="GOA:A4F747"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:A4F747"
FT                   /protein_id="CAL99871.1"
FT                   /translation="MAVGTVKWFNSEKGYGFIATDGGSDVFVHYSAINMSGFRTLAEGD
FT                   RVEFEVKAGRDGRSQADGVRKL"
FT   CDS_pept        581313..582575
FT                   /transl_table=11
FT                   /gene="pknJ"
FT                   /locus_tag="SACE_0526"
FT                   /product="serine/threonine kinase"
FT                   /function="15 Serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0526"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99872"
FT                   /db_xref="GOA:A4F748"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A4F748"
FT                   /protein_id="CAL99872.1"
FT                   /translation="MSEDLTGRRLGHYKIDAVLGRGGMSVMYRATDTRLGRKVALKVMG
FT                   EHITGDAEFRERFVDEARNTSAIDHANIVPLYDFGEVDGMLYIAMRLVDGSDLASKIKD
FT                   GPISAQRTLELLGQVAEALDMLHERNLVHLDLKPANVLVTSRESSSEHVYLADFGLTRR
FT                   GATGHRTSSGDFLGSPTYAAPEHLRGEPVDGRTDLYALACMLFACLTGRPPFQGQVQEV
FT                   IQGHLHGEPPKVTSLVVLPADIDDVLRRGMAKKADQRYSTCKGLITAAKAALSPVAGEG
FT                   AGRRRTEAVPPGPPSGAVPVQQQPQQAYPPPPPVQQQPYPGPQQYQQQMPQTLPPPAGD
FT                   PVRLRPPMPVGSSSFATKSGGSAKWVVPVLVVVALGVLVVLFVLMANSFGSGGGSTEPT
FT                   SSRTSTYNSNNLPSEVPTIGD"
FT   regulatory      582588..582639
FT                   /regulatory_class="terminator"
FT   CDS_pept        583144..584778
FT                   /transl_table=11
FT                   /gene="groL2"
FT                   /locus_tag="SACE_0527"
FT                   /product="60 kDa chaperonin GroEL"
FT                   /function="Chaperonin GroEL (HSP60 family)"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0527"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99873"
FT                   /db_xref="GOA:A4F749"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4F749"
FT                   /protein_id="CAL99873.1"
FT                   /translation="MAKMIAFDEDARRGLERGMNTLADAVKVTLGPKGRNVVLEKKWGA
FT                   PTITNDGVSIAKEIELEDPWEKIGAELVKEVAKKTDDVAGDGTTTATVLAQALVREGLR
FT                   NVAAGASPIALKRGIEKATEAIAEQLLKSAKEIETKDQIAATAAISAGDRQIGELIAEA
FT                   MDKVGKEGVITVEESNTFGLELELTEGMRFDKGYISPYFVTDSERMEASLDDPYILLLS
FT                   SKISNVKDLLPLLEKVMQANKPLLIISEDVEGEALATLVVNKIRGTFKSVAVKAPGFGD
FT                   RRKAMLQDMAILTGGQVISEEVGLKLESADLSLLGRARKVVVTKDETTIVEGAGDDEQI
FT                   AGRVNEIRAEIERSDSDYDREKLQERLAKLAGGVAVIKAGAATEVELKERKHRIEDAVR
FT                   NAKAAVEEGVLAGGGVALLQATVAAFDGLKLEGDEATGANSVRLAVEAPLKQIAVNAGL
FT                   EGGVVAEKVKNLTPGHGLNAATGEYEDLLAAGIIDPAKVTRSALQNAASIAALFLTTEA
FT                   VVADKPEKEAAGAAAGADPMGGMGGMM"
FT   regulatory      584797..584846
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(584990..585673)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0528"
FT                   /product="putative copper homeostasis protein CutC"
FT                   /function="uncharacterized protein involved in copper
FT                   resistance"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0528"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99874"
FT                   /db_xref="GOA:A4F750"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="InterPro:IPR036822"
FT                   /db_xref="UniProtKB/TrEMBL:A4F750"
FT                   /protein_id="CAL99874.1"
FT                   /translation="MTALLEVIALDAEDAVAAQEGGADRLELVRDIAADGLTPDAATVR
FT                   SVLSATDLPVRVMLREDSGYLARDVDALRRRAGELRELGVTEFVLGFLDEHGEVDVGST
FT                   RHVVAELGDGSSWTFHRAVDHAVHYRLAWNHAVSLGPDAVLTAGHPDGVGEGLAELHEQ
FT                   AATQDIDGVVLLAGGGLRQEHVDDLRAAGVRAFHIGTGAREDWSSPVRPDLVRRWRSTI
FT                   DTATP"
FT   CDS_pept        586356..588335
FT                   /transl_table=11
FT                   /locus_tag="SACE_0529"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0529"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99875"
FT                   /db_xref="InterPro:IPR011496"
FT                   /db_xref="InterPro:IPR015882"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="UniProtKB/TrEMBL:A4F751"
FT                   /protein_id="CAL99875.1"
FT                   /translation="MAALLGAVALLAGCTDQPAGRPAEETPGTSGALPATGVPQVTPQP
FT                   KKIERLGDDIAVRGRVQLVVDPMADKPTRDLAVRVLEMAGADEVLVREPGQPEQSAHLT
FT                   VRLGDRGAPGVTKGLQELGFHAPMPTPPEGYVLAGRGGDQPTLVMGASDPSGAYYAVQT
FT                   LRQLVSPGRIAGVGVSDSPRMPIRGSIEGFYGSPWTHAERMDQLAFYGDVKLNTYVYAP
FT                   KDDPYHREQWRDPYPPDKLAEVKELIGQAAAHHVKFTFALSPGNSICYSDPRDVQTLVN
FT                   KLRAVHDAGVRDFSIPLDDISYTRWNCPQDQAHYGAPSQGAAGRAQTDLLNQVQREFIA
FT                   THPDVSPLQMVPTEYSDVEDSPYKTALRTGLDPRVLVMWTGDGVIPRRISVADAKAAEK
FT                   VWGRKVFIWDNYPVNDFDNSVGRLMLGPYAKREPGLSAQVVGDVVNPMNQAAASKVVEI
FT                   GAADFSWNDEDFDAQRAWRAAAEYLAGDRFAGGRPGLSADPATVDSLLVFFDLEHMAPL
FT                   ASGKPWLEPAPELARRIAEFNRAWQAGDRAGAIAGLRGYAQAIKDAPQRIRAGAAPDFV
FT                   SDSGPWLDATVLWGDALLATLDGLEARAGRDEARAGERFAAAGKLADQAGQVHTVPGES
FT                   RPQGPVRVADGVLDVFVEQAPGLR"
FT   CDS_pept        complement(588340..588573)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0530"
FT                   /product="hypothetical protein"
FT                   /function="putative stress-responsive transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0530"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99876"
FT                   /db_xref="GOA:A4F752"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="UniProtKB/TrEMBL:A4F752"
FT                   /protein_id="CAL99876.1"
FT                   /translation="MTENSNVHHFSTAETTESRRFRRSREDSMIAGVCGGAARALDVDA
FT                   TLIRVVLVAATLLGFGMGILLYLACWLIVPQE"
FT   CDS_pept        complement(588654..589208)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0531"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99877"
FT                   /db_xref="InterPro:IPR020941"
FT                   /db_xref="UniProtKB/TrEMBL:A4F753"
FT                   /protein_id="CAL99877.1"
FT                   /translation="MSRFSGFPAHVEAHIGRIRGADSSTAGGRERGYHLVYCDHRDGAH
FT                   VSVLTSGLRMHTAGAPLPQELVCTTRADQERHARHLTGVIAELLTESRSRVGYGALIMN
FT                   DRALLPDTEIAGALAAPHPHLGDEFDVLLHEGRPVLQIITLVPITRNEAQLVARYGSDV
FT                   LYDRWEEQGADLLDVHRPSAA"
FT   CDS_pept        589507..589893
FT                   /transl_table=11
FT                   /locus_tag="SACE_0532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0532"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99878"
FT                   /db_xref="UniProtKB/TrEMBL:A4F754"
FT                   /protein_id="CAL99878.1"
FT                   /translation="MFEVLESGPPREVAVAAARHVVEWSRRNTAQARVLLAGSAAFGES
FT                   EWTPQARDELRRLNEEMFAAMAEVARGTGTCGELGYGRFSLAVVDLPIAVVRRNLTRGD
FT                   EIPEHEVAVVVEAVRDLLADGQGR"
FT   regulatory      589898..589946
FT                   /regulatory_class="terminator"
FT   CDS_pept        589969..590844
FT                   /transl_table=11
FT                   /locus_tag="SACE_0533"
FT                   /product="ATPase associated with various cellular
FT                   activities, AAA_5"
FT                   /function="MoxR-like ATPases"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0533"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99879"
FT                   /db_xref="GOA:A4F755"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F755"
FT                   /protein_id="CAL99879.1"
FT                   /translation="MADDALGMKSPADVAAALDATGYLPDDGIATAAFLSMRMRRPLLC
FT                   EGEPGTGKTALAQALASALDVELIRLQCHEGIDAAQALYDWDFPRQLLHLRTLEAASGG
FT                   SLDPDAAESSLYTSRFLLDRPLLRALREAPCVLLVDEIDRADDEFEAFLLEVLSEYSVS
FT                   IPEYGVVRAAEPPIVVLTSNRTREVHDALKRRCLYHWLEHPGLEREVAILRRRLPGLDE
FT                   RLAEQVAAAVQRMRQLELLKPPGVAEALDWAQSLLALGKDELDTEVAASTLGAVLKYRE
FT                   DAERVRAEWE"
FT   CDS_pept        590852..591946
FT                   /transl_table=11
FT                   /locus_tag="SACE_0534"
FT                   /product="VWA containing CoxE-like protein"
FT                   /function="Protein containing von Willebrand factor type A
FT                   (vWA) domain"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0534"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99880"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR011195"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A4F756"
FT                   /protein_id="CAL99880.1"
FT                   /translation="MDRTVIGLVGFARALRHSGMACGPSRVQAFLDAAEEVGLDDRDSL
FT                   YWAGRLTLCSDPDDIPRYDTAFGCWFGHDPMPSPQGGHAVPRPARIAALTAASGESDEG
FT                   AEPLSAAASEAEVLRRRDFAELGAAEREHLRRLLAVLRPDPPQRPALRRAPSRRGGLDA
FT                   RATLRELLRTAGEPLRLPRRSRARRPRRVVLLIDVSGSMAPYADSLLRFAHVVVRRSPA
FT                   STEVFTLGTRMTRVSRQLRQRDPEQALDAAARAVPDFSGGTRLGETLRAFLDRWGQRGV
FT                   ARGAVVVLFSDGWERGDVSVLAEQMRRLRRLTRSVIWANPHAGHEGYEPVQSGILAAMP
FT                   HVDGMVAGHSLRALEEIWARVLDR"
FT   CDS_pept        591966..593084
FT                   /transl_table=11
FT                   /locus_tag="SACE_0535"
FT                   /product="xanthine dehydrogenase accessory factor"
FT                   /function="Xanthine and CO dehydrogenases maturation
FT                   factor, XdhC/CoxF family"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0535"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99881"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:A4F757"
FT                   /protein_id="CAL99881.1"
FT                   /translation="MRDVLDELIKRYESGQAVGLGTVVATFRSAPRPPGAAMLVTADGE
FT                   AVGSVSGGCVEGAVYERGEAVLDGERPALQRYGVSDDDAFAVGLTCGGILDVFVERVDR
FT                   ESFPELGEVAESVRLEEPVAVATVVEHPDSDRIGAHLVIWNDRTSGGLGEQRVDDAVVD
FT                   DARGMLAAGRSGVLEYGPQGQRRGEGMRVFVNAFEPPPRMLVFGAIDFAAAMARIGSFL
FT                   GYRVTVCDARPVFATRSRFPEVDEVVVDWPHRYLAAEVEAGRVDERTAVMVLTHDPKFD
FT                   VPLLEVALRQRLAYVGAMGSRRTHDDRIARLREVGVGDRELERLSSPIGLDLGARTPEE
FT                   TAVSIAAELIALRWGGRGVRLSEREGPIHHHS"
FT   CDS_pept        593252..593812
FT                   /transl_table=11
FT                   /locus_tag="SACE_0536"
FT                   /product="carbon monoxide dehydrogenase small chain"
FT                   /function="Aerobic-type carbon monoxide dehydrogenase,small
FT                   subunit CoxS/CutS homologs"
FT                   /EC_number="1.2.99.2"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0536"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99882"
FT                   /db_xref="GOA:A4F758"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:A4F758"
FT                   /protein_id="CAL99882.1"
FT                   /translation="MPRITVNVDGTRYTDDVEPRTLLVHHLRERLGKVGTVVGCDTSNC
FT                   GACTVHLDGQSVKSCSVLAVQADGCEVTTIEGLARDGELHPLQQAFHDNHALQCGFCTP
FT                   GMIMQALDLLAENPDPDTDEVREGLEGNLCRCTGYQNIVKAVRDAAQKMRPGAGPPIEH
FT                   TEDTPMQRTGQEQDTKVTGGRQS"
FT   CDS_pept        593809..596247
FT                   /transl_table=11
FT                   /locus_tag="SACE_0537"
FT                   /product="carbon monoxide dehydrogenase large subunit"
FT                   /function="Aerobic-type carbon monoxide dehydrogenase,large
FT                   subunit CoxL/CutL homologs"
FT                   /EC_number="1.2.99.2"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0537"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99883"
FT                   /db_xref="GOA:A4F759"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:A4F759"
FT                   /protein_id="CAL99883.1"
FT                   /translation="MTSTLEPELGRSRKRKEDARLITGRTRWTDNLTPTGTLHLAILRS
FT                   PVAHARITSIDTAQAREMSGVVAVLTGRDLADEQGSLPCAWPITEDMKAPTAPSLAVDT
FT                   VNFAGEAVAVVAARSAAEARDALDAIDVDYEDLPVVLDMESALRDDSPLVHEDLGTNRN
FT                   ATWTFDSAEAGTGGNVEEALSAAEVRVERTFRQQRLIPAFMEPRSVVVDPTGDQITMWS
FT                   ATQVPHILRLMLAMTLGEPEHRIRVIAPDVGGGFGGKLQVTPEEVITFLLARRLGRPVK
FT                   WTESRSETMVAAHHGRDQVQKLAISARRDGTITGLKVELLADMGAYLRLVTPGVPILGA
FT                   FMFNAIYKIPAYHFSCTNVFTNKTPTDAYRGAGRPEATFAIERIMDELAAELGMDPMEL
FT                   RRKNWIGHDEFPYTTVAGLTYDSGNYEAATDKAMELFGYDRLREEQAERRRRGDAVQLG
FT                   IGISTFTEMCGLAPSRVLGSLSYGAGGWEHASIRVLPTGKVEVVTGTSPHGQGHETAWS
FT                   QIVADRLGVAFDDVTVLHGDTQSSPKGMDTYGSRSLAVGGIAVVHAADKVVEKAKKIAA
FT                   HLLECSEDDVEFSSGRFGVRGTDRGTALGDIALAAFAAHDLPDGVEPSLDADATYDPDN
FT                   FSFPHGTHLCATEVDTETGRVKIRSYVSVDDVGAVVNPLIVEGQVHGGLAQGIAQALFE
FT                   EAVYDEEGTLTTATLADYLVPSAVDLPEFTTDRTETRATSNPLGVKGVGEAGTIASTPA
FT                   VVNAIVDAVRHLGVDDVEMPCSPQRVWRAVTGARPAESTAPEAGGGLGSIDTSEQGGSR
FT                   "
FT   CDS_pept        596244..597098
FT                   /transl_table=11
FT                   /locus_tag="SACE_0538"
FT                   /product="carbon monoxide dehydrogenase medium subunit"
FT                   /function="Aerobic-type carbon monoxide
FT                   dehydrogenase,middle subunit CoxM/CutM homologs"
FT                   /EC_number="1.2.99.2"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0538"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99884"
FT                   /db_xref="GOA:A4F760"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:A4F760"
FT                   /protein_id="CAL99884.1"
FT                   /translation="MIPASFDYIAPSTVEEAVAALAEAGEDAKVLAGGQSLLPVLRMRM
FT                   ADPGVVVDVGKIESMRGVRDEGDAIVIGAMTTHHDVLRDQLVRRHAELIALTTRTVADP
FT                   QVRHRGTFGGSLAHADPAGDLLAPVLALDAEMIIAGRAGTRTVPAAEFFVDYFTTALAP
FT                   DEILVEVRVPKFTGWSAHYEKFNRVAQAWSLVGVAAAVRIEESSIADVRVGLTAMGPTP
FT                   VRATGVEQALIGGSATAEAIREAASHAAEGTSPTGDASADPDYREHLARVLTGRAVLAA
FT                   AGG"
FT   CDS_pept        597381..598262
FT                   /transl_table=11
FT                   /locus_tag="SACE_0539"
FT                   /product="carbon monoxide dehydrogenase subunit G"
FT                   /function="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0539"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99885"
FT                   /db_xref="GOA:A4F761"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A4F761"
FT                   /protein_id="CAL99885.1"
FT                   /translation="MQMQHHFTVPVPVDVAWKALLDPERVAPCMPGATLTKSEGNEFAG
FT                   TVKVKLGPVSLLYKGTGTFTEVDEEGRRAVIEASGKDSRGNGTAAATVTAVLTAEDGGT
FT                   SVQVDTDLKITGKPAQLGRGLISEVGGKILNQFAGCLSEKLAGEPEAAGEPEASASTGE
FT                   TATTGDADGVPASEPSGSSVNGDRSSVARAAGEDAAAASESAQRETAARTRRPGWRVTS
FT                   PSEEGQWSSTAQETAANRADAVVTGKPMPSDEAIDLLGTAGAPVLKRVAPIAAAVVGLL
FT                   IVLRLIRRRRRG"
FT   CDS_pept        598451..598711
FT                   /transl_table=11
FT                   /locus_tag="SACE_0540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0540"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99886"
FT                   /db_xref="UniProtKB/TrEMBL:A4F762"
FT                   /protein_id="CAL99886.1"
FT                   /translation="MARMLVPAALLVASAAFVPMTAQAVETPRTNGDCTNYADDQDINE
FT                   NAAEVACNAKTNDECLAAFSQGGVAPESAKAACDIRARATQ"
FT   regulatory      complement(598577..598610)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(598829..599824)
FT                   /transl_table=11
FT                   /gene="menC"
FT                   /locus_tag="SACE_0541"
FT                   /product="O-succinylbenzoate-CoA synthase"
FT                   /function="L-alanine-DL-glutamate epimerase"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0541"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99887"
FT                   /db_xref="GOA:A4F763"
FT                   /db_xref="InterPro:IPR010196"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="InterPro:IPR041338"
FT                   /db_xref="UniProtKB/TrEMBL:A4F763"
FT                   /protein_id="CAL99887.1"
FT                   /translation="MDATGARIELTDLDAVRVYGLPMRNRFRGITVRQGVLLRGPAGWG
FT                   EFCPFDDYGDAESVPWLATALEACAGDWPEPVRDSVPVNCTVPVVTPEKAHEIAAGSGC
FT                   ATAKVKVAESGRPPGEDVERVAAVRDALGPGGAVRVDANAAWDVDTAVARIRELDRAAG
FT                   GLEYVEQPCPSVDELAAVRRRVEVRIAADESIRRAEDPMRVAVAGAADVAVIKVSPLGG
FT                   VRRALRVAEASGLPCVVSSAVESSVGLAAQLALAGALPELPFACGLGTITLLEGDVVAD
FT                   SLVPSGGRLPVPRRPPEPTPALVAAATPPADVQRRWLDRLRRVHALLPAG"
FT   regulatory      complement(599836..599881)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(599928..600203)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0542"
FT                   /product="transcriptional regulator, XRE family"
FT                   /function="predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0542"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99888"
FT                   /db_xref="GOA:A4F764"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A4F764"
FT                   /protein_id="CAL99888.1"
FT                   /translation="MPIVVDIDVMLAKRKMSVGALAERVGITPANLAVLKNGRAKAVRF
FT                   TTLAALCEVLECQPGDLLRWEPGDQAGDVPLGGSGAQPLARGGPDS"
FT   CDS_pept        complement(600203..600691)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0543"
FT                   /product="transmembrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0543"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99889"
FT                   /db_xref="GOA:A4F765"
FT                   /db_xref="InterPro:IPR021354"
FT                   /db_xref="UniProtKB/TrEMBL:A4F765"
FT                   /protein_id="CAL99889.1"
FT                   /translation="MGKVAVLALRVVLAFGLAGSLFVQAVMVPLLAVDLDEAPAAVRVP
FT                   VIMIVLLGVVTCQVTMVCVWRLLTMVRRGTVFSHAAFRYVDVVLGAVAAASVLTFALGV
FT                   TLAPGEAVAPGVVLLVGGAGVMVAGVALLVLVLRTLLAQAVARDTEAKHLQAELNEVI"
FT   regulatory      complement(600712..600740)
FT                   /regulatory_class="terminator"
FT   regulatory      complement(600714..600773)
FT                   /regulatory_class="promoter"
FT   CDS_pept        complement(600922..601515)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0544"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99890"
FT                   /db_xref="InterPro:IPR020941"
FT                   /db_xref="UniProtKB/TrEMBL:A4F766"
FT                   /protein_id="CAL99890.1"
FT                   /translation="MSAEQHGTTVGGAHRFVGLAENLERHAGRPTGAEPPNVRGDNRGF
FT                   ALVFFHLERYHLTTVISSGLRFQPLGAEPAQELACTVYKEQAEAARHLVDMTAELLVNQ
FT                   RTHLVPDQIVPNEQPLLPHTEFHGVLASGHPLFPPEFTRFTDPEGVEQLQVFTLLPVTL
FT                   GELNFILDNGVTALRQQWARFEVDVFDLGRPSVA"
FT   CDS_pept        complement(601607..603268)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0545"
FT                   /product="ATP-dependent DNA helicase"
FT                   /function="DNA or RNA helicases of superfamily II"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0545"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99891"
FT                   /db_xref="GOA:A4F767"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032438"
FT                   /db_xref="InterPro:IPR032830"
FT                   /db_xref="UniProtKB/TrEMBL:A4F767"
FT                   /protein_id="CAL99891.1"
FT                   /translation="MTDGPLIVQSDKTLLLEVEHAQADEARIAIAPFAELERAPEHVHT
FT                   YRITPLALWNARAAGHDAEQVVDGLVRHSRYPVPQPLLVDIVETMGRFGRLQLTNDPAH
FT                   GLVLVSLDRAVLEEVLRNKKIQPMFGARIDDDTVVVHPSERGRLKQMLLKVGWPAEDLA
FT                   GYVDGEAHPISLAEDGWALRDYQRQAVQAFWAGGSGVVVLPCGAGKTLVGAAAMAEAGA
FT                   TTLILVTNTVAGRQWKRELVERTSLTEEEIGEYSGEKKEIRPVTIATYQVITRKSKGEY
FT                   KHLELFDSRDWGLVVYDEVHLLPAPVFRMTADLQSRRRLGLTATLVREDGREGDVFSLI
FT                   GPKRYDAPWKDIESQGWIAPAECVEVRVTLTDDERLRYATSEAEDRYKVCSTARTKAPV
FT                   VKAILDRHPGEPALVIGAYLEQLHELGEALDAPIVEGSTKNKEREALFDAFRRGEINRL
FT                   VVSKVANFSIDLPEASVAVQVSGTFGSRQEEAQRLGRLLRPKAERKQAHFYSVVSRDTL
FT                   DTDYAAHRQRFLAEQGYAYRIVDADDLLGPAIPDVG"
FT   CDS_pept        complement(603412..603597)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0546"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99892"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A4F768"
FT                   /protein_id="CAL99892.1"
FT                   /translation="MPEEPLLTTRDVAKALAVSPRTVARWVERGWVQPELTLPSGHHRF
FT                   RLSSVKRQLREQREKH"
FT   regulatory      603618..603677
FT                   /regulatory_class="promoter"
FT   CDS_pept        603716..603970
FT                   /transl_table=11
FT                   /locus_tag="SACE_0547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0547"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99893"
FT                   /db_xref="UniProtKB/TrEMBL:A4F769"
FT                   /protein_id="CAL99893.1"
FT                   /translation="MTSRHYWLPVAGDIGGVRHAFRGRRWEGQPADEAVCGLAVAMAQP
FT                   SEMDWITFRSCADCRCALLAEAGIEPGAVNPGDSAKARR"
FT   CDS_pept        complement(604009..604518)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0548"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99894"
FT                   /db_xref="GOA:A4F770"
FT                   /db_xref="UniProtKB/TrEMBL:A4F770"
FT                   /protein_id="CAL99894.1"
FT                   /translation="MRIPGEVAELAAENGFGAYVLTTVEGSEPRGSRGSALRPMMWTIV
FT                   LVAGVWMIIAAETTSVTVLGSALVALVAAVAVRAVLRERRSYAARPRLHCFEGGVVVRR
FT                   RAYPWPELEITEWPDTVLVGQGAIPRRVVYRSISAGDGSFLIGLGTGGQQIRDLAERGG
FT                   ATIEAL"
FT   CDS_pept        604725..605462
FT                   /transl_table=11
FT                   /locus_tag="SACE_0549"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0549"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99895"
FT                   /db_xref="GOA:A4F771"
FT                   /db_xref="UniProtKB/TrEMBL:A4F771"
FT                   /protein_id="CAL99895.1"
FT                   /translation="MSYPPQPGQYGPQQGWGPQQPPQDGSQDFWRQVAGGTGGPQPPYP
FT                   PQPPKKSNTGLIIGLAAGGAALVLVVVVILVFALNGGRDDNQAGGETGGGTSPTTSKTR
FT                   PTTTSSETGSGIEVGDCVALSVQSGGSLTEEPCGSADSDYEIVEVKSGEDKNGCPDNYS
FT                   NTYSGDTYCMVLDVVVGDCLTGYSEDDSVLPLKEECASPAAVDQVTKVDTNPTAEQVCK
FT                   PEEGWYSFQDPPFTACFADKKPA"
FT   CDS_pept        605676..606476
FT                   /transl_table=11
FT                   /locus_tag="SACE_0550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0550"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99896"
FT                   /db_xref="GOA:A4F772"
FT                   /db_xref="UniProtKB/TrEMBL:A4F772"
FT                   /protein_id="CAL99896.1"
FT                   /translation="MTYPPQQQGPYGQPGRPQGYPQQPGFPQSGPQAVPGQAWGAPQYG
FT                   PVGAGYPTQTGQVPPGQAPHAQMPPGQVPPGQVPPQGQGFGPPPVPPQPSKGGGGALAA
FT                   KIISGVVALAVVGLILLGINMVSGSGAPEAGECLNLTNNSTVNPDWEVAPCGSADSDFV
FT                   IAKQLGGSESCGEDFSEVSKSGRRTSGYTLCLVPDVKAGDCMNIPQYMGLEEKVACGDA
FT                   DANMEILSVENSTAGESACDYDQEFQYIVYNEPAPGRTICMKQV"
FT   CDS_pept        606580..608175
FT                   /transl_table=11
FT                   /gene="mdlC"
FT                   /locus_tag="SACE_0551"
FT                   /product="benzoylformate decarboxylase"
FT                   /function="Thiamine pyrophosphate-requiring enzymes
FT                   [acetolactate synthase, pyruvate dehydrogenase
FT                   (cytochrome), glyoxylate carboligase, phosphonopyruvate
FT                   decarboxylase]"
FT                   /EC_number="4.1.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0551"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99897"
FT                   /db_xref="GOA:A4F773"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A4F773"
FT                   /protein_id="CAL99897.1"
FT                   /translation="MPEETSTVRDITRGLLRRLGLTTVFGNPGTTEVPFLTDWPDDFRY
FT                   VLGLQESAVVAMADGYAQARREPVLVNLHSAGGVGHALGSVFTAYRNRTPMIVTAGQQT
FT                   RSLMFGEPFLGATDAASFPQPYVKWSYEPARAADVPAALMRAYQIATQPPYGPVFVSIP
FT                   ADDWDQPGVEVADRPRTRGFAADPDSVAELAEALNSCERPAFVVGPAVDGDGVVDEMVR
FT                   LAEKARAEVWVSPMSPRCSFPEDHPAFAGFLHPERKALSKELAAYDLVVVWGAPAFTYH
FT                   VYRGESDVELPEMFVVHDDPDVLARAVRGRGVLGTLAHSVRQVSALVGQSDRAEPRGCE
FT                   RPDKPAPSTPMTAAYVFDTISSALPDDAAVVEETPSHRNDLHDHFPIRSTDGGFFTCAS
FT                   GALGYGIGAAVGVAMADQTRRTVALLGDGSSMYGVQALWTAAREQTPVTFVIMDNSRYA
FT                   AVAVLGEAAGGSKLPGVELGGIDFVGLATSLGVPAKSVNTPEELDAALGEEFTTMNGPS
FT                   LLHVKVDPGQRYLY"
FT   CDS_pept        608655..609659
FT                   /transl_table=11
FT                   /locus_tag="SACE_0552"
FT                   /product="conserved membrane spanning protein"
FT                   /function="predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0552"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99898"
FT                   /db_xref="GOA:A4F774"
FT                   /db_xref="InterPro:IPR007349"
FT                   /db_xref="UniProtKB/TrEMBL:A4F774"
FT                   /protein_id="CAL99898.1"
FT                   /translation="MATATAPTERIAFASSSSGPRIGQLDALRGLALGGILLVNIGQIM
FT                   HMPGIVDLRKLPIPHVLDMTAHQRFFPLFSLLFGVGFGIFLQRAGARAQRPRLLLLRRL
FT                   VALAVLGAVHHLLQPGEALLWYALFGIVVLLPLSWVPRWINLAIGLTMTVVLTVLFGGG
FT                   LLLVPGLLVTGFALAQLGLPNALDRLGPHLLTAFVLAAAGSVAALLWQEQDPLSAGFTP
FT                   SSAVAGLTMAVAYATGLLLVLRTPVGRRLAPTLEALGRMALTNYITATLLIVSFGAALG
FT                   LEGSTAWPTMLGFAAAILVVQALWSRWWLARFRYGPLEWAWRCVTWWRRFDLR"
FT   regulatory      complement(609692..609735)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(609746..610624)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0553"
FT                   /product="nitrate ABC transporter, ATP-binding
FT                   protein,putative"
FT                   /function="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0553"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99899"
FT                   /db_xref="GOA:A4F775"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F775"
FT                   /protein_id="CAL99899.1"
FT                   /translation="MVTMLDVSGVGHRYGTGAGANLAIDELSFKVEAGELACIVGPSGC
FT                   GKSTLLRAISGLLTPSSGEVRLHGDLVQGVPSDLAVVFQDYSRSLFPWLSVRANVEFPL
FT                   RSRGLSKAQRHERADEVLEWVGLSGAARKYPWQLSGGMQQRVSIARALACRPALLLMDE
FT                   PFASVDAQTRFELEDLLLRVRRQFDSTVLLVTHDIDESIYLADRVFVLSKSPASIVADI
FT                   PVDLGSERDQITTRESDTFVHLRSEVARLLQMRSPETVSTADGRTAAADRAAADRWAEA
FT                   ERAESRETARN"
FT   CDS_pept        complement(610626..611423)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0554"
FT                   /product="ABC transporter, permease component"
FT                   /function="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0554"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99900"
FT                   /db_xref="GOA:A4F776"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4F776"
FT                   /protein_id="CAL99900.1"
FT                   /translation="MSQVRGFLHRWVVFVGAVLVWELVTRLASSPFFPPPSEIVATAAV
FT                   KWFSGPASSLFLSDVVFSDLLASIGRIAAGWLIAVVVGVGIGTALGRSRTAMDYFGPLF
FT                   AFVRAIPPPVLVPVFMVLLGIGTSMQITVIVFGVVWPILLNTVDGVRSVDQVKVDTARS
FT                   FRIPPVQWVFGVVLPAAMPKIFAGLRVSLSLALVLMVVSELVGSTNGIGYQLVNSQQQF
FT                   DLPGMWTGIVLLGVLGYALNTVLLAVERKVLNWQPSQTAKVGG"
FT   CDS_pept        complement(611494..612237)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0555"
FT                   /product="ABC transporter, permease component"
FT                   /function="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0555"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99901"
FT                   /db_xref="GOA:A4F777"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4F777"
FT                   /protein_id="CAL99901.1"
FT                   /translation="MGLLGFFAVWEAFSRLGPVPQQYLPPPSLVLVRLAELLGDRMFLL
FT                   DVIASVLAWAIALGISVVIAVPAGLLLGSVPAVRVATRAIIEFLRPIPSVALIPLALVL
FT                   IGSGPNTKISLAVYASVWPILFNTIYALDEMDPVMVETARSFGLGRARVLFSVALPNSA
FT                   PFVLTGVRMSAAVALILVVSTEFLAGGTSGLGSFVLDASTGAGRMDLVLAGTLVAGVIG
FT                   FAINEALEAVHKRGLRWSIVGQEAS"
FT   CDS_pept        complement(612263..613282)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0556"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   systems-like protein"
FT                   /function="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   systems"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0556"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99902"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:A4F778"
FT                   /protein_id="CAL99902.1"
FT                   /translation="MSPFPGGGIPRRNLLKLAGGVVTAGALMGTSGCGLLGGSENAGQS
FT                   GPGGLEKANLKVGALATSEIAPLHLAVKNGHFQREGLNVEIVTAKDGASALNAAIGGDY
FT                   DITFSSYVPIFAAQASGVAQLKIVADCASATPNTIMIMTAPGSPVRTAADLAGKKIAIS
FT                   GMGTISQLMVQATMRAHGVDFSRVEWAPIGFPNMPEQLRQGHVDAAFLVEPFLTLAARD
FT                   TKAVPVVDAATGPLQDIPLGGYVSTANFADQNPNTVAAFHRAMQAATDEAQDRSKIEPL
FT                   LPTFAKVDAETAAVMGLLNMHTRVDATRLERVPRLMREFGYIQKDVDVKAMIATPPQN"
FT   CDS_pept        613958..617344
FT                   /transl_table=11
FT                   /locus_tag="SACE_0557"
FT                   /product="sensor signal transduction histidine kinase"
FT                   /function="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0557"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99903"
FT                   /db_xref="GOA:A4F779"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR013587"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4F779"
FT                   /protein_id="CAL99903.1"
FT                   /translation="MLNNDPGTGGRQDRRVEAQDPHSKRWWLRNWRLRTKMAAVLLVPT
FT                   LAALGVGGIRVYDGMSTADRLNTIVEQVELAQRTADITHELQRERDHAVVQTASGGADR
FT                   VPYDDQARRVDDAIARFRLPESELEDFTPKVREAYQSALNRLSSLNSLRAIVNRGFTDS
FT                   QTLVAYNSVVESVLNVPRAVSSGAANTQLTQSAWAAESISRAKEYLAQQRSILLSAGIR
FT                   NEFFTGQVAQMREADARFEAAFTEFENVASPAQRELYAARVAGAAVDDSEQIKQYALIN
FT                   AENDRALNMNPGEWGAASGTRGDLLRGVEEEVLGEFHDTAKQYADAAWWSMLRDGALIV
FT                   LLLLVAFAVASYIARSMLRPLRTLRYGALEIAEQSLPQAIKQVNENPSGASSVTVPPVP
FT                   VHTREEIGQVARSFDAVHQQALRLASEQALLRTNVNDLFVNLARRSQTLVQRQLSLIDR
FT                   LEQDEQDPDQLSSLFELDHLATRMRRNNENLLILGGTDLTRRMMRPVPLSEVVGAAVSE
FT                   VEQYARIAIAESPDLAIQGRVVNDFVHLIAELLENATVFSNPDTEVTVRTAYRRQELVI
FT                   EIRDRGVGIDDEEIDEINDRLTRPPEVDVAVSRRMGLFVVGQLARRHNIGVQLQNNGDL
FT                   EGGVTATVHLSGEYVVQLTADGPRPMPDIGRPVGGDEPKRDPLSETGTHLGLAAAFGSR
FT                   GGAADRGVDAPTERAPLPPLNFDSPGAPAPSAPAPSSNGFDPSGGPLPQRRKESPAAQE
FT                   AEEQEPVEDLPGNYSFQVSSGGSFGATDIPKWEDDAEASTDDDVRAEQWPSAESAAAAE
FT                   DRELPAAFDGQCGVPAQEEEESPSLFHSPFEAEKTATFEAARPDPDSDGADQNGTRPAP
FT                   DAPLAAGATQDAQDAPGELRASTASDYETEGQPPAVDTQPKGASWDMDDAPTQRLPIYE
FT                   AVLSQWFRESDVDEGGSPLGDSLSSGGGQPPRPARQEAPAEPPSVADGEQALQARRAAE
FT                   PESETGELRATGASGPGGETGEFPEELLAPTGPRDPGWGSADVGWQAAEALVQQSQQVQ
FT                   ETTSAGLPKRVPKSNLVPGSAAPRPQSPAPAKPATTRSPDAVRGRMSNFQQGIRRGRHA
FT                   KADPVSTEPPRSIPSRHEEQE"
FT   CDS_pept        617365..617772
FT                   /transl_table=11
FT                   /gene="cvnB7"
FT                   /locus_tag="SACE_0558"
FT                   /product="hypothetical protein"
FT                   /function="uncharacterized distant relative of homeotic
FT                   protein bithoraxoid"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0558"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99904"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="UniProtKB/TrEMBL:A4F780"
FT                   /protein_id="CAL99904.1"
FT                   /translation="MSSNSFSWLITDFVRRVPGVAHSVVVSADGLLLAGSQGLPRDRAE
FT                   QLSAVASGLVSLTQGAARCFEAGDVTQTVVEMEQGYLFLMSISDGSCLAVLAAPNADIG
FT                   LVAYEMTLLVERVGRQLTPELRAQLQGMGRR"
FT   CDS_pept        617804..618607
FT                   /transl_table=11
FT                   /locus_tag="SACE_0559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0559"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99905"
FT                   /db_xref="InterPro:IPR007995"
FT                   /db_xref="UniProtKB/TrEMBL:A4F781"
FT                   /protein_id="CAL99905.1"
FT                   /translation="MNAGSDPSWDGDLFRLYNKRLSADSWQEDFVDDQQESAGDGVSDY
FT                   SRALFGGPGADLFGSGYSGSGYSNSGYPGSGHSGSGYSAASAEGGDDRRYDSGPSSMSM
FT                   PSISSTSMPSVSMPSISQPMSPISQSMPSISGSMPAIRGGDGPASDEGAGETGSLVRPY
FT                   ARTRGRTRTDYDLAIETLVSTSERGRAQPAASSPEHRSISELCMEARSVAEVAAHLRLP
FT                   LGVVRVLIGDMAGLGLVLIHESGMVVGDRPSMEFLERVLSGLRRL"
FT   CDS_pept        618588..619196
FT                   /transl_table=11
FT                   /gene="cvnD6"
FT                   /locus_tag="SACE_0560"
FT                   /product="ATP/GTP-binding protein"
FT                   /function="predicted GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0560"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99906"
FT                   /db_xref="InterPro:IPR004130"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F782"
FT                   /protein_id="CAL99906.1"
FT                   /translation="MGFAGSDPRSQVNNHGGNKTSTKIVVAGGFGVGKTTFVGSVSEIV
FT                   PLTTEAVMTEASVGVDDLTATPGKVTTTVAMDFGRVSLDSDLILYLFGTPGQHRFWFMW
FT                   DDLVRGAIGAVVLVDTRRLADAFASIDFFDDRGLPYVVAVNTFDGVLHHRMEDVREALT
FT                   IADSVPMISVDARNRESTKQALIKLVEHAMRQRMAAARA"
FT   regulatory      619230..619284
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(619555..621804)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0561"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0561"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99907"
FT                   /db_xref="InterPro:IPR032830"
FT                   /db_xref="UniProtKB/TrEMBL:A4F783"
FT                   /protein_id="CAL99907.1"
FT                   /translation="MPALADWLRERSDDDLVALLRMRPDLATPPPADSSVLATRAGVRS
FT                   SVARACEDLDAFALSTLEALVLLDADVEAASLGAAAELLGVDVTPQRTRRTLDDLRSRA
FT                   LVWGDDDALSISPAVREALPTFPAGLGRPAENLTEAQAKAAIAELDEDERRLIGKLADG
FT                   SPIGRTRDAAAQTPLERAVNPVQRLLAKGLLLRRDAETVELPRQLAFAVRGDHPMGRVE
FT                   PEEPLLDLTDAGASAVDSTAAGEVLELLRHVELLLDLWGQDPPDVLKSGGVGVRDLRRA
FT                   GKAMEVDETRLGLIAELVVAAGLVANSEEAEPRWIPTYQSDSWLASMPETRWAALAQSW
FT                   LDLPRLPGLIGARDEKDRLLGPLSEDLRRPLAPKDRRRVLDVLDELPSGHGVRGADDLA
FT                   AVLAWRAPRKGGRLRDDLVRWTLAEAAVLGITAMGALSTAGRVLLTDGGAEAARHVALP
FT                   EALDHVLVQADLTVVAPGRLEPDLAAEMKLVADVESAGSATVYRVGESSVRRALDAGRT
FT                   ADDLHALFRNRSRTPIPQSLTYLIDDVARRHGQLRAGTASAFLRCDDPVLLAEVLANPA
FT                   VHELELRKIAPTVLVSPLPLADVVDGLRGAGFSPAAEGPDGQVLDLRASGERVRGRNRP
FT                   NPPAAMSAPSDAQLVELVGQVRAGDRAGAARRGSAVSPERGRPSAEATLQLLRDAARER
FT                   RSVWLGFVDSHGVATQRIVRPVRVGGGVLQGLDQSGDSTGTFPLHRITSVALVEE"
FT   CDS_pept        622081..622266
FT                   /transl_table=11
FT                   /locus_tag="SACE_0562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0562"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99908"
FT                   /db_xref="UniProtKB/TrEMBL:A4F784"
FT                   /protein_id="CAL99908.1"
FT                   /translation="MAGKTKKDRIDPSWPKVGDGEHPVSEFLADKQGALSPFGDTSFPL
FT                   STETVPYTHPVTKINK"
FT   regulatory      622287..622346
FT                   /regulatory_class="promoter"
FT   CDS_pept        622482..623936
FT                   /transl_table=11
FT                   /locus_tag="SACE_0563"
FT                   /product="malate dehydrogenase
FT                   (oxaloacetate-decarboxylating)"
FT                   /function="Malic enzyme"
FT                   /EC_number="1.1.1.38"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0563"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99909"
FT                   /db_xref="GOA:A4F785"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:A4F785"
FT                   /protein_id="CAL99909.1"
FT                   /translation="MPVPGPGYSITVRVEAPPSASAAGDLTGSVGRAGGVITAFDVVES
FT                   HADRIVVDITCNALSADHANDITDGLRELPGVTVRKVSDRTFLVHLGGKIEVNSRVALT
FT                   NRDDLSRAYTPGVARVCTAIAENPEDARRLTIKRNSVAVVTDGSAVLGLGNIGPEAALP
FT                   VMEGKAALFKKFAGVNAWPVCLDTQDTEEIIRAVELIAPVYGGINLEDIAAPRCFEIER
FT                   RLREKLNIPVFHDDQHGTAVVVLGALRNALRVVGKDLADCRVVVCGVGAAGSAIIRLLQ
FT                   KKGPADVIAVDIDGIVHTGRGDSDPNLQSIAANTNAEGRTGTLSDAVAGADVFIGVSAP
FT                   NLLNAEEVATMNSDAIVFALANPDPEIDPLEAQKHAKVVATGRSDYPNQINNVLAFPGV
FT                   FRGLLDAHAHEITDDMMIAASNAIADVVDGERLNASFIVPSVFDSAVAPAVADAVRKAA
FT                   TAGRTARPAPVGGSSLPWSMAEDLEY"
FT   CDS_pept        623958..624437
FT                   /transl_table=11
FT                   /gene="moaC"
FT                   /locus_tag="SACE_0564"
FT                   /product="molybdenum cofactor biosynthesis protein"
FT                   /function="Molybdenum cofactor biosynthesis enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0564"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99910"
FT                   /db_xref="GOA:A4F786"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:A4F786"
FT                   /protein_id="CAL99910.1"
FT                   /translation="MAQSDLTHVDEAGAARMVDVSGKQVTARTAVASGVLRTTAEVIGL
FT                   LRRDGLPKGDALATGRLAGIMAAKRTPDLIPLCHPIALSGVKVDLEVGDAEVRITATVR
FT                   TTDRTGVEMEALTAVTGAGLALHDMIKAVDPAAVLDAVRVERKEGGKTGTWVREE"
FT   CDS_pept        624558..625661
FT                   /transl_table=11
FT                   /locus_tag="SACE_0565"
FT                   /product="putative bifunctional molybdopterim biosynthesis
FT                   protein"
FT                   /function="Molybdopterin biosynthesis enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0565"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99911"
FT                   /db_xref="GOA:A4F787"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:A4F787"
FT                   /protein_id="CAL99911.1"
FT                   /translation="MTRTARVVAASNRAAAGVYEDRTGPVIVEWLRARGYESPDPAVVP
FT                   DGEPVGAELRRAVADGVDVVITTGGTGISPTDRTPEVTAEVLDYPIPGLAEALRSAGLP
FT                   QVPTAVLSRGLAGVSGRTLIVNLPGSRGGVSDGLGVLEGVLDHAVDQIHGGDHKPHGGA
FT                   AASHGAVTSHGAVASHGGVASHGVGEPHGGIGEPHVGSVAADGSSGGAVAAGQDLGRAA
FT                   PARTQASVLRADVVDEAIDVDELSRLVEHRAAGAVVTFGGVVRDHDGGRGVRELEYTGH
FT                   PSAGDVVAEVAREIAARFEGVRAIAVAHRIGLLAIGDVALGCAVAAEHRKQAFDACSEL
FT                   VDEVKRRLPIWKRQVFDDGSEEWVNCP"
FT   CDS_pept        complement(626428..627033)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0567"
FT                   /product="secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0567"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99912"
FT                   /db_xref="InterPro:IPR010618"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A4F788"
FT                   /protein_id="CAL99912.1"
FT                   /translation="MARYHGKHRKPSNAARAAARVAVAGAVIATPLAIAAPANAADWDA
FT                   LAQCESSGNWSANTGNGFSGGLQFTPSTWAAYGGTQYASNAKDATREEQIAVAEKVLAS
FT                   QGKNAWPGCSAKLNWSGGSTKTTKKVTKTETKTQTRTQTKTTSPVQTGGGDYTVQLGDT
FT                   LGKIGEKFGVDYKKIAERNSDIIKDPNLIFPGQKLDIK"
FT   CDS_pept        complement(628510..628797)
FT                   /transl_table=11
FT                   /gene="moaD2"
FT                   /locus_tag="SACE_0568"
FT                   /product="MoaD2"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0568"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99913"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A4F789"
FT                   /protein_id="CAL99913.1"
FT                   /translation="MTAVSEHLAVKVRYFAGARAAAGVAEEVVRLARPADGRPVRASDL
FT                   IEAVLSTHGERLAEVVPACSFLLDGVAVRDRAVEIPDGAEFDVLPPFAGG"
FT   CDS_pept        complement(628802..629851)
FT                   /transl_table=11
FT                   /gene="moaA"
FT                   /locus_tag="SACE_0569"
FT                   /product="molybdenum cofactor biosynthesis protein A"
FT                   /function="Molybdenum cofactor biosynthesis enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0569"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99914"
FT                   /db_xref="GOA:A4F790"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A4F790"
FT                   /protein_id="CAL99914.1"
FT                   /translation="MDLGIPVVRPTTDMSTRPDTPHLVDRFGRIARDLRVSLIDKCNLR
FT                   CTYCMPAEGLPWLKRSELLDTGEMIRLIRIAVEELGVTNVRFTGGEPLLRQDLVDIISA
FT                   TSELPSKPKTSLTTNGINLGRYADALKRGGLNRVNVSLDTLDRDTFRELTRRDRFSDVL
FT                   EGLEAAKAAGLEPVKVNTVLMRGLNGHEACDLLRYCVEHDYQLRFIEQMPLDPQHGWDR
FT                   GQMITAEEILEMLGAEFDLTPHTAERGSAPAERWLVDGGPATVGVIGSVTRPFCATCDR
FT                   TRLTADGQLRSCLFSTTETDLRGPMRAGAGDEEIMRLWQETMWAKKAGHGMDTEGFAQP
FT                   SRPMSAIGG"
FT   CDS_pept        630043..630441
FT                   /transl_table=11
FT                   /locus_tag="SACE_0570"
FT                   /product="probable ABC molybdate transporter, substrate
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0570"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99915"
FT                   /db_xref="GOA:A4F791"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A4F791"
FT                   /protein_id="CAL99915.1"
FT                   /translation="MPHYRISEVAGLLGVSDDTVRRWVDGGALPTGRDAGGRIVVDGAA
FT                   LARFARDQAKSTPDPSGVGRSARNRLVGLVTEVVSDRVMSQVEMQCGPHRVVSLMSTEA
FT                   VRELGLEPGVLAVAVVKSTTVVVETPGE"
FT   CDS_pept        630441..631202
FT                   /transl_table=11
FT                   /locus_tag="SACE_0571"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /function="ABC-type molybdate transport system"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0571"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99916"
FT                   /db_xref="GOA:A4F792"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:A4F792"
FT                   /protein_id="CAL99916.1"
FT                   /translation="MMSRIRPAVAGLVAVLLLGGCGQASPQQQQQERTLTVLAAASLTE
FT                   SFDEIGRRFAAEHPGVRVQFDYQGSSTLAEQINQGRSADVFASADTRNMDKAAANLAAP
FT                   AETFATNRLAIAVPKGNPARVASLADLAAAGRVVVVCAPQVPCGSATEKIERAAGVRLR
FT                   PSSEEDDVKAVLQKVSAGEADAGLVYVSDARSAAGEVDSVEFPESGKAVNTYPIAALKN
FT                   APQAELAKQFLAYVRGPVGREVLTAHGFATP"
FT   CDS_pept        631277..632038
FT                   /transl_table=11
FT                   /locus_tag="SACE_0572"
FT                   /product="ABC transporter, putative molybdenum transport
FT                   system"
FT                   /function="ABC-type molybdate transport system, permease
FT                   component"
FT                   /EC_number="3.6.3.29"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0572"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99917"
FT                   /db_xref="GOA:A4F793"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR006469"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4F793"
FT                   /protein_id="CAL99917.1"
FT                   /translation="MLWVPAMLGLALIVLPVAGLFLRVDPVRLPALLSSDAALSALELS
FT                   VRTGLISTALALVLGGPLAVVLARSGIRGMRVVRGLVLLPLVLPPVVGGLALLYLLGRT
FT                   GLAGQALEVVGVRLPYTTAAVVLAQTFVAMPFLVVGLEGALRTAGARYEQIAATLGAGP
FT                   WLAFRRVTVPLLLPALGSSLVLTFARALGEFGATITFAGSLQGTTRTLPLAIYTTAQSD
FT                   VDAAVAMSLLLVVVALLVIVVARPKAVEGQS"
FT   CDS_pept        632079..633239
FT                   /transl_table=11
FT                   /locus_tag="SACE_0573"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /function="ABC-type sulfate/molybdate transport
FT                   systems,ATPase component"
FT                   /EC_number="3.6.3.29"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0573"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99918"
FT                   /db_xref="GOA:A4F794"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F794"
FT                   /protein_id="CAL99918.1"
FT                   /translation="MSLRADIEVRRDEFALGAELTVAPGRVLAVLGPNGAGKSTLLSAL
FT                   SGLLTPDRGRIELGGHVWLDTERRVRVPTHRRGVGLLAQNALLFPYLTALENVAFGPRA
FT                   SGLGKAEARRTAAHWLSEVDAAELADRKPGQLSGGQAQRVALARALAADPKLLLLDEPL
FT                   AALDIDAAPAMRGLLHRVLRRQQRPTVLVTHDVLDAVVLADELVVLLDGRIVEAGPTRQ
FT                   VLSRPREAFTARIAGLNLLPGVAADGGLELVGGTTASVAMEPGSGAAGGAEGQDGAAVA
FT                   LHGRVAEPLEAGEPAAAVFAPSAVAVHRDRPHGSPRNTIPVRLTGLEPRGDVVRVRGAV
FT                   RDCPLAADVTPAAVADLSLVPGDEVWFVVKAAEVAIHPVSGGSSGA"
FT   CDS_pept        633236..634030
FT                   /transl_table=11
FT                   /locus_tag="SACE_0574"
FT                   /product="HAD-superfamily hydrolase, subfamily IIA"
FT                   /function="predicted sugar phosphatases of the HAD
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0574"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99919"
FT                   /db_xref="GOA:A4F795"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4F795"
FT                   /protein_id="CAL99919.1"
FT                   /translation="MTEPAPWTYLMDMDGVLVHEEHMVPGADTFLNALREHDIPFMVFT
FT                   NNSIYTPRDLRARLHRTGLDVPEEAIWTSALATAQFLEKQRPGGSAFVVGESGLTTALH
FT                   NIGYVLTDREPDYVILGETRTYSFEAITKAIRLVEGGARFIATNPDEKGPSREGTLPAT
FT                   GAVAALIERVTGRAPYYVGKPNPLMMRSALRQLGVHSENTLMIGDRMDTDVRSGLESGL
FT                   QTILVLSGISDEHTAELFPYRPTKVVRSIADLIEHVKDPFWA"
FT   CDS_pept        complement(634040..634378)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0575"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99920"
FT                   /db_xref="UniProtKB/TrEMBL:A4F796"
FT                   /protein_id="CAL99920.1"
FT                   /translation="MITDLELERVAAVIERVLRRRDGTATWEQVERLRLQSDLLDRLAA
FT                   AQRHWGGSIGGRAEMVRDAAERLADELNRAPGATTEHECPCCAERAAAAGRRPGGDDVR
FT                   AAKTSPPA"
FT   CDS_pept        complement(634470..634859)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0576"
FT                   /product="integral membrane protein"
FT                   /function="predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0576"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99921"
FT                   /db_xref="GOA:A4F797"
FT                   /db_xref="InterPro:IPR005185"
FT                   /db_xref="InterPro:IPR031308"
FT                   /db_xref="UniProtKB/TrEMBL:A4F797"
FT                   /protein_id="CAL99921.1"
FT                   /translation="MLNIVWLIFGGLLMALGYVVAGAVLAITVVGIPFAIASFRMANFA
FT                   LWPFGRRLADEPDAGAFSMVGNVLWVVLAGWWLALGHIVTGLAQCVTVIGIPLGVANFK
FT                   LVPVSLFPLGKRIVDTDAHRLYHVR"
FT   CDS_pept        complement(635051..635836)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0577"
FT                   /product="phenazine biosynthesis PhzC/PhzF protein"
FT                   /function="predicted epimerase, PhzC/PhzF homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0577"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99922"
FT                   /db_xref="GOA:A4F798"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:A4F798"
FT                   /protein_id="CAL99922.1"
FT                   /translation="MRAYVVDSFTDRAFSGNPAGVVLLDAPADAAWMQSVAAELKHSET
FT                   AFVVVGGDAPAKPLRWFTPDTEVPLCGHATLATAHVLGGDQLFDTASGELRCTAGEDGW
FT                   IEMDFPVDVPEPVEPPEELTAGLPGITIEQVAEGATKLLVRAASAAEVRALHPDFDALV
FT                   QVPKPGVVVTAPGDHDGVDFVSRVFAPRVGIPEDPVTGSAHCTLAAWWSTRLDRTGHGA
FT                   EFVGEQASARGGTVRMTLRGDRVGLRGRAVTVLEGELLA"
FT   CDS_pept        635927..637543
FT                   /transl_table=11
FT                   /locus_tag="SACE_0578"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /function="Acyl-CoA synthetases (AMP-forming)/AMP-acid
FT                   ligases II"
FT                   /EC_number="6.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0578"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99923"
FT                   /db_xref="GOA:A4F799"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A4F799"
FT                   /protein_id="CAL99923.1"
FT                   /translation="MPAELSYASGTSDVPLLGDTIGGNLDRTAARFPERDALIEHTTGR
FT                   RWSYREFVADVDALALGLLGAGITKGDRVGIWSPNRAEWTLVQYATARIGAILVNINPS
FT                   YRVHELEYVLDQAGIRMLVSARAFKTSDYVSMVEQVRAKCAALERVVFLDGDEWDALFD
FT                   RDGDPARLAAIELSADDPINIQYTSGTTGFPKGATLSHHNILNNGFFVGELCRYTEADR
FT                   VCIPVPFYHCFGMVMGNLACTSRGAAMVIPSEGFDPRTALAAVAEERCTSLYGVPTMFI
FT                   AELDHPEFADFDLSSLRTGIMAGSPCPVEVMKQVIDRMGMAEVAICYGMTETSPVSTQT
FT                   RADDSLERRVSTVGRVGPHLEVKIVDPATGLTVPRGEPGELCTRGYSVMLGYWEQADKT
FT                   AEVIDAARWMHTGDLAVMDADDYVGITGRIKDMVIRGGENIYPREIEEFLYTHPDILDA
FT                   QVVGVPDARYGEELMAWVRLREGAAELTVEALREFCTGKLAHYKIPRYVHVVEEFPMTV
FT                   TGKVRKVEMREEAKRLLGLDT"
FT   CDS_pept        637775..638020
FT                   /transl_table=11
FT                   /locus_tag="SACE_0579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0579"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99924"
FT                   /db_xref="GOA:A4F7A0"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7A0"
FT                   /protein_id="CAL99924.1"
FT                   /translation="MAREYDAQLLESVAVRRGRLRESLLWGRARRQMATVDNLKRLAIS
FT                   VVVAAVCCAGCVGWSFLENALAQQKRQQTTSSQVVR"
FT   CDS_pept        638017..639336
FT                   /transl_table=11
FT                   /locus_tag="SACE_0580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0580"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99925"
FT                   /db_xref="GOA:A4F7A1"
FT                   /db_xref="InterPro:IPR024962"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7A1"
FT                   /protein_id="CAL99925.1"
FT                   /translation="MTPPQATGTLTRLTLAAPWRRVDLVLPSETPLGELLPEIVRLLGY
FT                   QTAESPEAYRISLFDGRVVELDQSLRSAAVPDGALLRVDRISEAPMPAVVHDVTDEVAD
FT                   DLDRRPGRWGDDARRWLATAVISAAAVWATLLAAPTTPPPVLVAAGLIALVGGTALALP
FT                   GARVIGTAVLLAGAAATATAVPHWLAEWPLRSLAWAVLVGLTVLAAGAANGRLRAGATG
FT                   AGTLLGLLGLWAVPSALHLPIERTATLLAIVSTVVLGLLPRLALVTSGLTRLDDQQLGE
FT                   RPTTRSSVRAAVDSAHRGLALAVVFAAASAALAGWNLAHASNGWAVALACLLGVTTCLR
FT                   ARACPLTAEVVSLTAATLVVVVGLVSNWLFVAPAQWWGGVLVAVAVLSIGFAALAYRPP
FT                   AHVRARARQLADRVEGVAVVAMVPVAVGVFGIYERLLQTF"
FT   CDS_pept        640015..640779
FT                   /transl_table=11
FT                   /locus_tag="SACE_0581"
FT                   /product="putative ATPase involved in chromosome
FT                   partitioning"
FT                   /function="ATPases involved in chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0581"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99926"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7A2"
FT                   /protein_id="CAL99926.1"
FT                   /translation="MEEILTAVQAPITTGRRIAVTSVRGGAGKTAVAAMLGSVFAGRRA
FT                   EPVLAVDADPDAGSLSWRLGVESAMTLPGLAPALQTASGQDLSSVDRLLPRTSRGLWVV
FT                   PGGGAAQPQLARDVTRALSRLFAVAVLDCTTGMNNPAAGAVLSDAHAVVVVAPASPDGV
FT                   RTTAEALTRIGPAALQHVVVALNAVDRTGAAALRTKQALSLFSQLGLPAVVLPHDRHAG
FT                   AGGPIDPGRLAEPTVTEVSRLAAWSLRRARPL"
FT   CDS_pept        640949..644755
FT                   /transl_table=11
FT                   /locus_tag="SACE_0582"
FT                   /product="FtsK/SpoIIIE family protein"
FT                   /function="DNA segregation ATPase FtsK/SpoIIIE"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0582"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99927"
FT                   /db_xref="GOA:A4F7A3"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR023836"
FT                   /db_xref="InterPro:IPR023837"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7A3"
FT                   /protein_id="CAL99927.1"
FT                   /translation="MQGLLPMAGAAASMTMMMFFRGSGFAALGAVVMLVSVCAAALFYF
FT                   TQRGQATRKRRQQRERYLDHLEQLRDDLRDWEQDFQRRASVPDPPVGRLLDLVHDPARL
FT                   WERRRGDTDFLLVRVGTGHQPVRELRMRVEGTPVNPPDSFMLAEANALRRRFGTVPHLP
FT                   LRVNLDRAGDVSLIGEGRDAVLGAARTLIAQVAAMHAPDDVMIAVITPPEREADWAWVR
FT                   WLPHALGRAHIGPGGPQPLFAPDAAALAALLADDLTDRATRAAQAFRHGSGAAEAVTRS
FT                   RLLVIDDAFGDVARKLPTPDKGVGLDRLGVTVLHLLSNRLHEPSEISSRVTVGEQVTVE
FT                   QTEPRAMRAGTLEPASHAFAAGLARELAPLRLSADSYDDGSGTPPADFLQLLGMEDPAK
FT                   LDVDRMWAQRGERDFLRVPIGVTALGNATLLDLKESAQLGMGPHGLCVGATGSGKSELL
FT                   RTLVLALVAAHSPRQLSLVLVDYKGGATFAPFEKLPHTAGLITNLESDSSLVERMYASL
FT                   DGEVQRRQQLLADADKSVDITQYAMRRAALGEPEELPPLQHLFVVIDEFGELMTAKPEF
FT                   IELFLRIGRIGRSIGVHLLLSSQRIEGGKLRGLETYLSYRLGLRTLSEMESRTVLDTPD
FT                   AFHLPPLPGAGYLKVDTSVYDQFKSAYVSGPVAEPEEARPVETGAPRVLAMPRYGSPDE
FT                   QEQTDHPKATRRTIGPTLLSTIVEQLEGAAEPVAPVWLEPLPSAVTLDQAAGGFDVTVD
FT                   GLRLRDTGAAGLPVPMGRLDDPARQWQGTWTLDLSSAGGNLLVLGGPGAGKTTALRTLA
FT                   LGLACAHRPTDIGIYGIDLLGSGMRALADLPHVGGVAGRDDRERIRRTVDELHGMLSER
FT                   ERLFQRRQVDDIAQLRGKPAELPCTEVVLLIDGYGQLAGEFEAIESRVHDLLARGGRYG
FT                   IHVVATARRWNEVRGAQQVGFGNRIELRLTDPAESSIDGKLARAVGAKQLGRALTTDKL
FT                   FAQVALPRLDSVPDPAGSGLPEAAALVRSTWTGPVPPPIRVLPAVLDPRELPATDRGTV
FT                   ALGRFENDFGAANLDLFGRDQHLLVLGDTGTGKTNLLKLVTSTLVRQYPAEEIVFAVFD
FT                   PRHGLEGLVPEDHLGGYASNHALANQLAQAVSQELVKRGSPDHPAGPRIVLVIDDYDVL
FT                   AASGSQPLAPFVPFLASGRDLGLHVVMTRRVMGAARGLFEPFTMGVRESGCLSLLMSGD
FT                   RSEGQLFPGVRPTTLPPGRALHVRPGDQTRTVQTAFLDYLEES"
FT   CDS_pept        644799..645149
FT                   /transl_table=11
FT                   /locus_tag="SACE_0583"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0583"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99928"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7A4"
FT                   /protein_id="CAL99928.1"
FT                   /translation="MTFDIVALCREQPGPGAMLAAMRAAGAELRVNTIDEAQLIQLYHE
FT                   DGRLMMTTEGARLVQVRGEVRRLLGFDEDVPHPVWWVETRAPGGDPEAEAAARRFTQAL
FT                   VTTSGGVSWSTR"
FT   CDS_pept        645134..646105
FT                   /transl_table=11
FT                   /locus_tag="SACE_0584"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0584"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99929"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7A5"
FT                   /protein_id="CAL99929.1"
FT                   /translation="MVDALTGHPAADRETAEAIVVEQDRRVVPLSSWLADAAVTAAAGG
FT                   RVLQVLTPARSRITYPLELLITDGHAQWVVRDGVERFRDGITGEPLRWNGARFTAAEGP
FT                   AAPPVPTRSGSLEVQITTLHAADNALQLGLSTEAAMRALVGAAPAGWGVVEPASEPWSP
FT                   RELTRHCHDRSPEPTNVVVVGGEGEPAAVGSLEVTRVDTGVRERLRLAGPASTAVGQDA
FT                   IEDLAAAVAGKARSMLVASHPGRLDGLRWHTPTMPALPYGILVGHQVVQQRGVEHAQSA
FT                   PAARVRILGLDRGRACWCRLDGGQKAPYELLTDVLRHFGLPD"
FT   CDS_pept        complement(646102..646542)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0585"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99930"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7A6"
FT                   /protein_id="CAL99930.1"
FT                   /translation="MGLMDLAEVEAVARRAHAEQVDKAGRPYAEHLAAVADGVRARGGS
FT                   EEQIAAAWLHDAVEDYALSEQWLCEAPLAPQTVDIVLALTKRTGESPEDYAARILATPG
FT                   ARLVKEADLAHNADPARLAALDEQTRERLTGKYAHMRALLGI"
FT   CDS_pept        complement(646557..647102)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0586"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0586"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99931"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7A7"
FT                   /protein_id="CAL99931.1"
FT                   /translation="MHEFLVRHFGEEISHPKLGPIAVRDEVTRDFDIAETFAVDTVRAI
FT                   DSGNPADGLMSGGIVVPKDGSPVHWAPTMPAVEDYVKAVADGERWWSSGGAEPVTEVTY
FT                   YGLLTPGRTRSNPSGVLRRRTAAGNTTDEVFTRNLRWEPTDYFRKYELGHNDDEQVEIT
FT                   PGEAAEFVRRIRSKLAQS"
FT   CDS_pept        complement(647154..650141)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0587"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0587"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99932"
FT                   /db_xref="InterPro:IPR028908"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7A8"
FT                   /protein_id="CAL99932.1"
FT                   /translation="MINPAEIPQIPGDMDALAGHASTLKTAGAAFASTGADVHAKWQGL
FT                   AAVYDAPEAGQLLNATQPVSAVSDTVGGNVETVAGALSTYATTVKPIKARLESLRAQAQ
FT                   TFVSSVEGDDDWREDEGKVNQHNQLLSQVNEAVAEWMEAQRTCANAINAVYGGTQYAAD
FT                   NGDGRRDPNEFGYTKDQLNSALGEGLPWGKAEEHDGGFWGDVGDFFVGIKDGAVQMVTD
FT                   LGALIGYANGEWSWSTAGAAWKGLGTFALALGTYANPLAIVADQTIGLPGFKRGEMGGT
FT                   LLNAGKSIIAYDQWGKGHNGRAAGQATFNIVSAVVGTKGAGAGLKGAGAAIQGGKVAGM
FT                   AAKVGGGMVRAGDFVAKMPTVGELGIKLANKLNIHIPHLGPTPALAGDGPSFGHRVDTD
FT                   IADTRGPDVARMDNGGPRGGGPSVGDGLHHTPDGHHGGGTPPGGNTATDGPRDSGVPDG
FT                   RQPSDSHVGGSHHGNGHVSGDGTTLHNGDRPIDSRTPFDGHTQVEGHAPVDGHTPDGDR
FT                   PDGDHTSSPDGGDPSSTSPAPGADTPALPERLGNQPDGSWVNVEHGTRYDLSPEMNAAV
FT                   DRYLGGASVTEGHVTPHVRSIADGIDGARLQGYPDFVLKGEDSFKRKFAQDLARYPDLS
FT                   PDEILANVKDSVRYTIEMPSRNYTDGVLSAVDDLRARGYENVTFKPTWENPDTYKGVNS
FT                   TWRDPATGRVFELQFHTPDSFKAKMDTHGLYEAERVATDEADRLRAAEAQAEIFRQVDV
FT                   PDHAIDRLHELKQTLEAERAAVDPADHAPPQHPDADGHGHHDGNPAPGPADPGDPAGHG
FT                   DGAGDAAPDWSAVSGTTDVNSKPALHSGTATPEQAQRYVAEHHPYVVDVNVDRFQRGVP
FT                   GSDQNCSRCVRAVDLGFTGTPASALPWPEGPGWGLSSNTFADYARSLGADPAAFRQVSS
FT                   YDDIIGDMTARGEGARGMVYIGRPGSAHVFNVVHDQNGVVFLDGQTGGLALLEKNVNIM
FT                   YLPIGR"
FT   CDS_pept        complement(650138..650485)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0588"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0588"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99933"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7A9"
FT                   /protein_id="CAL99933.1"
FT                   /translation="MGRWDIQPAGVQGVLQQVEGVADDFEGHLRSINSAMEGAGTQASS
FT                   GIIGQALTGFANSQRSSIEFVFTRTGAAMNGAVNATQAYVRGDLEMAANAQANATAAPD
FT                   PRGTMPNGGAR"
FT   CDS_pept        complement(650507..650812)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0589"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99934"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7B0"
FT                   /protein_id="CAL99934.1"
FT                   /translation="MTMDRRSFDTGVSQSVQGDLQGIIGRLESVIGQRDQAVAAAMADF
FT                   QADGVSDDYHHVEQRWKSAATEVRQIINLVKQTMTQNDDSANTALSRARSAVQGIG"
FT   CDS_pept        complement(650832..651164)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0590"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99935"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7B1"
FT                   /protein_id="CAL99935.1"
FT                   /translation="MKFDMGSSTLSTLTKQTQGSSDDLGALIRQLIAAAEPLQGKFNGA
FT                   GRAAFDGFKTRADEITAELNSSLAAILGGQSGMDSSFGQGDTEMADNATSAQGSANFDA
FT                   ARFGAR"
FT   CDS_pept        complement(651603..652556)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0591"
FT                   /product="ribonucleoside-diphosphate reductase beta chain"
FT                   /function="Ribonucleotide reductase, beta subunit"
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0591"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99936"
FT                   /db_xref="GOA:A4F7B2"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR033908"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4F7B2"
FT                   /protein_id="CAL99936.1"
FT                   /translation="MTSTATFREDFHSLRAGGLNWDSLPLRLFGKGNAKFWDPADIDFT
FT                   RDAEDWQGLTEEERRSVAMLCSQFIAGEEAVTQDLQPFMAAMAAEGRFGDEMYLTQFCF
FT                   EEAKHTQVFRLWMDAVGLTGDLHSHVAENPGYRAIFYEELPRSLNALHDDPSPANQVRA
FT                   SVTYNHVVEGTLALTGYFAWQKICRSRGILPGMQEVVRRIGDDERRHMAWGTFTCRRHV
FT                   AADESNWDVVQEQMQHLLPLAVTQIQWRPEDAPEETPFRLDIDELAAYASDRAGRRLGA
FT                   ISAARGVPVEQIDVDASPEQLEDQFGVEDAAALEKA"
FT   regulatory      complement(652592..652651)
FT                   /regulatory_class="promoter"
FT   CDS_pept        652676..653299
FT                   /transl_table=11
FT                   /locus_tag="SACE_0592"
FT                   /product="haloacid dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0592"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99937"
FT                   /db_xref="GOA:A4F7B3"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7B3"
FT                   /protein_id="CAL99937.1"
FT                   /translation="MTTVGFDLDLTLIDPRAGMVEVFTALGAEFGLDLDGEHFAANLGP
FT                   PLPSVLRGYGFDEPLVESLVARFRELYPSVVIPATAAMPGAADALAAPRAGGGRSLVVT
FT                   GKFEPNAALHVAAFEWEVDHLSGDVFAEAKGEVLLAQGAQVYVGDHMADIAGARTAGAV
FT                   AVAVATGPYDADALAAAGADVVLGDLTEFPEWLAGYERRSRQRR"
FT   CDS_pept        complement(653241..653462)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0593"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0593"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99938"
FT                   /db_xref="GOA:A4F7B4"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7B4"
FT                   /protein_id="CAL99938.1"
FT                   /translation="MASSSSRSAVLPVSMGMFGLGLIAVVAVFALYATGSTDLPLWLNL
FT                   ATLLAPAGLVIGVVAIVVRSRRATRGTR"
FT   CDS_pept        653734..654126
FT                   /transl_table=11
FT                   /locus_tag="SACE_0594"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /function="Cold shock proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0594"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99939"
FT                   /db_xref="GOA:A4F7B5"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7B5"
FT                   /protein_id="CAL99939.1"
FT                   /translation="MPTGRVKWFDAEKGFGFVTQDGGEDVYVRASALPSGVESLKTGQR
FT                   VDFDMAQGRRGPQALKVQLLDPPPSVVEARRRPADELHGMVDDMIKLLELKVLPDLRRG
FT                   RYPDRKVSKRIGEVVRAVARELDPGA"
FT   regulatory      654177..654217
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(654398..654874)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0595"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0595"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99940"
FT                   /db_xref="InterPro:IPR024495"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7B6"
FT                   /protein_id="CAL99940.1"
FT                   /translation="MFRGLKPLLLAGTAVALAGCSAPSDPQVTFYSHGQAVEVAPAQYC
FT                   DALGEKCTPPPADPIGELRVPGRAPLQISVPSDVAEAPWQIAFIYRTTSGEEVGGKTEV
FT                   FTGGDRHAYTLQLPGDGVQFEHVEVQRFSALLSPGTEGGVDFVIGGSWIIDVNP"
FT   CDS_pept        complement(654978..656888)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0596"
FT                   /product="hypothetical protein"
FT                   /function="77 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0596"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99941"
FT                   /db_xref="GOA:A4F7B7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7B7"
FT                   /protein_id="CAL99941.1"
FT                   /translation="MGGRRDQRPRGRAGWGAGQRGKRGDYDGLSARERDEVSDFSARYA
FT                   RARAEEPPDGRTREPDLGEPIRESDSRGKCENDSRGKSTRGDDRRGKWTRESDSRGKPT
FT                   REGGQRRKWTRRREQHAEADQAQRSEHRFEAPQRRYPWDDDEHRPRYRTSRLPPLPRDH
FT                   HSYRDEPDERADPDDFDGPERPRGTAPPRKLTVTRVAAWRSRDLTQRAMRLFFSAAHAD
FT                   GADRSGLARFTYAVMGNYAVDAAMAVALANTLFFSAATGESKDKVALYLLITVAPFAVI
FT                   APVIGPALDRLQRGRRLALAASFGIRVLLAAVMALNFNSWLLYPAALGCMVLSKSFGVL
FT                   KAAMTPRVLPRAITLTTANSRLTTFGMAAGGVFGAVASGFAWLLGSEGALWFMAAMAAC
FT                   GVWLCLRIPSWVESTEGEVPASISSHPRRAERTPLTGHVVVALWGNGGIRLLTGFLTLF
FT                   AAFVIKQGTQTDPFMQLLLLGMVGGAAGLGSFLGNGAGARMSFGKPDRLIVACLGSALA
FT                   VTVCAALLAGLPMAVVVGLVGATCSALAKVCLDAVIQRDMPEASRASAFGRSETVLQLS
FT                   WVFGGALGVLLPPVYWIGFTVVAVLLALALAQTVVAGRGGSLPARTFWRRGSPEAARTA
FT                   T"
FT   CDS_pept        complement(657000..658142)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0597"
FT                   /product="glutamine cyclotransferase precursor"
FT                   /function="Glutamine cyclotransferase"
FT                   /EC_number="2.3.2.5"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0597"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99942"
FT                   /db_xref="GOA:A4F7B8"
FT                   /db_xref="InterPro:IPR007788"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7B8"
FT                   /protein_id="CAL99942.1"
FT                   /translation="MFALGLETDVLADRVAALGVHRQHRRADRVVTRRGLVLRRLAGDA
FT                   DGLDEHRIRARGHAGGLDRFVERRAWAGHRSRQRRHVLDCAVRHPRRLRPCQAFGVRLF
FT                   NTGRVLAGGMLVCCLGLLACAPPEPAERDGEQHREQSDEGVGHAGSLPHLRVEVINVLP
FT                   HDRSSFTQGLELADGTLYEGTGTYGGSRMRATDPATGAVHREDRLPPELFGEGITVEGD
FT                   RIWQLTWQEGVAIERDRASLRELRRVGYTGEGWGLCHDGARLVMSDGSSRLTFRDPATF
FT                   APTGEVTVRAGGEEVGDLNELECAGGHVWANVWHTDQILRIDPATGQATAVVDASGLLS
FT                   PQERAGADVLNGIAAVPGTDEFLITGKYWPHLYRVRFAPA"
FT   CDS_pept        657702..658757
FT                   /transl_table=11
FT                   /locus_tag="SACE_0598"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0598"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99943"
FT                   /db_xref="InterPro:IPR021391"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7B9"
FT                   /protein_id="CAL99943.1"
FT                   /translation="MPNALIGLLAVLLAVALRWFWRRARQQPQAADEHPAGQHTSRVEQ
FT                   AHPESLTRAQASRMPYGTIEHVTPLPAPMTSPGASFDEPVEPAGVPARPDPVLVEAVGI
FT                   AREAAEDEAAPGDDPIGSPVLTVDAEGGDPVGEHVGFEPEGEHALTHYFESNYPGYVGW
FT                   RWAVTVAAVPGEPVTVSEVVLLPGPSALTAPEWVPWAQRVRPGDLGAGDLLPSGPDDHR
FT                   LAPAYLANDDPAVESLAREVGLGRERVLSREGRLEAAERWHGGEFGPHSEIARLAPGAC
FT                   GTCGFFMQLAGSMGAAFGVCANEIAPADGRVVHAEFGCGAHSEAEVDTSSTVPVAEVVY
FT                   DDATLDFEPRG"
FT   CDS_pept        658754..661708
FT                   /transl_table=11
FT                   /locus_tag="SACE_0599"
FT                   /product="putative heat shock protein, HSP90-family"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0599"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99944"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7C0"
FT                   /protein_id="CAL99944.1"
FT                   /translation="MNGTDVFGTAELRQAVLQSWRSSPTRFREDANAEEDLRLGGYRDR
FT                   LLVELAQNAADAAGSKGVLRVRLADGELRVANTGEPLTAEGVAGLASLRASAKREGSTV
FT                   GRYGVGFAAVLAVSEEPRVVSSSGSVTFSAERTRQEAERLPGPAEELAARAGEVPVLRL
FT                   VWPLEDVPPEGFATEVRLPLRSGVDADALLESFAEQASGLLLALPALTEIHIGEQTWYR
FT                   TDEGRDRVVVHGPRGAERWQVQRGAGQVGEAALAGLGVEARRDTGWWVCWAAPLDADGV
FT                   PAPLERDVLHAPTPTDERLSLPARLLASVPMEADRRRAAASPATDQVLVRAAECYPELV
FT                   ARIAPEHRPALVPLPGFPMSDVDDKLRQAVTDRLRVAEWLPRAGGGLVAPLEARVLDQA
FT                   LPELAELLRDAVPGLLTAEMAELRHRAALSALEVRRLGPAEIVQAVTGLERPAPWWNRL
FT                   YEALRPIASADSQAREEFAALPVPLADGRTVTGVRDVLLGSDADPAGVLSTLDISGLRI
FT                   VHPEAAHPMLEELGARPAGPDELLDSPSLAEAVRGSVTDAHTSVDARALADAVLGLVER
FT                   SRPRDWLGALALPDSEGGFRRADELLLPEAALREVLAPDAPLGVVDAEFAARWPAGLLR
FT                   SIGVIDSFVVHVEEEPAEPDTGFADAERWWLDNEAEQHDQWPPDRFVGIRDLDLVAEDA
FT                   WPAALRLLAEDPDTLRALRDPAGYPAWWIARHASLAGLPPRHWRLPAAEEIAGLYDPVP
FT                   DVGLDTEQLRLAGVRDAMRVDDAADAADLIERLGDVDRALRAGTALRAHRALADAVACG
FT                   VIDASEIEPPHSVRSLSGAVVSAERAAVLDEPWMLGVLDAPLLVSGGSPDQFDAEALAE
FT                   LFDLPLASEENAMQVQGPGRAQRWGDVARVATSCELLGIAVPTGEVTLHDTLVVQAATT
FT                   GHRVHWWVDTGGTVHAERTPDGLGRALAWAAGSWGERFALGALLADPEATTLLR"
FT   regulatory      661761..661809
FT                   /regulatory_class="terminator"
FT   CDS_pept        662354..663553
FT                   /transl_table=11
FT                   /locus_tag="SACE_0600"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0600"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99945"
FT                   /db_xref="GOA:A4F7C1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7C1"
FT                   /protein_id="CAL99945.1"
FT                   /translation="MPSTGSGLTIGERLAMARKVAGLSQHALATRAAYSVSMVRAVEQG
FT                   REPASPAFVAAAARALGIEAEELYGQPYRELLGDDGGVDGLFELRTLFAEGCYVEPLVP
FT                   APLDELDAEMRRIRQMRHTDRARQAIETMHVLLRQIYGAVREASAEEDRERAYRLLAQG
FT                   YANTAQMLYRFGWLALATQALDRMELAAERSGGPHLLAHATQQRALLLMSHASYDVGER
FT                   LVERSLALLEREEESEGVLALRGSAHLRGAIICARKHDETRAREHIAHARRYGARIGRQ
FT                   SSAYDTSFGPGNVEIHDTAVSLEVGDPWRAARDGSALDIPADVAPTRAGHHWQDVARAW
FT                   VLSGEHGKALRALNKARSIAPQQTRYHPQVHETARLIALAERRKSDSIAHFTAWLGIKV
FT                   "
FT   regulatory      663565..663602
FT                   /regulatory_class="terminator"
FT   CDS_pept        664266..666092
FT                   /transl_table=11
FT                   /locus_tag="SACE_0601"
FT                   /product="multidrug ABC transporter, ATP-binding protein"
FT                   /function="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0601"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99946"
FT                   /db_xref="GOA:A4F7C2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7C2"
FT                   /protein_id="CAL99946.1"
FT                   /translation="MEPDAASRPTSSLRTLISRLAPFRGALTVVLLLELGTRAAALIQP
FT                   LAARAVVDGVAARADLMWPIAVLGAVAIIGLCLNYAGFYQRGKLSERFVLGLRKAMAGR
FT                   IVGAPVSYVESRSTADLVSRVGADSTLIQQTTVKALVDLVVVPLTVVAGIVLMLTIDVF
FT                   LALVVIVLLSVAGLAEAGVFRRVVVDTETAQEHVAGLTGVVQRVLLAFRTVKASRSERR
FT                   EAESFDRNADSAYRASVKAVRTGALADTVAYAAVDFTFLVTLAVGVVRVSTGSVGVGDL
FT                   VAILLYVVYIQEPVEALTNSAGKLSEGLAALRRITELLDAPQETDTAAAPARTEVPAVS
FT                   NGSKPPASRRSVRFDQVWFGYGDQPVLRDVSIEAVPGLTVLVGSSGAGKTTLLSLAERF
FT                   VEPERGAVLLDGADVRDLPLAELRGRVAYVQQEAPLLGATIGEAATYGVDDVDEERLRR
FT                   ILESVGLRTWIEGLPLGLDTEVGERGVQISGGQRQRLAVARALARDSEVLLLDEATSQL
FT                   DPLNEQNLVRSLTRDFRDRVVIAVTHRMPMAYQADQVIMLRHGSVHARGTHDDLLSDPH
FT                   YRQLIASPSAGSPELAEQLTASGEDGRGEPGA"
FT   CDS_pept        666076..666537
FT                   /transl_table=11
FT                   /locus_tag="SACE_0602"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0602"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99947"
FT                   /db_xref="GOA:A4F7C3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7C3"
FT                   /protein_id="CAL99947.1"
FT                   /translation="MSPVPEDYTWRSPRAGDAGRGESMIRGVAVRDRPTLESTAADFAE
FT                   ALGETDLTSDGFGVFRGEALVGYSLLRSGRDGRWYEVQRCVHGEHRGRGLGTVLLGWGR
FT                   AQAAQRRAVAGTAGELRVWCPDHSAARKSLGELPGRAARVTSEPLLEPR"
FT   CDS_pept        666534..669206
FT                   /transl_table=11
FT                   /locus_tag="SACE_0603"
FT                   /product="hypothetical protein"
FT                   /function="Acyl-CoA synthetases (AMP-forming)/AMP-acid
FT                   ligases II"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0603"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99948"
FT                   /db_xref="GOA:A4F7C4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7C4"
FT                   /protein_id="CAL99948.1"
FT                   /translation="MTGGLLAANSVRPWAELERAACGIAEGLRERGVRTADRVLLCGDN
FT                   SAEYVLVLLALMRLGASIVLTDHRQTPQEARRAADVAQVRWTVADAGVATSAGRRLEIT
FT                   ELVEDRPDAGTAELSLRDWYCLPDGLITWSSGTRGPAKGVVRSGKSFLDNVERSRRRMG
FT                   YRPDDVLMPLLPFSHQYGLSMVLLWWQVRCSLLVAPYRRLDHALELGGRWGATVLDATP
FT                   MTYHSVLNLGAGRPGLLSALRTVRMWCVGGSPLSPALADRFRAATGRPLLDGYGSTETG
FT                   NIALAAPGDETGCGHPLDAVEVLVLDTGGAVAAPGRLGEIAVQSPDLTSGYLEPDGGVR
FT                   PLPPGPHRTGDVGFVDEDGHVFVLGRRGAVHRMGHTLYPDVLAHKAAACGAPVHVLATE
FT                   DERTGCQLVFVVADPRLRAGGYWRRRIQDVLPSYEHPNRVVVVEEMPLNSNGKPDTGQL
FT                   DRLLRGTASGGASSPAVPAQTRRGPTPRNARIPFAERLDALRAVEDFLRNERGAVLDVL
FT                   TEISPLKTAESELASSLATLAGARAEVERHGPRRLSRLAVFMPSNVLCYSYVLYLLVPA
FT                   LYAERIAFRASAQVGAPARRLHELLAPVHGLPVHPHQVSQRRFVDEPVSEADVVVFTGA
FT                   YDNAEQIRSRLRPEQLMLFFGQGVNPFVVASGADLDLAVADAVRIRMLNSGQDCFGPDV
FT                   FLVDAAEADRFVELLVKRLGELRYGDYRDADADYGPLFYDSALQKATEYLRRNHERIVF
FT                   GGRVDLRDRHLHPTVLVRSSSDDLVVEELFSPIFNVVVHHDREQLRAVLRTPFVTDRAM
FT                   AAMVYGDDPETVELLARRHQVCHNRSILDAENGNRPFGGHGIVANYAAHRGRRVAEPLL
FT                   VSKAVADHLSAASDVIGGR"
FT   CDS_pept        669203..670885
FT                   /transl_table=11
FT                   /gene="ilvB"
FT                   /locus_tag="SACE_0604"
FT                   /product="acetolactate synthase large subunit"
FT                   /function="Thiamine pyrophosphate-requiring enzymes
FT                   [acetolactate synthase, pyruvate dehydrogenase
FT                   (cytochrome), glyoxylate carboligase, phosphonopyruvate
FT                   decarboxylase]"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0604"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99949"
FT                   /db_xref="GOA:A4F7C5"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7C5"
FT                   /protein_id="CAL99949.1"
FT                   /translation="MTVESFPNAWHAVVDHLREAGVSVLFGLPGDDLEALCALEKAGMR
FT                   MVLCRDQRNAVCMAAGYAIQSGRPGVCVVGKGPAVANAVGGLLEARSAGAPVVVLAGGT
FT                   GTDRRGSGAFQELDQVPLVTPVVKWAHRIDHPDRVVPAVEKAFLLAGAGAAGPVYLEIP
FT                   DHLAHVPVNRFREWTPPALVGATAVPGTGPAVAALEASRRPVLLVGGGMRHRNGDGAVE
FT                   SFADTAGAAVFSTASGRGTASEEHPLFCGLSGLYCPEAAAELWRTTDLVVAVGTALEET
FT                   ATYGWDGAIGAETPVVQVNCDAGGLSTEYGGLRVVGDGADVLGAWTRALASKPPDESWL
FT                   AAIARCRADVWAHTEDRLARMAADDGLHVAEVLAAIDAVAPPSRILVQENGLQDMWSYF
FT                   YPYHVCRTRGGSLVPSEQTTLGFGAAASAGARLAAPDRPVIAFVGDGAFATVRSELPAL
FT                   RREGVGVVYVVLRNGGYGWLHAQVTSRGLDHRLHPFAADEEEQPEGAVVRQKSQLEDAL
FT                   RDALATCEQGGGPAIVHIDVQLTDTPPGITGLDGDFPSHANEI"
FT   CDS_pept        670869..671426
FT                   /transl_table=11
FT                   /locus_tag="SACE_0605"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0605"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99950"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7C6"
FT                   /protein_id="CAL99950.1"
FT                   /translation="MPTRSDAVVVGTTAPVRSADARVVGGCESTAAAVTATLGAAIATL
FT                   PDEAGTSVPVLVLADAYSRWAARRFARRCADPARRLRPSDSTGLETSELLRKFAIASGW
FT                   RGPCYLLAGSDAAEFLETGRAFAATGPVVLCEVAPLDTDALDDPGCTVTAVVLTGADSV
FT                   LDIPQAPPGALLAAAGSAGGRG"
FT   CDS_pept        671423..672571
FT                   /transl_table=11
FT                   /gene="fabF"
FT                   /locus_tag="SACE_0606"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase II"
FT                   /function="3-oxoacyl-(acyl-carrier-protein) synthase"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0606"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99951"
FT                   /db_xref="GOA:A4F7C7"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7C7"
FT                   /protein_id="CAL99951.1"
FT                   /translation="MTDVVITGLGLVTPFGPGAGVFWEALRTGRCALAAPARFDLPSEH
FT                   GEPVGEVPPDAVVGVPRKRAYLAAALSEALESAGSSGLPDDALLVLVGQAPWEPGDDPD
FT                   WHEFVGPVQPRAARTTYLTHACASAAFGIGFARDAIRAGLTGTAVVAGGSALNRYEYAS
FT                   LQAVRAISRSAARPFDRARSGISIGEGGGAVVLEDASRAAARGAATDVLVAGACRRVGA
FT                   GKSAASDAGLIEECVREALADARVDRLDHVHAHATGTPQGDQAELAALEAVAAALGHDD
FT                   LPVSSHKGAIGHLLHVSCLPAVVAAVKALRTGETPPTAGLADPEPTKRLRLAPGRIPVD
FT                   EPATAAVTSFGFGSNNSTVVLARRPNQPAGHRRAEPIGRPTW"
FT   CDS_pept        672565..673305
FT                   /transl_table=11
FT                   /locus_tag="SACE_0607"
FT                   /product="hypothetical protein"
FT                   /function="Phosphatidylserine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0607"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99952"
FT                   /db_xref="GOA:A4F7C8"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033175"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7C8"
FT                   /protein_id="CAL99952.1"
FT                   /translation="MVKSLRRWIEEDVKPFRDEPVRWLSEQHFFRDPLRPVHADPDVFL
FT                   SPADGVILYQDFLDPDEPVVDIKGSPHTVREALRDDSYAERSLVIGIFMSFYDVHVNRV
FT                   PYSGRLSYRELAPIDTFNRPMLDVEHELLEELRIPVGGSEYLRHNQRVVNRIDVGALHL
FT                   SYYVLQIADYDVNRITPFVLGQQRAVLQGTRFSQIRFGSQVDLVIPLSGEHDLVPLCLP
FT                   GQHVEAGVDALVRIDRRRPGEEQR"
FT   CDS_pept        673302..674228
FT                   /transl_table=11
FT                   /locus_tag="SACE_0608"
FT                   /product="hypothetical protein"
FT                   /function="N-Dimethylarginine dimethylaminohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0608"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99953"
FT                   /db_xref="GOA:A4F7C9"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7C9"
FT                   /protein_id="CAL99953.1"
FT                   /translation="MTTTSEVQSPRNPSEFEGPAFLLNAPFSFSAEVYGDTDDGRRRPD
FT                   SRRAMAQFLSLYRFLAAESLVYLLPTPRADGLRDLVFTANLGIVLEHLPERDTVVLANS
FT                   GRPRAGARAVAASFFESMGYRVVVPERAFEGEAALKHLHGNVYVGGYGSCSQRESYEWM
FT                   ERTLDMTVVPVAQHGPLLRRLDRALFPITREQTLVCTGVLDQDELRLLEKHTEVVDVSV
FT                   AGAGAGLCGSLRLDNLILNASHIHELAAGSEEYWRELAKNRELEDVATRLGFEIALINL
FT                   SEYRRSGAQLSCMVMHLNRHAYRYSQL"
FT   regulatory      complement(674076..674113)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(674333..674620)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0609"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0609"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99954"
FT                   /db_xref="GOA:A4F7D0"
FT                   /db_xref="InterPro:IPR019681"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7D0"
FT                   /protein_id="CAL99954.1"
FT                   /translation="MVDDSESAPAAFGHRHVPALPRRLAEPTPVVLAGTVLWCAGAVVF
FT                   AVTDPGSIQFWTSAVGCGLGVIGYGVFRWQRSASRRGSRGAWKGLSGLDG"
FT   CDS_pept        674671..676131
FT                   /transl_table=11
FT                   /locus_tag="SACE_0610"
FT                   /product="xanthine/uracil/vitamin C permease"
FT                   /function="Permeases"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0610"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99955"
FT                   /db_xref="GOA:A4F7D1"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7D1"
FT                   /protein_id="CAL99955.1"
FT                   /translation="MSNTTRQPVLDRYFKITERGSSIAREVRGGVVTFVTVAYIIVLNP
FT                   LILGSYSAEDATAKRDVLGNILPVPQVAAVTALVAGVMTVLFGLIANYPFAIAAGLGIN
FT                   TLLAVTIAPQVTWPEAMGLVVIDGIIILVLVATGFRTAVFNAVPPELKAAIAVGIGVFI
FT                   SFVGLVDAGFVRRLPDEANTTVPVGLGINGSIASWPTAVFVFGLVLTAVLVARKVRGAI
FT                   MISVAVSTVLSIVVETIVRVGPSKGVNLYGWNLGYPALPEKVIDLPDLSLVGDVSFGAL
FT                   TRLPALAVAMLVFTLVLANFFDAMGTMTGLGKEGNLADSQGNLPGIGKALAVEGAGAVA
FT                   GGLGSASSNTVFVESASGIAEGARTGLANVVTGLLFLAAMFFTPLYQVIPVEAAAPALV
FT                   VVGAMMMSQIRQIDLSDFTVALPAFLTIVVMPFTYSIANGIGAGFVSYVVMQVSTGRGR
FT                   KVHPLMWVVSAAFVLYFVAGPVSDAFGA"
FT   CDS_pept        676226..676660
FT                   /transl_table=11
FT                   /locus_tag="SACE_0611"
FT                   /product="transcriptional regulator, MarR family"
FT                   /function="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0611"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99956"
FT                   /db_xref="GOA:A4F7D2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7D2"
FT                   /protein_id="CAL99956.1"
FT                   /translation="MSEIAERERTLASRLRVAVVRLNRRLRAQSTGSAITLSQLSALFC
FT                   LNKVGPMTPGELAAKEGVQPPSMTRVIAALEDSGLVVRRAHPTDGRQAIVELTDAGKAR
FT                   IDEEVSARERWLDLQLADLTEEERTTLCRAAEIIDRLASR"
FT   CDS_pept        676686..678026
FT                   /transl_table=11
FT                   /locus_tag="SACE_0612"
FT                   /product="probable multidrug efflux transport protein"
FT                   /function="77 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0612"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99957"
FT                   /db_xref="GOA:A4F7D3"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7D3"
FT                   /protein_id="CAL99957.1"
FT                   /translation="MSEETSFRPGAQAPGEVPDNLTRSSTSDATGGGGMFRSLRERNYR
FT                   YYASGQVVSLTGTWMQRAAQDWLVLELSGGNAAALGVAVALQFMPTLLLTLWAGVAADR
FT                   FDKRRLLIGVQSALGACGFVLGLLDVTGVVVLWHVYALCLVLGCFAAVDAPVRQSFVTE
FT                   MVGPAQVTNAVALNSMTFNLARIVGPAVAGLMITAVGTGWVFLANGLSSVAVVTGLVLM
FT                   DPARLHRSAPLREKRGQLVAGLRYVRGRPDLITLMALVLCIGTFGMNFENTLAVLARNT
FT                   FEREADGYGLLITMLAVGTLSGASLAARRSARGGPRLRLVLIGAAAFGALEVVASVMPG
FT                   YWTFAVALIPVGIAVMTFTTSANATVQLSVDPTVRGRVMGLYMLVFLGGKPLGGLASGW
FT                   LAAELGPRSPLMIGGLLSLAAALVAAGVLARRRAHGGRVGSRREGDS"
FT   CDS_pept        complement(678049..678582)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0613"
FT                   /product="acetyltransferase, GNAT family"
FT                   /function="Histone acetyltransferase HPA2"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0613"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99958"
FT                   /db_xref="GOA:A4F7D4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7D4"
FT                   /protein_id="CAL99958.1"
FT                   /translation="MPHTQLPRETGSSGFLLRAATPADLPAVAPLWETAWLDGHRDRVP
FT                   DELMALRDSDHFAHYAARWVSVTTVATENAGNLIGLVIVGPDDGEVVQLAVERDARGRG
FT                   VGTALLQAAETRLSSAHREAWLAVVPGNTKARRFYELHGWHDTGRIVHHAPTRTGTVAV
FT                   PVHRYVKPLSISYS"
FT   regulatory      678724..678783
FT                   /regulatory_class="promoter"
FT   CDS_pept        679005..679652
FT                   /transl_table=11
FT                   /locus_tag="SACE_0614"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0614"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99959"
FT                   /db_xref="GOA:A4F7D5"
FT                   /db_xref="InterPro:IPR009339"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7D5"
FT                   /protein_id="CAL99959.1"
FT                   /translation="MGNASRAPRASFACGLAGAVLFVVVFLVAGALRPGYSALRHPVSS
FT                   LALGESGRVQSTSFVATGVLMFAFAVGVRRTAGGLWLSRLLGVYAIGLAGAGFFRTDPI
FT                   SGYPAGTPALGQSTLTGSLHDTFSALVFAALPLACGVLARRCFKSGRTGWAWYSVATAV
FT                   VFLAGFVLAGVGFAQNAALLPVAGLLQRLTLVVGWVWVGALAAHLLRRSAPA"
FT   CDS_pept        679672..680031
FT                   /transl_table=11
FT                   /locus_tag="SACE_0615"
FT                   /product="transcriptional repressor, CopY family"
FT                   /function="predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0615"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99960"
FT                   /db_xref="GOA:A4F7D6"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7D6"
FT                   /protein_id="CAL99960.1"
FT                   /translation="MLGLGELELKVMDVLWSSGEPMRVRDVLERLAGERRLAYTTVMTV
FT                   LDHLHGKGWVHRSMTGRAYSYRPARTREEAGANLLREVLDSSGDAESVLLHFARSVSDR
FT                   ESEVLRRALDRGRES"
FT   CDS_pept        680028..680969
FT                   /transl_table=11
FT                   /locus_tag="SACE_0616"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0616"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99961"
FT                   /db_xref="GOA:A4F7D7"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7D7"
FT                   /protein_id="CAL99961.1"
FT                   /translation="MTLAIGLLAGAVFIALSGPLYLRAVVSPRVRPGVALTVWVASAAV
FT                   VVTGAVTGAVLLVLPHRGAADHLIGMAWTCVNAVHAGGEPVWEHVLRLGAALPVFAATV
FT                   RTLFVAYRLTRRDAGRRRHHLRLLRALSTAEPDSAVLWLEQATPVAYSLGGRRGAIVAT
FT                   TGVSRLGAAERDAILAHERAHLSGNHHRLVLMADVLARALPFVPLFRAAPPMVRVLVEL
FT                   AADAAAATRCGPGPVRSALRAVSGAGVPAGSLAMSREAVELRLRWLGAARGSRRGRTGY
FT                   LAAVFAAAAPAMAAVGVVAGLVLLYCLSDGRL"
FT   CDS_pept        681012..681710
FT                   /transl_table=11
FT                   /locus_tag="SACE_0617"
FT                   /product="DsbA-like thioredoxin domain protein"
FT                   /function="Protein-disulfide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0617"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99962"
FT                   /db_xref="GOA:A4F7D8"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7D8"
FT                   /protein_id="CAL99962.1"
FT                   /translation="MGKAKVRRLNVLAGVLAAAVVFLLGYVLATQNRGDAPPAPEPAPQ
FT                   AQQNPLESLARRDPGDPLAKGRPDAPVVLVNYTDFRCPFCAKFGRDIEPELQRRYVDTG
FT                   VLRIEWRDFPIFGEESLSAAEAGRAAARQGRFWEFHDAVFAQAPPTGHPPMPRERLVEL
FT                   ARQAGVPDIQRFEADMGDPGVYAGIQADAMEGAQLGVSSTPTFVINGQPVFGAQPLEVF
FT                   TEVIEQARAR"
FT   CDS_pept        681707..682567
FT                   /transl_table=11
FT                   /locus_tag="SACE_0618"
FT                   /product="integral membrane cytochrome biogenesis protein"
FT                   /function="Cytochrome c biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0618"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99963"
FT                   /db_xref="GOA:A4F7D9"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7D9"
FT                   /protein_id="CAL99963.1"
FT                   /translation="MTEIGLVGAFLGGLLSLLSPCSALLLPSFFAYAFNGIGRLVARTS
FT                   VFYAGLCVTLVPLGAAAGLFGALLTSYRDTVTLAGGLVLVGLGLLQISGRGFGISAAQQ
FT                   LTGRIRVSSNLSVFALGAVYGLAGFCAGPLLGSVLTVSATGGDPLYGAVLLAVFALGMA
FT                   FPLFVLAVLWDRFDIRNRKWLRGREIGVGRLRVHTANLVSGLVFVAIGVLFVVTDGTAN
FT                   LGGLADVDGQFAVQVWLRRAVAGVTDAQVLLVVAVVALVAVLWRIRHVERKADQDAERE
FT                   PADRE"
FT   CDS_pept        complement(682707..683336)
FT                   /transl_table=11
FT                   /gene="sodF"
FT                   /locus_tag="SACE_0619"
FT                   /product="superoxide dismutase [Fe-Zn] 1 (FeSOD I)"
FT                   /function="Superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0619"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99964"
FT                   /db_xref="GOA:A4F7E0"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7E0"
FT                   /protein_id="CAL99964.1"
FT                   /translation="MAQYVLPELDYDYAALEPAISGEINELHHSKHHATYVKGANDTLD
FT                   KIAEARDKGDFGSIVGLETTLAFNLAGHSLHLVWWKILSPDGGDKPTGELAAAIDQDFG
FT                   SFDKFRAQMEAVSTTIQGNGWGVLAWDPVGRRLITQQLRDHHSNLSIATTPLLVFDIWE
FT                   HAYYLQYRNVKADYVKQLWNVVNWDEVAKRFEDARAGYNGLRLPAA"
FT   CDS_pept        683738..684682
FT                   /transl_table=11
FT                   /locus_tag="SACE_0620"
FT                   /product="putative iron ABC transporter binding protein"
FT                   /function="ABC-type Fe3+-hydroxamate transport system"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0620"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99965"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7E1"
FT                   /protein_id="CAL99965.1"
FT                   /translation="MRRLLVVLATTLLLAGCGTAASTGPAWEGMRVENCGRTQVIAEPP
FT                   RRVVSLNQHATEILLALGLGDRLVGTAYPDDRTPPASVAADYARVPLLAVEYPSAERIL
FT                   EAEPDLVVGGYSSAFDEGEGRGREALESKGIATLLLSESCATGPTGMPALLADIDMFGS
FT                   VLGLRERASVLAADIEGRVRAVEQRLAGVPPVDVFVYDSGEQAAFTLGGHGVGNDALTR
FT                   AGARNVFADVPEGFADVSWEQVASRAPRAIVLVDYLAKPVHDKRAYLEGHPLASGTPAV
FT                   RADRYSTVPLVELTEGIRFPDAVERLARDLHGA"
FT   CDS_pept        684679..685692
FT                   /transl_table=11
FT                   /locus_tag="SACE_0621"
FT                   /product="ABC iron transporter, permease component"
FT                   /function="ABC-type Fe3+-siderophore transport
FT                   system,permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0621"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99966"
FT                   /db_xref="GOA:A4F7E2"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7E2"
FT                   /protein_id="CAL99966.1"
FT                   /translation="MRGAAVHVVLLAALVLAGLVAVSLGSVHLPPGQVWRILAAPLLPV
FT                   EQDWTQVRASIVWDSRLPRVVTAVVVGAALALAGGIAQIVTSNPMADPYLLGVSQGAGL
FT                   AVSLVTVLGFGAGAVGMATLPVAAFAGGLLALLFVLAVAGRSGSVTTLVLGGLAVGEVA
FT                   YALTSLVLHAFATGDQAKQVLFWITGGLGAARWELLPVPAAVLGAGIVAAVAAGRWMNL
FT                   LHAGDDAAAAMGLHARRFRLLSLVAVSLLAGTAVAVAGGIVFVGLLVPHAAAFLVGAEA
FT                   RRMLSVSAVLGALFLVLADLAARLVVAPSELPVGVLTAIVGGPLFLVMLRRRRRTA"
FT   CDS_pept        685689..686477
FT                   /transl_table=11
FT                   /gene="fecC"
FT                   /locus_tag="SACE_0622"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /function="ABC-type cobalamin/Fe3+-siderophores transport
FT                   systems, ATPase components"
FT                   /EC_number="3.6.3.34"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0622"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99967"
FT                   /db_xref="GOA:A4F7E3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7E3"
FT                   /protein_id="CAL99967.1"
FT                   /translation="MIGARGVRVVLDGGAVLSDVDVSVREGEVFGLVGPNGSGKTTFLR
FT                   TLYRAVRPDAGAVEVAGLPVANTGRRRLARTLAATTQEAEHRAALTVSEVVAQGRVPHL
FT                   GLLEPMRAEDRRIVGEALVATALSDAAGRDVGTLSGGERQRVAIARALAQRPRVLVLDE
FT                   PTNHLDLRHQFGVLDLLAALASDGLAVLLTLHDLRHAVEYCHRIAVLDAGRVVATGAPA
FT                   EVLTAGLLADVFGVRGRAHVVDGRPVLEIHGAVATGPTAP"
FT   CDS_pept        complement(686615..688048)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0623"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0623"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99968"
FT                   /db_xref="GOA:A4F7E4"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR016602"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7E4"
FT                   /protein_id="CAL99968.1"
FT                   /translation="MQRGLDALARMLAEGNFSFPHQQMGLEMELHLVDEHMEPSMSNTI
FT                   VLEKISDPAFTTELGQNNVEFNVEPRVLAGDGALHLEEELRTALARADGKAHDAGAKLV
FT                   MIGTLPTVRRAHVEPHWLTKLPRYQLLNEQIFNARGEETLLDMEGVPLADGSSDKLRSY
FT                   ADSIQPESASTSVQLHLQVAPEDFAAHWNAAQCLAGIQLAIGSNSPFLLGKALWHETRI
FT                   PLFQQATDTRSQELKNQGVRPRVWFGERWITSIFDLFEENVRYFPALLPEPEDEDPVAA
FT                   LDAGRAPVLAELRLHNGTIWRWNRPVYDLVDGVPHLRVENRVLPSGPTVVDVLANAAFF
FT                   YGAQRALTEQDRPLWTRMSFEAAEENFFAGARNGTDAHLYWPSAGWVAPDELVLRRLLP
FT                   MAHDGLRACGVSDAARERYLGIIEQRCLKRQTGATWQRDTVVALERRGMDRQEALAAML
FT                   RRYIELAENGDPVHTWPIG"
FT   CDS_pept        complement(688267..689202)
FT                   /transl_table=11
FT                   /gene="mocA"
FT                   /locus_tag="SACE_0624"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /function="predicted oxidoreductases (related to
FT                   aryl-alcohol dehydrogenases)"
FT                   /EC_number="1.1.1.91"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0624"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99969"
FT                   /db_xref="GOA:A4F7E5"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7E5"
FT                   /protein_id="CAL99969.1"
FT                   /translation="MARLGDSDLDVFPICLGGNVFGWTADRDRSFEVLDAYVAAGGNFV
FT                   DTADVYSAFAEGNAGGESEAVLGEWLRARGNRDRIVIATKVGMWDRRPGLGAENIRAAA
FT                   EDSLRRLGTDHIDLYYAHRDDERTPLEETLAAFDELVRSGKVRHIAASNYTAPRLAEAL
FT                   EVSKREGFARFTALQPHYNLVERAEFEGEPAGLAERENLAVLPYFALAKGFLTGKYRPG
FT                   DASSESPRAERARAYLDERGVKVLAALDEIATLRDLPVASVALAWLLGKRNVTAPIASA
FT                   RNTEQLSALLPAAESALTDAEVERLDEASA"
FT   CDS_pept        complement(689267..690559)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0625"
FT                   /product="drug resistance transporter, Bcr/CflA family"
FT                   /function="77 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0625"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99970"
FT                   /db_xref="GOA:A4F7E6"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7E6"
FT                   /protein_id="CAL99970.1"
FT                   /translation="MPRAEEEAVEAGNSSLSRKARFALILGGLTAFGPLSIDMYLPALP
FT                   ELTRELGATEAQAQLTLTAVLLGLAFGQLFAGPVSDAVGRRKPLLAGLAVYIAATVLCA
FT                   LTESVHTLAVLRAVQGFGAAAGMVIARASVRDLYSGAEAARFFSSLMLVVGLAPILAPV
FT                   IGGQVLAHTTWRGVFVVLTAFGVVLMAVAAFALPETKPKQWRQPARIGSTFRTFGTLLA
FT                   KPSFLGCALAAGLAMAAMFAYVSGSSFVMQNIYGMSPQTYAMVFGANAIGLVAAGQVNA
FT                   RLVGRVATEAQLLTTALLTASVAGAVLVTTALLGLPLPVLLGALFVMISSLGFVMPNTT
FT                   TLALAEHREVSGSASALLGVSQFVVGALAAPLVGMGGVGSALPMVSVMFGVILASAAVF
FT                   LTLGRRGGPSQRIVATRTSGSARAEVAATER"
FT   CDS_pept        690652..691515
FT                   /transl_table=11
FT                   /locus_tag="SACE_0626"
FT                   /product="hypothetical tRNA/rRNA methyltransferase Rv0881"
FT                   /function="rRNA methylases"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0626"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99971"
FT                   /db_xref="GOA:A4F7E7"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7E7"
FT                   /protein_id="CAL99971.1"
FT                   /translation="MSWIIIGPGRRIPGNAKMRYVAQIVEVTDVEDPRVDDFRDLSTAD
FT                   RRPDRPGGRGLVIAEGVVVVERLVASPYPVRALLGVRRRIEALADLLAPLDVPAYVAEP
FT                   DVMASVVGFHLNRGVLAVADRAPELTAEHLVATSRRLAVLEGVGDHENLGALFRNAAAL
FT                   GVDGVLLGEGCSDPLYRRSVRVSMGHVLRVPFTRLKSWPDDLDLLRDGGFRVAALTPRA
FT                   DAVSLREAALDSGPVAVVLGSEGPGLTEQAIAAADVAVRIPMAGGVDSLNVATAGAIAF
FT                   HAMSGI"
FT   CDS_pept        691520..692206
FT                   /transl_table=11
FT                   /locus_tag="SACE_0627"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0627"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99972"
FT                   /db_xref="GOA:A4F7E8"
FT                   /db_xref="InterPro:IPR024244"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7E8"
FT                   /protein_id="CAL99972.1"
FT                   /translation="MKSTTWELRARSGRAVLVNGAEREVDPARLPLPEALVDALHEWAH
FT                   VVDAISEAPAGESAEDAEAQLAAVSGEVATQVSQRGRQLALRLAVETGGEIGYADPVTG
FT                   EVDRVGRRRTSGQAAGRYTGWYARGGRPGPVPPTPWATGLTITAIIAAIVVVTLVVVTQ
FT                   GLAEVSPALAIGVNVVVAAGFAPSIWLGRRIPVWRWVAFGTAAGVVLAWIALLLSALGP
FT                   STPGVH"
FT   regulatory      692230..692270
FT                   /regulatory_class="terminator"
FT   CDS_pept        692521..692748
FT                   /transl_table=11
FT                   /locus_tag="SACE_0628"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0628"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99973"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7E9"
FT                   /protein_id="CAL99973.1"
FT                   /translation="MPTSIPTRTISRLPADAPEIRVRAATLNAALRVTADDFAWATAEG
FT                   VSADAVDRHRKRMAEALRTTASSAVHLAEL"
FT   regulatory      complement(692803..692853)
FT                   /regulatory_class="terminator"
FT   regulatory      692814..692865
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(692874..693830)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0629"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0629"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99974"
FT                   /db_xref="InterPro:IPR021421"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7F0"
FT                   /protein_id="CAL99974.1"
FT                   /translation="MRALRVVGLDEDGETVICEDPENGDRFSVPADERLRAAARGDLTR
FT                   LGQVQIEMEAQMRPREIQARIRGGASVEQVAEAAGIPEQRVERYAYPVLLERAQVAEMA
FT                   QRAHPVREDGPDVQTLGEVVAHTFGMRGHDYNETSWDAWRGEDGKWVVELQWNAGRSEN
FT                   AAHWVFHPGAHGGTVAALDDHAADLLDPSPNRPLRTVRPVTELAREALELDQQSGAERA
FT                   EPAPPHRAEPSASVPPLDLDGAAPAAKAPEAPAAAEPDDEPEAPADDAEPGEAPAEAAT
FT                   AEDEAGQRKAEPQRRGRKNHPIVPSWEDVLLGVRSHR"
FT   regulatory      complement(693865..693912)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(694110..695255)
FT                   /transl_table=11
FT                   /gene="serC"
FT                   /locus_tag="SACE_0630"
FT                   /product="phosphoserine aminotransferase"
FT                   /function="Phosphoserine aminotransferase"
FT                   /EC_number="2.6.1.52"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0630"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99975"
FT                   /db_xref="GOA:A4F7F1"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR006272"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7F1"
FT                   /protein_id="CAL99975.1"
FT                   /translation="MTQAEPKTDPTTLQLPSELKPADGRFGCGPSKVRPEQLSRLADEG
FT                   AAVMGTSHRQKPVKSLVGRVREGLRELFSLPEGYEVVLGVGGTTAFWDAASFGLVRERA
FT                   LHLTYGEFSSKFAKATKGAPFLADPVVVSAEPGDAPDPVSDPSVDLIGWAHNETSTGVM
FT                   LAPSRPEGSENALIAVDATSGAGGLAFDARDVDVYYFAPQKCFAADGGLWLAAMSPAAI
FT                   ERIGEIGSTDRWVPEFLSLPTALDNSRKDQTYNTPAVATLFLLADQIEWMNGQGGLDWC
FT                   VSRTGESSQRLYQWAEASDYAKPFVTEPAKRSQVVGTIDFDDSVDAAAVAKALRANGIV
FT                   DTEPYRKLGRNQLRVGMFPAIDPDDVSALCKSIDWVVSQLH"
FT   CDS_pept        complement(695429..696046)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0631"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0631"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99976"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7F2"
FT                   /protein_id="CAL99976.1"
FT                   /translation="MAVTPLPDGRRRLIDISFAEALEDDAETGGQRSDELVEAATYWRR
FT                   AGDHDRARRALLAAVDADDGTGFFDAKAAYAAYLMLRGLRESADELFARLLQSRSTREQ
FT                   TYLSAACAYARDGRPRVALRWANVGLQRLVPEGFPRDFAGGDPGYELLRFRRSLRQRLG
FT                   EPADALDEVFDQALHRGRELSERIRTLRRQAGAPAADTTDTA"
FT   CDS_pept        complement(696107..696589)
FT                   /transl_table=11
FT                   /gene="citA4"
FT                   /locus_tag="SACE_0632"
FT                   /product="citrate (Si) synthase"
FT                   /function="Citrate synthase"
FT                   /EC_number="2.3.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0632"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99977"
FT                   /db_xref="GOA:A4F7F3"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7F3"
FT                   /protein_id="CAL99977.1"
FT                   /translation="MLPMIAEAERTGDARRVVESILDRGERLMGFGHRVYRAEDPRARV
FT                   LRNTCEQLSAPRFEVAAELERAALSVLRERRPDRQIETNVEFWAAVVLDFAEVPTTMMP
FT                   AMFTCARTAGWCAHVLEQKRTGRLVRPSAQYVGPAPRAPQDVEGWGSINPMVAAAG"
FT   CDS_pept        complement(696577..697242)
FT                   /transl_table=11
FT                   /gene="citA"
FT                   /locus_tag="SACE_0633"
FT                   /product="citrate synthase"
FT                   /function="Citrate synthase"
FT                   /EC_number="2.3.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0633"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99978"
FT                   /db_xref="GOA:A4F7F4"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7F4"
FT                   /protein_id="CAL99978.1"
FT                   /translation="MSNAGESGFRPGLEGVVAFRTEIAEPDRDGGALRYRGVDIEDLVG
FT                   TVSFGDVWSLLVDGRFGDGLPTAPDLALPVRTGDVRVDAQAGLAMLAPSQGFAPLLDIT
FT                   DEQAREQLARASVLGLSYVAQSARGDLPPVPQQRVAEAATTTEQFLTLWRGEPDPRHVR
FT                   ALDAYWVSAAEHGLNASTFTARVIASTGADVAAALSGAVGAMSGPLHGGAPARPGCCR"
FT   regulatory      697439..697498
FT                   /regulatory_class="promoter"
FT   regulatory      complement(697453..697512)
FT                   /regulatory_class="promoter"
FT   CDS_pept        697541..697843
FT                   /transl_table=11
FT                   /gene="ureA"
FT                   /locus_tag="SACE_0634"
FT                   /product="urease gamma subunit protein"
FT                   /function="Urea amidohydrolase (urease) gamma subunit"
FT                   /EC_number="3.5.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0634"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99979"
FT                   /db_xref="GOA:A4F7F5"
FT                   /db_xref="InterPro:IPR002026"
FT                   /db_xref="InterPro:IPR012010"
FT                   /db_xref="InterPro:IPR036463"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4F7F5"
FT                   /protein_id="CAL99979.1"
FT                   /translation="MHLAPHERDKLLVHLAARLARERMDRGLKLNHPEAVALITDHVVE
FT                   GARDGRGVSELMKSGREVLTAEQVLDGVADMVREVQVEATFPDGTKLVTVHDPIN"
FT   CDS_pept        697890..698258
FT                   /transl_table=11
FT                   /gene="ureB"
FT                   /locus_tag="SACE_0635"
FT                   /product="urease beta subunit"
FT                   /function="Urea amidohydrolase (urease) beta subunit"
FT                   /EC_number="3.5.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0635"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99980"
FT                   /db_xref="GOA:A4F7F6"
FT                   /db_xref="InterPro:IPR002019"
FT                   /db_xref="InterPro:IPR036461"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4F7F6"
FT                   /protein_id="CAL99980.1"
FT                   /translation="MRPGEIITGDGPVPLNPGRPRVRITVVNRADRAVQVGSHYHFAAV
FT                   NEGLEFDRAAAWGHRLDVPAGTAVRFEPGVEREVRLVPVGGSRRVPGLRPEYAGELDGR
FT                   GHEPTAPNYGEKGQGHFE"
FT   CDS_pept        698255..699982
FT                   /transl_table=11
FT                   /gene="ureC"
FT                   /locus_tag="SACE_0636"
FT                   /product="urease alpha subunit"
FT                   /function="Urea amidohydrolase (urease) alpha subunit"
FT                   /EC_number="3.5.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0636"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99981"
FT                   /db_xref="GOA:A4F7F7"
FT                   /db_xref="InterPro:IPR005848"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011612"
FT                   /db_xref="InterPro:IPR017950"
FT                   /db_xref="InterPro:IPR017951"
FT                   /db_xref="InterPro:IPR029754"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7F7"
FT                   /protein_id="CAL99981.1"
FT                   /translation="MSTPSIDRDRYAELFGPTTGDRVRLADTDLFIEVTEDRSQGPGGS
FT                   GDEVVFGGGKVVRESMGQAAATRAEGTPDVVITGAVVLDHWGVVKADIGIRDGRIAGIG
FT                   KAGNPEAGDDVDDALVIGPSTEVIAGNGKILTAGGIDCHVHFICPQAVEVALSAGLTTL
FT                   IGGGTGPAEGSKATTVTPGAWNLGRVMRSMDFMPVNVLLLGKGSTMRAEALREQLRAGA
FT                   GGFKIHEDWGATPAVIDSALRVAEESGVQVALHADTLNEAGFYESTLAAVNGRSISVFH
FT                   AEGAGGGHAPDIIRIASEPNALPSSTNPTRPHTVNTIDEHLDMVMVCHHLNPSVPEDLA
FT                   FAESRIRPSTIAAEDVLQDMGAISIMSSDAQAMGRVGEVIIRTWQTAHVMKRKRGALPG
FT                   DGRADNARAQRYVAKYTINPAIAHGISGRVGSVEVGKLADLVLWEPKFFGVRPDVVLKG
FT                   GFPAWAAMGDANASIPTPQPCVGRPMFGAQPRAAAASSMFFVAPDALEAGLPDRLGLST
FT                   ELVSIDSTRGVTKHDLPHNSATPDIAVDPDSFAVRIDGDLVEQDPVSEVPMAQRYFLF"
FT   CDS_pept        699982..700683
FT                   /transl_table=11
FT                   /gene="ureF"
FT                   /locus_tag="SACE_0637"
FT                   /product="putative urease accessory protein"
FT                   /function="Urease accessory protein UreF"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0637"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99982"
FT                   /db_xref="GOA:A4F7F8"
FT                   /db_xref="InterPro:IPR002639"
FT                   /db_xref="InterPro:IPR038277"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7F8"
FT                   /protein_id="CAL99982.1"
FT                   /translation="MPGPRSGLAVLALADSRFPGGGHVHSGGVEEAAARGLVTGIADLR
FT                   EFLYGRLHGAGALQAVFAAAAAHAAARGVRQEHWLRLDAELDARTPSPAQREASRAQGR
FT                   GTIRAGRAAWPSPELRELVAATPRPHHPIVLGVLAATAGSGPREAALTAGYLAVSGPSS
FT                   AGVRLLGLDPFAVNAVVAELANDLDGIADAAASAAGLDPADLPAPGAPALDLLAESHDR
FT                   HHREEVRLFAS"
FT   CDS_pept        700673..701419
FT                   /transl_table=11
FT                   /gene="ureG"
FT                   /locus_tag="SACE_0638"
FT                   /product="urease accessory protein"
FT                   /function="Ni2+-binding GTPase involved in regulation of
FT                   expression and maturation of urease and hydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0638"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99983"
FT                   /db_xref="GOA:A4F7F9"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004400"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4F7F9"
FT                   /protein_id="CAL99983.1"
FT                   /translation="MLPEHHDHGHEHGGNGHGHGHRHQVNFDPTAAEPDPYGVAPRGGR
FT                   AFRLGIGGPVGSGKTALTAALCRALGSEVNLAVVTNDIYTTEDADFLRRAGVLDTDRIE
FT                   AVQTGACPHTAIRDDITANLDAVEKLEERHPGLELVIVESGGDNLTAVFSRGLADSQVF
FT                   VVDVAGGDKVPRKGGPGVTTADLLVINKVDLAEQVGADMAVMVADAHRMRGELPVITQS
FT                   LTRTPNAPDVSAWVRQQLAAGVVVGA"
FT   CDS_pept        701423..702190
FT                   /transl_table=11
FT                   /gene="ureD"
FT                   /locus_tag="SACE_0639"
FT                   /product="putative urease accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0639"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99984"
FT                   /db_xref="GOA:A4F7G0"
FT                   /db_xref="InterPro:IPR002669"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4F7G0"
FT                   /protein_id="CAL99984.1"
FT                   /translation="MRATAALRVELAADGRNVVRELRSQPPITLIPRRGVASAAGGPAV
FT                   VHLVGSATSPMGGDRVDLRVHVGAGAALRLSGTAATVALPGQRTGHSRATVRIEVEAGG
FT                   TVEYLPEATVVSGRADHRADMRVELAEHARARCREVLVLGRYGERPGVLTTSTHVVRAG
FT                   TPLLRQRLDIGEQRLAASAGYLAGARVLAAETVVWDHDPAAPAGGQWWSLAPLSGGGAL
FT                   ATSVAADAVTAQRGLAEALGHHPDAEALTRELW"
FT   CDS_pept        complement(702356..702952)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0640"
FT                   /product="putative integral membrane protein"
FT                   /function="predicted integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0640"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99985"
FT                   /db_xref="GOA:A4F7G1"
FT                   /db_xref="InterPro:IPR010617"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7G1"
FT                   /protein_id="CAL99985.1"
FT                   /translation="MGEEAGGRVLALSDGVFAIAATLLALDLRVPEGLPSGELHAALHR
FT                   MVPPLQGYAIAFLVIGVLWLGHHQLFALMHRIGPRVAALNVLLLGLVALLPFPSSVVND
FT                   YDDEPVVVISYALNVCLIALVQVAIVAVALHEGDFVPGVTRARAYVPSAITAGVFLVSV
FT                   PLALVSTQWAMLSWLLLIPGHFVEARVNRDPRSGG"
FT   CDS_pept        703270..703938
FT                   /transl_table=11
FT                   /gene="pdxH"
FT                   /locus_tag="SACE_0641"
FT                   /product="pyridoxamine 5'-phosphate oxidase"
FT                   /function="Pyridoxamine-phosphate oxidase"
FT                   /EC_number="1.4.3.5"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0641"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99986"
FT                   /db_xref="GOA:A4F7G2"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="InterPro:IPR019740"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4F7G2"
FT                   /protein_id="CAL99986.1"
FT                   /translation="MSEANSTPTATLPSMRVSYEAGSLDEGSLAGTWHEQLALWFEQAV
FT                   HDPSIHEANAMVLATADADGLPSSRTVLCKGFDARGVVFFTNYTSAKSHDLKVTRFAAA
FT                   TFPWLAMQRQVNVRGTVEKVSQEETAEYWAERPRGSQLGAWASPQSRVVSGRSALESTL
FT                   NGIERRFADAEKVPVPPHWGGWRIVPESVEFWQGRPDRLHDRLRFRNNDGAWVVERLAP
FT                   "
FT   CDS_pept        704109..705431
FT                   /transl_table=11
FT                   /locus_tag="SACE_0642"
FT                   /product="probable multidrug resistance transporter, MFS
FT                   superfamily"
FT                   /function="77 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0642"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99987"
FT                   /db_xref="GOA:A4F7G3"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7G3"
FT                   /protein_id="CAL99987.1"
FT                   /translation="MQKRSGEAVAERRTLRSRLGKVFLDTRPLRYPAYRRLWLSNIVTS
FT                   VGAQVSSVAVPKQVYDLTGSSAYVGLAGLFGLVPLLVFGLWGGAIADTVDRRRLLLVTN
FT                   GGLAVTAVLLWLVAAAGVPSVWLVLVLFAAQQTFFAVNMPTRGAAIARLLPLHLLPSAQ
FT                   ALGTTVFQLGAITGPLLAGMLLPLLGLPALYLIDAIALCAALWAVLRLPPLPPNEGAPA
FT                   RAGLRSILDGFRYLTLHKVLLASFLMDIIAMVFGMPRALFPEMAERTFGDPPGGGVALG
FT                   LLFAAIPLGAFVFGVLSGWLHRVQRHGVGVTVGVVAWGVAVIGFGMSDALWPAVLFLAV
FT                   GGGADLVSMVYRSAMLQAAATDEMRGRMQGVFTVVVAGGPRLADVLHGAGGAVVGTGAA
FT                   VAGGGALVVFFAILAVFCLPAFWRYRAPQESDEPAEKANAE"
FT   CDS_pept        705569..706942
FT                   /transl_table=11
FT                   /locus_tag="SACE_0643"
FT                   /product="cationic amino acid transporter, APC family"
FT                   /function="Amino acid transporters"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0643"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99988"
FT                   /db_xref="GOA:A4F7G4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7G4"
FT                   /protein_id="CAL99988.1"
FT                   /translation="MNDDAPGGAQNPGLKKVMGPKLLLFFVVGDILGTTIYSLTGKVAG
FT                   KVGGALWIPFLVAFLVAFLTAFSYLELVGKYPKAGGAPLYVHRAFGVHFVTFLIAFAVM
FT                   CSGITSASSAAQAFSGDYLEAIVPGVPAWPVAIGFLLILAGINLRGVGESVKMNVVLTC
FT                   VELTGLLIVIVFGAFAVFGGSSNPDLVPDPSRLTQFNADTSPLLAITSATALAFFAMVG
FT                   FEDSVNMAEETKNPAKNFPRALLMGLSITAAIYLVIALITSTLVPTAELAESDGPLLLV
FT                   VQAAAPWFPPILFSAIALFAVTNTALINMLMASRLVYGMAQEKIIPKQFGAVHRTRQTP
FT                   WVSILFTSIIAMVLVSLLDISDLGSTTSLLLLAVFAVVNVAVLVLRKHKVEHEHFQAPT
FT                   WVPVLGALSCAFFASPLSGRPVDEYLIAGALLGIGVIFWVINYFVTGGTRFDAAKLSK"
FT   CDS_pept        706977..707903
FT                   /transl_table=11
FT                   /gene="yihR"
FT                   /locus_tag="SACE_0644"
FT                   /product="predicted aldose-1-epimerase"
FT                   /function="Galactose mutarotase"
FT                   /EC_number="5.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0644"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99989"
FT                   /db_xref="GOA:A4F7G5"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR037480"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7G5"
FT                   /protein_id="CAL99989.1"
FT                   /translation="MNDPVPATGRQFEIAHGAARAVVTEVGAALRAFEVGGVPYSETYG
FT                   PDEQPPSAAGAVLVPWPNRVADGHWTLDGEPQQLALSEPARHNAIHGLLRHAPWRLVEH
FT                   AESTVVLHAMVVAQPGWPVPLLTSIGYTLDDDGLTVTHTVENLGARATPFGVGVHPYPR
FT                   AGHAETDDCVLRLAASSVLPVDPERLLPTRPPRALQGDEIEFRTGRRLAGVLLDTAFGG
FT                   AAPAPDDPRERIRHTLTDPTGHGVELWADPVFKWVQVYTADDFPGRGRAVAIEPMTCPP
FT                   AALNSGEDLLVLQPGETWIASWGLRPL"
FT   CDS_pept        complement(708952..710100)
FT                   /transl_table=11
FT                   /gene="acd"
FT                   /locus_tag="SACE_0645"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /function="Acyl-CoA dehydrogenases"
FT                   /EC_number="1.3.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0645"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99990"
FT                   /db_xref="GOA:A4F7G6"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7G6"
FT                   /protein_id="CAL99990.1"
FT                   /translation="MMPADRLLPTPEATDLLALTREMARDELAGAAAGHEAAGTFPREV
FT                   FELLGKSGLLGLPYPEQYGGGEQPYEVYLQVLEEISRAWMTVGVGLSVHTMACFPLAHF
FT                   GTDGQREKWLPDMIGGRTLGGYALSESHAGSDAAALSTRAVRAGDAYEVTGTKSWITHG
FT                   GVADFYTLMARTSDDGPRGISCLLVDGTTPGLSAGTPEHKMGLTGSPTTELRFDGARVP
FT                   AERLVGAEGDGLKIALAALDSGRLGIAACAVGLAQAALDLAVDYAKQREQFGRPIIEFQ
FT                   GLEFLLADMAAVVHSARATYLDGARRRDAGMPFGMQASVAKLVATDAAMKVTTDAVQVL
FT                   GGVGYTRDFPAERYMREAKVLQIFEGTNQIQRMLIGRHLAKS"
FT   CDS_pept        710258..710920
FT                   /transl_table=11
FT                   /locus_tag="SACE_0646"
FT                   /product="possible transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0646"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99991"
FT                   /db_xref="GOA:A4F7G7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7G7"
FT                   /protein_id="CAL99991.1"
FT                   /translation="MTTSDRSLAGGPRPRQAGTRQVSARRAELLDRLRDLFLAEGFAHL
FT                   TLDDLAGRLHCSKSTLYTLAGSKEQLAVRVVGHYFKTATAFVEGRVETVTDVRDRMRVY
FT                   LDAAAEALRPASREFIEDMAANSATRATYEANAHAAADRVRRYIRDGVREGVFREVHAA
FT                   LVAEMVGRTINGIQSGEIGERTGLSDAEAFAALSQFLLGGLSAEQGDNGRDHSSEEK"
FT   CDS_pept        710917..711846
FT                   /transl_table=11
FT                   /gene="cscK"
FT                   /locus_tag="SACE_0647"
FT                   /product="ribokinase:carbohydrate kinase, PfkB"
FT                   /function="Sugar kinases, ribokinase family"
FT                   /EC_number="2.7.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0647"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99992"
FT                   /db_xref="GOA:A4F7G8"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7G8"
FT                   /protein_id="CAL99992.1"
FT                   /translation="MIVIGGEALVDLVPDQSTADGELGPLHPRLGGGPYNVAIALGRLG
FT                   VPVGFFARVSTDQFGDKLVERLHDSNVDTSLVQRGPQPTTLAVVGLAEDGSARYSFHTA
FT                   DTAVRFVEDRELPAETSAVAFGTLGMVLEPAASVYEKVLFREAERGRFVALDPNIRADL
FT                   IEDPSAYRERFASWLPAVSLLKVSEEDAEWLAGGEDLATALRRWQQAGPAAVVMTRGAE
FT                   GLSVLTASGELFEVPGVRAEVADTIGAGDTVQAALLGWLHRNDALSVDGVRALGREDWE
FT                   RALRFAAAAAAVTVSRPGAEPPFASEVD"
FT   CDS_pept        712643..713947
FT                   /transl_table=11
FT                   /gene="gltA-2"
FT                   /locus_tag="SACE_0649"
FT                   /product="citrate synthase"
FT                   /function="Citrate synthase"
FT                   /EC_number="2.3.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0649"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99993"
FT                   /db_xref="GOA:A4F7G9"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR010953"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7G9"
FT                   /protein_id="CAL99993.1"
FT                   /translation="MPDDATTKRTVALRYDGGEHEMQVTQPTEGAPGVDLGKLLAQTGL
FT                   VTLDPGFVNTAACTSDITYIDGDAGILRYRGYPIEELAAKSNFIEVSYLLIYGELPTQQ
FT                   QYEDFAERIRRHTLLHEDLKQFFDGFPRDAHPMPVLSSAVSALSTFYQDSLNPFDANQV
FT                   ELSTVRLLAKLPTIAAYAYKKSVGQPFLYPDNSLGLVENFLRMTFGFPAEPYEVDPTLT
FT                   RALDLLFILHADHEQNCSTSTVRMVGSSEANLFASISAGINALFGPLHGGANSAVLEML
FT                   EGINRNGGDVDSFVNRVKNKEPGVKLMGFGHRVYKNYDPRAAIIKKTADEVLGKLSAND
FT                   PLLDIALKLEEKALADDYFVERKLYPNVDFYTGLIYKAMGFPTKFFTVLFALGRLPGWI
FT                   AHWREMLEDPARKISRPRQVYTGQAERSYTPIAQR"
FT   CDS_pept        complement(714121..714933)
FT                   /transl_table=11
FT                   /gene="cloP"
FT                   /locus_tag="SACE_0650"
FT                   /product="O-methyltransferase"
FT                   /EC_number="2.1.1.101"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0650"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99994"
FT                   /db_xref="GOA:A4F7H0"
FT                   /db_xref="InterPro:IPR008884"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7H0"
FT                   /protein_id="CAL99994.1"
FT                   /translation="MSATGLSRPDARERTGSPDANGTRYLELMKRVLTNVVYEDVTHRL
FT                   DHANARGNPRFDPERRRNGLDWPSVAHTMIGRKRLDNLHDCLERVVADDVPGDLAETGV
FT                   WRGGACIFMRAFLAAHGITDRQVWVADSFEGMPDTDGSAHDLDRELALHRMNEVLGIPL
FT                   EVVRDNFRRYGLLDEQVRFLPGWFADTLPAAPVSELAVLRLDGDLYESTMDALVHLYPR
FT                   LSPGGFVIVDDYALPPCRAAVREFRRDNGIHEPVEWIDYMGVYWRRER"
FT   CDS_pept        complement(714930..716198)
FT                   /transl_table=11
FT                   /gene="cypA"
FT                   /locus_tag="SACE_0651"
FT                   /product="cytochrome P450-like enzyme"
FT                   /function="Cytochrome P450"
FT                   /EC_number="1.14.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0651"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99995"
FT                   /db_xref="GOA:A4F7H1"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7H1"
FT                   /protein_id="CAL99995.1"
FT                   /translation="MQPDQSPTPRPESRHSPAAACPHAAVHREERPGGLVTWQISAFSE
FT                   ARAALGDSRFSKDPRRLGEALRAGGRSMFAEYGDNLLDNLLNSDPPDHTRLRRLVGKAF
FT                   SPATIERLGPTTQRLADELVASMLPAGRADLLAQFAYPFAFGVIARVLGLPPDSYRIFQ
FT                   RWTESMTAPREQGTDRMVAARHLCEHVTELVRRSREWLASAPAETLLDELVSARDDGDR
FT                   LSENELVATVLLLIIAGHETTVNLIGNGVHALLQHPGQLALLRDHPDLIDGAVEELLRF
FT                   QPPISKTTLRVTTTDVEVAGTEIPAGSIVNVLVPAANRDQRQFPDADRLDITRPPSAHM
FT                   SFGHGIHYCIGAPLARMEGRIAIGALLRGLPGLRLAEPAAEIPWRASNILRGLQRLPVR
FT                   FDSAGADDEVRDRRHAGAARVHA"
FT   CDS_pept        complement(716246..717397)
FT                   /transl_table=11
FT                   /gene="iroB"
FT                   /locus_tag="SACE_0652"
FT                   /product="putative glucosyltransferase"
FT                   /function="Glycosyl transferases, related to
FT                   UDP-glucuronosyltransferase"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0652"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99996"
FT                   /db_xref="GOA:A4F7H2"
FT                   /db_xref="InterPro:IPR010610"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7H2"
FT                   /protein_id="CAL99996.1"
FT                   /translation="MRVLLSSLPAAGHLYPLVPFAWALRCAGHDVLVAAPSDLVPEATA
FT                   TGLPVAAVTDGPIGLRDLLERLRRLPWFGGDHAILGSLHDFATGADDRSPLTDLVEQTL
FT                   PGTEALVRDWRPDVVLRDMADLTGVLACARTGVPFAEHWWGLAAPAPARGELRRIFGDL
FT                   FARFEARTPPRRALTIDPVPPSFQSDDAPPVYRSRYVPYNGRAERPALPPRSQTPRICL
FT                   SFGTLLTGDGVSGLAERVLDAAHRLGAEVVLAADEPPVESHPALLAAGRLPLDQVLASC
FT                   DALVHHGGSGTMLTALCHGLPQLVFPHGSDHFVNADRLRSLHLAAVLNARDDPTRVERT
FT                   LHAVLTDEGMRAGTRKIADEIAAQPAPADLVPLFEATVEDLAA"
FT   CDS_pept        complement(717413..718435)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0653"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0653"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99997"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7H3"
FT                   /protein_id="CAL99997.1"
FT                   /translation="MVVELEITDGAALVRYPIALVRGRRPEVADDPGHSPEARFSFDVV
FT                   DLANELFGPRRSRGAAARRSELTSSSPFSGGRLDIDAARRMASVHRAISALAEACSGGS
FT                   SSLNALAIRYGTDKWGGLHWYTPHYERHFADLRDEPVRLLEIGIGGYDVDGFGGGSLKM
FT                   WKRYFRRGLVHGLDIYDKSFLDGTRIRTLRGDQNDPAYLTAIAEEMGPFDIVVDDGSHV
FT                   GEHQLTSFHALFPHIRPGGFYVIEDLHTSYWPEYGGTDAPVRGSGTALGLLTQLLDGLH
FT                   YEERGDSGGVPLPGVDDRTVALHVYRNIAFVEKGVNAEGGIPLWTKAPSQSVAAATTAR
FT                   "
FT   CDS_pept        complement(718864..720039)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0654"
FT                   /product="ABC transporter (permease) (Na+ exclusion)"
FT                   /function="ABC-type Na+ efflux pump, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0654"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99998"
FT                   /db_xref="GOA:A4F7H4"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7H4"
FT                   /protein_id="CAL99998.1"
FT                   /translation="MSVVWLVARREVVTRVRTRSFVVGTLVTIAILGLYVAVTMFVGAN
FT                   QTTKVGVAGQATAVAEQLRVVADERGKALEVLDVDDEAAGLARLRDGELDALVTGAPDA
FT                   LRLVVEQQADPELAGALDTIARQQALDAELAKSGLDPAAVHSTMDSAQVLVTSLEQPDP
FT                   QRGERIGIAVAAGLMLYMFLIMAGQTVAQGVVEEKSSRVVEILLSTIRPGQLLTGKVIG
FT                   IGLVGLLQFGIISGTGLAAAAGAGAVTLPKGALAGSLALTLVWFVLGYFFFATILAAAA
FT                   SLVSRQEELQSVVSPVSVLLVLPFVVAVSVLPGDPDSTTGAVLSLVPGFSPVLMPMRAA
FT                   LGVAATWELVVSVVLTLVATAALLRLGGRVYAGAVLRTGARVRLGDALRRS"
FT   CDS_pept        complement(720036..720935)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0655"
FT                   /product="ABC transporter, ATP-binding component"
FT                   /function="ABC-type uncharacterized transport system,ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0655"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99999"
FT                   /db_xref="GOA:A4F7H5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7H5"
FT                   /protein_id="CAL99999.1"
FT                   /translation="MLEVDNVSKRYGDVVALEGMTFSVHAGEMFGFVGSNGAGKTTTMR
FT                   IALGVLAADAGEVRWNGAPLDLDARRRIGYMPEERGLYPKMRVAAQLAYLGELHGMSRA
FT                   RAADAAELWTGRLGLSERRDEEVQKLSLGNQQRVQLAAALVHDPEVLVLDEPFSGLDPV
FT                   AVEVMSEVLRDRCAAGVPVVFTSHQLDLVERLCDRVGIVRDGRMVACGTVAELRDAGPA
FT                   RLVVDGPDGGGAWARDLPGVRVVGVDRDRTTLELTDGTDDQAVLRAAVAAGPVREFRRL
FT                   RPTLTELFHNVVTEEPVA"
FT   CDS_pept        complement(721067..721495)
FT                   /transl_table=11
FT                   /gene="tnp9B"
FT                   /locus_tag="SACE_0656"
FT                   /product="transposase, IS4 family,"
FT                   /function="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0656"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00000"
FT                   /db_xref="GOA:A4F7H6"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7H6"
FT                   /protein_id="CAM00000.1"
FT                   /translation="MSDRSGIPLAVVISAANRNDHRELQTVIDAVAPVRGSAGRPRRRP
FT                   RKLHADKGYDYPVCRHALRRRGIIARIARRGIESTTRLGRHRYVIERTLEWVSRFRRLA
FT                   RRYERKAAHYAAFASLACAVICYRRAAKLDLLTHNNPK"
FT   CDS_pept        complement(721546..721866)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0657"
FT                   /product="IS1647-like transposase"
FT                   /function="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0657"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00001"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7H7"
FT                   /protein_id="CAM00001.1"
FT                   /translation="MWLLARSLLPEAPQRHQGGGRRRLDDRAVLAAILYVLQTGCAWSA
FT                   LPTSFGVSCATAHRRFTEWSQADVFTRLHQELLDLLGTAGAIDWSRASVDSMHIRAVKR
FT                   GT"
FT   regulatory      complement(722218..722261)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(722391..723971)
FT                   /transl_table=11
FT                   /gene="glpD"
FT                   /locus_tag="SACE_0658"
FT                   /product="glycerol-3-phosphate dehydrogenase"
FT                   /function="Glycerol-3-phosphate dehydrogenase"
FT                   /EC_number="1.1.99.5"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0658"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00002"
FT                   /db_xref="GOA:A4F7H8"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7H8"
FT                   /protein_id="CAM00002.1"
FT                   /translation="MITTPLPAGSLRATSLNASRRAEELSAVGDDEVDVLVVGGGVTGT
FT                   GVALDAAARGLSVALVEAEDLAWGNSRWSSKLVDGDLASLTAGDLLTARESAVERGVLM
FT                   TRTAPHLVRTMPQLIPLHQSASRRAELLLTAGLRAGDALRRAARTPSSALPAPRRVSAP
FT                   EALALVPGLRAAGLRGGLLGFDGQLVDDARLVIALARTAAGFGARVLTRVRVTALDRDG
FT                   ADTVDERSGESLRIRARSVVNATGVWAGVLAPEVRLRAVRSAHLVVDADAAGLAGTSLI
FT                   APLPTGGFLRFLPQPDGRAYLGATEGQTLDTPAELSVPRANESDVDTLLSAVRDLLGAP
FT                   LERTHVMGSFAALRAVPEVSGGSRLRRRPEPLSRRHSVLTSPDGIVTVAGGRLTTYRRA
FT                   AADAVDTAIEAAGMPAGPSRTTAVALVGAAGRHQLTDIEADARLVAKYGTEAVRVAALS
FT                   ELDPDLADTIAPGLTAAEVLWAVRHEGALDVDDVLDRRTRIGLDAGARAAARPAVAELV
FT                   NRALEGVWA"
FT   CDS_pept        complement(724489..725220)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0659"
FT                   /product="TetR-family transcriptional regulator"
FT                   /function="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0659"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00003"
FT                   /db_xref="GOA:A4F7H9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7H9"
FT                   /protein_id="CAM00003.1"
FT                   /translation="MASERHRSTSARRADLVRSAPIASTRAPEADEPGADQHVRTAEHI
FT                   RRAPNRVGDAELLTAARECVLDLGVRRSTLAEIARRARVSRMTLYRRFPDVDSLVTALM
FT                   TTEFAEILHHARAAEGTGSARNRLVNAVLRCVRLLRSAPLLRRVLETDAELLLPYLVEQ
FT                   LGSTQLAAERFLRDYLVQGHLDGSIRRADPAAQSRALLMTLQSFVVSTGPAETGVDPAA
FT                   LAEELAHLLDAALRPETADAP"
FT   CDS_pept        725237..726886
FT                   /transl_table=11
FT                   /locus_tag="SACE_0660"
FT                   /product="FAD linked oxidase-like"
FT                   /function="FAD/FMN-containing dehydrogenases"
FT                   /EC_number="2.5.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0660"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00004"
FT                   /db_xref="GOA:A4F7I0"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7I0"
FT                   /protein_id="CAM00004.1"
FT                   /translation="MSELIDHTLRGSWTPSGAAAAPLSAHALRWLRERIGLVEESTPAV
FT                   PASLLDVPESALGEAVRAELADVVGDQHVLTEVAPRLGRAGGMSYTDLMRRRTGSELAV
FT                   PDGVVLPADPEQVQRVLDVCVRHDVAVVPFGGGTSVVGGVSALCGGKAAVIALDVTRLD
FT                   QLVSIDPVSRIAVFQAGVRAPEAEAVLASHGFTLGHFPQSYERATLGGFAATRSAGQAS
FT                   AGYGRFESMVEGVRLATPAGDWRLGAAPASAAGPDLRQLAVGSEGALGVITEVALRVRP
FT                   AATEHQYEAWVLDGWQAGADAVRALAQAHALADVTRLSDVDETEVQLELAGGIKARALH
FT                   TMLRGRGVVEPCMLVLGWEAASRAELKQRRAATLQVLRGLRSVRLGRKAGEAWRANRFA
FT                   GPRQRDALLDLGVCVETLETATRWSAVSDLRSAVRSAVVRAIGVDRKAPIVMCHISHAY
FT                   ETGASLYFTVLAARDSDDPIAQWQRAKAAAGEAIAERGTITHHHAVGADHLPWLSGEIG
FT                   TIGVDVLAAAKRAIDPTGILNPGKLIPGREPA"
FT   CDS_pept        727432..728769
FT                   /transl_table=11
FT                   /locus_tag="SACE_0661"
FT                   /product="xanthine/uracil/vitamin C permease"
FT                   /function="Xanthine/uracil permeases"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0661"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00005"
FT                   /db_xref="GOA:A4F7I1"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7I1"
FT                   /protein_id="CAM00005.1"
FT                   /translation="MPATHPVDEFRPLSRLIPFGLQHVLVMAASPISSVFLVSKTLGLD
FT                   PDLTVRLLSATFVLSGVGTLVQSLGPWKFGARLPFVMLPGGAPVVLFIAIAEEHGLPTA
FT                   SGAVILTGLCYFVALPLFARLLRFFPSIVIGTMIVIIGVTLVKAGGVLVVGKPGTPGFG
FT                   DPRNLLLGFATVAFTVLCFRFLGGMLRQLAVVFGLLAGTALAALLGAVHVEGLDRTAVV
FT                   GLPSPLPFGPPEFDLVAALPLMIFALASMAEATGQTVLNGEIVGKEIDVRRDVPRTIRG
FT                   DALISLLGGLFGTSMMVTSGENVGIVRVTGVRSRFVTVIAGVVLVLIGVFTPIAHLVNA
FT                   VPPAVVGGTAIVVFAIIAVLGVQMLAKADFADHANVVIVAVALSAGLLPSLLPGLYQAL
FT                   PSNLAMLLESGVAVGAFVAAGLNLLFHHLPRFGAATEKRENDCAAT"
FT   CDS_pept        728750..730102
FT                   /transl_table=11
FT                   /locus_tag="SACE_0662"
FT                   /product="cytosine deaminase or related metal-dependent
FT                   hydrolase"
FT                   /function="Cytosine deaminase"
FT                   /EC_number="3.5.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0662"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00006"
FT                   /db_xref="GOA:A4F7I2"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7I2"
FT                   /protein_id="CAM00006.1"
FT                   /translation="MTAPQRDLLQARELLLLPEVLLAGGPVRDHAVVVADGVFRAVGPA
FT                   AELVEAHPELDPVHLDGHLLMPGFVDAHHHLTQSFGKALAFGEPSEIFRRIWVPLEQQL
FT                   DPESAYVAAKLAALEALRGGFTTVAEAGTRARVDIGVVADAATDAGIRCVLGEVCFEPD
FT                   DGERHLSRWDSAELVHPSLAIPIAEAAEHEVLHAVSRLCAEAGAVFQIHVNEHLASVER
FT                   SLERHGRRPLEHLHDVGALGPQTLAAHATMLTPGELRLLADSGAAVSYNPVASGWKGNA
FT                   VAPAALMAASGVRFGLGTDGTRGDGFRLTDAAELAQRLAFGLHNGDSSCGGGLTWLRHA
FT                   TAGGADAVGLGSVTGAVEAGRAADFLLVDLRVPELCPSWDLPWELVRLANRDQITAVVV
FT                   AGRLRLWRGWPVDWDGRELLEEAAKTGREVVARAPLRKIHPLSTGCREEDA"
FT   CDS_pept        730099..730806
FT                   /transl_table=11
FT                   /locus_tag="SACE_0663"
FT                   /product="protein of unknown function DUF81"
FT                   /function="predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0663"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00007"
FT                   /db_xref="GOA:A4F7I3"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7I3"
FT                   /protein_id="CAM00007.1"
FT                   /translation="MSIGFLVLVAVAVAAAAFVQGATGVGFALIVAPVVGLVEPSLLPV
FT                   LLLVLMIPLNLYVAGRERGSLDRTGAGWITAGRFAGTFGGLWVLAAIPLAQLNLLVGGS
FT                   TVLAAVVTLLAPSFSPGRAAFLTAGAVTGVTETATGVGGPPLALVYQHSPAPVLRSTVA
FT                   VCFLAGELISLVVLLATERIRAEQLWLALLLLPAVVLGALLSRFVHHRLDGRLMRLLVQ
FT                   VFAIVSGVVLLFA"
FT   CDS_pept        complement(730929..731945)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0664"
FT                   /product="transcriptional regulator, LacI-family"
FT                   /function="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0664"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00008"
FT                   /db_xref="GOA:A4F7I4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7I4"
FT                   /protein_id="CAM00008.1"
FT                   /translation="MAGARPTIADVAREAGVSRTTVSHALNGIGKVDPRTRERVERVAA
FT                   ELGYRPSLRAQRLRRGEARTIGLVSSMPFAVAGGPSRLGFFMEVAAAAAESALMHGFAL
FT                   VLVPPVEADPPLDSLDIDGAIVVEPDADDSATKRLRDRGLPIVALGRQPGTDLPHVDLH
FT                   AAAVVRLLLEHLREQGGRRIALLVGSARRHSYVDAAHEYRRFAHEHGMPELVVLAEESG
FT                   GTEAGYAACADLLDRHPGVDAVCATVDAFAVGAVRALTDRGLRVPDDVMVATRYDGLRA
FT                   RTCEPPLTAVDLHLGQAAEGAVSVLLAEMRRGPARGEAPEVPVPPPVLVPRASSLRR"
FT   regulatory      732088..732147
FT                   /regulatory_class="promoter"
FT   CDS_pept        732175..732687
FT                   /transl_table=11
FT                   /locus_tag="SACE_0665"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0665"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00009"
FT                   /db_xref="InterPro:IPR007061"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7I5"
FT                   /protein_id="CAM00009.1"
FT                   /translation="MTTSSNTPADERDDILATLREQRGFLLITVRGIGDEQAARRTTAS
FT                   ELTLGGIVKHLTRVERYWMQVMTRQEPEIVMDPDQYRMVEGETLAGIVDDYAAAARETE
FT                   QALMATPDLSRQIQLPPAPWAPDPVFWSPRRIMLHLIRETAHHSGHADIIREEMDGAIT
FT                   TTQMASV"
FT   CDS_pept        complement(732733..733122)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0666"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0666"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00010"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7I6"
FT                   /protein_id="CAM00010.1"
FT                   /translation="MSEQVPASVRYKELAAAATTAAQRMRRHEQEKAAELEESVTRGNS
FT                   RKKEADQQREQVEKDVRIRWNLALEALWDERWLKVSSLPEPDLSAPPATPEESRRTVQD
FT                   AFLELHDALDKPRWSAGSLLRRKSG"
FT   CDS_pept        complement(733115..735940)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0667"
FT                   /product="cell divisionFtsK/SpoIIIE"
FT                   /function="DNA segregation ATPase FtsK/SpoIIIE"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0667"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00011"
FT                   /db_xref="GOA:A4F7I7"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7I7"
FT                   /protein_id="CAM00011.1"
FT                   /translation="MRKRNERRSRIEAAFARLRSSVATALGAAENERRRIHADCAQREF
FT                   ALRIAQIGVAEAARDPSRVEGAPSPAFDAAMTEATLERDEIYAEWTASGPVELTALTAA
FT                   AAPGSAGRPWEEWLGWVGTADLSSPAPELWHIGTAEVPDSPAPQPFPAAVPLLDESHLR
FT                   ITTRPGTRETAEALVQNLLLRVLGHFQPGLVRVHVWDVAQLTGTLPGLYPLTRAGLLTA
FT                   HDPTRLDEMLEALSDHIRRIHTSALLGGHTSLRALAAETGHRSEPWRIAVLFGDGQPLR
FT                   EEQQQQLQRIARNGLACGIQLVIVDLPLTVNSAIESVTLIDPDRARCSMTGPEAVIRLE
FT                   ESPPGGTVTKACSAVAEAFLARRARVRTFEDLVPEQLWTQRSTSGLHAPVGFSEGEPVW
FT                   VTLGDASPHTLIGGPSGSGKTNFLYGMLGGMAARYSPDELELYLLDFKEGVSFAQFTPG
FT                   KRDPSWLPHAQLVGVNVNADREFGLALLRFLSAEMRRRADAAKAHEVTKLEELRAEDPD
FT                   GRWPRIVAVIDEFQYLFAERDTVSSQATTLLEDVARRGRSQGIHLVLASQDVSGIEAFW
FT                   GKPAIFEQFILRIALPKARRVLTEQNTAAMELPRWHAVINHESGVKHGNEIARIPDATA
FT                   KHTFDDLQLKLWERRDPAAAPPRLFDGSHLPSLAALGDYRGLRPTGAAPKALLGQVIDV
FT                   DGTAAAVELARSPGRNIAVIGSVRVDAASVLGAAALSLARQHEPGGIRFTVAELVDEAH
FT                   EDVRALVGALRDEGHEVEVVGLDGIEAAVASLADTVDQRSASSEAVPVPHCLLLYAADA
FT                   AQTVLERKDPQTRASALDHLRKVLKQGPELRIHVIGWWRSAQRVKNTLGMGPVDDIGAW
FT                   VAFDVHGQELQVFAAGQVVNWSPRARRGLFFDRSKHSRPEVVLPFDLAGTAVPEVPAQR
FT                   SSDQIWEEADE"
FT   CDS_pept        complement(736271..736522)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0668"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0668"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00012"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7I8"
FT                   /protein_id="CAM00012.1"
FT                   /translation="MSALGELIAALNEVEDRLELAQGQLARGRRSLGEAHEALARLDPE
FT                   HPETVVPPGLRRADDQIERTQGLVDHTLDALRGFVTRL"
FT   CDS_pept        complement(736526..736786)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0669"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0669"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00013"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7I9"
FT                   /protein_id="CAM00013.1"
FT                   /translation="MAGVEEVRAGIALASQKASESIAALQQATLALEEAQQALANATQG
FT                   SSQEEIQHATGMLAEAAHSLTGVQGTINASISSAEGYAGRL"
FT   CDS_pept        complement(736954..737781)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0670"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00014"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7J0"
FT                   /protein_id="CAM00014.1"
FT                   /translation="MRPAMSENTELELLITVVAGAEDERAARDACRGLVRRLDGRIVES
FT                   GDCSDEEPGCWSVTISCTGAASGTGPGALSRAVRTFLRELGPDYGRHRVSCEPPTAWTV
FT                   VDNPELVGDLVAGGERMLVEAWTGGSAAFDSFDPLDDPDEPMPEPDPGPSELDEHGRRR
FT                   PRLALLVDVVTERRAGAEWPARALASRLSRNAVVVDWAERPPMVRIELDLGPAVGEPPE
FT                   IVTNAIAQLGGSGWSRLRVDGPRAMARWSAAPTPPSGIAAIELSAAADAANAD"
FT   CDS_pept        complement(738492..738884)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0672"
FT                   /product="conserved protein (PRC-barrel domain)"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0672"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00015"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7J1"
FT                   /protein_id="CAM00015.1"
FT                   /translation="MDVERAQDLIGTAVYDRSGVKIGRVGNVYVHDSTHQPEWVTVRCG
FT                   FLGTRETFVPLNGASTQEDRIDVSVSKDMVKFAPRVAAEHGHLSDAEGRDLYSHYGISE
FT                   LPGVETTGTPGAGQTGTTGRHRRHDG"
FT   CDS_pept        complement(739120..739923)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0673"
FT                   /product="lipase"
FT                   /function="Lysophospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0673"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00016"
FT                   /db_xref="GOA:A4F7J2"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7J2"
FT                   /protein_id="CAM00016.1"
FT                   /translation="MVEPTAREVTVPSGSLAVRTWSAAAPRWIALLAHGYGEHSGRYQW
FT                   VAQQLVGAGAFVCAPDHVGHGNSPGERVLFSDADDVVADLDAVRREISAEHPGLPVVLI
FT                   GHSLGGMLATRYAQLHQDELAAVVLSAPVLGTWHALDLLEAEEIPETPIDPATLSRDPQ
FT                   VGRDYADDPLVWHGAFKRTTLAAIDECLTRINEGVTLRVPALWIHGEDDELVPEADTRT
FT                   GIDRIRGYSFHEHIYPGGRHELFNETNKAEVMGDVLTFVGRELNT"
FT   CDS_pept        complement(740240..740842)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0674"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0674"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00017"
FT                   /db_xref="InterPro:IPR025326"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7J3"
FT                   /protein_id="CAM00017.1"
FT                   /translation="MLLSSCGQQSGGMSVPAVQNAQSPTPPASAAPPAPSSGTAPAASA
FT                   SGKTEPQAPQPKPQDASSQRCHTSMLSGSLQPGEPGAGQRYAELVLTNTSGETCNLYGY
FT                   GGLQLIGADGRPLPTDLKRTPNPGPTLIRLAPGKSASATLHWTAVPHEGEPTDGQCQPT
FT                   PVRAEVIPPDETEPLSVTWDLGEVCGFGSIDGSAYHS"
FT   CDS_pept        741284..742072
FT                   /transl_table=11
FT                   /locus_tag="SACE_0675"
FT                   /product="lysozyme M1 precursor"
FT                   /function="Lyzozyme M1 (1,4-beta-N-acetylmuramidase)"
FT                   /EC_number="3.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0675"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00018"
FT                   /db_xref="GOA:A4F7J4"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018077"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7J4"
FT                   /protein_id="CAM00018.1"
FT                   /translation="MRIPGIDVAKYQGEPDWGAVRGAGYAFTYIKATEGIGYVSPTLDA
FT                   QLAGARGAGMVTGLYHFARPDTNSPQQDAADFAAQLGRLNSSAAGNLPPCLDIETDGPD
FT                   LAAWVKGFIDAIRGHTGRHEVVVYASTSWFAGKLGTDSWVDPGVFLWVAHYGRPPGEPG
FT                   YLTDRVVMHQHASDGQVPGIAGNTDLNVSMVDLPVLTGAGAPPPPPPGPPPAETYVVQP
FT                   GDTLSGIGARLGVDWREIARVNGIADPNLIYVGQVLRIPR"
FT   CDS_pept        complement(742929..743984)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0677"
FT                   /product="probable copper resistance transporter"
FT                   /function="predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0677"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00019"
FT                   /db_xref="GOA:A4F7J5"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7J5"
FT                   /protein_id="CAM00019.1"
FT                   /translation="MAVDPDAATSSGSPSEADKSRAVKNAVVAVALAVAVLTALVATAY
FT                   VGTGAIPGLPLPEPDVRFGLPALRVLLDLAAVGTIGLSLLPKLLGSARPKQVEPVLSRT
FT                   RRVSVITALAWMCFALASLLLQVRELAPGSALTTTAVVDYVVSVPAGLGLVVSAGAALV
FT                   SAALGLAALTYGETIPAELRTVVALLGVLPMPLTGHATDWEYHQFSMLSIELHVVAAAL
FT                   WAGGLAALLFFVAPRRGLLAVALPRFSKLATAALATVAVTGAFNGLMQLAITPGVGLAG
FT                   LLTTGYGQLVLLKTACLVAVALLGAQVRFRLLPRVERHQNSALLTWAAAEIVVMAVAYG
FT                   LGAVLARSPVA"
FT   CDS_pept        745061..746002
FT                   /transl_table=11
FT                   /locus_tag="SACE_0678"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0678"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00020"
FT                   /db_xref="GOA:A4F7J6"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7J6"
FT                   /protein_id="CAM00020.1"
FT                   /translation="MTTLAVVLAALGAVGYAVGARTQHGAVHDTIGDSGLGLRSQLRLL
FT                   KNVRWLLGLLALGAGAVLHACALGLAPLTVVQPIGVIALPITVLLNVRERGIRVRDLKP
FT                   AMVFAVVASTVGVGAFVVLAAGSATPTPVAPDDQVLATQLVGGGVLALGVFAMMSRSKL
FT                   RCVLFAAGCAVAYGYVSLLTRAVVQQLGTTDLLSLNLWPLFGIGIAMIVGAWLLQHGYA
FT                   SGPPDLIVACLTVIDPIVAVGLGIGLLGEADRVDTWTAIGEVVCAAVACAGVFALARFH
FT                   PENRERRVPTPVTGSSDLAGPSSTDRPDGSTP"
FT   CDS_pept        746068..747234
FT                   /transl_table=11
FT                   /locus_tag="SACE_0679"
FT                   /product="glycosyl transferase, group 1"
FT                   /function="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0679"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00021"
FT                   /db_xref="GOA:A4F7J7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7J7"
FT                   /protein_id="CAM00021.1"
FT                   /translation="MNGAANFGHRLATGLARLGHDVHVICHAMDRRSSTRVEDGVTVHR
FT                   VGSYATPVHPTFRINTPWQAFAAADELLAEIQPDVVHVQSHFYICRALINAARKRGIGL
FT                   VATNHFMPENIFGYLKIPGLLQPVASRILWRNLIKHYSKAQMVTAPTPRAVQLLQDNGF
FT                   DHRAIPVSCGMDVERYRRRARLFRKNNPDPKTRTVLFVGRLDEEKHIDDLLRAMSLLRT
FT                   EAATRLEIVGDGSKRAAYEQLAHELGIGDRVHFAGFVSDDELLDAYARADVFCMPSIAE
FT                   LQSLATMEAMSAATPVVLADAMALPHLVESGKNGKLFPPHDVHALAAAIDEIISDRATI
FT                   DRMGAASERLVSKHDINAVLGRFESIYRHVTNPDEVLELEELHAELAS"
FT   CDS_pept        747416..747760
FT                   /transl_table=11
FT                   /locus_tag="SACE_0680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0680"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00022"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7J8"
FT                   /protein_id="CAM00022.1"
FT                   /translation="MIALLLASVSMPLPLTVRMSLPAPMRLAVRMPLAALMSLLVGMPL
FT                   AAPKPLAALIPMPPPLSLAPPMSLAPPRLLAAVSWPAPTPMPRPMHAVASSSAMLQRPT
FT                   SADAMPWRPC"
FT   CDS_pept        747652..748521
FT                   /transl_table=11
FT                   /locus_tag="SACE_0681"
FT                   /product="alpha/beta hydrolase fold"
FT                   /function="predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0681"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00023"
FT                   /db_xref="GOA:A4F7J9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7J9"
FT                   /protein_id="CAM00023.1"
FT                   /translation="MAGADANAAADARGRVVVSDAAAADVGGRDAVETVLMVHGLRGTH
FT                   HGLELIADGLDEHRVVVPDLPGFGASGPMSGHRHDVEGYASAMIQLIKLLGDRPVTLLG
FT                   HSFGSIVAAHVASSAPELVRRLVLVNPISSLALNGPRVVLSGLTSAYYSLGKALPPRMG
FT                   NSLLSNKWIVLAASRTMTRTKDRQLRRFIDQNHLRHFSRFHSPALLNETFLASVNNTVM
FT                   EYVDALTMPTLLIAGESDEIAPLPGQRVLAKRLDDAELVVLPDVGHLVHYETPVAAANQ
FT                   IKRFLAAS"
FT   CDS_pept        749142..750278
FT                   /transl_table=11
FT                   /locus_tag="SACE_0682"
FT                   /product="glycosyl transferase, group 1"
FT                   /function="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0682"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00024"
FT                   /db_xref="GOA:A4F7K0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7K0"
FT                   /protein_id="CAM00024.1"
FT                   /translation="MNVFIDARWTRTDTHDGISRYGANLIEALHQLHPVTMLIHDVRQL
FT                   DLLPDGVPHVKINSPFSPRELWVSRTLNKLGADVVFSPMQVIGGFSRRYKLILTLHDLI
FT                   YYRHPQPPGFLPLPVQVVWRLYHKAYWPQRVLLNRADAVVTVSETTRTLMRSYRLTRRP
FT                   ITVVHNAPSELDSSVSVKDSVDSGRGEGAVERAAGEDARNGAGGPRELVYMGSFMPYKN
FT                   VETLIDGMASLPGYRLHLVSRVAPAREAELVRRIPPGADVIFWRGISDGDYHELLSRAF
FT                   ALVTASKDEGFGLPIIEAMNVGTPVVCSDLTIFREVTGGHARFFQPDSPDGFAAAIDGL
FT                   EDGAVRAELVESARVQAKHFTWASSAERLLEVMRSVAR"
FT   regulatory      750475..750532
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(750607..751323)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0683"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0683"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00025"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7K1"
FT                   /protein_id="CAM00025.1"
FT                   /translation="MSAHATAVDLHTTRRGPTRQRSSHLTAVPAAPAQGTSRTLTSPPP
FT                   DIPVLRAPERIPLAFRLVGGRRPTRTSRPEPTPTTQLHGRRYGPGRLSSLLRPPSRPGS
FT                   SSTRLRSVLLNLATTVLLVVGTALATATAAHAASAEGPATIEPHACPADSFCAWPSHDF
FT                   QGAAHQTEVSAAPLGRCVALPQDFEATSFANNTGRPVTVYQDGSCSTEADFRTYPTGSF
FT                   VPRSPYVARAIQVWSH"
FT   CDS_pept        complement(751847..752866)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0684"
FT                   /product="probable transcriptional regulator, AraC family"
FT                   /function="AraC-type DNA-binding domain-containing
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0684"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00026"
FT                   /db_xref="GOA:A4F7K2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR032783"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7K2"
FT                   /protein_id="CAM00026.1"
FT                   /translation="MDPLADLLHGVRAQGAQFCQSILSPPWSLRFESTASLELHTMLHE
FT                   DAWIVPDDGPVLRLRPGDIAVVRGPGRYVIADEPSTPPGLLVRDDRCFSIADGSDVGEA
FT                   LALGPRTFGSSADGSATLVSGTYQLPDSLGERLLCALPPVLVVPAVDDSCLELLELVTA
FT                   ELVRDTPGQQIALDRMLDVLLVFTLRDWFTRPEAEAPSWYRALADPVVGGALRAMHNAP
FT                   AAPWTVRSLAAHVGVSRAGLARRFTELVGEPPLTYLTCWRMDLAADLLRRPGATVTSVA
FT                   AQVGYADGFAFSSAFKRVRGISPRDHRRRAQTATADPDEQASPAIPTDSQPKVPSPVP"
FT   CDS_pept        752966..753763
FT                   /transl_table=11
FT                   /locus_tag="SACE_0685"
FT                   /product="NmrA-like"
FT                   /function="predicted nucleoside-diphosphate-sugar
FT                   epimerases"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0685"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00027"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7K3"
FT                   /protein_id="CAM00027.1"
FT                   /translation="MVLGGTGKTGRRVAAKLAARGADVRVASRRGAVRFDWDDRSTWAP
FT                   ALEGADAAYVIAPSETDDGETISEFIVAATAAGVGRLVLLSAREVETSMVPGLKAAEAA
FT                   VRRSDARWTILRPSWFAQNFSEDMFLPLIDAGLVALPTGDGKEPFIDAEDIADVAVAAL
FT                   TEDGHDRQVYELSGPDLLSFPEAVEMIAAASGREVAFKAVTAGEFMESLLGNGLPENVA
FT                   RLLTDLLDAIRRGENAHLSDGVQRALGRPPRPFADYVREVWGA"
FT   CDS_pept        complement(754393..755199)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0686"
FT                   /product="transposase for IS3518"
FT                   /function="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0686"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00028"
FT                   /db_xref="GOA:A4F7K4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7K4"
FT                   /protein_id="CAM00028.1"
FT                   /translation="MLLAVAGVARSTFFYHQARMDAEDPQADLKEAVTEVFEQAHRRYG
FT                   HRRVHTILVRRGWRVAKKTVLKLMRALGLVCKVRRRRPYVSWKGEVGTIAANVLNREFA
FT                   ATAPNTKWVTDVTEFRVGTGKIYLSPVIDLFDRSVVAYSWSTSPNTELTNSSLRKAIAT
FT                   LEPGQTPLVHSDQGFQYQHASWRRLLTNAGLTQSMSRKATCLDNALAENFFGHLKEELF
FT                   HHNQFDTAKDLTTALDDYLDWYNTTRISTTMKGLSPAEYRAQTPTN"
FT   CDS_pept        complement(755244..755567)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0687"
FT                   /product="transposase for IS3517"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0687"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00029"
FT                   /db_xref="GOA:A4F7K5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7K5"
FT                   /protein_id="CAM00029.1"
FT                   /translation="MKPKQSFSFEFKLEVVRRFLDGEATTAELAREYALSSPKLVETWV
FT                   RKYRREGEDALRPKRRGRPPGAPEPPEGELSEVQRLRQENQRLAAENAYLKKLRALRAQ
FT                   GRK"
FT   regulatory      complement(755724..755786)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(755829..757421)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0688"
FT                   /product="SSS sodium solute transporter superfamily"
FT                   /function="predicted symporter"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0688"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00030"
FT                   /db_xref="GOA:A4F7K6"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7K6"
FT                   /protein_id="CAM00030.1"
FT                   /translation="MNPPELIPSEGAIFNTSIFAVFVLITLFVVYRASSQSTSSDYFAA
FT                   GGSFSGAQNGIALSGDFLSAASFLGIAGAIAVHGYDGFLYSIGFLVAWLINLLLLAERT
FT                   RNTGRFTMGDVIAFRMRARPVRAAAAASTLAITFVYLIAQMAGAGGLVALLLDVKSTGG
FT                   QALVIAVVGLVMMLYVLVGGMKGTTWVQIIKATMLLLCAALITIFLLGKFGYSMTHLLQ
FT                   EAAQNNPKGDAIFAPGVQYGKSELTKIDFVSLSLALVLGVGGLPHVLMRFYTVPNAREA
FT                   RRSSVWAIWAMTAFYLCTLIIGYGAAALVGTDAILDAPGAENSAAPLLAYRIGGTVLLG
FT                   IVSAVAFATILAVVAGLTLTASASFAHDIYANAMRRGRTDSDSVVRVARITALVIGAAS
FT                   ILGGILVNGQNIAFLVGLAFAFAASANLSTILYSLFWKRFNTTGTLWGIYSGLISCLLL
FT                   VIFSPVVSGASDSIFPSVDFAFFPLKNPGIVSIPISFICGIIGTFVGREKVDEDRLAEM
FT                   EVRQLTGIGGVRG"
FT   CDS_pept        complement(757418..757648)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0689"
FT                   /product="hypothetical protein"
FT                   /function="predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0689"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00031"
FT                   /db_xref="GOA:A4F7K7"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7K7"
FT                   /protein_id="CAM00031.1"
FT                   /translation="MTAFFIVWYLGYVVLAAYLPDFMATKLWGEVNVGLVMGIGQFATT
FT                   LIITGAYVRFARKHMDPEVEEIRREAIGDQR"
FT   CDS_pept        758562..762005
FT                   /transl_table=11
FT                   /locus_tag="SACE_0690"
FT                   /product="putative signal transduction histidine kinase
FT                   membrane protein"
FT                   /function="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0690"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00032"
FT                   /db_xref="GOA:A4F7K8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013587"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7K8"
FT                   /protein_id="CAM00032.1"
FT                   /translation="MATGDTGRGAAVIRWRNWSLTTKLAAVVLVPVIFAITLGVGQIRW
FT                   QVDRADEYDRVAKVLDAVDQIEPLVVSVQEERTRSVDFLTGSIDAGKVDEQAVVVDAAV
FT                   RGTRQVMASPEDYSDVVRERFGELNTELGKLDETRALVRDRRAPAPAVIERYSKLVNSI
FT                   LSLNRALTSTVADRNLSSTASAMQDMVSIMEEVRLQQAWVLTGLAEGSISPQALDQLLG
FT                   SRARLIGKISEARATVAAHWQRRLDQTMTGTAILERNKLATAIVLETTDGKFSGGYSVP
FT                   RDQWNQRSDEVIQLIDEGHDDLGAEVRRIAFDLEDDASSAAGWDSVLLLSALILAAAII
FT                   ITIARQLLGSLRDLRRGALKSANKGLPEAVTSIRAGRKVDSELEPVGVDTDEEVGQVAR
FT                   AFDEVNRQALRLAVEQASLRRGYSEAFVSVSRRSQALLERQLRLFEELEKDEEDPDQLS
FT                   RLFQLDHLATRMRRNNENLMVLSGSDLARRFYQPTELADVLRAAVSEIEQYPRVIVQPP
FT                   PAVKLVGHAASDMVRLVAELLDNAANFSSPDTSVTVSSYQSGDGSVVLDVLDEGIGMGH
FT                   AELASANERLARVDEDDLATSRRMGLFVAGRLAVRHDIGVELHGGPDVEGVRATVTIPA
FT                   EHVVAGDAGRTAPPPPGQGVHRNGSTQHDLPNATSIPAQPAGDDQGFPAADFDPSPSLP
FT                   RRGVSEPTARAEFESSAPLPRRDPSGGLNALDSGSPLPRREPREPSLQQDHGAPATEGD
FT                   LSGPAPLFEPSQPSEAAEEQSESYGAAQQIPPEQPAEQTVNLFTPEPGGTSLDIPHQPR
FT                   TVGQDFAPAWPAVTEEPPRDQVADTSESPIFEEVSTQWFQPATDDAQAHATSGTAEHEF
FT                   AWPDSGQRDRSEVEVDELGLPVGPGAADGLARSDQPRSPGRWEDAGQSPAPSGWSEVGE
FT                   HRSPSGWDDADLARSSGDDADGARSSGGWGESRDPEDWSRSDESRSSDGWGLGAATGQV
FT                   EAGEPAEVGMSQEPAPLTTSGLPRRTPRGAAQAEGAGNSRSASDVSREFSEKYNGVHFG
FT                   QSEPAAPAEAGSAVEDAWNFAADDARRAAEAAVNPQPTSFTEAGLPRRTPKAHLAPGSV
FT                   NTPPGDEGGRFERDAEHLRSRLASFQSGSQRGRHRAPDEG"
FT   CDS_pept        762088..762528
FT                   /transl_table=11
FT                   /gene="cvnB1"
FT                   /locus_tag="SACE_0691"
FT                   /product="hypothetical protein"
FT                   /function="uncharacterized distant relative of homeotic
FT                   protein bithoraxoid"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0691"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00033"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7K9"
FT                   /protein_id="CAM00033.1"
FT                   /translation="MTAQETISRRFGWLVTDFTERVAGVAHAIVVSADGLLLTASAKLP
FT                   RDRADQLAAVASGLLSLTQGSAKCFEAGQVIQTVVEMQRGTLLQMGISDGSCLTVLAAP
FT                   QCDMGLIAYEMTMLVERVGQMLTPEIRSQLQGSPGAPTGQLV"
FT   CDS_pept        762596..763090
FT                   /transl_table=11
FT                   /gene="cvnC6"
FT                   /locus_tag="SACE_0692"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0692"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00034"
FT                   /db_xref="InterPro:IPR007995"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7L0"
FT                   /protein_id="CAM00034.1"
FT                   /translation="MLDGFTFTGGRKKRRDRRADRQQPEPAQEQEVLRPAPEPEAAPAP
FT                   PPVEPEAPAASSIRSYTWTGGRTRSNHQLELETLVSTGDAYQPDSVLRLEHQSIAELCR
FT                   HPRSVAEVGALLSIPIGVARVLLADMADLGLITVHQTVSESGSAPHLMLMERVLSGLRR
FT                   L"
FT   CDS_pept        763071..763742
FT                   /transl_table=11
FT                   /gene="cvnD6"
FT                   /locus_tag="SACE_0693"
FT                   /product="ATP/GTP-binding protein"
FT                   /function="predicted GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0693"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00035"
FT                   /db_xref="InterPro:IPR004130"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7L1"
FT                   /protein_id="CAM00035.1"
FT                   /translation="MDSVGYRAQQAGATPPQPQSSRGTTSAKIVVAGGFGVGKTTFVGS
FT                   VSEIVPLTTEAVMTEASRGVDDLAATPNKTSTTVAMDFGRISLDSDLILYLFGTPGQQR
FT                   FWFMWDDLVRGAIGAVVLVDTRRLADSFSAVDFFEDRGLPYLIGVNCFDGQLMHSIEQI
FT                   REAMAIGPDVPIGPCDARDKESTKQTLIALVQHAMRWWTAKQMPPGSQQPPGSPQQPPM
FT                   R"
FT   regulatory      763798..763839
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(763937..764575)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0694"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0694"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00036"
FT                   /db_xref="GOA:A4F7L2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7L2"
FT                   /protein_id="CAM00036.1"
FT                   /translation="MHSRLGDIEAAEVIRDEMARADAHGYALEWKLYGHDEPADLADRL
FT                   LAAGFRPDAAETVLALTLTDTSAFAAPAYDIRRVHDADGLDAVVEISREIGRANADEEK
FT                   QRLAAVLRDTPDEMSVHVAYADGEPVACGRTHFAPGSDLAELAGGRTRTTHRRRGLFTA
FT                   LVAVRLREALARGRTHLVVDALPTSEPILRKRGFHAPTWTRPYLYEPTR"
FT   CDS_pept        complement(765395..766219)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0695"
FT                   /product="protein of unknown function DUF574"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0695"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00037"
FT                   /db_xref="GOA:A4F7L3"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7L3"
FT                   /protein_id="CAM00037.1"
FT                   /translation="MPNTDETSIPHVDTSQPSIARVYDAFVGGKDNFEVDRVVYRKILE
FT                   IAPEAAEVGKQCRAWLIRVVRFLSGQAGIDQFLDLGSGLPTAENTHQAAQRLNPEARVV
FT                   YIDNDPSVAAHGRALLEENDRTHFAVADLREPADLLADPIVTSNLDLTRPVALIQCNTL
FT                   HHVTDDERPADIMRAYVDALAPGSYVAISHLFNPADGSDRAQLAEDSQKRFNAMMGSCY
FT                   YRRREEIEELFCGLEMVEPGLSYLFDWWPDGPRLTPPAPGAHNLLGGVARKN"
FT   CDS_pept        complement(766308..767402)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0696"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0696"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00038"
FT                   /db_xref="GOA:A4F7L4"
FT                   /db_xref="InterPro:IPR009351"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7L4"
FT                   /protein_id="CAM00038.1"
FT                   /translation="MAVDVLSARDLNRATLHRQLLLERSTRTPVEAVEHLVGMQAQVPI
FT                   PPYFGLWTRLDGFAPDDLAQRLLDRSLVRIVLMRSTVHLVTADDCLTLRPLMQPPIDRD
FT                   LARNHPVGVEHREIAAYGRKLLDEKPRTLAQLRPLLAERWPQEDPARLGYAVRSLLPLV
FT                   QIPPRAVWGRSGQPTYATAETWLGRQLDPVPSLEDVVRRYLAAFGPATVADVQTWSGLI
FT                   GLRELVRGLGLRVFRDEHGRELFDLPDAPRPEPDVPAPPRFLPPYDNVLLSHADRTRIM
FT                   TERHRKLLFGANSGVFPGTVLLDGFVRGTWEISRQGTTAVLHVRPLARLSRRDSAALEA
FT                   EGRGLLGFAEESAEQHEVRFGAAE"
FT   CDS_pept        complement(767442..767762)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0697"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /function="predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0697"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00039"
FT                   /db_xref="GOA:A4F7L5"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7L5"
FT                   /protein_id="CAM00039.1"
FT                   /translation="MASRTASPLLHPDESEIDFFAVLSALCDPVRLSIVRALDQRTEVA
FT                   CGTFDLPVAKSALSRHFRVLRESGLIRQRDDGTRRLNTLRRDELDRRFPGFLDLVLREA
FT                   AR"
FT   CDS_pept        767876..768952
FT                   /transl_table=11
FT                   /locus_tag="SACE_0698"
FT                   /product="oxidoreductase"
FT                   /function="predicted dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0698"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00040"
FT                   /db_xref="GOA:A4F7L6"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7L6"
FT                   /protein_id="CAM00040.1"
FT                   /translation="MTSKIGVGIVGLSVNGGWAARAHVPALAALDGYELRALAASGPES
FT                   ARAAGEHFGVAHGSVDDLVARDDVDLVVVTVKVPHHRELVMAALEAGKSVLSEWPLGNG
FT                   LAEAEEMAAAAESRGLRGFVGLQARSAAPVRHLRDLISDGYVGEVLSTSIIASGGRWGA
FT                   TFEPRGEYLLDRGNGATMLTIPFGHTVDALAMVLGEFTEVSSTIATRRAEVGEEGTGRL
FT                   APMTAEDQLVVAGVLDGGAVASVHYRGGISHGTGFHWEINGTEGDLVISGENGHLQFGQ
FT                   VTLRGARAGDAGLAEIAVPAEYDLVPGVARTETAHAVAHAYVQIRADLESGTTTAPDFA
FT                   HAVHRHRELERIRRAARS"
FT   CDS_pept        769006..769758
FT                   /transl_table=11
FT                   /locus_tag="SACE_0699"
FT                   /product="2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase"
FT                   /function="2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase"
FT                   /EC_number="4.1.2.20"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0699"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00041"
FT                   /db_xref="GOA:A4F7L7"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7L7"
FT                   /protein_id="CAM00041.1"
FT                   /translation="MRRELLESGRTTHGGWCCLPGPITAEVMGRAGFDWVCVDTQHGLI
FT                   GYDVLPSMLQALALTGTPALVRVPWNQPAEIMRALDAGASGVIVPMVQSAREAEQAVRA
FT                   CRYPPQGERSFGPMAPLMRDRGFSTTKANDEVLCAVQIETRSTLDELDEILSVPGVDVA
FT                   YVGPADLGISLGVAPTLDVVEPGHLAAVERVLSACQEHDVIPGIHCADPRGARRWRDMG
FT                   FRLLAVATDVRLLELSAAEAVTGAGLSR"
FT   CDS_pept        769886..770629
FT                   /transl_table=11
FT                   /locus_tag="SACE_0700"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /function="8 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0700"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00042"
FT                   /db_xref="GOA:A4F7L8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7L8"
FT                   /protein_id="CAM00042.1"
FT                   /translation="MSGTVLVLGGRSEIGLAVAERLVKRGNDTVVLAARRSGELAAEEE
FT                   RLRQAGATTVARVEFDADDVEGHGPLLEAVVAEHGRIDVVVTAFGILGDQERAERDAAH
FT                   AVQVVHTDYVAHVSVLTHVANLLREQGGGSVVVYSSVAGVRVRRANYVYGSAKAGLDGF
FT                   AGGLADALHGSGAHLLVVRPGFVIGRMTTGMSPAPWSSTPDQVADATVKALARRRRVVW
FT                   VPPVLRLVFAVMRLLPQAIWRRMPR"
FT   CDS_pept        complement(770639..771334)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0701"
FT                   /product="ArsR-family transcriptional regulator"
FT                   /function="predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0701"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00043"
FT                   /db_xref="GOA:A4F7L9"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7L9"
FT                   /protein_id="CAM00043.1"
FT                   /translation="MPSTAQRVADLAGLLADSTRAAFCLALLDGRAWTASELAAHARVA
FT                   LSTASEHLSRLVGSGLLVERRQGRHRYVQLADAQAAELVEGFVAYLSPVREEPRSLRAA
FT                   TTSAALARGRTCYDHLAGRLGVRITDAMAESGLLDTSGGFALTGTGIAWFASIGVEEAE
FT                   LRRTRRPLARSCLDWTERRSHLGGAAGARLCERFLSNGWVKRIGSNRAVRVTPGGDDAL
FT                   RDLLGITDL"
FT   CDS_pept        complement(771389..772339)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0702"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0702"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00044"
FT                   /db_xref="GOA:A4F7M0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7M0"
FT                   /protein_id="CAM00044.1"
FT                   /translation="MEQRHPDIGRWSGRLQELAEATGLSLRQLSEHVPWSPSTLSRYLS
FT                   GERVVDEAWLLASKLIDLAHRRGTPVDVRSDELHLLYQQARKAYQQQRRSARGKADQVG
FT                   ESAATAPTSSDVGLPERPAEQPVVASSGQPNATEPATDSSEQPNATPPAPSPDTPATAT
FT                   SEQSDAAPEPPSSPDARPARRSRRPFVLALATAVAVAAVAAAVWASLLWLRPQTVVWRA
FT                   NIVGTWSAQHQQHLGVFRFRTPDVPGDTDKATYHEGTAVSIVCQARHRRVVSDPTTGQS
FT                   SPVWNRLSDGYWIPDLYTDLPKVTGEAPPLGIPLC"
FT   CDS_pept        772682..773236
FT                   /transl_table=11
FT                   /locus_tag="SACE_0703"
FT                   /product="putative carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0703"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00045"
FT                   /db_xref="GOA:A4F7M1"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7M1"
FT                   /protein_id="CAM00045.1"
FT                   /translation="MNRKSTAWAVALAVTASAFAATPAVASGGTAAAAPSRAELAEQVL
FT                   ADDGITLLDSHVGGQNDPESTAQRNIKDTSQGGAARTSPWSDVGVTKVELSTAMLRGMV
FT                   SIGKDYRYRVTTVAGGDHSPTSYHYKGTAFDVDQIDGQAVNGSNPKVAKIKSACKSAGA
FT                   VEILGPGDAGHDTHIHCAWNS"
FT   CDS_pept        773252..773977
FT                   /transl_table=11
FT                   /locus_tag="SACE_0704"
FT                   /product="lysozyme M1 precursor"
FT                   /function="Lyzozyme M1 (1,4-beta-N-acetylmuramidase)"
FT                   /EC_number="3.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0704"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00046"
FT                   /db_xref="GOA:A4F7M2"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018077"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7M2"
FT                   /protein_id="CAM00046.1"
FT                   /translation="MNIRRKLLVVLASSAALLASVPGAANADSAAADALGIDVSNHNGE
FT                   VDFAKVGADGRDFAFVLATDGESFTSDLFDSQYSGAGEAGLYRAGYHFARPDGSATKQA
FT                   DRFLKTVGYTNDGRTMPPVLDMEANPNGATCYGLDDAQMEEWIKSFVGRVKEKTGREAV
FT                   IYTSPSFWKECTGNSEAFTSNPLWTAEWDVDKPSKVGGWPAHTFWQYSNSGKVDGVDGA
FT                   VDVNRFNGGTAELEKFVKG"
FT   regulatory      773992..774038
FT                   /regulatory_class="terminator"
FT   CDS_pept        774077..774877
FT                   /transl_table=11
FT                   /locus_tag="SACE_0705"
FT                   /product="PEP phosphonomutase"
FT                   /function="PEP phosphonomutase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0705"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00047"
FT                   /db_xref="GOA:A4F7M3"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7M3"
FT                   /protein_id="CAM00047.1"
FT                   /translation="MSTAAERFRALHRAGDPLLLPNAWDLASAAALAAAGFPAVGTTSL
FT                   GVAAAHGLPDAEGAAKSETLALARRLVRLPCLVTVDAEAGFGDPVAVAVELAEAGVAGM
FT                   NLEDGRPGGMADPAEQAAMLREVKHHAPELFLNARIDTHWLREPGVPAMLERARRYEDA
FT                   GADGVFVPGLTDPDDIRTLVASVALPVNVLCPPAGTGNLADLGVRRISTGSLLYRTAVH
FT                   TAVNTARGTLGGRAPQGAVAGYEEFEAMVRDAQLSRRETNSAEY"
FT   regulatory      775054..775098
FT                   /regulatory_class="terminator"
FT   CDS_pept        775113..775514
FT                   /transl_table=11
FT                   /locus_tag="SACE_0706"
FT                   /product="putative Streptomyces subtilisin inhibitor-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0706"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00048"
FT                   /db_xref="GOA:A4F7M4"
FT                   /db_xref="InterPro:IPR000691"
FT                   /db_xref="InterPro:IPR023549"
FT                   /db_xref="InterPro:IPR036819"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7M4"
FT                   /protein_id="CAM00048.1"
FT                   /translation="MRAAIRLTGRLAVASIVFAVAALIPLGANAETGPTKVTLTAQQLG
FT                   APLSVAVLTCEPSGGTHPRAEDACAVMSATGGMIEEMPAQNPQALCPLIWRPVGVTATG
FT                   LWNGKPIEYAKTFANDCVMRSQLGVVFDF"
FT   CDS_pept        775631..776035
FT                   /transl_table=11
FT                   /locus_tag="SACE_0707"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0707"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00049"
FT                   /db_xref="GOA:A4F7M5"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7M5"
FT                   /protein_id="CAM00049.1"
FT                   /translation="MAEVFAGFGAGLLVLGLAPVVTLLLVRPEGLLLREAARLAPGVAG
FT                   LLTGLARDGGVPRLVRLRLWLLLAYLAMPFDLEPDFAPALGLADDAVIVAVAMSTTLRR
FT                   VGFDAVERHWPDSRESFAVLRRLAPSAGTA"
FT   CDS_pept        776083..776241
FT                   /transl_table=11
FT                   /locus_tag="SACE_0708"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0708"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00050"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7M6"
FT                   /protein_id="CAM00050.1"
FT                   /translation="MRLRWFAGLLAALLTATTVGVAHSQPTRQAEPQDPPRHVTCEFIP
FT                   TPENRSR"
FT   CDS_pept        776238..776711
FT                   /transl_table=11
FT                   /locus_tag="SACE_0709"
FT                   /product="putative peptidyl-prolyl cis-trans isomerase"
FT                   /function="Peptidyl-prolyl cis-trans isomerase (rotamase) -
FT                   cyclophilin family"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0709"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00051"
FT                   /db_xref="GOA:A4F7M7"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7M7"
FT                   /protein_id="CAM00051.1"
FT                   /translation="MTIRTNHGDVVAELDRANAPCAVHNLVHLARQDFYDSSRCLRLTN
FT                   SQRLGVLQCGDIFSVEKGGPGYRFADEVTGAETYPRGTVAMGNQGPDTNGSQFFVVHSH
FT                   ANIKPAYTVLGRVVEGMEVLDAIVAGGIVPGEGGEQDGEPRLPVEIRDVKVRR"
FT   regulatory      776891..776924
FT                   /regulatory_class="terminator"
FT   CDS_pept        776922..778160
FT                   /transl_table=11
FT                   /locus_tag="SACE_0711"
FT                   /product="putative IS element transposase"
FT                   /function="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0711"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00052"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7M8"
FT                   /protein_id="CAM00052.1"
FT                   /translation="MARFRMYPTAVQEQQMLLHCAHARYVWNLAVEQHSHWQKGRRSAP
FT                   GFAEQCKQLTEARAASEWLRAGNVDVQQQALKDFAYAKQARFTPGFGEPTWRKKHKHEG
FT                   FRVIGTDRVPACRDDGTPLLNGKGKQVMSRSVVVRKLNKNWAQVTVPGCGWVRFRLSRR
FT                   QPPDAKTFRVTCHNGQWHVAFAVIPEPIEAPGNGETVGIDRGVTITAHLSDGRVLNCPQ
FT                   LTAKERARVRKHQRRAARAAKNSPAKQAEYAKVAQLRAREANRRKDWAEKTSTMLASEF
FT                   DVIRFEKLNIRNMTRTARGTVAEPGRNVRVKAGLNRSILAQGWGMLRSRAEHKAPGRVE
FT                   DVPAPYTSLRCSDCGWIEKNSRKSQAEFVCVSCGFTCNADLNASINVAAGHAGGTTTTP
FT                   GRSRVREPQLALR"
FT   CDS_pept        778214..778594
FT                   /transl_table=11
FT                   /locus_tag="SACE_0712"
FT                   /product="putative erythromycin esterase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0712"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00053"
FT                   /db_xref="GOA:A4F7M9"
FT                   /db_xref="InterPro:IPR007815"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7M9"
FT                   /protein_id="CAM00053.1"
FT                   /translation="MVFDGELTLLPMGQYLHRALGGDYVALAATHTGTSAPEIELDDSS
FT                   DSGFAVREVDLPAPEDGSIEAAAVAARIGTGLVDLRAQAPGLDRIRSQSTWMRTPLRDA
FT                   FDAVLTVPTATAEVSTPRPARD"
FT   CDS_pept        778654..779847
FT                   /transl_table=11
FT                   /gene="eryK"
FT                   /locus_tag="SACE_0713"
FT                   /product="cytochrome P450 Erythromycin B/D C-12
FT                   hydroxylase"
FT                   /function="Erythromycin biosynthesis: Erythromycin B/D C-12
FT                   hydroxylase"
FT                   /EC_number="1.14.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0713"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00054"
FT                   /db_xref="GOA:P48635"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="PDB:2JJN"
FT                   /db_xref="PDB:2JJO"
FT                   /db_xref="PDB:2JJP"
FT                   /db_xref="PDB:2WIO"
FT                   /db_xref="PDB:2XFH"
FT                   /db_xref="PDB:3ZKP"
FT                   /db_xref="UniProtKB/Swiss-Prot:P48635"
FT                   /protein_id="CAM00054.1"
FT                   /translation="MTTIDEVPGMADETALLDWLGTMREKQPVWQDRYGVWHVFRHADV
FT                   QTVLRDTATFSSDPTRVIEGASPTPGMIHEIDPPEHRALRKVVSSAFTPRTISDLEPRI
FT                   RDVTRSLLADAGESFDLVDVLAFPLPVTIVAELLGLPPMDHEQFGDWSGALVDIQMDDP
FT                   TDPALAERIADVLNPLTAYLKARCAERRADPGDDLISRLVLAEVDGRALDDEEAANFST
FT                   ALLLAGHITTTVLLGNIVRTLDEHPAHWDAAAEDPGRIPAIVEEVLRYRPPFPQMQRTT
FT                   TKATEVAGVPIPADVMVNTWVLSANRDSDAHDDPDRFDPSRKSGGAAQLSFGHGVHFCL
FT                   GAPLARLENRVALEEIIARFGRLTVDRDDERLRHFEQIVLGTRHLPVLAGSSPRQSA"
FT   CDS_pept        complement(779802..780404)
FT                   /transl_table=11
FT                   /gene="eryBVII"
FT                   /locus_tag="SACE_0714"
FT                   /product="dTDP-4-deoxyglucose 3,5-epimerase"
FT                   /function="Erythromycin biosynthesis: dTDP-4-deoxyglucose
FT                   3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0714"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00055"
FT                   /db_xref="GOA:A4F7N1"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7N1"
FT                   /protein_id="CAM00055.1"
FT                   /translation="MRVRELAVAGGFEFTPDPKQDRRGLFVSPLQDEAFVGAVGHRFPV
FT                   AQMNHIVSARGVLRGLHFTTTPPGQCKYVYCARGRALDVIVDIRVGSPTFGKWDAVEMD
FT                   TEHFRAVYFPRGTAHAFLALEDDTLMSYLVSTPYVAEYEQAIDPFDPALGLPWPADLEV
FT                   VLSDRDTVAVDLETARRRGMLPDYADCLGEEPASTGR"
FT   CDS_pept        complement(780412..781881)
FT                   /transl_table=11
FT                   /gene="eryCV"
FT                   /locus_tag="SACE_0715"
FT                   /product="EryCV NDP-4,6-dideoxyhexose 3,4-enoyl reductase"
FT                   /function="Erythromycin biosynthesis: NDP-4,6-dideoxyhexose
FT                   3,4-enoyl reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0715"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00056"
FT                   /db_xref="GOA:A4F7N2"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016863"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7N2"
FT                   /protein_id="CAM00056.1"
FT                   /translation="MNTTRTATAQEAGVADAARPDVDRRAVVRALSSEVSRVTGAGDGD
FT                   ADVQAARLADLAAHYGAHPFTPLEQTRARLGLDRAEFAHLLDLFGRIPDLGTAVEHGPA
FT                   GKYWSNTIKPLDAAGALDAAVYRKPAFPYSVGLYPGPTCMFRCHFCVRVTGARYEAASV
FT                   PAGNETLAAIIDEVPTDNPKAMYMSGGLEPLTNPGLGELVSHAAGRGFDLTVYTNAFAL
FT                   TEQTLNRQPGLWELGAIRTSLYGLNNDEYETTTGKRGAFERVKKNLQGFLRMRAERDAP
FT                   IRLGFNHIILPGRADRLTDLVDFIAELNESSPQRPLDFVTVREDYSGRDDGRLSDSERN
FT                   ELREGLVRFVDYAAERTPGMHIDLGYALESLRRGVDAELLRIRPETMRPTAHPQVAVQI
FT                   DLLGDVYLYREAGFPELEGATRYIAGRVTPSTSLREVVENFVLENEGVQPRPGDEYFLD
FT                   GFDQSVTARLNQLERDIADGWEDHRGFLRGR"
FT   CDS_pept        complement(781919..783124)
FT                   /transl_table=11
FT                   /gene="eryCIV"
FT                   /locus_tag="SACE_0716"
FT                   /product="eryCIV NDP-6-deoxyhexose 3,4-dehydratase"
FT                   /function="Erythromycin biosynthesis: NDP-6-deoxyhexose
FT                   3,4-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0716"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00057"
FT                   /db_xref="GOA:A4F7N3"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR030967"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7N3"
FT                   /protein_id="CAM00057.1"
FT                   /translation="MKRALTDLAIFGGPEAFLHTLYVGRPTVGDRERFFARLEWALNNN
FT                   WLTNGGPLVREFEGRVADLAGVRHCVATCNATVALQLVLRASDVSGEVVMPSMTFAATA
FT                   HAASWLGLEPVFCDVDPETGLLDPEHVASLVTPRTGAIIGVHLWGRPAPVEALEKIAAE
FT                   HQVKLFFDAAHALGCTAGGRPVGAFGNAEVFSFHATKAVTSFEGGAIVTDDGLLADRIR
FT                   AMHNFGIAPDKLVTDVGTNGKMSECAAAMGLTSLDAFAETRVHNRLNHALYSDELRDVR
FT                   GISVHAFDPGEQNNYQYVIISVDSAATGIDRDQLQAILRAEKVVAQPYFSPGCHQMQPY
FT                   RTEPPLRLENTEQLSDRVLALPTGPAVSSEDIRRVCDIIRLAATSGELINAQWDQRTRN
FT                   GS"
FT   CDS_pept        complement(783121..784584)
FT                   /transl_table=11
FT                   /gene="eryBVI"
FT                   /locus_tag="SACE_0717"
FT                   /product="NDP-4-keto-6-deoxy-glucose 2,3-dehydratase"
FT                   /function="Erythromycin biosynthesis:
FT                   NDP-4-keto-6-deoxy-glucose 2,3-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0717"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00058"
FT                   /db_xref="InterPro:IPR005212"
FT                   /db_xref="InterPro:IPR038153"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7N4"
FT                   /protein_id="CAM00058.1"
FT                   /translation="MGDRTGDRTIPESSQTATRFLLGDGGIPTATAETHDWLTRNGAEQ
FT                   RLEVARVPFSAMDRWSFQPEDGRLAHESGRFFSIEGLHVRTNFGWRRDWIQPIIVQPEI
FT                   GFLGLIVKEFDGVLHVLAQAKAEPGNINAVQLSPTLQATRSNYTGVHRGSKVRFIEYFN
FT                   GTRPSRILVDVLQSEQGAWFLRKRNRNMVVEVFDDLPEHPNFRWLTVAQLRAMLHHDNV
FT                   VNMDLRTVLACVPTAVERDRADDVLARLPEGSFQARLLHSFIGAGTPANNMNSLLSWIS
FT                   DVRARREFVQRGRPLPDIERSGWIRRDDGIEHEEKKYFDVFGVTVATSDREVNSWMQPL
FT                   LSPANNGLLALLVKDIGGTLHALVQLRTEAGGMDVAELAPTVHCQPDNYADAPEEFRPA
FT                   YVDYVLNVPRSQVRYDAWHSEEGGRFYRNENRYMLIEVPADFDASAAPDHRWMTFDQIT
FT                   YLLGHSHYVNIQLRSIIACASAVYTRTAG"
FT   CDS_pept        complement(784738..785451)
FT                   /transl_table=11
FT                   /gene="eryCVI"
FT                   /locus_tag="SACE_0718"
FT                   /product="TDP-desosamine-N-dimethyltransferase"
FT                   /function="Erythromycin biosynthesis:
FT                   TDP-desosamine-N-dimethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0718"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00059"
FT                   /db_xref="GOA:A4F7N5"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7N5"
FT                   /protein_id="CAM00059.1"
FT                   /translation="MYEGGFAELYDRFYRGRGKDYAAEAAQVARLVRDRLPSASSLLDV
FT                   ACGTGTHLRRFADLFDDVTGLELSAAMIEVARPQLGGIPVLQGDMRDFALDREFDAVTC
FT                   MFSSIGHMRDGAELDQALASFARHLAPGGVVVVEPWWFPEDFLDGYVAGDVVRDGDLTI
FT                   SRVSHSVRAGGATRMEIHWVVADAVNGPRHHVEHYEITLFERQQYEKAFTAAGCAVQYL
FT                   EGGPSGRGLFVGVRG"
FT   CDS_pept        complement(785504..786751)
FT                   /transl_table=11
FT                   /gene="eryBV"
FT                   /locus_tag="SACE_0719"
FT                   /product="6-DEB TDP-mycarosyl glycosyltransferase"
FT                   /function="Erythromycin biosynthesis: 6-DEB TDP-mycarosyl
FT                   glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0719"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00060"
FT                   /db_xref="GOA:A4F7N6"
FT                   /db_xref="InterPro:IPR010610"
FT                   /db_xref="InterPro:IPR030953"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7N6"
FT                   /protein_id="CAM00060.1"
FT                   /translation="MRVLLTSFAHRTHFQGLVPLAWALRTAGHDVRVAAQPALTDAVIG
FT                   AGLTAVPVGSDHRLFDIVPEVAAQVHRYSFYLDFYHREQELHSWEFLLGMQEATSRWVY
FT                   PVVNNDSFVAELVDFARDWRPDLVLWEPFTFAGAVAARACGAAHARLLWGSDLTGYFRG
FT                   RFQAQRLRRPPEDRPDPLGTWLTEVAGRFGVEFGEDLAVGQWSVDQLPPSFRLDTGMET
FT                   VVARTLPYNGASVVPDWLKKGSATRRICITGGFSGLGLAADADQFARTLAQLARFDGEI
FT                   VVTGSGPDTSAVPDNIRLVDFVPMGVLLQNCAAIIHHGGAGTWATALHHGIPQISVAHE
FT                   WDCMLRGQQTAELGAGIYLRPDEVDADSLASALTQVVEDPTYTENAVKLREEALSDPTP
FT                   QEIVPRLEELTRRHAG"
FT   CDS_pept        complement(786751..787719)
FT                   /transl_table=11
FT                   /gene="eryBIV"
FT                   /locus_tag="SACE_0720"
FT                   /product="dTDP-4-keto-6-deoxy-L-hexose 4-reductase"
FT                   /function="Erythromycin biosynthesis:
FT                   dTDP-4-keto-6-deoxy-L-hexose 4-reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0720"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00061"
FT                   /db_xref="GOA:A4F7N7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7N7"
FT                   /protein_id="CAM00061.1"
FT                   /translation="MNGISDSPRQLITLLGASGFVGSAVLRELRDHPVRLRAVSRGGAP
FT                   AVPPGAAEVEDLRADLLEPGRAAAAIEDADVIVHLVAHAAGGSTWRSATSDPEAERVNV
FT                   GLMHDLVGALHDRRRSTPPVLLYASTAQAANPSAASRYAQQKTEAERILRKATDEGRVR
FT                   GVILRLPAVYGQSGPSGPMGRGVVAAMIRRALAGEPLTMWHDGGVRRDLLHVEDVATAF
FT                   AAALEHHDALAGGTWALGADRSEPLGDIFRAVSGSVARQTGSPAVDVVTVPAPEHAEAN
FT                   DFRSDDIDSTEFRSRTGWRPRVSLTDGIDRTVAALTPTEEH"
FT   CDS_pept        787944..798581
FT                   /transl_table=11
FT                   /gene="eryAI"
FT                   /locus_tag="SACE_0721"
FT                   /product="EryAI Erythromycin polyketide synthase modules 1
FT                   and 2"
FT                   /function="Erythromycin polyketide synthase modules 1 and
FT                   2"
FT                   /note="DEBS1"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0721"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00062"
FT                   /db_xref="GOA:A4F7N8"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7N8"
FT                   /protein_id="CAM00062.1"
FT                   /translation="MADLSKLSDSRTAQPGRIVRPWPLSGCNESALRARARQLRAHLDR
FT                   FPDAGVEGVGAALAHDEQADAGPHRAVVVASSTSELLDGLAAVADGRPHASVVRGVARP
FT                   SAPVVFVFPGQGAQWAGMAGELLGESRVFAAAMDACARAFEPVTDWTLAQVLDSPEQSR
FT                   RVEVVQPALFAVQTSLAALWRSFGVTPDAVVGHSIGELAAAHVCGAAGAADAARAAALW
FT                   SREMIPLVGNGDMAAVALSADEIEPRIARWDDDVVLAGVNGPRSVLLTGSPEPVARRVQ
FT                   ELSAEGVRAQVINVSMAAHSAQVDDIAEGMRSALAWFAPGGSEVPFYASLTGGAVDTRE
FT                   LVADYWRRSFRLPVRFDEAIRSALEVGPGTFVEASPHPVLAAALQQTLDAEGSSAAVVP
FT                   TLQRGQGGMRRFLLAAAQAFTGGVAVDWTAAYDDVGAEPGSLPEFAPAEEEDEPAESGV
FT                   DWNAPPHVLRERLLAVVNGETAALAGREADAEATFRELGLDSVLAAQLRAKVSAAIGRE
FT                   VNIALLYDHPTPRALAEALAAGTEVAQRETRARTNEAAPGEPVAVVAMACRLPGGVSTP
FT                   EEFWELLSEGRDAVAGLPTDRGWDLDSLFHPDPTRSGTAHQRGGGFLTEATAFDPAFFG
FT                   MSPREALAVDPQQRLMLELSWEVLERAGIPPTSLQASPTGVFVGLIPQEYGPRLAEGGE
FT                   GVEGYLMTGTTTSVASGRIAYTLGLEGPAISVDTACSSSLVAVHLACQSLRRGESSLAM
FT                   AGGVTVMPTPGMLVDFSRMNSLAPDGRCKAFSAGANGFGMAEGAGMLLLERLSDARRNG
FT                   HPVLAVLRGTAVNSDGASNGLSAPNGRAQVRVIQQALAESGLGPADIDAVEAHGTGTRL
FT                   GDPIEARALFEAYGRDREQPLHLGSVKSNLGHTQAAAGVAGVIKMVLAMRAGTLPRTLH
FT                   ASERSKEIDWSSGAISLLDEPEPWPAGARPRRAGVSSFGISGTNAHAIIEEAPQVVEGE
FT                   RVEAGDVVAPWVLSASSAEGLRAQAARLAAHLREHPGQDPRDIAYSLATGRAALPHRAA
FT                   FAPVDESAALRVLDGLATGNADGAAVGTSRAQQRAVFVFPGQGWQWAGMAVDLLDTSPV
FT                   FAAALRECADALEPHLDFEVIPFLRAEAARREQDAALSTERVDVVQPVMFAVMVSLASM
FT                   WRAHGVEPAAVIGHSQGEIAAACVAGALSLDDAARVVALRSRVIATMPGNKGMASIAAP
FT                   AGEVRARIGDRVEIAAVNGPRSVVVAGDSDELDRLVASCTTECIRAKRLAVDYASHSSH
FT                   VETIRDALHAELGEDFHPLPGFVPFFSTVTGRWTQPDELDAGYWYRNLRRTVRFADAVR
FT                   ALAEQGYRTFLEVSAHPILTAAIEEIGDGSGADLSAIHSLRRGDGSLADFGEALSRAFA
FT                   AGVAVDWESVHLGTGARRVPLP