(data stored in SCRATCH3701 zone)

EMBL: AM711867

ID   AM711867; SV 1; circular; genomic DNA; STD; PRO; 3297891 BP.
XX
AC   AM711867;
XX
PR   Project:PRJNA19643;
XX
DT   18-MAY-2007 (Rel. 91, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 5)
XX
DE   Clavibacter michiganensis subsp. michiganensis NCPPB 382 complete genome
XX
KW   complete genome.
XX
OS   Clavibacter michiganensis subsp. michiganensis NCPPB 382
OC   Bacteria; Actinobacteria; Micrococcales; Microbacteriaceae; Clavibacter.
XX
RN   [1]
RP   1-3297891
RA   Linke B.;
RT   ;
RL   Submitted (10-MAY-2007) to the INSDC.
RL   Linke B., Center For Biotechnology, Bielefeld University,
RL   Universitaetsstrasse 25, 33501 Bielefeld, GERMANY.
XX
RN   [2]
RX   DOI; 10.1128/JB.01595-07.
RX   PUBMED; 18192381.
RA   Gartemann K.H., Abt B., Bekel T., Burger A., Engemann J., Flugel M.,
RA   Gaigalat L., Goesmann A., Grafen I., Kalinowski J., Kaup O., Kirchner O.,
RA   Krause L., Linke B., McHardy A., Meyer F., Pohle S., Ruckert C.,
RA   Schneiker S., Zellermann E.M., Puhler A., Eichenlaub R., Kaiser O.,
RA   Bartels D.;
RT   "The genome sequence of the tomato-pathogenic actinomycete Clavibacter
RT   michiganensis subsp. michiganensis NCPPB382 reveals a large island involved
RT   in pathogenicity";
RL   J. Bacteriol. 190(6):2138-2149(2008).
XX
DR   MD5; 99529bee6d9e5c09e291e773da4a9ba4.
DR   BioSample; SAMEA3138263.
DR   EnsemblGenomes-Gn; CMM_PS_01.
DR   EnsemblGenomes-Gn; CMM_PS_02.
DR   EnsemblGenomes-Gn; CMM_PS_03.
DR   EnsemblGenomes-Gn; CMM_PS_04.
DR   EnsemblGenomes-Gn; CMM_PS_05.
DR   EnsemblGenomes-Gn; CMM_PS_06.
DR   EnsemblGenomes-Gn; CMM_PS_07.
DR   EnsemblGenomes-Gn; CMM_PS_09.
DR   EnsemblGenomes-Gn; CMM_PS_10.
DR   EnsemblGenomes-Gn; CMM_PS_11.
DR   EnsemblGenomes-Gn; CMM_PS_12.
DR   EnsemblGenomes-Gn; CMM_PS_13.
DR   EnsemblGenomes-Gn; CMM_PS_14.
DR   EnsemblGenomes-Gn; CMM_PS_15.
DR   EnsemblGenomes-Gn; CMM_PS_16.
DR   EnsemblGenomes-Gn; CMM_PS_17.
DR   EnsemblGenomes-Gn; CMM_PS_18.
DR   EnsemblGenomes-Gn; CMM_PS_19.
DR   EnsemblGenomes-Gn; CMM_PS_20.
DR   EnsemblGenomes-Gn; CMM_PS_21.
DR   EnsemblGenomes-Gn; CMM_PS_22.
DR   EnsemblGenomes-Gn; CMM_PS_23.
DR   EnsemblGenomes-Gn; CMM_PS_24.
DR   EnsemblGenomes-Gn; CMM_PS_25.
DR   EnsemblGenomes-Gn; CMM_RNA_0001.
DR   EnsemblGenomes-Gn; CMM_RNA_0002.
DR   EnsemblGenomes-Gn; CMM_tRNA_0001.
DR   EnsemblGenomes-Gn; CMM_tRNA_0002.
DR   EnsemblGenomes-Gn; CMM_tRNA_0003.
DR   EnsemblGenomes-Gn; CMM_tRNA_0004.
DR   EnsemblGenomes-Gn; CMM_tRNA_0005.
DR   EnsemblGenomes-Gn; CMM_tRNA_0006.
DR   EnsemblGenomes-Gn; CMM_tRNA_0007.
DR   EnsemblGenomes-Gn; CMM_tRNA_0008.
DR   EnsemblGenomes-Gn; CMM_tRNA_0009.
DR   EnsemblGenomes-Gn; CMM_tRNA_0010.
DR   EnsemblGenomes-Gn; CMM_tRNA_0011.
DR   EnsemblGenomes-Gn; CMM_tRNA_0012.
DR   EnsemblGenomes-Gn; CMM_tRNA_0013.
DR   EnsemblGenomes-Gn; CMM_tRNA_0014.
DR   EnsemblGenomes-Gn; CMM_tRNA_0015.
DR   EnsemblGenomes-Gn; CMM_tRNA_0016.
DR   EnsemblGenomes-Gn; CMM_tRNA_0017.
DR   EnsemblGenomes-Gn; CMM_tRNA_0018.
DR   EnsemblGenomes-Gn; CMM_tRNA_0019.
DR   EnsemblGenomes-Gn; CMM_tRNA_0020.
DR   EnsemblGenomes-Gn; CMM_tRNA_0021.
DR   EnsemblGenomes-Gn; CMM_tRNA_0022.
DR   EnsemblGenomes-Gn; CMM_tRNA_0023.
DR   EnsemblGenomes-Gn; CMM_tRNA_0024.
DR   EnsemblGenomes-Gn; CMM_tRNA_0025.
DR   EnsemblGenomes-Gn; CMM_tRNA_0026.
DR   EnsemblGenomes-Gn; CMM_tRNA_0027.
DR   EnsemblGenomes-Gn; CMM_tRNA_0028.
DR   EnsemblGenomes-Gn; CMM_tRNA_0029.
DR   EnsemblGenomes-Gn; CMM_tRNA_0030.
DR   EnsemblGenomes-Gn; CMM_tRNA_0031.
DR   EnsemblGenomes-Gn; CMM_tRNA_0032.
DR   EnsemblGenomes-Gn; CMM_tRNA_0033.
DR   EnsemblGenomes-Gn; CMM_tRNA_0034.
DR   EnsemblGenomes-Gn; CMM_tRNA_0035.
DR   EnsemblGenomes-Gn; CMM_tRNA_0036.
DR   EnsemblGenomes-Gn; CMM_tRNA_0037.
DR   EnsemblGenomes-Gn; CMM_tRNA_0038.
DR   EnsemblGenomes-Gn; CMM_tRNA_0039.
DR   EnsemblGenomes-Gn; CMM_tRNA_0040.
DR   EnsemblGenomes-Gn; CMM_tRNA_0041.
DR   EnsemblGenomes-Gn; CMM_tRNA_0042.
DR   EnsemblGenomes-Gn; CMM_tRNA_0043.
DR   EnsemblGenomes-Gn; CMM_tRNA_0044.
DR   EnsemblGenomes-Gn; CMM_tRNA_0045.
DR   EnsemblGenomes-Gn; EBG00001048856.
DR   EnsemblGenomes-Gn; EBG00001048857.
DR   EnsemblGenomes-Gn; EBG00001048858.
DR   EnsemblGenomes-Gn; EBG00001048859.
DR   EnsemblGenomes-Gn; EBG00001048860.
DR   EnsemblGenomes-Gn; EBG00001048861.
DR   EnsemblGenomes-Gn; EBG00001048862.
DR   EnsemblGenomes-Gn; EBG00001048863.
DR   EnsemblGenomes-Gn; EBG00001048864.
DR   EnsemblGenomes-Gn; EBG00001048865.
DR   EnsemblGenomes-Gn; EBG00001048866.
DR   EnsemblGenomes-Gn; EBG00001048867.
DR   EnsemblGenomes-Gn; EBG00001048868.
DR   EnsemblGenomes-Gn; EBG00001048869.
DR   EnsemblGenomes-Gn; EBG00001048870.
DR   EnsemblGenomes-Gn; EBG00001048871.
DR   EnsemblGenomes-Gn; EBG00001048872.
DR   EnsemblGenomes-Gn; EBG00001048873.
DR   EnsemblGenomes-Gn; EBG00001048874.
DR   EnsemblGenomes-Gn; EBG00001048875.
DR   EnsemblGenomes-Gn; EBG00001048876.
DR   EnsemblGenomes-Gn; EBG00001048877.
DR   EnsemblGenomes-Gn; EBG00001048878.
DR   EnsemblGenomes-Gn; EBG00001048879.
DR   EnsemblGenomes-Gn; EBG00001048880.
DR   EnsemblGenomes-Gn; EBG00001048881.
DR   EnsemblGenomes-Gn; EBG00001048882.
DR   EnsemblGenomes-Gn; EBG00001048883.
DR   EnsemblGenomes-Gn; EBG00001048884.
DR   EnsemblGenomes-Gn; EBG00001048885.
DR   EnsemblGenomes-Gn; EBG00001048886.
DR   EnsemblGenomes-Gn; EBG00001048887.
DR   EnsemblGenomes-Gn; EBG00001048888.
DR   EnsemblGenomes-Gn; EBG00001048889.
DR   EnsemblGenomes-Gn; EBG00001048890.
DR   EnsemblGenomes-Gn; EBG00001048891.
DR   EnsemblGenomes-Gn; EBG00001048892.
DR   EnsemblGenomes-Gn; EBG00001048893.
DR   EnsemblGenomes-Gn; EBG00001048894.
DR   EnsemblGenomes-Gn; EBG00001048895.
DR   EnsemblGenomes-Gn; EBG00001048896.
DR   EnsemblGenomes-Gn; EBG00001048897.
DR   EnsemblGenomes-Gn; EBG00001048898.
DR   EnsemblGenomes-Gn; EBG00001048899.
DR   EnsemblGenomes-Gn; EBG00001048900.
DR   EnsemblGenomes-Gn; EBG00001048901.
DR   EnsemblGenomes-Gn; EBG00001048902.
DR   EnsemblGenomes-Gn; EBG00001048903.
DR   EnsemblGenomes-Gn; EBG00001048904.
DR   EnsemblGenomes-Gn; EBG00001048905.
DR   EnsemblGenomes-Gn; EBG00001048906.
DR   EnsemblGenomes-Gn; EBG00001048907.
DR   EnsemblGenomes-Gn; EBG00001048908.
DR   EnsemblGenomes-Gn; EBG00001048909.
DR   EnsemblGenomes-Gn; EBG00001048910.
DR   EnsemblGenomes-Gn; EBG00001048911.
DR   EnsemblGenomes-Gn; EBG00001048914.
DR   EnsemblGenomes-Gn; EBG00001048916.
DR   EnsemblGenomes-Gn; EBG00001048917.
DR   EnsemblGenomes-Tr; CMM_PS_01.
DR   EnsemblGenomes-Tr; CMM_PS_02.
DR   EnsemblGenomes-Tr; CMM_PS_03.
DR   EnsemblGenomes-Tr; CMM_PS_04.
DR   EnsemblGenomes-Tr; CMM_PS_05.
DR   EnsemblGenomes-Tr; CMM_PS_06.
DR   EnsemblGenomes-Tr; CMM_PS_07.
DR   EnsemblGenomes-Tr; CMM_PS_09.
DR   EnsemblGenomes-Tr; CMM_PS_10.
DR   EnsemblGenomes-Tr; CMM_PS_11.
DR   EnsemblGenomes-Tr; CMM_PS_12.
DR   EnsemblGenomes-Tr; CMM_PS_13.
DR   EnsemblGenomes-Tr; CMM_PS_14.
DR   EnsemblGenomes-Tr; CMM_PS_15.
DR   EnsemblGenomes-Tr; CMM_PS_16.
DR   EnsemblGenomes-Tr; CMM_PS_17.
DR   EnsemblGenomes-Tr; CMM_PS_18.
DR   EnsemblGenomes-Tr; CMM_PS_19.
DR   EnsemblGenomes-Tr; CMM_PS_20.
DR   EnsemblGenomes-Tr; CMM_PS_21.
DR   EnsemblGenomes-Tr; CMM_PS_22.
DR   EnsemblGenomes-Tr; CMM_PS_23.
DR   EnsemblGenomes-Tr; CMM_PS_24.
DR   EnsemblGenomes-Tr; CMM_PS_25.
DR   EnsemblGenomes-Tr; CMM_RNA_0001-1.
DR   EnsemblGenomes-Tr; CMM_RNA_0002-1.
DR   EnsemblGenomes-Tr; CMM_tRNA_0001-1.
DR   EnsemblGenomes-Tr; CMM_tRNA_0002-1.
DR   EnsemblGenomes-Tr; CMM_tRNA_0003-1.
DR   EnsemblGenomes-Tr; CMM_tRNA_0004-1.
DR   EnsemblGenomes-Tr; CMM_tRNA_0005-1.
DR   EnsemblGenomes-Tr; CMM_tRNA_0006-1.
DR   EnsemblGenomes-Tr; CMM_tRNA_0007-1.
DR   EnsemblGenomes-Tr; CMM_tRNA_0008-1.
DR   EnsemblGenomes-Tr; CMM_tRNA_0009-1.
DR   EnsemblGenomes-Tr; CMM_tRNA_0010-1.
DR   EnsemblGenomes-Tr; CMM_tRNA_0011-1.
DR   EnsemblGenomes-Tr; CMM_tRNA_0012-1.
DR   EnsemblGenomes-Tr; CMM_tRNA_0013-1.
DR   EnsemblGenomes-Tr; CMM_tRNA_0014-1.
DR   EnsemblGenomes-Tr; CMM_tRNA_0015-1.
DR   EnsemblGenomes-Tr; CMM_tRNA_0016-1.
DR   EnsemblGenomes-Tr; CMM_tRNA_0017-1.
DR   EnsemblGenomes-Tr; CMM_tRNA_0018-1.
DR   EnsemblGenomes-Tr; CMM_tRNA_0019-1.
DR   EnsemblGenomes-Tr; CMM_tRNA_0020-1.
DR   EnsemblGenomes-Tr; CMM_tRNA_0021-1.
DR   EnsemblGenomes-Tr; CMM_tRNA_0022-1.
DR   EnsemblGenomes-Tr; CMM_tRNA_0023-1.
DR   EnsemblGenomes-Tr; CMM_tRNA_0024-1.
DR   EnsemblGenomes-Tr; CMM_tRNA_0025-1.
DR   EnsemblGenomes-Tr; CMM_tRNA_0026-1.
DR   EnsemblGenomes-Tr; CMM_tRNA_0027-1.
DR   EnsemblGenomes-Tr; CMM_tRNA_0028-1.
DR   EnsemblGenomes-Tr; CMM_tRNA_0029-1.
DR   EnsemblGenomes-Tr; CMM_tRNA_0030-1.
DR   EnsemblGenomes-Tr; CMM_tRNA_0031-1.
DR   EnsemblGenomes-Tr; CMM_tRNA_0032-1.
DR   EnsemblGenomes-Tr; CMM_tRNA_0033-1.
DR   EnsemblGenomes-Tr; CMM_tRNA_0034-1.
DR   EnsemblGenomes-Tr; CMM_tRNA_0035-1.
DR   EnsemblGenomes-Tr; CMM_tRNA_0036-1.
DR   EnsemblGenomes-Tr; CMM_tRNA_0037-1.
DR   EnsemblGenomes-Tr; CMM_tRNA_0038-1.
DR   EnsemblGenomes-Tr; CMM_tRNA_0039-1.
DR   EnsemblGenomes-Tr; CMM_tRNA_0040-1.
DR   EnsemblGenomes-Tr; CMM_tRNA_0041-1.
DR   EnsemblGenomes-Tr; CMM_tRNA_0042-1.
DR   EnsemblGenomes-Tr; CMM_tRNA_0043-1.
DR   EnsemblGenomes-Tr; CMM_tRNA_0044-1.
DR   EnsemblGenomes-Tr; CMM_tRNA_0045-1.
DR   EnsemblGenomes-Tr; EBT00001651627.
DR   EnsemblGenomes-Tr; EBT00001651628.
DR   EnsemblGenomes-Tr; EBT00001651629.
DR   EnsemblGenomes-Tr; EBT00001651630.
DR   EnsemblGenomes-Tr; EBT00001651631.
DR   EnsemblGenomes-Tr; EBT00001651632.
DR   EnsemblGenomes-Tr; EBT00001651633.
DR   EnsemblGenomes-Tr; EBT00001651634.
DR   EnsemblGenomes-Tr; EBT00001651635.
DR   EnsemblGenomes-Tr; EBT00001651636.
DR   EnsemblGenomes-Tr; EBT00001651637.
DR   EnsemblGenomes-Tr; EBT00001651638.
DR   EnsemblGenomes-Tr; EBT00001651639.
DR   EnsemblGenomes-Tr; EBT00001651640.
DR   EnsemblGenomes-Tr; EBT00001651641.
DR   EnsemblGenomes-Tr; EBT00001651642.
DR   EnsemblGenomes-Tr; EBT00001651643.
DR   EnsemblGenomes-Tr; EBT00001651644.
DR   EnsemblGenomes-Tr; EBT00001651645.
DR   EnsemblGenomes-Tr; EBT00001651646.
DR   EnsemblGenomes-Tr; EBT00001651647.
DR   EnsemblGenomes-Tr; EBT00001651648.
DR   EnsemblGenomes-Tr; EBT00001651649.
DR   EnsemblGenomes-Tr; EBT00001651650.
DR   EnsemblGenomes-Tr; EBT00001651651.
DR   EnsemblGenomes-Tr; EBT00001651652.
DR   EnsemblGenomes-Tr; EBT00001651653.
DR   EnsemblGenomes-Tr; EBT00001651654.
DR   EnsemblGenomes-Tr; EBT00001651655.
DR   EnsemblGenomes-Tr; EBT00001651656.
DR   EnsemblGenomes-Tr; EBT00001651657.
DR   EnsemblGenomes-Tr; EBT00001651658.
DR   EnsemblGenomes-Tr; EBT00001651659.
DR   EnsemblGenomes-Tr; EBT00001651660.
DR   EnsemblGenomes-Tr; EBT00001651661.
DR   EnsemblGenomes-Tr; EBT00001651662.
DR   EnsemblGenomes-Tr; EBT00001651663.
DR   EnsemblGenomes-Tr; EBT00001651664.
DR   EnsemblGenomes-Tr; EBT00001651665.
DR   EnsemblGenomes-Tr; EBT00001651666.
DR   EnsemblGenomes-Tr; EBT00001651667.
DR   EnsemblGenomes-Tr; EBT00001651668.
DR   EnsemblGenomes-Tr; EBT00001651669.
DR   EnsemblGenomes-Tr; EBT00001651670.
DR   EnsemblGenomes-Tr; EBT00001651671.
DR   EnsemblGenomes-Tr; EBT00001651672.
DR   EnsemblGenomes-Tr; EBT00001651673.
DR   EnsemblGenomes-Tr; EBT00001651674.
DR   EnsemblGenomes-Tr; EBT00001651675.
DR   EnsemblGenomes-Tr; EBT00001651676.
DR   EnsemblGenomes-Tr; EBT00001651677.
DR   EnsemblGenomes-Tr; EBT00001651678.
DR   EnsemblGenomes-Tr; EBT00001651679.
DR   EnsemblGenomes-Tr; EBT00001651680.
DR   EnsemblGenomes-Tr; EBT00001651681.
DR   EnsemblGenomes-Tr; EBT00001651682.
DR   EnsemblGenomes-Tr; EBT00001651683.
DR   EnsemblGenomes-Tr; EBT00001651684.
DR   EnsemblGenomes-Tr; EBT00001651685.
DR   EuropePMC; PMC2258877; 18192381.
DR   EuropePMC; PMC3027613; 21297863.
DR   EuropePMC; PMC3497371; 23001675.
DR   EuropePMC; PMC3691591; 23738754.
DR   EuropePMC; PMC6595409; 31294068.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01746; mraW.
DR   RFAM; RF01747; msiK.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01763; ykkC-III.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   StrainInfo; 7256; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3297891
FT                   /organism="Clavibacter michiganensis subsp. michiganensis
FT                   NCPPB 382"
FT                   /sub_species="michiganensis"
FT                   /strain="NCPPB 382"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:443906"
FT   CDS_pept        1..1434
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="CMM_0001"
FT                   /product="chromosomal replication initiator protein dnaA"
FT                   /function="ATPase involved in DNA replication initiation"
FT                   /note="Chromosomal replication initiator protein dnaA.
FT                   Plays an important role in the initiation and regulation of
FT                   chromosomal replication. Binds to the origin of
FT                   replication; it binds specifically double-stranded DNA at a
FT                   9 bp consensus (dnaA box): 5-TTATC(C/A)A(C/A)A-3. DnaA
FT                   binds to ATP and to acidic phospholipids (By similarity).
FT                   DnaA: chromosomal replication initiat"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00006"
FT                   /db_xref="GOA:A5CLT3"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5CLT3"
FT                   /protein_id="CAN00006.1"
FT                   /translation="MSDRSDPTHAIWQKVLAALTADDRITPQLHGFISLVEPKGVMTGT
FT                   LYLEVPNDLTRGMLEQRIRVPLLNAIGSLDEAAGVSNFAIVVNPEIAQDAFAQHPEPAA
FT                   EQPYIETPTITAPTDNPGLPASPSRGDSRLNPKYGFDTFVIGGSNRFAHAAAVAVAEAP
FT                   AKAYNPLFIYGDSGLGKTHLLHAIGHYAISLYPGIRVRYVSSEEFTNDFINSIANNRSS
FT                   LFQSRYRDNDILLIDDIQFLQGKDSTQEAFFHTFNTLHDHNKQVVITSDLPPKHLTGFE
FT                   DRMRSRFEWGLITDVQAPDLETRIAILRKKAQSEKLQVPDDILEYMATKVTSNIRELEG
FT                   TLIRVTAFASLNKTPVDLALVQTVLKDLITLDEDNVIAPVDIINHTAAYFKLTVDDLYG
FT                   SSRSQAVATARQIAMYLCRELTNLSLPKIGQLFGNRDHTTVMYANKKITELMKERRSIY
FT                   NQVTELTSRIKQNHRYGKM"
FT   CDS_pept        1978..3129
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="CMM_0002"
FT                   /product="DNA polymerase III, beta chain"
FT                   /function="DNA polymerase sliding clamp subunit (PCNA
FT                   homolog)"
FT                   /EC_number="2.7.7.7"
FT                   /note="DNA polymerase III, beta chain (YP_061215.1| DNA
FT                   polymerase III, beta subunit [Leifsonia xyli subsp. xyli
FT                   str. CTCB07];; P27903|DP3B_STRCO DNA polymerase III, beta
FT                   chain). InterPro: DNA polymerase III beta chain"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00007"
FT                   /db_xref="GOA:A5CLT4"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLT4"
FT                   /protein_id="CAN00007.1"
FT                   /translation="MKFQVNRDVFSEAVSFAVKLLPQRTTLPILSGVLIEATEDGLTLS
FT                   SFDYEVSARTQIQADIEEPGRVLVSGRLLADIANRLPNAPVRFTTEDSKITVSCGSAHF
FT                   TLLSMPVEEYPTLPQISEQSGLLPAEQFAAAVSQVAVAASRDDVTPVITGVQLEVGETS
FT                   LGLIATDRYRVAVREIDWDGGDSTTDGTSRTALVPARTLQEIGKTFGHSGTISVAITDT
FT                   DDRQLIAFSADRKTVTSLLIRGNFPPVKRLFPETVDNYAVINTADLIEATRRVQLVLER
FT                   EAALRFTFSIDGLTLEAIGSEHAQASESIDALLTGVDTVVSLKPQFLLDGLGAVHSEFV
FT                   RLSFTKTDNPNKPGPVLITSQSSKDQAGADNYRYLLQPNLLLR"
FT   CDS_pept        3150..4037
FT                   /transl_table=11
FT                   /gene="gndA1"
FT                   /locus_tag="CMM_0003"
FT                   /product="6-phosphogluconate dehydrogenase"
FT                   /function="Predicted 6-phosphogluconate dehydrogenase"
FT                   /EC_number="1.1.1.44"
FT                   /note="High confidence in function and specificity"
FT                   /note="6-phosphogluconate dehydrogenase (ZP_00226753.1|
FT                   COG1023: Predicted 6-phosphogluconate dehydrogenase
FT                   [Kineococcus radiotolerans SRS30216];; S70988 gnd protein
FT                   -Mycobacterium smegmatis). , pfam03446, NAD_binding_2, NAD
FT                   binding domain of 6-phosphogluconate dehydrogenase.
FT                   ,pfam00393, 6PGD, 6-phosphogluconate dehydrogenase,
FT                   C-terminal domain."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00008"
FT                   /db_xref="GOA:A5CLT5"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLT5"
FT                   /protein_id="CAN00008.1"
FT                   /translation="MHIGLVGLGKMGARMRARLEANGIEVTGYDTNPDVSDVATLDDLA
FT                   AALPTPRLVWVMVPAGKVTQNVVGDLARILEPGDLVIDGGNSKFTDDFAHAGLLAEKGI
FT                   DFVDAGVSGGVWGLENGYGLMVGGPVEQVQRAMPVFDALRPEGPREEGFVHVGDSGAGH
FT                   YAKMVHNGIEYAMMQSFAEGYELLAARKDIIKDVTGTFEAWQRGTVVRSWLLELLVKAL
FT                   KEDPGFEDIEGFVQDSGEGRWTIEEALDNAVPMPAISASIFARFSSRQEDSPAMKAVAA
FT                   LRNQFGGHSVQKKS"
FT   CDS_pept        4045..5259
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="CMM_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /function="Recombinational DNA repair ATPase (RecF
FT                   pathway)"
FT                   /note="DNA replication and repair protein recF
FT                   (P36176|RECF_STRCO DNA replication and repair protein
FT                   recF;; NP_938412.1| DNA replication and repair protein
FT                   [Corynebacterium diphtheriae NCTC 13129]). The recF protein
FT                   is involved in DNA metabolism; it is required for DNA
FT                   replication and normal SOS inducibility. RecF binds
FT                   preferentially to single-stranded linear DNA. It also seems
FT                   to bind ATP (By similarity). pfam02463, SMC_N,RecF/RecN/SMC
FT                   N terminal domain. This domain is found at the N terminus
FT                   of SMC proteins. The SMC (structural maintenance of
FT                   chromosomes) superfamily proteins have ATP-binding domains
FT                   at the N- and C-termini, and two extended coiled-coil
FT                   domains separated by a hinge in the middle."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00009"
FT                   /db_xref="GOA:A5CLT6"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5CLT6"
FT                   /protein_id="CAN00009.1"
FT                   /translation="MIVRHLSLGDFRNYTRADVALLPGATLFVGSNGQGKTNLVEALGF
FT                   LSTLGSHRVSTDQALIRQGAESAVIRALLQHAGRELRVEVQINRSAANRAQVNSTPTKP
FT                   RELPRYFSSVLFAPEDLALVRGDPSGRRRLLDQLLVLRTPRLAGVLSDYDRALKQRNTL
FT                   LKSARARGMKADQLGTLDIWDERLVAIGSQIIAARGALVEALQPELARAYLAVAGSDHG
FT                   PSARPELSILADDPGEDDIADETGARDGGRFTRSDDVVPVFTAAIARMRPRELERGLTL
FT                   VGPHRDDVLFRLNGLPAKGYASHGESWSFALALKLASAELLRRDSQTGDPVLILDDVFA
FT                   ELDQARRGRLAEAVTGFEQVLITAAVFEDVPAHLAANAVHIRAGEIVDAPAPASEPDAE
FT                   GGGAA"
FT   CDS_pept        5256..5768
FT                   /transl_table=11
FT                   /locus_tag="CMM_0005"
FT                   /product="conserved hypothetical protein"
FT                   /note="conserved hypothetical protein (AAS02321.1|
FT                   hypothetical protein MAP0004 [Mycobacterium avium subsp.
FT                   paratuberculosis str. k10];; CAF18570.1| CONSERVED
FT                   HYPOTHETICAL PROTEIN [Corynebacterium glutamicum ATCC
FT                   13032]). pfam05258, DUF721, Protein of unknown function
FT                   (DUF721). This family contains several actinomycete
FT                   proteins of unknown function."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00010"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLT7"
FT                   /protein_id="CAN00010.1"
FT                   /translation="MIPRAPDGGPMPESEAVAVYRRFRKVFGDASVRSPSARKRREQKA
FT                   GSSPFQPGRDPDSLGNVMDSLTSRMGWTSSLSQAELMAAWTTIAGEETAVHSSPVGIED
FT                   GLLMVECESTAWATQLRLMRVEITTRIAERFPDAGIRSIRFQGPNAPSWKKGPRSIPGR
FT                   GPRDTYG"
FT   CDS_pept        5958..8003
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="CMM_0006"
FT                   /product="DNA gyrase subunit B"
FT                   /function="DNA gyrase (topoisomerase II) B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="DNA gyrase subunit B (EC 5.99.1.3) (NP_787133.1| DNA
FT                   gyrase subunit B [Tropheryma whipplei str. Twist];;
FT                   NP_695821.1| DNA gyrase subunit B, novobiocin-sensitive
FT                   [Bifidobacterium longum NCC2705]). DNA gyrase negatively
FT                   supercoils closed circular double- stranded DNA in an
FT                   ATP-dependent manner and also catalyzes the interconversion
FT                   of other topological isomers of double-stranded DNA rings
FT                   including catenanes and knotted rings. smart00433,
FT                   TOP2c,TopoisomeraseII; Eukaryotic DNA topoisomerase II,
FT                   GyrB,ParE"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00011"
FT                   /db_xref="GOA:A5CLT8"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLT8"
FT                   /protein_id="CAN00011.1"
FT                   /translation="MTSDATQDLPDDSTPDEVEVEETHNDSDHITRQQVSNDYGANEIQ
FT                   VLEGLEAVRKRPGMYIGSTGPRGLHHLVSEIVDNSVDEALAGFASDIQITMRKDGGIRV
FT                   VDDGRGIPVDIHPVEGISTVELVLTKLHAGGKFGGGGYAVSGGLHGVGSSVVNALSERL
FT                   DVEVRRQGAVWRQSFTIGVPDEPLQKGEGSTETGTTITFWPSREIFETVEFDYDTLRAR
FT                   FQQMAFLNKGLALTLHDEREVDGAEHRTEKFLYERGLVDYVEHLVKAKKTEVVNADVIA
FT                   FESEDTVKKISLEVAMQWTTSYTESVHTYANTINTHEGGTHEEGFRAALTTLVNRYARE
FT                   NKLLREKDENLTGDDVREGLTAVISVKLGEPQFEGQTKTKLGNTEAKAYVQRIVGQQLG
FT                   DWLEKNPSQAKDIIRKGMQASQARLAARKAREQTRRKGLLESGGMPGKLKDCQSKDPAL
FT                   SEVFLVEGDSAGGSAVQGRNPTTQAILPLRGKILNVEKARLDRALQNNEVQSMITAFGA
FT                   GIGEDFNAEKVRYHKIVLMADADVDGQHITTLLLTLLFRYMRPLIELGYVYLAQPPLYR
FT                   LKWSNAEHQYVYTDAERDALLVHGQAKGKKMPKDNGIQRYKGLGEMDYKELWETTMDPA
FT                   TRTLMQVTLDDAAGADEVFSTLMGEDVESRRSFIQRNAKDVRFLDI"
FT   CDS_pept        8086..10773
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="CMM_0007"
FT                   /product="DNA gyrase subunit A"
FT                   /function="DNA gyrase (topoisomerase II) A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="DNA gyrase subunit A (EC 5.99.1.3)(T10970 DNA
FT                   topoisomerase (ATP-hydrolyzing) (EC 5.99.1.3) chain A
FT                   -Streptomyces coelicolor;; ZP_00226749.1| COG0188: Type IIA
FT                   topoisomerase (DNA gyrase/topo II, topoisomerase IV), A
FT                   subunit [Kineococcus radiotolerans SRS30216]). DNA gyrase
FT                   negatively supercoils closed circular double- stranded DNA
FT                   in an ATP-dependent manner and also catalyzes the
FT                   interconversion of other topological isomers of
FT                   double-stranded DNA rings including catenanes and knotted
FT                   rings. smart00434, TOP4c, DNA Topoisomerase IV; Bacterial
FT                   DNA topoisomerase IV, GyrA, ParC"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00012"
FT                   /db_xref="GOA:A5CLT9"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLT9"
FT                   /protein_id="CAN00012.1"
FT                   /translation="MADDNTPDDEQGTGATPDDEQASSTDDALPQEGVTPASSAAAASD
FT                   SLPGAIVDPDATVVVTHDRIEQVDLQLEMQRSFLDYAMSVIVQRALPEVRDGLKPVHRR
FT                   VIYAMYDGGYRPDRSFFKSARVVGEVMGQFHPHGDSSIYDALVRLVQPWSLRYPLALGQ
FT                   GNFGSAGNDGAAAPRYTETKMAPLAMEMVRDITEDTVDFQDNYDGRTLEPKILPSRFPN
FT                   LLVNGSVGIAVGMATNIPPHNLREVASGAQWLLAHPDANREELLEALLERIKGPDFPTG
FT                   AQVLGTKGILEAYRTGRGSITMRAVVAVEEIQGRVCLVVTELPYQVNPDNLAIKIAELV
FT                   KDGKLGGVADIRDETSGRTGQRLVIVLKRDAVAKVVLNNLYKHTQLQENFGANMLAIVD
FT                   GIPRTLALDGFISAWVDHQIDVIVRRTQYRLNEAEARAHILRGYLKALDALDDVIALIR
FT                   RSETVEVARSGLMKLLDIDELQANAILEMQLRRLAALERQKIQDQAAELEQRIAEYNHI
FT                   LATPTVQREIISTELQEITDKYGDDRRTEIMLGFDGDMSMEDLIPEEEMVVTVTRGGYI
FT                   KRTRIDNYRSQHRGGKGVRGAQLRADDVVEHFFVTTTHHWLLFLTDKGRVYRAKAYELQ
FT                   EAGRDAKGQHVANLLAMQPDEEIQQVLDIRDYQVAQYLVLATRDGLMKKTALTEYDTNR
FT                   TGGIIAINLRDGDALVSALLVDEDDDLLLVSRKGMSLRFSADNQALRPMGRSTSGVKGM
FT                   TFRGDDTLLSASVVGEQGYVFVVTEGGFAKRTAADQYRVQNRGGMGIKVAKLQDARGDL
FT                   AGALIVGEEDEILVVLASGKVVRSVVAEVPAKGRDTMGVVFARFADDDRIISLAKNSER
FT                   NLVVPEAAPDASDGTAAGKGTPDE"
FT   CDS_pept        10766..11173
FT                   /transl_table=11
FT                   /locus_tag="CMM_0008"
FT                   /product="putative integral membrane protein"
FT                   /note="conserved membrane protein (NP_825500.1| putative
FT                   membrane protein [Streptomyces avermitilis MA-4680];;
FT                   ZP_00198923.1| COG0477: Permeases of the major facilitator
FT                   superfamily [Kineococcus radiotolerans SRS30216])."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00013"
FT                   /db_xref="GOA:A5CLU0"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLU0"
FT                   /protein_id="CAN00013.1"
FT                   /translation="MSSVAEKLAKKSSRATTTKQVRLKLVYVDFWSALKLAFLFSVVLG
FT                   IITVVATFLIYVVLQTTNVFGTVDQLFQEVSGSADFSLQDVFGLGQVLGFAIVVAVLNI
FT                   VVGTVLGAVAALLYNLSVRITGGVLVGFTNA"
FT   tRNA            11222..11298
FT                   /locus_tag="CMM_tRNA_0001"
FT                   /anticodon="(pos:11256..11258,aa:Ile)"
FT   tRNA            11379..11451
FT                   /locus_tag="CMM_tRNA_0002"
FT                   /anticodon="(pos:11412..11414,aa:Ala)"
FT   CDS_pept        complement(11620..12258)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00014"
FT                   /db_xref="GOA:A5CLU1"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLU1"
FT                   /protein_id="CAN00014.1"
FT                   /translation="MEVPLGLSRKNKKELAKLRTHAAAVLKEQREVLDRANVVVAEAAH
FT                   TARKLSDQHVVPAVKRGVDDHIRPGYEAGAERVRTAADSAYKGFTHTVLPAVAGAAGSA
FT                   VAATEGIRNSKQVKDAVKKANKVSSKAQEFGKHYVDNGRSYVGRYVPQVAPAKKGLGFG
FT                   GVALIALGVVVVGGVGYALYQTFRADDDLWIADDEPEAVDGTAKDQPAS"
FT   CDS_pept        12368..12907
FT                   /transl_table=11
FT                   /gene="ppiA"
FT                   /locus_tag="CMM_0010"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /function="Peptidyl-prolyl cis-trans isomerase (rotamase)
FT                   -cyclophilin family"
FT                   /EC_number="5.2.1.8"
FT                   /note="peptidyl-prolyl cis-trans isomerase B (EC 5.2.1.8)
FT                   (P77949|PPIB_STRCH Peptidyl-prolyl cis-trans isomerase B
FT                   (PPIase B) (Rotamase B) (Cyclophilin ScCypB)
FT                   (S-cyclophilin);; ZP_00226474.1| COG0652: Peptidyl-prolyl
FT                   cis-trans isomerase (rotamase) -cyclophilin family
FT                   [Kineococcus radiotolerans SRS30216]). PPIases accelerate
FT                   the folding of proteins. It catalyzes the cis-trans
FT                   isomerization of proline imidic peptide bonds in
FT                   oligopeptides. pfam00160, Pro_isomerase, Cyclophilin type
FT                   peptidyl-prolyl cis-trans isomerase."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00016"
FT                   /db_xref="GOA:A5CLU2"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLU2"
FT                   /protein_id="CAN00016.1"
FT                   /translation="MSAHTHVATMTTNHGTIILNLFGSHAPQTVENFVGLATGEKEWTH
FT                   PQTGKKSTDPLYDGVVFHRIIKDFMLQGGDPLGQGTGGPGYQFDDEINRDLDFSKPYIL
FT                   AMANAGTQGGRGTNGSQFFITTAPTTWLQGKHTIFGEVADDASKKVVDALNAVPTDGRD
FT                   RPREDVVIESVTVEKV"
FT   CDS_pept        12907..13770
FT                   /transl_table=11
FT                   /locus_tag="CMM_0011"
FT                   /product="conserved membrane protein"
FT                   /note="conserved membrane protein (NP_334528.1| Rhomboid
FT                   family protein [Mycobacterium tuberculosis CDC1551];;
FT                   NP_628043.1| putative membrane protein [Streptomyces
FT                   coelicolor A3(2)]). pfam01694, Rhomboid, Rhomboid family."
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00017"
FT                   /db_xref="GOA:A5CLU3"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLU3"
FT                   /protein_id="CAN00017.1"
FT                   /translation="MTDSPRTAADRCYRHPDRQSFVLCQRCGRTICPECQTPAAVGVIC
FT                   PEDMKEQRRTAPRSRASFVTRMTRSSAPVVTYGIMAVCAVVWILQVLPVVGAYVTTSLW
FT                   FAPVYGSVASGAYEPWRMLTSAFTHSPDSILHIVFNMLSVFVFGRVLEPMLGRARFLAL
FT                   FLISALGGSLAVEVIGSAMGEPLQAVVGASGAIFGLMGGYFVLARKLGGNVGPLLGIIA
FT                   INLLLGFVVQGVSWQAHVGGLVTGALVALVLLRTRDARQRGAQIGSLAGLAVAIVVAAA
FT                   VLPVTL"
FT   CDS_pept        complement(14163..14402)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0012"
FT                   /product="conserved membrane protein"
FT                   /note="conserved membrane protein (NP_788965.1| putative
FT                   membrane protein [Tropheryma whipplei TW08/27];;
FT                   CAF18608.1| putative membrane protein [Corynebacterium
FT                   glutamicum ATCC 13032]). pfam06781, UPF0233,Uncharacterised
FT                   protein family (UPF0233)."
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00018"
FT                   /db_xref="GOA:A5CLU4"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLU4"
FT                   /protein_id="CAN00018.1"
FT                   /translation="MARDKMTRPSRQERVRDEDAPNPVWFKPIMFGFMLVGLAWLIVYY
FT                   VSLNAFPIPDLGVGNILIGFGLILVGFLMTTRWR"
FT   CDS_pept        14508..15308
FT                   /transl_table=11
FT                   /locus_tag="CMM_0013"
FT                   /product="putative sortase"
FT                   /function="Sortase (surface protein transpeptidase)"
FT                   /note="putative sortase (ZP_00226470.1| COG3764: Sortase
FT                   (surface protein transpeptidase) [Kineococcus radiotolerans
FT                   SRS30216];; NP_789137.1| putative membrane protein
FT                   [Tropheryma whipplei TW08/27]). pfam04203,Sortase, Sortase
FT                   family. The founder member of this family is S.aureus
FT                   sortase, a transpeptidase that attaches surface proteins by
FT                   the threonine of an LPXTG motif to the cell wall."
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00019"
FT                   /db_xref="GOA:A5CLU5"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042003"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLU5"
FT                   /protein_id="CAN00019.1"
FT                   /translation="MSAQEPAPSRRATRRRGRRGDALLGTVGVLGELLLTAGVLIMLFL
FT                   GWQLWFNDIVVSSGQRDQALENSRSWATAAPDAAASPDPAATPAAPGDPVITTAPTSDA
FT                   TDFGNIYIPRFGADYVVPVATGVGLGNVLNLGKIGHYRETQMPGQVGNFAVAAHRTTYG
FT                   KPFNQITDLRVGDAIVVETQDGWYTYRFRTLEYVKPTGVDVLDEVPQAPDAQPGDRILT
FT                   MTSCNPLFSAAERVVAYSVFESWQPRSDASTPAALAGTSFAKAG"
FT   CDS_pept        15466..16104
FT                   /transl_table=11
FT                   /gene="pabA"
FT                   /locus_tag="CMM_0014"
FT                   /product="para-aminobenzoate synthetase component II"
FT                   /function="Anthranilate/para-aminobenzoate synthases
FT                   component II"
FT                   /note="glutamine amidotransferase class I, putative
FT                   para-aminobenzoate/ anthranilate synthase glutamine
FT                   amidotransferase component II [Includes: Para-aminobenzoate
FT                   synthase glutamine amidotransferase component II (EC
FT                   4.1.3.-) (ADC synthase); Anthranilate synthase component II
FT                   (EC 4.1.3.27)] (ZP_00209755.1| COG0512:
FT                   Anthranilate/para-aminobenzoate synthases component II
FT                   [Magnetospirillum magnetotacticum];; NP_214527.1| pabA
FT                   [Mycobacterium tuberculosis H37Rv]). CATALYZES THE
FT                   BIOSYNTHESIS OF 4-AMINO-4-DEOXYCHORISMATE (ADC) FROM
FT                   CHORISMATE AND GLUTAMINE AND ALSO INVOLVED IN THE SYNTHESIS
FT                   OF ANTHRANILATE. pfam00117, GATase,Glutamine
FT                   amidotransferase class-I. InterPro: Anthranilate synthase
FT                   component II/delta crystallin"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00020"
FT                   /db_xref="GOA:A5CLU6"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLU6"
FT                   /protein_id="CAN00020.1"
FT                   /translation="MTRVLVIDNYDSFVYTLNGYLQQLGAETVVMRNDDHADVDMAGVI
FT                   SEYDAVLVSPGPGKPSEAGVSIPTVTAALASGTPLLGVCLGHQAIAEAFGATVTNAEEL
FT                   MHGKTSLVTHDDGEFYLGVPKPFTATRYHSLAVVDGTVPSDLVVTSRTEGGVIMGLRHE
FT                   AAPIVGVQFHPESVLTEGGYRMLGNWLEGAGLVGARDTASRLSPLVRVA"
FT   CDS_pept        complement(16218..17966)
FT                   /transl_table=11
FT                   /gene="pknB"
FT                   /locus_tag="CMM_0015"
FT                   /function="Serine/threonine protein kinase"
FT                   /EC_number="2.7.1.-"
FT                   /note="probable serine/threonine-protein kinase pknB (EC
FT                   2.7.1.37) (ZP_00227925.1| COG0515: Serine/threonine protein
FT                   kinase [Kineococcus radiotolerans SRS30216];;
FT                   ZP_00121611.1| COG0515: Serine/threonine protein kinase
FT                   [Bifidobacterium longum DJO10A]). smart00220,
FT                   S_TKc,Serine/Threonine protein kinases, catalytic domain;
FT                   Phosphotransferases. Serine or threonine-specific kinase
FT                   subfamily. pfam00069, Pkinase, Protein kinase domain."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00021"
FT                   /db_xref="GOA:A5CLU7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLU7"
FT                   /protein_id="CAN00021.1"
FT                   /translation="MTDTRVLGGRYEVGALLGRGGMADVFEGVDSRLGRRVAVKVLRRG
FT                   LAEDPAFRSRFRQEAQAAARMSHPTIVRVFDAGEDVVTDQDGASHTVPFIVMERVEGRL
FT                   LKDVITDGPLDPDEAVRIMGQVLTALEYSHRAGVVHRDIKPGNIMVTPTGQVKVMDFGI
FT                   ARAVSDTSATIAQTTAILGTARYFSPEQAKGESVDARTDLYSAGVVLFEMLTGQAPFRA
FT                   DTAVAVAYQHVSETPVAPSTVQEAVSPQLDQVVLHAMAKDRYARFQTAGDFRTDLDRAA
FT                   AGTLAPREAPTNDVGATLFGAPAGPSSSQQALRQLGVDDDRTVRTQSRPPVPWIWAGVT
FT                   VVVVILIAVVIWVTSLSNIAPPDISPTVPDVTGSTYASAAAALEEADLVPLEREEASTT
FT                   VAEGIVLRTNPDPGENVAAKTEIDVFVSSGPPEVQVPNVMNMDEGTATAALEAAGLKVG
FT                   EVVRQSSPTVPDGVVMQTEPASSQQVDQGSAVKLILSNGKVALPDVLGQPLVDAQKLLE
FT                   ASDLVVTTRRDPSCSRADGSPVSQQSVAPGDVAQRSTVALTYCTGAVRSTPAPTTGTPS
FT                   PDPARG"
FT   CDS_pept        complement(18101..20008)
FT                   /transl_table=11
FT                   /gene="pknA"
FT                   /locus_tag="CMM_0016"
FT                   /function="Serine/threonine protein kinase"
FT                   /EC_number="2.7.1.-"
FT                   /note="probable serine/threonine-protein kinase pknA (EC
FT                   2.7.1.37) (NP_787905.1| serine/threonine-protein kinase
FT                   [Tropheryma whipplei str. Twist];; T10010 probable
FT                   serine/threonine-specific protein kinase (EC 2.7.1.-)
FT                   [Mycobacterium leprae]). InterPro: Serine/Threonine protein
FT                   kinase (Eukaryotic protein kinase) smart00220,S_TKc,
FT                   Serine/Threonine protein kinases, catalytic domain;
FT                   Phosphotransferases. Serine or threonine-specific kinase
FT                   subfamily. pfam00069, Pkinase, Protein kinase domain."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00022"
FT                   /db_xref="GOA:A5CLU8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLU8"
FT                   /protein_id="CAN00022.1"
FT                   /translation="MRPTSGLTFGGRYQLGDRIAIGGMGEVWEATDLVIGRKVAIKILK
FT                   DEYLGDPGFLERFRAEARHAALVNHEGIANVFDYGEEDGSAFLVMELVPGEALSTILER
FT                   ERVLSTDKVLDIIAQTALALHAAHQAGLVHRDIKPGNLLITPDGRVKITDFGIARIADQ
FT                   VPLTATGQVMGTVQYLSPEQASGHPASPSTDVYSMGIVAYECLAGRRPFTGESQVAIAM
FT                   AQINELPPELPVTVAEPVRNLVMSCIAKKPADRPQSAAHLARAAQALRRGDVATATIAV
FT                   AAVAGAAALADPGTPTQATQLMPSGRRAADTGATTVLASSAPRAGAADPFLLDDADDEE
FT                   PEEPRARKRAIWIFVVVAILVVAAIVAGLLAYFASQETAAPTPAATETSASPSPSASPT
FT                   PSPTPSPTASTVDVNRDDYIGRDQKTVTAELTALGLKVTVVTGSAAPSGEEEGRVTAIT
FT                   PTGTVAKGATIQITAYGPPTLPTTAPGTPTVTPTDVRAGQTVDISWPAYSCPAGQTLNG
FT                   YQIQADSVSQGATGTWGGSTNPTNAQTTSGEIKVGTNPGTFTVKYLAICGTNESPYSST
FT                   VTVTVEAAPGGTGTGGTGTGGGTGGGTGGTGGGTTGMAPTPAPGRTDERSLISSSHRNP
FT                   "
FT   CDS_pept        complement(20005..21456)
FT                   /transl_table=11
FT                   /gene="pbpA"
FT                   /locus_tag="CMM_0017"
FT                   /product="penicillin-binding protein"
FT                   /function="Cell division protein FtsI/penicillin-binding
FT                   protein 2"
FT                   /note="putative penicillin-binding protein 2 (PBP-2)
FT                   (ZP_00227926.1| COG0768: Cell division protein
FT                   FtsI/penicillin-binding protein 2 [Kineococcus
FT                   radiotolerans SRS30216];; NP_787904.1| penicillin-binding
FT                   protein [Tropheryma whipplei str. Twist]).,
FT                   pfam00905,Transpeptidase, Penicillin binding protein
FT                   transpeptidase domain."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00023"
FT                   /db_xref="GOA:A5CLU9"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLU9"
FT                   /protein_id="CAN00023.1"
FT                   /translation="MNRELKRVSVFVLAMFVALFVAASVIQVISAPTLQADPRNSRTII
FT                   ASYSAERGSILVDGTPIASSVPVDDRYKFLRTYAQPDLYSAVTGYYTLGQGSTGLEDSM
FT                   NDVLSGTSGTQFFDSLTRTFTGQDPKGASVELTIDPKVQQAAYDALGSLQGSVVAIEPK
FT                   TGRILAMVSKPGYDPNTLASHDRAAVQQSYSSLLADESNPLINRAVNSLNPPGSTFKLI
FT                   TAAAAIESGQYTPDSLLPNPPTFTLPGTGTVITNAGEGACGPEAEVSIATALRLSCNIP
FT                   FAQLGIALGSERIAKMAEAFGYGKSIDVPMASAKSVFSPDLDDAQTAQSAFGQLDVRAT
FT                   PLQTAMVTAGIANGGEVMKPSVVDSVLNPDLSELSGFSPSRFADPISKETADTMTRMMI
FT                   DDVQSGVASNARISGVDVAGKTGTAQNGSDDPYTLWFTGFAPAADPQVAVAVLVEDGGG
FT                   RGRSGSGNTLAAPVAKKVIEAVLDR"
FT   CDS_pept        complement(21453..22850)
FT                   /transl_table=11
FT                   /gene="ftsW1"
FT                   /locus_tag="CMM_0018"
FT                   /product="putative cell division membrane protein"
FT                   /function="Bacterial cell division membrane protein"
FT                   /note="putative cell division membrane protein
FT                   (ZP_00227927.1| COG0772: Bacterial cell division membrane
FT                   protein [Kineococcus radiotolerans SRS30216];; NP_695774.1|
FT                   protein involved in cell wall formation and stabilization
FT                   of the FtsZ ring during cell division [Bifidobacterium
FT                   longum NCC2705]). This is a septum-peptidoglycan
FT                   biosynthetic protein involved in cell wall formation. Plays
FT                   a role in the stabilization of the ftsZ ring during cell
FT                   division (By similarity). pfam01098,FTSW_RODA_SPOVE, Cell
FT                   cycle protein. This entry includes the following members;
FT                   FtsW, RodA, SpoVE"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00024"
FT                   /db_xref="GOA:A5CLV0"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLV0"
FT                   /protein_id="CAN00024.1"
FT                   /translation="MASAGMADAPARPRERAPKVPRIHVPRRLRNLELALVVLASVING
FT                   GALYLVQLGVLGAFDQSFFIPATGLAVLVLGMHVALRWLAPDADPFILPIATVLNGLGI
FT                   AAIYRLDLAAGLSGWDSVAVRQIVWSGLAIVCGLAVIVLLKNHRVLQRYRYIAMFVGLI
FT                   LLLLPMLPVLGQNINGARVWIHIGGFSFQPGEIAKICLAIFFAGYLVTARDSLSMVGVK
FT                   VLGMRFPRIRDLGPILLVWAVSMSVLVFQRDLGTSLLYFGLFIVMTYVSTGRIGWVVLG
FT                   LVLFLGGAYGASTLGYVGGRVDAWLNPFDPAVYDANGGSYQLVTGLFGMADGGLFGRGL
FT                   GEGMPNLTPLANSDFILASLGEELGLTGVFAILALYLLLVSRGFRIGFAGQDDFGKLLG
FT                   IGLSFVIALQVFIVIGGVTRVIPLTGLTTPFMAAGGSSLLANWIIAALLLRLSDTVRNQ
FT                   PRLVVES"
FT   CDS_pept        complement(22843..24105)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0019"
FT                   /product="putative serine/threonine protein phosphatase"
FT                   /function="Serine/threonine protein phosphatase"
FT                   /note="putative serine/threonine protein phosphatase
FT                   (ZP_00227928.1| COG0631: Serine/threonine protein
FT                   phosphatase [Kineococcus radiotolerans SRS30216];;
FT                   ZP_00058950.1| COG0631: Serine/threonine protein
FT                   phosphatase [Thermobifida fusca]). pfam00481, PP2C,Protein
FT                   phosphatase 2C. Protein phosphatase 2C is a Mn++ or Mg++
FT                   dependent protein serine/threonine phosphatase."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00025"
FT                   /db_xref="GOA:A5CLV1"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLV1"
FT                   /protein_id="CAN00025.1"
FT                   /translation="MATVTQAAAVSHVGKVRSNNQDSGYAGRDLFVVADGMGGHAGGDV
FT                   ASAVALTRIIEADKPYASAHDAEFALQAGLVAANQLLAETVFEHSELTGMGTTVSALAR
FT                   VGRHVAIAHIGDSRIYLFRRGELSQISADHTFVQRLVDSGRITPEEALVHPRRSVLMRV
FT                   LGDVDAAPEVDTQVLDTHTGDRWLLCSDGLSSYVSEERITEILATAGTPDTVADALVKE
FT                   SLDHGAPDNVTVVVVDVLDEDDETAASRPAPEPVVVGSASQPLAFGDEPAKRAVRIPSL
FT                   LLHPLRATTAARDAQFEPESDQYLEALIAEDKRRALRRRVTWLVGVTLIVAGLVLACVL
FT                   GYRWTQSRYYVGESDGVVAVYNGVQQTIGPIELSHVYARTEVQVDDLQPFYRQQVEQTI
FT                   NADSLAGAEEIVNRLQEAAGG"
FT   CDS_pept        complement(24110..24694)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0020"
FT                   /product="conserved hypothetical protein"
FT                   /note="conserved hypothetical protein (NP_628032.1|
FT                   putative secreted protein [Streptomyces coelicolor A3(2)];;
FT                   CAB02439.1| CONSERVED HYPOTHETICAL PROTEIN [Mycobacterium
FT                   tuberculosis H37Rv]). pfam00498, FHA, FHA domain. The FHA
FT                   (Forkhead-associated) domain is a phosphopeptide binding
FT                   motif."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00026"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLV2"
FT                   /protein_id="CAN00026.1"
FT                   /translation="MTELTLLVLRLAFLAVLWLFIFGIVYALRSDLFGQRVRKLREETG
FT                   AAGGSPFPQSPYASAAAAPPRSPQPGVQPPPISSMPSGANSGAVPSRAKATTSTARHLV
FT                   ITSGAKAGTEIPLGTEPLTIGRSSESGLVIRDDYTSTHHARLLLWNDEWMIQDLDSTNG
FT                   TFLDGKRVSVPTQVPLDTPIRIGATSFELRR"
FT   CDS_pept        complement(24691..25422)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0021"
FT                   /product="conserved hypothetical protein"
FT                   /note="conserved hypothetical protein containing C-terminal
FT                   FOG:FHA domain (COG1716) (ZP_00227930.1| COG1716: FOG: FHA
FT                   domain [Kineococcus radiotolerans SRS30216];; NP_695771.1|
FT                   hypothetical protein with FHA domain [Bifidobacterium
FT                   longum NCC2705]). pfam00498, FHA, FHA domain. The FHA
FT                   (Forkhead-associated) domain is a phosphopeptide binding
FT                   motif."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00027"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLV3"
FT                   /protein_id="CAN00027.1"
FT                   /translation="MGILDNFEKGLERAVNGAFVKTFKSGLQPVEIAAQLRRELDTHAA
FT                   VVDRDLILVPNSFTLRVSRADAERMASIGTALTDQLRQAVEKHASSQGYQFAGVVQVGF
FT                   REDDAVSEGVLEIDSRTAEGSVTWMPVVDVAGTRHPLPVGRTVIGRGSDADITVDDPGT
FT                   SRRHVEIAWDGSRAQVRDLGSTNGSELNGAPVTKAPLPPESVIRIGRTAITFRVVPQAT
FT                   EERGGRGTRGQRHDDGFWGAS"
FT   tRNA            25622..25708
FT                   /locus_tag="CMM_tRNA_0003"
FT                   /anticodon="(pos:25656..25658,aa:Leu)"
FT   CDS_pept        25879..28146
FT                   /transl_table=11
FT                   /locus_tag="CMM_0022"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /note="putative membrane protein (ZP_00121629.1| COG2898:
FT                   Uncharacterized conserved protein [Bifidobacterium longum
FT                   DJO10A]). pfam04329, DUF470, Family of unknown function
FT                   (DUF470). This sequence is usually found in association
FT                   with DUF471 and DUF472, and occasionally also with UPF0104
FT                   (pfam03706) in integral membrane proteins.
FT                   pfam04331,DUF472, Family of unknown function (DUF472)."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00028"
FT                   /db_xref="GOA:A5CLV4"
FT                   /db_xref="InterPro:IPR024320"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLV4"
FT                   /protein_id="CAN00028.1"
FT                   /translation="MTHPTLAPAARALPADPADRPPTQGTSGPVDATAPGARVALRAVG
FT                   RAVVRHPLAIAAVLGGSAWIGLMAGLGELAHPAATAIGIALTVMVLAWSESRIGILRTA
FT                   LVAALGSLAPVAVASLLLAAGVALGDLYSQLDAADRLWAPSVVLVAVAAAASRGLAPAH
FT                   RDGLRAAVLAAVLAGLLAGGHGVDLTRGVALLIGLGLGRILVPLSARPAWHDRAASSAR
FT                   VVAATVLGTVTLSWWIAAVSGDAIGVLSAMGSLLDPGPTVAVLCVLIVAVALLLRGRRL
FT                   GLVLGIAALLLVTGLLGWYYTVIPLAEDWFAFPIDSWVDLELPLLVLTTWLLPAAALVV
FT                   LVVRRRSFAARAVADGRSAGRDRVLAQLIRSDAGSLGFMGTWTGSSHWFAGDDGDDGDP
FT                   AVLGAVAYRAAHGVALTVSDPLASAGDAPATIRAFARHCSARGLVPAFYSIHSRHLPVF
FT                   AELGWSVTPVAEEAVIDLPGFSTSGKRRQDLRTATNRAARDGVDALWGTYRGLPDDLRA
FT                   AVDALSGDWADAKALPEMGFTLGGLRELDDPEVRMLLAVDAAGRVHGVTSWLPVFREGR
FT                   LVGRALDVMRRGADPMPGVMEFLIATAARAFQEEGLETLSLSGTPLAGVGATRPAGAVD
FT                   RVVARLLQATGRVLEPSYGFTSLLRFKAKFDPRYETLWLACPTAADLAPIGRALTAAYV
FT                   PTLRIRQLVGALRAARGEARAGCRAGRAAGRAARGASLGHAGDRGAATGDGGGSTGGRR
FT                   DA"
FT   CDS_pept        28143..28829
FT                   /transl_table=11
FT                   /locus_tag="CMM_0023"
FT                   /product="putative two-component system response regulator"
FT                   /function="Response regulator containing a CheY-like
FT                   receiver domain and an HTH DNA-binding domain"
FT                   /note="two-component system response regulator(NP_822457.1|
FT                   putative two-component system response regulator
FT                   [Streptomyces avermitilis MA-4680];; ZP_00058730.1|
FT                   COG2197: Response regulator containing a CheY-like receiver
FT                   domain and an HTH DNA-binding domain [Thermobifida fusca]).
FT                   pfam00072, Response_reg, Response regulator receiver
FT                   domain. This domain receives the signal from the sensor
FT                   partner in bacterial two-component systems. It is usually
FT                   found N-terminal to a DNA binding effector domain.
FT                   pfam00196, GerE, Bacterial regulatory proteins, luxR
FT                   family."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00029"
FT                   /db_xref="GOA:A5CLV5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLV5"
FT                   /protein_id="CAN00029.1"
FT                   /translation="MIEGPGAGDGTSEAGPVVSVVVIDDESLVRSGIAMVLGASPRIAV
FT                   RAAVSSDTAVATVREHAPDVVLLDIRMPAPDGLAILAELMAEPRPPAVAMLTTFDTDDQ
FT                   VLEALHRGASGFLLKDTDPEQLARHVLTLASGGIVLAPGLRPGRLFRSLEDDAARARVA
FT                   RLGDRETIVLKALARGLSNAEIVAECGLTLGTVKETVSSIVQALGVGTRVEAAVVADRA
FT                   GLVPRR"
FT   CDS_pept        28837..29955
FT                   /transl_table=11
FT                   /locus_tag="CMM_0024"
FT                   /product="putative two-component system sensor kinase"
FT                   /function="Signal transduction histidine kinase
FT                   nitrate/nitrite-specific"
FT                   /note="putative two-component system sensor kinase
FT                   (NP_822456.1| putative two-component system sensor kinase
FT                   [Streptomyces avermitilis MA-4680];; NP_823166.1| putative
FT                   two-component system sensor kinase [Streptomyces
FT                   avermitilis MA-4680]). pfam02518, HATPase_c, Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0024"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00031"
FT                   /db_xref="GOA:A5CLV6"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLV6"
FT                   /protein_id="CAN00031.1"
FT                   /translation="MRVSGADAVTTTGADRIRAALVDLLVAGIATAASYTFLSTAESPW
FT                   DAVAGVVACVGLLLRRRWPWLSLLAAMPAFYIGIAYVPLVVALFDLGLSRAARWRVVVA
FT                   SGVSVLAYLLPITPPEDLQSVVEPLVDATLYTVGPALLGAFLRERRTAAAQLRELREAQ
FT                   TLGQRQAAEVALARERAVLAREMHDVVSHQVSLIAVQAGALQVGAADERSREAARTIRG
FT                   LSTVTLEELRGMVEVLRAAGGERRELAPQPTLRDVPALVAASGIRATADLDLPADLPAA
FT                   AQRAVYRTVQEGLTNARKHATGADVRIIGRLDAGNVVLEVEAGRATLPLLDLPSGRHGL
FT                   TGLRERAQLLGGSLTAGTRPDGSHLLRLRFPL"
FT   CDS_pept        complement(29995..30117)
FT                   /transl_table=11
FT                   /gene="rpmJ2"
FT                   /locus_tag="CMM_0025"
FT                   /function="putative 50S ribosomal protein L36"
FT                   /note="putative 50S ribosomal protein L36 (second copy)
FT                   (NP_624882.1| putative 50S ribosomal protein L36
FT                   [Streptomyces coelicolor A3(2)];; CAF21195.1| Ribosomal
FT                   protein L36 [Corynebacterium glutamicum ATCC 13032])."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00032"
FT                   /db_xref="GOA:A5CLV7"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5CLV7"
FT                   /protein_id="CAN00032.1"
FT                   /translation="MKVRNSIKALKKLPGAQVVRRRGRVFVINKQNPRNKARQG"
FT   CDS_pept        30162..31235
FT                   /transl_table=11
FT                   /locus_tag="CMM_0026"
FT                   /product="conserved hypothetical protein"
FT                   /function="Putative GTPases (G3E family)"
FT                   /note="putative GTPase (NP_962706.1| hypothetical protein
FT                   MAP3772c [Mycobacterium avium subsp. paratuberculosis str.
FT                   k10];; ZP_00173773.1| COG0523: Putative GTPases (G3E
FT                   family) [Methylobacillus flagellatus KT]). weak similarity
FT                   to: pfam02492, cobW, Cobalamin synthesis protein/P47K."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00033"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLV8"
FT                   /protein_id="CAN00033.1"
FT                   /translation="MPARDHLPLPVYPQPPSGVFLVVGEGSGLRSVLRDAVDDIAGTLL
FT                   VLPPEEADPVEPIARFLDDLAERGPGVEAVVGIPATAGARATGMQLDLLLRREHELQRS
FT                   LGGTGSGFGLRHVVSVVAADRLHSIAFGRVEDAFDEAETLADLVEYATVVVLTGMARVP
FT                   LESRGTLLALVRRLAPRAAVLDARRPLALDRLPRWGDVAGLAASAGWMRELTAAGVASR
FT                   TGEVDRLGGPVGSVVVSDPRPLHPARLALAVEEELRPDRAGLVLRSKGFVSLASRPGEV
FT                   GGWSSVGSMLTLQPTGIDPWQEGASHGTEIAFFGVGLRPAVLRRAIGRAVLTGEELAAG
FT                   PAAWVGYADPFPRVDAG"
FT   CDS_pept        31412..33178
FT                   /transl_table=11
FT                   /gene="recQ1"
FT                   /locus_tag="CMM_0027"
FT                   /product="ATP-dependent DNA helicase"
FT                   /function="Superfamily II DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="ATP-dependent DNA helicase recQ (EC 3.6.1.-)
FT                   (ZP_00198343.2| COG0514: Superfamily II DNA helicase
FT                   [Kineococcus radiotolerans SRS30216];; ZP_00169039.2|
FT                   COG0514: Superfamily II DNA helicase [Ralstonia eutropha
FT                   JMP134]). InterPro: ATP-dependent DNA helicase RecQ
FT                   pfam00270, DEAD, DEAD/DEAH box helicase. Members of this
FT                   family include the DEAD and DEAH box helicases.
FT                   pfam00271,Helicase_C, Helicase conserved C-terminal
FT                   domain."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00034"
FT                   /db_xref="GOA:A5CLV9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR021938"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLV9"
FT                   /protein_id="CAN00034.1"
FT                   /translation="MTRTAHDRTADDRPADDRPAAEDPAIVPEPTPGPEPEDALRVARE
FT                   SFGWDELHDGQVRTIGPLVRGRDALVVMPTGYGKSAIYQVATVLMEGLTVVVSPLIALQ
FT                   ADQVQNLEDAPAAPPARVINSTIRGAALDEAWATVEEPGARIVFLTPEQLARDEVVARL
FT                   VARGVSLVVIDEAHCVASWGHDFRPDYLGLGGVIDALGHPPTVAMTATGSTPIRTEVAE
FT                   RLGLRDPFVLSSGFDRPNIRLEVRRHTEEAEKRRAIVAHVVEQTQPGLVYVATRKDAED
FT                   YADEIRAAGLRVDAYHAGLAAAERDRVQTAFHEDDVDVVVATSAFGMGIDKPTVRYVIH
FT                   AAPPESVDAYYQEVGRAGRDGEPAVGILHYRAEDLGLRRFFTARTPRPASLRDVYAAVA
FT                   VAGVDGPVRPAAVAERAGMSARTVGGVLNLLVDAGVLGSDRDGAFVREELDPREAAARG
FT                   KHVAQERERIEVSRLDMMRGYAETPQCRRQFLLGYFGEESPERCGNCDACDRLDAEDAH
FT                   EEAMGTGAADPAAAAASDEAFPAQSRVTHAEWGPGTVMSTEEDRITVFFESEGYRVLSR
FT                   KLVEEGRLLQPA"
FT   CDS_pept        33175..33420
FT                   /transl_table=11
FT                   /locus_tag="CMM_0028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00035"
FT                   /db_xref="GOA:A5CLW0"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLW0"
FT                   /protein_id="CAN00035.1"
FT                   /translation="MSEGVCEGGLIHLSFLHRSRWITYGTAIAIGLAGVAGLVVGNPRR
FT                   WIPVGIAVLAVLFQRLVSRDARRAQEAGTDPRDTVG"
FT   CDS_pept        33677..34654
FT                   /transl_table=11
FT                   /gene="glsA"
FT                   /locus_tag="CMM_0029"
FT                   /product="putative glutaminase"
FT                   /function="Glutaminase"
FT                   /EC_number="3.5.1.2"
FT                   /note="glutaminase (L-glutamine amidohydrolase)
FT                   (ZP_00162219.2| COG2066: Glutaminase [Anabaena variabilis
FT                   ATCC 29413];; ZP_00026087.1| COG2066: Glutaminase
FT                   [Ralstonia metallidurans]). pfam04960,
FT                   Glutaminase,Glutaminase. This family of enzymes deaminates
FT                   glutamine to glutamate EC:3.5.1.2."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00036"
FT                   /db_xref="GOA:A5CLW1"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5CLW1"
FT                   /protein_id="CAN00036.1"
FT                   /translation="MTAPGSASHDAAHDPAHALDLDRLLASAADDGGGQVDDSIPQLAE
FT                   TDPSLAGIALVTPDGRTHAAGDSAHAFSIQSAVKPFLFALALADTDGAALDAVGIEPTG
FT                   EAFDAIKLESGTGRPPNPMVNAGAILTASLVRGSTLEERTARILAGLSAFAGRDLEVDE
FT                   DVAECEQLLGDRNHALAHLMRSEGTLHVSADDAVAAYARACAVLVTPEILAAMGATLAC
FT                   GGRNPLTGSRVVSREVARDSVSVMATCGVYDGSGRWMRRVGVPAKSSVSGAIVLASPGR
FT                   LGAAVFSPPLDDQGTSVRGAVLAQRLADELGLHAFGGTGGRERA"
FT   CDS_pept        complement(34674..35723)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0030"
FT                   /product="putative hydrolase/acyltransferase"
FT                   /function="Predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily)"
FT                   /note="putative hydrolase/acyltransferase (ZP_00187188.2|
FT                   COG0596: Predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily) [Rubrobacter
FT                   xylanophilus DSM 9941];; NP_295074.1| hydrolase,alpha/beta
FT                   hydrolase fold family [Deinococcus radiodurans R1]).
FT                   pfam00561, Abhydrolase_1, alpha/beta hydrolase fold. This
FT                   catalytic domain is found in a very wide range of enzymes.
FT                   InterPro: Alpha/beta hydrolase fold."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00037"
FT                   /db_xref="GOA:A5CLW2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLW2"
FT                   /protein_id="CAN00037.1"
FT                   /translation="MTQHGRPATTVRVTRLVHRGLTVRISTLGSPDGRAFVLVPGIGVS
FT                   SDYFERLAPRLDGHGTVHALDLPGFAGVRHPGRALQIREYADLVGAAIDELGLDDPVLV
FT                   GHSMGTQMVADLAARRPGISTLVMISPVVDPAARSVPVAAVRFLRSSLHEPRRIQVLAI
FT                   RAYLVCGVRWFLRVLPRMMSFPIEARLPGIRASALVIRGEHDAVVPRAWVEEMGRLLPR
FT                   ARVWEIPGAAHSVMHDHADEVARLCLAHLERPPAEGSSTEDSSAQLRRFPVGEGERDEE
FT                   HADFAPTFRDSIRALRAQVAEGIAIRRDDDAAIGRAKTAHAEAMADAAERARRRQAWSV
FT                   PGGRTGTRR"
FT   CDS_pept        35841..36227
FT                   /transl_table=11
FT                   /locus_tag="CMM_0031"
FT                   /function="putative transcriptional regulator, PadR family"
FT                   /note="putative transcriptional regulator, PadR family
FT                   (NP_821203.1| putative transcriptional regulator PadR-like
FT                   family [Streptomyces avermitilis MA-4680];; ZP_00209884.1|
FT                   COG1695: Predicted transcriptional regulators
FT                   [Magnetospirillum magnetotacticum]). pfam03551,
FT                   PadR,Transcriptional regulator PadR-like family."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00038"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLW3"
FT                   /protein_id="CAN00038.1"
FT                   /translation="MVGIVPPMTSTAFWILTALAAGRRHGYAVLADVARLSDGEVTLRV
FT                   TTLYASLDRLVREGRIRTAGEEVVDGRARRYYEITDAGRGELEAEADRLQARAAAARAS
FT                   IAAAAPARSRPVVTPRATATAARA"
FT   CDS_pept        36305..37552
FT                   /transl_table=11
FT                   /locus_tag="CMM_0032"
FT                   /product="putative membrane protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00039"
FT                   /db_xref="GOA:A5CLW4"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLW4"
FT                   /protein_id="CAN00039.1"
FT                   /translation="MLDTLEEHADAEGRSRPAPGEAWSLRAHGLLERVTPRAILVIAAT
FT                   ASLLAVALPAATLSSLFLGSPVLLAMPWAAALLATIALIGLVGRSGVLRSESALAAAVL
FT                   AVPSWILGGVAAAAWSIGFDEADAGESRSAFSSAFAVLALAAWLLGAASLAVVLAGLLG
FT                   IRPAVARWIVAVVVALPGALLVGGVALTSGALALALAALIASARHRMRGRGREAGVAVD
FT                   GSAAVSAARAPLSASGRRAVVITSLVGSALGLACAAFALAGSAWLPAVGDATDAMRAGI
FT                   AVGSVVALLPVAAGAAALRPRMGRIVIPAAASLGAAFLTIAAAFSVPGLDAAAPGYQQV
FT                   AAGFVGVAGAALLLPVLSGGRVVRGILVVGVAVGIAAFAGMMVAAAGAFLAPVLGVVTA
FT                   VLVARRARVPRRTQPA"
FT   CDS_pept        complement(37569..37958)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0033"
FT                   /product="conserved hypothetical protein"
FT                   /note="conserved hypothetical protein (NP_627276.1|
FT                   conserved hypothetical protein [Streptomyces coelicolor
FT                   A3(2)];; ZP_00198785.1| COG2514: Predicted ring-cleavage
FT                   extradiol dioxygenase [Kineococcus radiotolerans
FT                   SRS30216]). pfam00903, Glyoxalase, Glyoxalase/Bleomycin
FT                   resistance protein/Dioxygenase superfamily."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00040"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLW5"
FT                   /protein_id="CAN00040.1"
FT                   /translation="MRIRQTIVVLDAPDLAAESAFWAGLLEGEVHAEDDWHSVRVDGEW
FT                   RIGIQLAPDFEPPVWPGDGPRQQQQIHLDFYVDDLAEGRERVLALGGRLLQPAADPTAA
FT                   DRFDVYADPAGHPFCLCVSGGVAQG"
FT   CDS_pept        40054..40860
FT                   /transl_table=11
FT                   /locus_tag="CMM_0034"
FT                   /product="putative sugar phosphate isomerase/epimerase"
FT                   /function="Sugar phosphate isomerases/epimerases"
FT                   /note="putative sugar phosphate isomerase/epimerase
FT                   (ZP_00229027.1| COG1082: Sugar phosphate
FT                   isomerases/epimerases [Kineococcus radiotolerans
FT                   SRS30216];; NP_623524.1| Sugar phosphate
FT                   isomerases/epimerases [Thermoanaerobacter tengcongensis])."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0034"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00041"
FT                   /db_xref="GOA:A5CLW6"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLW6"
FT                   /protein_id="CAN00041.1"
FT                   /translation="MTAPSVQLYTVRDAVSADLQGAVARVAEIGYTQVEPYAFVERADE
FT                   FAAAFAASGVTAPSGHAPVIDGDDDQAARTFDAAAKLGIQTVIDPFIPSERWQTADDAH
FT                   RIADRVNELQVQAAARGLAFGYHNHQWEFANKVDGRPIYELFVERLDADVVLELDAFWS
FT                   TVGGMDTPALLEQLGDRVRFLHVKDGKISDAIAKVLPSAESALVVPPELAQAFKMQEPA
FT                   GQGDVDVAAVLAAAPHALRVVEFDDYAGDVFDGIAASLAWLQENDK"
FT   CDS_pept        40857..41966
FT                   /transl_table=11
FT                   /locus_tag="CMM_0035"
FT                   /product="putative dehydrogenase/oxidoreductase"
FT                   /function="Predicted dehydrogenases and related proteins"
FT                   /note="putative dehydrogenase/oxidoreductase
FT                   (ZP_00227973.1| COG0673: Predicted dehydrogenases and
FT                   related proteins [Kineococcus radiotolerans SRS30216];;
FT                   NP_241574.1| BH0708~unknown conserved protein [Bacillus
FT                   halodurans C-125]). InterPro: Oxidoreductase C-terminal
FT                   pfam01408, GFO_IDH_MocA, Oxidoreductase family, NAD-binding
FT                   Rossmann fold. This family of enzymes utilise NADP or NAD."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00042"
FT                   /db_xref="GOA:A5CLW7"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLW7"
FT                   /protein_id="CAN00042.1"
FT                   /translation="MTGGTGRVGVGVIGAGVISGTYLENMTAMPDLEVLFVADIDLDRA
FT                   RSRAEEHGVPNHGTVDELLAMDEIEIVVNLTLPATHAEVGRRIVAAGKHVWSEKPLALD
FT                   HESGQDLLEAARAAGVQVACAPDTVLGAGIQSAMRAIARGDIGEPLTATTLFHVPGPDA
FT                   WHPNPEFLFARGAGPLFDMGPYYVTTLVHAFGAAETVSAVSSTSRTTRTIGSGPRAGTD
FT                   FPVEVPTHHAALISFAGGQSAQSTFSFQNALPRMGFVEISGSEGTIVLPDPNTFEGDSQ
FT                   LWRFGQEGPETLTAVGSTYGRGSGVLDLARSIRGGDPVRASGEVAAHVLDVLLAIRDAA
FT                   DSREVVEVASSVAKPTPLAEDWDPAAATL"
FT   CDS_pept        42124..43209
FT                   /transl_table=11
FT                   /locus_tag="CMM_0036"
FT                   /product="putative transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00044"
FT                   /db_xref="GOA:A5CLW8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLW8"
FT                   /protein_id="CAN00044.1"
FT                   /translation="MPSTSSSCGTISEQREPSRVGVQVMGRAPGMVDVAQVAGVSHVTV
FT                   SRVLNGHPSVRPETRARVEAAIAQLGYRRNTVARALKSKRSSTIGVVMAGSGLYELPRV
FT                   LLGIETTARAAGYEINLASWQGGAASDLAEMVRRLTDQSVEGVAVIAARQVAVDALSDV
FT                   VADIPMSVVMSGSVSNPRISFVELDQELGARLAVRHLRDLGHERITHLAGNFETFDAAA
FT                   RVQGWRDELACSPSLPQQLLEGDFTAESGYRGAMELARSSDGLPTAIFAGNDLMALGVL
FT                   AALAELGLSAPDDVSLVGFDDIAGADHFIPALTTIRQDFMTLGSSAIETLLSTMAGQEP
FT                   VRRQIPPTLVVRKSTAAPRPH"
FT   CDS_pept        43461..44466
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="CMM_PS_01"
FT                   /note="transcriptional regulator, LacI family, COG1609:
FT                   Transcriptional Regulators"
FT                   /note="Family membership"
FT   CDS_pept        44770..45300
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="CMM_PS_02"
FT                   /function="Alpha-galactosidase"
FT                   /note="alpha-galactosidase pseudogene, truncated
FT                   gene,homologous protein have about 700 amino acids,
FT                   COG3345: Alpha-galactosidase"
FT                   /note="Hypothetical protein"
FT                   /db_xref="PSEUDO:CAN00046.3"
FT   CDS_pept        complement(45327..45899)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0037"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein (ZP_00230295.1| conserved
FT                   hypothetical protein [Listeria monocytogenes str. 4b
FT                   H7858])."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0037"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00047"
FT                   /db_xref="GOA:A5CLX0"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLX0"
FT                   /protein_id="CAN00047.1"
FT                   /translation="MLAVISAVVIAPASAEAATKPSSVETIAASLKADTIISDITTGKL
FT                   SVDQLVDADLAAWPGDGSTATTPTRDQVKKEMTSEVQSVKDSGDLQVAQDIDVTASNDG
FT                   RVSASASMPGSSFFSFKHLFKHWATITLDGRVAKIIVGTQAAVATAFICATPGVGALMC
FT                   GLTAAIIGVIVGIYLNWPPCRGMTIYI"
FT   CDS_pept        complement(46243..46467)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="CMM_PS_03"
FT                   /function="Putative transposase"
FT                   /note="putative transposase reminant, COG3293: putative
FT                   transposase"
FT                   /note="Hypothetical protein"
FT                   /db_xref="PSEUDO:CAN00048.1"
FT   CDS_pept        46723..47512
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="chpD"
FT                   /locus_tag="CMM_PS_04"
FT                   /function="Serine protease"
FT                   /note="putative extracellular serine protease, family S1
FT                   (chymotrypsin)"
FT                   /note="Family membership"
FT   CDS_pept        complement(47879..48292)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0038"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00050"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLX2"
FT                   /protein_id="CAN00050.1"
FT                   /translation="MSKVKSKLDGIDSLVRSTGQHPWAHLQAGYWRIQVEDRPVLGYVI
FT                   RHRAELGDPFTFDVYADARNDQGQRIWIRREPSLNTAVAWMVQHSAELIAFAARSRSRS
FT                   GSRGPAETTAAEHASADVDQARELGHVERGQFG"
FT   CDS_pept        complement(48734..49567)
FT                   /transl_table=11
FT                   /gene="chpE"
FT                   /locus_tag="CMM_0039"
FT                   /product="putative extracellular serine protease, family
FT                   S1A"
FT                   /function="Serine protease"
FT                   /note="putative extracellular serine protease, family S1A
FT                   (AAD09893.2| unknown [Clavibacter michiganensis subsp.
FT                   michiganensis];; YP_063162.1| pat1 protein [Leifsonia xyli
FT                   subsp. xyli str. CTCB07]). pfam00089, Trypsin, Trypsin."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00051"
FT                   /db_xref="GOA:A5CLX3"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLX3"
FT                   /protein_id="CAN00051.1"
FT                   /translation="MKHFKILTSAAVMGAIALALMAPSAANARTSPERSSVPVVVGTEV
FT                   WGKWSGQNCTVGVVLQKSGLWAALSPSERGARYVVIAKHCVRRTTEPIEVRTANGTDVE
FT                   VGSVVALADPDDLALVRIEGSPHGARTCSATSGHFICMPSTVYSPQAFNRVFLPGFAPG
FT                   HETTLPMTRQGVPGPRETFCTSGAVTRSLCEWTSTNVPPAWVQHHVYAAARSTGANLLK
FT                   GDSGGAVVSRTGDFYGIATDSGLYDSDHSNIDIMGYTDAARVLSDFRGYHMAPAS"
FT   CDS_pept        complement(49775..50104)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00052"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLX4"
FT                   /protein_id="CAN00052.1"
FT                   /translation="MDPARGPARARVRDAAPRGARDPFTFEAYADARDELGQRIWPRRE
FT                   ESLNLAAAWMIQNSDRLISFAGQHAAAASDVDGPREPGDVGADRLPGGYEEADLHGRDR
FT                   RLPAG"
FT   CDS_pept        50376..51356
FT                   /transl_table=11
FT                   /gene="ppaA"
FT                   /locus_tag="CMM_0041"
FT                   /product="putative extracellular serine protease"
FT                   /note="putative extracellular serine protease (NP_779169.1|
FT                   conserved hypothetical protein [Xylella fastidiosa
FT                   Temecula1];; ZP_00293497.1| COG3591: V8-like Glu-specific
FT                   endopeptidase [Thermobifida fusca])."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00053"
FT                   /db_xref="GOA:A5CLX5"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLX5"
FT                   /protein_id="CAN00053.1"
FT                   /translation="MKKIYPKRRHAASMAALSVGIGLVLVCGPHDIGGESARAASSASG
FT                   PASGASDTGMSVSDADAAESENYWTPDKIAAAVPADGVTVTPQKQSPSLGASAVTSVFE
FT                   PVYWIGRLYYTAGGIDYACTASSIKSDSKLVIATAGHCLYHKGEFSTNLRFIPAWDGAN
FT                   KPLLTWGANDYQVPRAWRYQEDQQHDAGFVQLKPQRSWLGAKQYLADRAGATATNFGLA
FT                   KTGLHYEAFGYEQVSGFTSHPLLTCSGNGYRRFSQFSLLSINDCAMVGGGSGGPVYHES
FT                   GKGVNGTQVGVVSSVIPQGEHSIMTFAPWGDAEYQVFRTVDAWGR"
FT   CDS_pept        complement(51503..52507)
FT                   /transl_table=11
FT                   /gene="ppaB1"
FT                   /locus_tag="CMM_0042"
FT                   /product="conserved hypothetical protein, putative
FT                   extracellular serine protease"
FT                   /function="putative protease"
FT                   /note="conserved hypothetical protein, putative
FT                   extracelluar serine protease (NP_642686.1| conserved
FT                   hypothetical protein [Xanthomonas axonopodis pv. citri str.
FT                   306];; ZP_00227464.1| COG3591: V8-like Glu-specific
FT                   endopeptidase [Kineococcus radiotolerans SRS30216])."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00054"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLX6"
FT                   /protein_id="CAN00054.1"
FT                   /translation="MATRTGSTLIGAATCATLALTLMGAGAATAATTAEPTGTLRHTIS
FT                   STETAAAGSTWSRARMHAAVTNSFVDPDPADGNPPADDQDSALTATSTSDASPGAASPH
FT                   VSETTPVPGFTANDHLGVVFFRSGGIDQRCTGNVVVSDSGNLVATAGRCVSAIKDAFVT
FT                   DLVFVPQYDGTAPKGIWPATAVTVQSQWVTGRQVDFDTAFFQVKAPVGAAAGTTLSSNV
FT                   GASGVRFAGQEDDDDYRSTGYALDGGHDGTKPISVESSVEPNPWMNKDYAIEGIETDLR
FT                   AGISGSPWVNTDDDSGDIQRGMTTFAYHQFTHAAFGPQWTATLHATYRAAAAA"
FT   CDS_pept        52708..53559
FT                   /transl_table=11
FT                   /gene="pelA1"
FT                   /locus_tag="CMM_0043"
FT                   /function="putative pectate lyase"
FT                   /note="putative pectate lyase (NP_625403.1| putative
FT                   secreted lyase [Streptomyces coelicolor A3(2)];;
FT                   CAB40884.1| pectate lyase [Bacillus sp. BP-23]). pfam03211,
FT                   Pectate_lyase, Pectate lyase."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00055"
FT                   /db_xref="GOA:A5CLX7"
FT                   /db_xref="InterPro:IPR004898"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLX7"
FT                   /protein_id="CAN00055.1"
FT                   /translation="MPPVPTTQRHHLVTRPWVVVLVILVAVGGIATAPASSAHAAGLPA
FT                   QGSSISTLPAFPAPTSVKPPRATPYEVPAGQTVDYGNAELNGSTSGRGEFQQPVILVHP
FT                   GGTVKNVIIGSLAADGIHCEASCTIENMWSSHVGEDAVTLLDGSPTSSVVTIQGGGVQH
FT                   AYDKVVQMDGAGTVRIMHFAASDIGSLVRSCGNCPHQYPRHMVVSDVFIDGGRYKVAGV
FT                   NQNFGDTAKLDHITIRGTRMQVCDRTIGGRGTPAKEVPGGSGDPYPGVCDFSYATILFE
FT                   HG"
FT   CDS_pept        complement(53883..54896)
FT                   /transl_table=11
FT                   /gene="ppaC"
FT                   /locus_tag="CMM_0044"
FT                   /product="conserved hypothetical protein, putative
FT                   extracellular serine protease"
FT                   /function="putative extracellular protease"
FT                   /note="conserved hypothetical protein, putative
FT                   extracellular serine protease (NP_779169.1| conserved
FT                   hypothetical protein [Xylella fastidiosa Temecula1];;
FT                   ZP_00227464.1| COG3591: V8-like Glu-specific endopeptidase
FT                   [Kineococcus radiotolerans SRS30216])."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00056"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLX8"
FT                   /protein_id="CAN00056.1"
FT                   /translation="MRKLPISRVRPRASSSQQGRRSVRVLTMIAAATASVAAGGVIQGG
FT                   ALSAAPALAATPDVSAVSAASLGSRAFSDEEMTSTSDYWTVDRLQRAIPDDGSASVVGA
FT                   SDAGSGVVHSVSGSITATAWVGKIAFRRGGLDRLCSASAVHSDSGYLVATAGHCLLNDD
FT                   QTATGVTFVPGWDGKNMPYGTWIAKFYSVTPEWRVRADDSHDVGFIKVQPIGSKSLADT
FT                   VSALRVNFSLAKPQLHYFSLAYGNIGGGFQAKPLSTCVGPAYRLHDEQSLAMIGCKAVG
FT                   GMSGGPVYHASTEEPRGTQVGVIGRNVETAYGDAIAFTPFGKAELSTYKTVDSFTK"
FT   CDS_pept        complement(57043..57396)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0045"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00057"
FT                   /db_xref="GOA:A5CLX9"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLX9"
FT                   /protein_id="CAN00057.1"
FT                   /translation="MGTDTDLGQPQILRSAAPDAALGTQLSLWHKFKRLFHHWATVRIT
FT                   APTGGALLGGGTAVGIAAIVAGAFGLLASAIFASIGAVAFITLGSVSLSCNTRHLKYLY
FT                   IEFPDLGNSHCGN"
FT   CDS_pept        58928..59730
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="chpA"
FT                   /locus_tag="CMM_PS_05"
FT                   /function="Serine protease"
FT                   /note="putative extracellular serine protease, family S1A"
FT                   /note="Hypothetical protein"
FT   CDS_pept        61909..62718
FT                   /transl_table=11
FT                   /locus_tag="CMM_0046"
FT                   /product="hypothetical protein, putative phage protein"
FT                   /note="hypothetical protein, putative phage protein
FT                   (CAD43910.1| hypothetical protein [Lactobacillus casei
FT                   bacteriophage A2];; ZP_00230220.1| conserved hypothetical
FT                   protein [Listeria monocytogenes str. 4b H7858])"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0046"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00059"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLY0"
FT                   /protein_id="CAN00059.1"
FT                   /translation="MLTGLVGLSGDFAKAGAFNSEGIVDSEVLVRPAQEGSFLIEVVRV
FT                   VTENWEAISTVAGPPTLTQIILWATKSARADVEEFEHLGNGNVKVKWQDGTAQEVPLAA
FT                   WKELQKNTPRRKRQLRQILAPLSDSRVSAVDVERPSSKELEKLTPDDAPDVFVLTKPDY
FT                   DAVKPDDKTDERSEIVNAEAQMTAIDFDDATKWRVRATFDGKTLKRSATVEDEDFLGHV
FT                   SNGLAIRKEDIFQIRLRVDTSTTNGRTSTRWTVLEVLQHRRASGDDD"
FT   CDS_pept        complement(63422..63748)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0047"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein (weak similarity to:
FT                   NP_858518.1| hypothetical protein [Rhodococcus equi];;
FT                   YP_056012.1| hypothetical protein PPA1305
FT                   [Propionibacterium acnes KPA171202])."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00060"
FT                   /db_xref="GOA:A5CLY1"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLY1"
FT                   /protein_id="CAN00060.1"
FT                   /translation="MTDYNDLAARAERGELTPIPGTDLHGAAAANAGRAMLMDATGTDT
FT                   LDDAMAVALGRPRFDAEEPAGPMWKVRATKALDEQVEALAKRQGHNNKSRIIREATAAY
FT                   IRAS"
FT   CDS_pept        complement(64558..64995)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00061"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLY2"
FT                   /protein_id="CAN00061.1"
FT                   /translation="MAPGRGGIRDGPGSVLHGRRVQCGAVRVRFGLGRAHYGDGRLVGV
FT                   VRVALGTACVVDVGDDLLDLAERVPSRGELAEVRGVVGRHAAPRLAAHRALHAPTTTAR
FT                   ATCCAFVGVAARNFPSASPTSQSCDVRCQTPVDDDSASGAR"
FT   CDS_pept        complement(65242..65418)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="CMM_PS_06"
FT                   /function="ATP binding protein, putative transposase"
FT                   /note="ATP binding protein, putative transposase, COG2842:
FT                   ATP binding protein, putative transposase"
FT                   /note="Hypothetical protein"
FT                   /db_xref="PSEUDO:CAN00062.1"
FT   CDS_pept        65645..67468
FT                   /transl_table=11
FT                   /gene="nagA"
FT                   /locus_tag="CMM_0049"
FT                   /product="putative beta-N-acetylglucosaminidase"
FT                   /function="Beta-glucosidase-related glycosidases"
FT                   /note="putative beta-N-acetylglucosaminidase
FT                   (ZP_00187564.2| COG1472: Beta-glucosidase-related
FT                   glycosidases [Rubrobacter xylanophilus DSM 9941];;
FT                   NP_626989.1| beta-N-acetylglucosaminidase (putative
FT                   secreted protein)[Streptomyces coelicolor A3(2)]).
FT                   ,InterPro: Glycoside hydrolase family 3 N terminal
FT                   ,pfam00933, Glyco_hydro_3, Glycosyl hydrolase family 3 N
FT                   terminal domain. pfam01915, Glyco_hydro_3_C, Glycosyl
FT                   hydrolase family 3 C terminal domain."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00063"
FT                   /db_xref="GOA:A5CLY4"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLY4"
FT                   /protein_id="CAN00063.1"
FT                   /translation="MAHELEPDNGSSFSRRGFLTAAASIGAAVAVQATEEGGDAARAST
FT                   ANIDVVRLVQGMSLEDKVAQLFVLAVSGRTADTADPAAVTANRAAYGVATPAEVVARHR
FT                   PGGIIYFAGEKDNLVDPRQIARLSGDLQRASQGAGRIPLLVSTDQEQGGYVVRAPCTLL
FT                   PGQMGLASSPSSSADVRAVATITRDELLAMGINQAFAPVVDVASNPANPIIHVRSFGDD
FT                   PDRVALLAQSQIGTFQKRQGIVAAAKHFPGHGATDTDSHTGLPVNNRSRSELEDNDLPP
FT                   FAAAIKSGVGVIMSAHIVVPALDSSGDPATLSYPILTGVLRQKLGYDGVVITDALDMAG
FT                   VRQRYSDARVPVLAIKAGVDQLLTPPDFFAARDGVLAAIRAGELTEARIDESVTRILRL
FT                   KQRFGLLTTAKVHGDPSIVRSVTHLATAAEVTDRTITVLKDDDGLLPLPARPRKVLVTG
FT                   WGAVTTASLADVLTAHGDTTTLSTTGISPDAATVTSAATLAKQVDLVVVCTRNLGADTS
FT                   SGQLSLVSALIASGTPVISVAVLEPYDIAHTPQVRTHLLTYSYAKNALEALGRVLHGEV
FT                   AGTSVLAVDIPFSDGTDVLFPRGSHVRRTRS"
FT   CDS_pept        complement(67885..68886)
FT                   /transl_table=11
FT                   /gene="ppaB2"
FT                   /locus_tag="CMM_0050"
FT                   /product="conserved hypothetical protein, putative
FT                   extracellular protease"
FT                   /function="putative extracellular protease"
FT                   /note="conserved hypothetical protein, putative
FT                   extracellular protease (NP_642686.1| conserved hypothetical
FT                   protein [Xanthomonas axonopodis pv. citri str. 306];;
FT                   NP_693914.1| hypothetical protein OB2992 [Oceanobacillus
FT                   iheyensis HTE831])."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00064"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLY5"
FT                   /protein_id="CAN00064.1"
FT                   /translation="MATRTGSTLIGAATCATLALTLMGAGAATAATTAEPASTLRHTIS
FT                   STETAAAGSTWSRARMHAAVTNSFVDPDPADGNPPADDQDSALTATSTSDASPGAASPH
FT                   VSETTPVPGFTANDHLGVVFFRSGGIDQRCTGNVVVSDSGNLVATAGRCVSAIKDAFVT
FT                   DLVFVPQYDGTAPKGIWPATAVTVQSQWVTGRQVDFDTAFFQVKAPVGAAAGTTLSSNV
FT                   GASGVRFAGQEDDDDYRSTGYALDGGHDGTKPISVESSVEPNPWMNKDYAIEGIETDLR
FT                   AGISGSPWVNTDDDSGDIQRGMTTFAYHQFTHAAFGPQWTATLHATYRAAAA"
FT   CDS_pept        69085..69936
FT                   /transl_table=11
FT                   /gene="pelA2"
FT                   /locus_tag="CMM_0051"
FT                   /function="putative pectate lyase"
FT                   /note="putative pectate lyase (NP_625403.1| putative
FT                   secreted lyase [Streptomyces coelicolor A3(2)];;
FT                   CAB40884.1| pectate lyase [Bacillus sp. BP-23]). pfam03211,
FT                   Pectate_lyase, Pectate lyase."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00065"
FT                   /db_xref="GOA:A5CLY6"
FT                   /db_xref="InterPro:IPR004898"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLY6"
FT                   /protein_id="CAN00065.1"
FT                   /translation="MPPLLPARRHHLATRPWAVALVVLIAIGGVAAVPASSAHAAGLPA
FT                   QGSTISTLPAFPAPTSVKPPRATPYEVPAGQTVDYNNAELNGSTSGRGEFQQPVILVHP
FT                   GGTVKNVIIGPLAADGIHCEASCTIENMYSSHVGEDAVTLLDGSPTPSVVTIQGGGVQH
FT                   AYDKVVQMDGAGTVRIMHFAASDIGSLVRSCGNCPHQYPRHIVVSDVFIDGGRYKVAGV
FT                   NQNFGDTAKLDHITIRGTRMQVCDRTIGGRGTPAKEVPGGSGDPYAGVCDFSYATILFE
FT                   HG"
FT   CDS_pept        complement(70785..71645)
FT                   /transl_table=11
FT                   /gene="chpC"
FT                   /locus_tag="CMM_0052"
FT                   /product="putative extracellular serine protease, family S1
FT                   (chymotrypsin)"
FT                   /function="Serine protease"
FT                   /note="putative extracellular serine protease, family S1
FT                   (chymotrypsin) (YP_063162.1| pat1 protein [Leifsonia xyli
FT                   subsp. xyli str. CTCB07]). pfam00089, Trypsin, Trypsin."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00066"
FT                   /db_xref="GOA:A5CLY7"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLY7"
FT                   /protein_id="CAN00066.1"
FT                   /translation="MSKTHFRGIYFIVIPIALGLMAASSTVWSAFATEGARQTRPVIAG
FT                   SQLEFEFGGDCTAGAVVQKNSWSAVFFAKERATRYVVTANHCVARIGERVFVRNELESR
FT                   HGHVPPIGTVYWRSDDVDLALIKIDPIVHVSYTCGSSSHGAPHCLPVTTWTPNALPRVL
FT                   TASLRMRSIYAQPVIGYDNPGLNEAFATSGSTTGVQVNWRNLSVRAWPPGFRDPRSGDQ
FT                   AASSTTDFLLPGDSGGPVFNPDTGMLYGIMTDQVPHRLTEQSTMVYIKLSQFFHEQREY
FT                   NLVTR"
FT   CDS_pept        72304..72916
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="CMM_PS_07"
FT                   /function="putative DNA invertase/recombinase"
FT                   /note="putative DNA invertase/recombinase"
FT                   /note="Hypothetical protein"
FT   CDS_pept        74779..75633
FT                   /transl_table=11
FT                   /gene="chpF"
FT                   /locus_tag="CMM_0053"
FT                   /product="putative extracellular serine protease, family S1
FT                   (chymotrypsin)"
FT                   /function="putative serine protease"
FT                   /note="putative extracellular serine protease, family S1
FT                   (chymotrypsin) (YP_063162.1| pat1 protein [Leifsonia xyli
FT                   subsp. xyli str. CTCB07]). pfam00089, Trypsin, Trypsin."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00068"
FT                   /db_xref="GOA:A5CLY8"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLY8"
FT                   /protein_id="CAN00068.1"
FT                   /translation="MAVQASHAAQARHTRGVLRRQAAILLTVVAVLTGTLNYATPAQAV
FT                   TIPSNPDRIREPVVAGSKVNTPTGSCTVGAVLIPRSIYSRITPYQRATRWFVIAKHCAR
FT                   MYAPIHVGTSILGDVVWQSATSDIELVRVSPRPDPSPLICVAHHPKNPAVCSPFQTFTA
FT                   RAAGQVFMTARGHVARLPVTGSGAADDDRFCTSGWSTGVQCIWHGVSIPPRTPLSYEHL
FT                   VAGESGQLLNLDPGDSGGPVVNYSAELLGIISSVLPRTTLMLYTPMSQVLSELHDYQLA
FT                   SGD"
FT   CDS_pept        complement(76541..77545)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0054"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein (NP_954793.1| hypothetical
FT                   protein [Gordonia westfalica];; NP_940397.1| Hypothetical
FT                   protein DIP2073 [Corynebacterium diphtheriae NCTC 13129])."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0054"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00069"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLY9"
FT                   /protein_id="CAN00069.1"
FT                   /translation="MPDPLGYSSGPAARAAIKTAAQKAAQGASPSVGDLIKQTMFDRFL
FT                   CRVFADDEPMFVLKGGTGMLARMPRSRSTLDIDLAATEGALDAAVDELVQCASRDLGDH
FT                   FRFVYKSRTELLTGENQPYTSGCRVTFDAYLGVTSHGKIGIDLAVGHMPSAAPERRAPA
FT                   NRLTQLKFRTYDYLLYPLVDQVSDKLCATIQVYGPEGRPSSREKDLVDLAMIASFETVD
FT                   AAELRVAVSQEFLLRSLEPVDHLTVPEHWGAAYRRMAATTPLADHRPRIEDTVELVSSF
FT                   LDPVLDGTTNEGRLDPATSTRVAGEGRSSRGRVTRAVVEGDLLPFSQLRLAHR"
FT   CDS_pept        complement(77538..78542)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0055"
FT                   /product="conserved hypothetical protein"
FT                   /function="Predicted transcriptional regulator"
FT                   /note="conserved hypothetical protein (NP_940396.1|
FT                   Hypothetical protein DIP2072 [Corynebacterium
FT                   diphtheriae];; NP_954792.1| hypothetical protein [Gordonia
FT                   westfalica])."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0055"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00070"
FT                   /db_xref="InterPro:IPR025159"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLZ0"
FT                   /protein_id="CAN00070.1"
FT                   /translation="MKSLDALPLLAELTAGQWGMVTTAQAEAVGVSRLQLSRLAQRGLL
FT                   ERMAHGVYRDAGSAPGEWDPIRAAWISTDSRRTAEERITSGDPRAVVGGSTAAHLHGYG
FT                   DLQPEPYDFITSKRRQSQRSDVRYRQDQLDPHDVTIVAGLPTTAIERTIADLVLEDQDL
FT                   SLVADVLADAVRAESIDLDRLADLLEPAARRPGRPADDGAGFLRQLLELGGVDAASRLQ
FT                   RALEGASRGNTTAFNAIQVRIGEEIAKSLSRSILETSGALPDISRIASAAIGRIGVPEI
FT                   VSESVARALRPQTGYISEMLLNEIRGIPARTQRTSDRSKQSRARESATKESGA"
FT   CDS_pept        complement(79094..79756)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00071"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLZ1"
FT                   /protein_id="CAN00071.1"
FT                   /translation="MSAPPRVLRALGQRRDAAHCRTAARPPVGGRSCARRRARPDADNV
FT                   PPLTTYPKMVHPSVALRTLADERGRALPPDRIDGEEHPVSRVKSKLDGINSLVRSTGQH
FT                   PWAHLQAGYWRIQVEDRPVPGYVIRHRAELGDPFTFDVYADARNDQGQRIWIRREHSLN
FT                   TAVAWMVQHSAELIAFAARSRSRSGSRGPAETTAAEHASADVDQARQLGHVERGQFG"
FT   CDS_pept        complement(80653..80916)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00072"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLZ2"
FT                   /protein_id="CAN00072.1"
FT                   /translation="MTSTIAPTFVQIDARKRASLGSMAKFDQYLVREEPNGTIIFEPAI
FT                   IMTPAEREFMNDPELVAALARVNANPERRRTRERRGARSTAV"
FT   CDS_pept        82453..82716
FT                   /transl_table=11
FT                   /locus_tag="CMM_0058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00073"
FT                   /db_xref="InterPro:IPR024997"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLZ3"
FT                   /protein_id="CAN00073.1"
FT                   /translation="MADRAVRQTGKDRDGDITSLADRGSSWSPVSKAQAIYDIENRLHT
FT                   YHVPWKTAGRTEIRVVPDPKGKYLRTDSDNTTRNNLRDLPDA"
FT   CDS_pept        82939..83772
FT                   /transl_table=11
FT                   /gene="chpG"
FT                   /locus_tag="CMM_0059"
FT                   /product="putative extracellular serine protease"
FT                   /function="putative serine protease"
FT                   /note="putative extracellular serine protease (AAD09893.2|
FT                   unknown [Clavibacter michiganensis subsp. michiganensis];;
FT                   BAA06163.1| SAM-P20 serine protease precursor [Streptomyces
FT                   albogriseolus]). pfam00089, Trypsin,Trypsin."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0059"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00074"
FT                   /db_xref="GOA:A5CLZ4"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLZ4"
FT                   /protein_id="CAN00074.1"
FT                   /translation="MPARHHTIQRKRSIGAALLALPATLVLTCMAGTPAYANGLSNPDR
FT                   GNFPIIAGSEVGVPNGYCSVGAVLVPSSIFQRITPYQRAVRYLVLAKHCAPLNSPIYFA
FT                   QQDIGDVVWQSAASDIELVRVSPSRDNMTLHCAGHSTPATCSPIQTFTPRANGQVFMTA
FT                   PPSPIVGRRAIAGTGIPSATGTFCTSGHVTGVICDFQPTSLPVGVLRAYEHLAAGQSAA
FT                   VGALRPGDSGGPVVSKDRRLLGIISGDVPNTHFLVYTPMAQVLHELSSYKLAPAN"
FT   CDS_pept        85126..85584
FT                   /transl_table=11
FT                   /locus_tag="CMM_0060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00075"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLZ5"
FT                   /protein_id="CAN00075.1"
FT                   /translation="MIRLAELAPPAPRSSAGVLHTAVGAARDAAELVDAGEPATAGWRF
FT                   GVLQALDDYTSTCLRGGTELGAQVFTEPPAPTGSVELDAAFAALADYLAERDGWAAPLW
FT                   IHDAWRTVKPGQWWASTPNIYRQIALEEGPRTFRDRGIWITLSGLARA"
FT   CDS_pept        85938..86894
FT                   /transl_table=11
FT                   /locus_tag="CMM_0061"
FT                   /product="putative cell filamentation protein"
FT                   /function="Protein involved in cell division"
FT                   /note="putative cell filamentation protein (ZP_00038266.1|
FT                   COG2184: Protein involved in cell division [Xylella
FT                   fastidiosa Dixon];; NP_990877.1| unknown [Achromobacter
FT                   denitrificans]). pfam02661, Fic, Fic protein family. This
FT                   family consists of the Fic (filamentation induced by cAMP)
FT                   protein and its relatives."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00076"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLZ6"
FT                   /protein_id="CAN00076.1"
FT                   /translation="MTVDDKYTYPGSGGVLINAAGIRDHAELDEAMNDVASFVLAKIYT
FT                   EPVPARLDLEYLRGIHVRMFGDLLPEIAGRIRDVDVQATGTGIPYCRPDFIEANLDTLF
FT                   RKLEREDYLTGLDADTFTERLAARWGELSAIHPWRDGNTRSQSMYVAALAQRAGHPIDW
FT                   KRIDVDELRHHRLQAIAGTDRPLADYLRAHLIDTAPTRGPEAAAPLSAARSAGREQGGV
FT                   ARRRRGTGLQPPRARRARDAPHGGDRPGRAQCAAPRLVVDEREIARASARSRGRRARAL
FT                   GRAPRRRRVADARGWRGGAAVLRSGWVCRHAGTPTKG"
FT   CDS_pept        87336..88883
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="parB2"
FT                   /locus_tag="CMM_PS_09"
FT                   /function="Predicted transcriptional regulators"
FT                   /note="putative partitioning protein,"
FT                   /note="Hypothetical protein"
FT   CDS_pept        complement(88997..89862)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="chpB"
FT                   /locus_tag="CMM_PS_10"
FT                   /function="Serine protease"
FT                   /note="putative extracellular serine protease"
FT                   /note="Hypothetical protein"
FT   CDS_pept        91403..91792
FT                   /transl_table=11
FT                   /locus_tag="CMM_0062"
FT                   /function="hypothetical protein, putative single-strand
FT                   binding protein"
FT                   /note="hypothetical protein, putative single-strand binding
FT                   protein (NP_052579.1| single-strand binding protein homolog
FT                   Ssb [Corynebacterium glutamicum];; NP_817551.1| gp102
FT                   [Mycobacteriophage CJW1];; SSB2_STRCO Single-strand binding
FT                   protein 2 (SSB 2) (Helix-destabilizing protein 2)).
FT                   pfam00436, SSB, Single-strand binding protein family. This
FT                   family includes single stranded binding proteins and also
FT                   the primosomal replication protein N (PriB). PriB forms a
FT                   complex with PriA, PriC and ssDNA."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00079"
FT                   /db_xref="GOA:A5CLZ7"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLZ7"
FT                   /protein_id="CAN00079.1"
FT                   /translation="MSHISRTGNLAGTPVLRQGPKGPYTYAAVIVNDRFQDENGTWVQG
FT                   PPIRYELAVSGTQAVALVATAKACGNIRVTFSGAYTVREFQGDKGTILQHKVFVDEIGA
FT                   SFFGQDVTIARRTASTSTTTTAGEE"
FT   CDS_pept        92168..92875
FT                   /transl_table=11
FT                   /locus_tag="CMM_0063"
FT                   /product="conserved hypothetical protein"
FT                   /note="conserved hypothetical protein (NP_739263.1|
FT                   conserved hypothetical protein [Corynebacterium efficiens
FT                   YS-314];; ZP_00226454.1| hypothetical protein Krad06003337
FT                   [Kineococcus radiotolerans SRS30216])."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00080"
FT                   /db_xref="GOA:A5CLZ8"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLZ8"
FT                   /protein_id="CAN00080.1"
FT                   /translation="MLLSIGGLAGGRYGSGLGNLQEPADSATAGPRTAASGPVVDALTA
FT                   AGLVRGGAVDAPSVRSLVDAHTRTPNYDRAAYGPSWADTEYNGCDQRNDVLARDLTAIT
FT                   YTMADPGCTVATGHLADVYTGRSIDLTRGKATRAAVQIDHLVPLGWACQHGAAAWTGDR
FT                   REQLATDFNNLQAIDGPTNEAKSDHGPATWLPPAAGYDCMYVTRFAFVLHASALTTDDA
FT                   HRAAIDHTPKTCN"
FT   CDS_pept        complement(92944..93639)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0064"
FT                   /product="putative hydrolase"
FT                   /function="Predicted hydrolase (HAD superfamily)"
FT                   /note="putative hydrolase (Q8TWR2|Y970_METKA Putative
FT                   HAD-hydrolase MK0970;; ZP_00310287.1| COG1011: Predicted
FT                   hydrolase (HAD superfamily) [Cytophaga hutchinsonii]).
FT                   pfam00702, Hydrolase, haloacid dehalogenase-like
FT                   hydrolase."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00081"
FT                   /db_xref="GOA:A5CLZ9"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLZ9"
FT                   /protein_id="CAN00081.1"
FT                   /translation="MRKHLASASTIVFDLAGTLTPSVPAFAKSTAWGAYASVVRPADVE
FT                   ASVLALEAAEDSARVACVERGSSWSFRRVLADSGMPYRLEAVEAFIDTWRPGLRVPADI
FT                   SSRLRIIHDAGYRVGLVSNTIWPADWHGRLLEADGARASFDLTVYSSSTPWAKPNQRIF
FT                   AYALRELGCDRASDALFVGDRTFEDLDGAHLSGMKAVLVGNEPEGARSESEQRWDIRAL
FT                   LDGLITRSI"
FT   CDS_pept        complement(93727..94533)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0065"
FT                   /product="conserved hypothetical protein, putative
FT                   phosphotransferase"
FT                   /note="conserved hypothetical protein, putative
FT                   phosphotransferase (NP_977552.1| trifolitoxin immunity
FT                   domain protein [Bacillus cereus ATCC 10987];;
FT                   ZP_00200969.1| COG3173: Predicted aminoglycoside
FT                   phosphotransferase [Exiguobacterium sp. 255-15])."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00082"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM00"
FT                   /protein_id="CAN00082.1"
FT                   /translation="MQVLALQTRGVNTVSATEPLSGGNSAPVIYRQGNVVYKSSHESTP
FT                   AVGRLLRYLEQRAPGLTPRFSGVGDDGLQRLEYIPGHLLADQGRLSDTALRDAGAAIRE
FT                   LHDALESYKPNAMDRFYPSFPTEAGSILCHNDLSPWNFILRPDGSMCIIDWDGVGWGAR
FT                   EWDLGYAIKTFVGLEPGTGVANNGTRMCIFLDGYRWSGSPDLILSNVLLRTESMRDLLE
FT                   TGKRNNTPPWSRLYDEGHWGYWSDCYDYIASNMEHWRAPLFRRGIE"
FT   CDS_pept        94677..95309
FT                   /transl_table=11
FT                   /gene="parX"
FT                   /locus_tag="CMM_0066"
FT                   /product="partitioning protein"
FT                   /function="ATPases involved in chromosome partitioning"
FT                   /note="partitioning protein (ZP_00174639.2| COG1192:
FT                   ATPases involved in chromosome partitioning [Crocosphaera
FT                   watsonii WH 8501];; NP_940697.1| stability protein
FT                   [Pseudomonas syringae pv. syringae]). , pfam00991,
FT                   ParA,ParA family ATPase."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00083"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM01"
FT                   /protein_id="CAN00083.1"
FT                   /translation="MILLVGSQKGGAGKSTIATNLAAEYARQGSDVVLVDADVQRSSAR
FT                   WHADREAAGLTPAIACIEKLGNISGTLNDLDSRYGVVIVDVAGKDSKEMRTGMVVAHKM
FT                   IVTVRPSQFDLDTLPHMSELVEQARDLNPGLDVRSLLTQVPTNPGVTERADSEDYLSDY
FT                   PELRPLQTVVFERKAYRDVIGEGRGVVEWSNPKARAEIQELAAEVTA"
FT   CDS_pept        96096..97265
FT                   /transl_table=11
FT                   /locus_tag="CMM_0067"
FT                   /product="putative ATPase"
FT                   /note="putative ATPase (NP_695848.1| hypothetical protein
FT                   BL0662 [Bifidobacterium longum NCC2705];; NP_940101.1|
FT                   Conserved hypothetical protein [Corynebacterium diphtheriae
FT                   NCTC 13129]). pfam01637, Arch_ATPase, Archaeal ATPase. This
FT                   family contain a conserved P-loop motif that is involved in
FT                   binding ATP."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00084"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM02"
FT                   /protein_id="CAN00084.1"
FT                   /translation="MDGTTNPYAPGAGARPPALVGRDAELEAWRVSVARAAAGRAPRSL
FT                   VLYGLRGVGKTVLLSQMSAEAEASGWIVAQVEAAAGTSMRGALSSTLQSHVARIARRNR
FT                   KRPFLRALKTALSFSARVDTDGTTTFGLTLDDIEAELADSGNIELDLTTVVDGILDAVH
FT                   DEGLGLAILIDEAQDLTADELVAICTVAHRASQRQRPVLFVLAGLPSLPTRLAEAKSYS
FT                   ERLFQYRHIRELESDAAADALTVPAADEGVTWTDDAIDLVVTLTGGYPYFLQEYGSEAW
FT                   LEAASSPISRDDAQNGAGLALRHLDDGFYRTRWDRATPLEKEYLRAMAADGDTGSKTAD
FT                   VARRLDRTTQRLSKIRQNLTDKGIIYAPEHGRIAFTVPWMAAFIERQPA"
FT   CDS_pept        97383..97616
FT                   /transl_table=11
FT                   /locus_tag="CMM_0068"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0068"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00085"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM03"
FT                   /protein_id="CAN00085.1"
FT                   /translation="MSPTAGMTLWLDGRQVAANTSFRAAENTTGWWRIGYDNLDTWPAA
FT                   GNRYFTGSMRYAAVYSTTLTATQIQNHYNAGR"
FT   CDS_pept        complement(97673..98977)
FT                   /transl_table=11
FT                   /gene="nhaA1"
FT                   /locus_tag="CMM_0069"
FT                   /product="Na+/H+ antiporter, NhaA family"
FT                   /function="Na+/H+ antiporter"
FT                   /note="Na(+)/H(+) antiporter, NhaA family (ZP_00228734.1|
FT                   COG3004: Na+/H+ antiporter [Kineococcus radiotolerans
FT                   SRS30216];; ZP_00058667.1| COG3004: Na+/H+ antiporter
FT                   [Thermobifida fusca]). pfam06965, Na_H_antiport_1, Na+/H+
FT                   antiporter 1. This family contains a number of bacterial
FT                   Na+/H+ antiporter 1 proteins. These are integral membrane
FT                   proteins that catalyse the exchange of H+ for Na+ in a
FT                   manner that is highly dependent on the pH."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00086"
FT                   /db_xref="GOA:A5CM04"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5CM04"
FT                   /protein_id="CAN00086.1"
FT                   /translation="MISPNPALPTPPHAPTAPGRGARLSRFLSRDTTGGILLLIATVLA
FT                   LVIANSPAADLYERVRGFTFGPEALHLDLSVSAWAADGLLAIFFFVVGLELKQEFVAGS
FT                   LRDPRVAALPIAAAAGRVIVPAGIFTLINLGAGPEALRGWAIPAATDIAFAVAVVAVVG
FT                   RRLPPVLRTFLLTLAVVDDLLAITIIAVFYTAGIAFVPLLLASVPLAVFGILVQRGVRA
FT                   WYVLIPLGVAAWALVHASGIHATIAGVALGLLVPAIATARAGVTHRGTAGREERHALTH
FT                   FFAERWSPISSGIAVPVFAFFSAGVTVGGLEGLTSSLTDSVAVGIIVALVIGKAAGITG
FT                   ASLLVARLPGIRLDPTLRWPDVLGLSFVAGIGFTVSLLVGELAYGTGSAQDDAVKVGVL
FT                   IGLLTSAVIGGTLLALRGRWHAAASLHEPVPAAVR"
FT   CDS_pept        complement(99640..102741)
FT                   /transl_table=11
FT                   /gene="sbtA"
FT                   /locus_tag="CMM_0070"
FT                   /product="subtilisin-like serine protease, peptidase family
FT                   S8A"
FT                   /function="Subtilisin-like serine proteases"
FT                   /EC_number="3.4.21.-"
FT                   /note="subtilisin-like serine protease, peptidase family
FT                   S8A (CAA07000.1| subtilisin-like protease [Lycopersicon
FT                   esculentum];; NP_717522.1| serine protease, subtilase
FT                   family [Shewanella oneidensis MR-1]). ,
FT                   pfam05922,Subtilisin_N, Subtilisin N-terminal Region. This
FT                   family is found at the N-terminus of a number of
FT                   subtilisins. It is cleaved prior to activation of the
FT                   enzyme. , pfam02225,PA, PA domain. The PA (Protease
FT                   associated) domain is found as an insert domain in diverse
FT                   proteases.,pfam00082, Peptidase_S8, Subtilase family."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0070"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00087"
FT                   /db_xref="GOA:A5CM05"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR010259"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="InterPro:IPR037045"
FT                   /db_xref="InterPro:IPR041469"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM05"
FT                   /protein_id="CAN00087.1"
FT                   /translation="MPSHRHPLPPGRRARLRSARPLAACALAVALVVAGGSAAGAAVLP
FT                   QAAVSLDAADGHYLITLKDQPAATYDGTLDGLARTEVDPGARLDARSDAVERYTDHLAR
FT                   AQRSVADAIGVTPTHQYSLTTNGFSASLTAAQVRALAHDGDVLSVEPDQTLHPQSTPAI
FT                   RSLGLEGDHGLWAAAGGAEHAGAGTVIGDIDSGIAPDNPSFAGKPLGSAPGAEPYRDGT
FT                   GIAFRKADGSVFHGTCETGDGFTAADCSTKVIGARSFVSGRDASGVPLGPQERRSARDT
FT                   NGHGSHTASTAAGDADVPAVIHGRTLDTIAGVAPAARIAAYKVCWDGPDPTVETDDGCA
FT                   ASDIIAAIDQATADGVDVINMSLGGDGPSPDEEQRALLGAASAGIFVAASAGNSGPDAS
FT                   TVSNLEPWVTTVAASSVPDNYAATLTLGDGRRFAGASHMGPSPVSGPLVRAAASGVAGA
FT                   TSPELCGKGTLDPAKVTGRIVQCDRGVSARVDKSAEVTRAGGIGMVLTNVKADSEDLNS
FT                   HAVPTVHVDVDARPAIVAYAAKAGATATLTAGDTSGVERPAPQVTGFSSRGPDPADGAD
FT                   IIKPDITAPGSGIPAAYKDVDGRPGFAALSGTSMSSPHIAGFALVYLGIHPTASPSEIK
FT                   SAMMTTATDTVDAQGKAVTDPFAQGAGEIASARYLHPGLVYASGPRDWAGYAAQTGLEL
FT                   PHPVAAVPVSQLNLPSIAVGSLLGGTTLTRTVTSQAAGTWRASVQGVAGADVTVSPARL
FT                   TFTAPGQTRTFHVRIQAKVGASTGAWTTGSLTWTGPGGTVRSPVAVRPQELGVPSSVSG
FT                   SGTSGKLDVAVDSGVTGRIALEASGLAPAQRLHDPSGTQSGPTGSLAPNREYAMQINVP
FT                   ANEKALVVDVAPRDGASDLALELERIGDGGKRTVIDVKITPSPSERIVVQAPEAGEYVA
FT                   TVAAESVAGSAAMTGFDLTRYDVVASGGQGAFATTPVQLPVQRGKKATYEASWSGLAVG
FT                   SRYLGLLSYSGSDATTLFDITVPADSTAPSASAPLAATSYRIRR"
FT   CDS_pept        complement(103059..103187)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="CMM_PS_25"
FT                   /note="isocitrate dehydrogenase"
FT                   /note="Hypothetical protein"
FT   CDS_pept        complement(103428..104384)
FT                   /transl_table=11
FT                   /gene="ppaE"
FT                   /locus_tag="CMM_0071"
FT                   /function="putative serine protease"
FT                   /note="putative serine protease (NP_693914.1| hypothetical
FT                   protein OB2992 [Oceanobacillus iheyensis HTE831];;
FT                   ZP_00293497.1| COG3591: V8-like Glu-specific endopeptidase
FT                   [Thermobifida fusca];; NP_297821.1| hypothetical protein
FT                   XF0531 [Xylella fastidiosa 9a5c]). pfam00089,
FT                   Trypsin,Trypsin."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00089"
FT                   /db_xref="GOA:A5CM06"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM06"
FT                   /protein_id="CAN00089.1"
FT                   /translation="MKLHLLSVTKRARPRSAHRLANAAVGVGGAMIIALSTGAGAVYAS
FT                   ENEGQSHIATATDSSEASTTYWTTARQAQAIASSSPEADMTPELSTSAVQTSARTHAHA
FT                   VLPYVGELFFVQGGKNRACTATVINTPDGDTIATAASCLIDRGAKTVHRLATFVPSTDH
FT                   AAAPQGIWPIRVAEATPQWNATGATSADVAFAKVAGPTGTHLKDAAGSVPAVFDTITPP
FT                   ATELLRVFAYPQEKPYSGQKLVGCGAIAHRLAAPSAAREIGCDINDGAMGGPALSPAGE
FT                   LRSVIAQSSDQRVGKRGLVLAAWGTDAATTLADLSKR"
FT   CDS_pept        complement(104495..105838)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="CMM_PS_11"
FT                   /note="putative pyridine nucleotide-disulphide
FT                   oxireductase, COG0446: Uncharacterized NAD(FAD)-d"
FT                   /note="Hypothetical protein"
FT   CDS_pept        complement(106123..106863)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0072"
FT                   /product="conserved hypothetical protein"
FT                   /function="putative Zn-dependent hydrolase"
FT                   /note="conserved hypothetical protein (NP_631356.1|
FT                   conserved hypothetical protein SC5F8.11c. [Streptomyces
FT                   coelicolor A3(2)];; AAD31327.1| beta-lactamase-like protein
FT                   [Mycobacterium smegmatis]). pfam00753,Lactamase_B,
FT                   Metallo-beta-lactamase superfamily."
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00091"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM07"
FT                   /protein_id="CAN00091.1"
FT                   /translation="MSRNKGDAYTITAVEADVFVVRGSHVNWSILTEGSGMTLIDAGYP
FT                   GNSAAVLDSLEEVSAKTGAHRLEAIVITHGHSDHIGGLTAVLDALPNTPRVLCSLLEAS
FT                   HVRREHLQQVTLRQVLRHAGQPGVLTWLLAAIQQGGLKEVGYSDVQAFAGDASLDIPGR
FT                   PSPVDAPGHTEGHTAYYLERAGVLVTGDALITAHATSRDVGPQLLHPMFHGDVQATRET
FT                   YDRLVNWPYAVRFAPGHGPVVSSR"
FT   CDS_pept        107334..108860
FT                   /transl_table=11
FT                   /locus_tag="CMM_0073"
FT                   /product="putative acyl-CoA synthetase (AMP-forming)"
FT                   /function="Acyl-CoA synthetases (AMP-forming)"
FT                   /note="putative acyl-CoA synthetase
FT                   (AMP-forming)(ZP_00294061.1| COG0318: Acyl-CoA synthetases
FT                   (AMP-forming)/AMP-acid ligases II [Thermobifida fusca];;
FT                   NP_822779.1| putative acyl-CoA synthetase, long-chain fatty
FT                   acid:CoA ligase [Streptomyces avermitilis MA-4680]).
FT                   pfam00501, AMP-binding, AMP-binding enzyme."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00092"
FT                   /db_xref="GOA:A5CM08"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM08"
FT                   /protein_id="CAN00092.1"
FT                   /translation="MSVVSILAESAIRYPNTIAIVTGNERTTYKELWNQTRATAGALAA
FT                   YGVSPGIPVAMLIPNVSDFPRVYYAVLALGGVVVPINPLLKSEEIAFVLRDSGAQLLVC
FT                   AAAFLEQAVPAARQASCTVVSLHSSVDMPESPARLEDELSKSNPINSYVPTLPGEAATI
FT                   LYTSGTSGRPKGAVGSHQALIMQVDVLLLNTLDMRHGDRILGCLPLSHTFGQTCTMNLA
FT                   FRIGATVILMPRFDGDEALKLMVEYETQLFMGVPSMFVALLGAAKRNVARPPLRYAMSG
FT                   GAAIPVAIIEAFRVEFAAHIHEGYGLTETSPVATFNHVGISPRPGTVGQAIWGVQVEVA
FT                   DPTRLDTVCLLQVGELGELVVRGHNIMMGYLNRPDETARVIVDGWFRTGDLGVIDDDGY
FT                   VRVVDRTSDMIIRNGYNVYPREVEEVLARHPSVQQCAVFGVPHESHGEEIVAAVVLRPE
FT                   MTMNPKAVRDFMYRQLAAYKVPRRIEIVESLPLGPSGKVLRRQLVAAFST"
FT   CDS_pept        112168..112389
FT                   /transl_table=11
FT                   /locus_tag="CMM_0074"
FT                   /product="conserved hypothetical protein"
FT                   /note="conserved hypothetical protein (NP_687579.1|
FT                   conserved hypothetical protein [Streptococcus agalactiae
FT                   2603V/R];; ZP_00224261.1| hypothetical protein
FT                   Bucepa02001221 [Burkholderia cepacia R1808])."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00093"
FT                   /db_xref="InterPro:IPR018691"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM09"
FT                   /protein_id="CAN00093.1"
FT                   /translation="MARKRYDVVYKLSVWTVTHAGSTVSTHSTKQYAIDAGVALARANQ
FT                   PSQLIIHQSDGTIEDERTYGNDPFPPRG"
FT   CDS_pept        complement(113031..114005)
FT                   /transl_table=11
FT                   /gene="ppaD"
FT                   /locus_tag="CMM_0075"
FT                   /product="putative extracellular serine protease"
FT                   /function="Serine protease"
FT                   /note="putative extracellular serine protease (NP_779169.1|
FT                   conserved hypothetical protein [Xylella fastidiosa
FT                   Temecula1];; YP_061793.1| secreted protein [Leifsonia xyli
FT                   subsp. xyli str. CTCB07];; ZP_00293497.1| COG3591: V8-like
FT                   Glu-specific endopeptidase [Thermobifida fusca])."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0075"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00094"
FT                   /db_xref="GOA:A5CM10"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM10"
FT                   /protein_id="CAN00094.1"
FT                   /translation="MTALWKNRFSVLALLLLVVMVGQSSVARPAQAAGPTGTAFSDDTG
FT                   QSFSDAEASDAVRSWTPEALAAASDLDRPSDAVNAPVTGATEQALITQGAGTFEPVYWI
FT                   GRIYFDVDGRQYSCSGSSIRSDSQLVVATAAHCLYDHGEWSTRVVFIPAWDGANKPLGV
FT                   WGAFFYAVSRDWRTTEDPGHDAAFIKMAPKTAWDGSKEYLASKAGAPAPTFSAAMPGLH
FT                   FEAFGYRPLGGYVPAPLYTCAGEGRHFRGFASIPEYEIANCDPPGGASGGPVYHASTHG
FT                   PNGTQYGVITETRRARDGSPLLIFVPWGQVEYSLYRSVDLWPK"
FT   CDS_pept        114879..115307
FT                   /transl_table=11
FT                   /locus_tag="CMM_0076"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein (CAD47974.1| hypothetical
FT                   protein [Arthrobacter nicotinovorans])."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0076"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00095"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM11"
FT                   /protein_id="CAN00095.1"
FT                   /translation="MSTAKLYCSYLLCYHGNHPQSSYIRFADGVYDEGFEAVQIYCPHF
FT                   QAGIEYASRVIPEDSGLAVGDAASPLDASPRVIAAGTYKTVDAPSDCYYEINNQLGSII
FT                   TNNFKNSAPGGLTVTLRSGQSSDSQGCGMCIPQCSVLV"
FT   CDS_pept        complement(116970..117137)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0077"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein (NP_600530.1| hypothetical
FT                   protein NCgl1256 [Corynebacterium glutamicum ATCC 13032];;
FT                   XP_322451.1| predicted protein [Neurospora crassa])"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0077"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00096"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM12"
FT                   /protein_id="CAN00096.1"
FT                   /translation="MCRRVTCRVCGKEDWAGCGQHVEQVMRGLAQSDRCQGHPKGESGG
FT                   GLLAKLFRRG"
FT   CDS_pept        117213..118871
FT                   /transl_table=11
FT                   /locus_tag="CMM_0078"
FT                   /product="putative NADH oxidase"
FT                   /function="Uncharacterized NAD(FAD)-dependent
FT                   dehydrogenases"
FT                   /EC_number="1.6.-.-"
FT                   /note="putative NADH oxidase (NP_736949.1| putative
FT                   pyridine nucleotide-disulphide oxidoreductase
FT                   [Corynebacterium efficiens YS-314];; NP_654717.1|
FT                   pyr_redox, Pyridine nucleotide-disulphide oxidoreductase
FT                   [Bacillus anthracis A2012]). InterPro: FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase.
FT                   pfam00070,Pyr_redox, Pyridine nucleotide-disulphide
FT                   oxidoreductase. This family includes both class I and class
FT                   II oxidoreductases and also NADH oxidases and peroxidases.
FT                   pfam02852, Pyr_redox_dim, Pyridine nucleotide-disulphide
FT                   oxidoreductase, dimerisation domain. pfam00581,
FT                   Rhodanese,Rhodanese-like domain."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00097"
FT                   /db_xref="GOA:A5CM13"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM13"
FT                   /protein_id="CAN00097.1"
FT                   /translation="MRTVIIGGVAGGMSAATRLRRLDEEREILVFERGAYVSFANCGLP
FT                   YYVGGVIPERASLLLQTPESLAARFRLDVRVRHEVVGIDAGAKTVAVRDLDAGTVDTVV
FT                   YDDLVIAAGAGAAPGGTDGGVPSSTLRTVEDVDRIMALLNVTTDAHAVVVGAGFIGLEG
FT                   VENLLARGVHVTLVQRGQQVLSPLDPEMATPVREALEAAGVDVRTGTTVTGATSGYVHL
FT                   DDGTRVRADLVIRAPGVRPETGLARAAGLRIGASGGIAVDGRQRTSDPSIRAVGDGVEK
FT                   IDHIDGTPTLVTMAGLANRHGRAAADDIAGAAKTDAAPALGTAILGLLGLTIGLVGRNE
FT                   KRLAAEGRPHRIIHTHSASHAGYYPGAQHMAIKLLVDPDDDRILGAQIVGRDGVDKRLD
FT                   VIAVAMSAGLTASALTRLELAYAPQYGSAKDPVNLLGYVAENAATGTTRSIQWHELEDS
FT                   LAAGATLVDVRTASEHATAAIPGAVSLPLDELRARHHELPAGPLVVHCQVGQRGHTAAR
FT                   LLAQLGHDVRNLDGGLLTWRAGTASTTRTTTGTAA"
FT   CDS_pept        118888..119187
FT                   /transl_table=11
FT                   /locus_tag="CMM_0079"
FT                   /product="Conserved hypothetical protein"
FT                   /function="Rhodanese-related sulfurtransferase"
FT                   /note="conserved hypothetical protein (NP_601905.1|
FT                   rhodanese-related sulfurtransferase [Corynebacterium
FT                   glutamicum ATCC 13032];; ZP_00058946.1| COG0607:
FT                   Rhodanese-related sulfurtransferase [Thermobifida fusca]).
FT                   pfam00581, Rhodanese, Rhodanese-like domain."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0079"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00098"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM14"
FT                   /protein_id="CAN00098.1"
FT                   /translation="MTSITVQQLAASAGATIIDVREPDEYAAGHARSAVNVPLSELGER
FT                   IDGIPADRPVHFICQSGGRSARATEALTACGIDAIEVTGGTTAWIDADLTTDRA"
FT   CDS_pept        119184..119501
FT                   /transl_table=11
FT                   /locus_tag="CMM_0080"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /note="conserved hypothetical protein (NP_736667.1|
FT                   conserved hypothetical protein [Corynebacterium efficiens
FT                   YS-314];; NP_898741.1| conserved hypothetical protein
FT                   [Rhodococcus erythropolis]). pfam02583,
FT                   DUF156,Uncharacterised BCR, COG1937."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00099"
FT                   /db_xref="GOA:A5CM15"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM15"
FT                   /protein_id="CAN00099.1"
FT                   /translation="MNATSGQLHDAVAVRKVANRLKRAQGQLSAVIAAVENGGDCRDVV
FT                   TQLAAVSSALDRAGFLIVSTAMQQCLVADNVTDLDATKNGEASPRKLTMEEIERLFLTL
FT                   A"
FT   CDS_pept        complement(119736..120527)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0081"
FT                   /product="putative short-chain dehydrogenase/reductase"
FT                   /function="Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /note="putative oxidoreductase(ZP_00229014.1| COG1028:
FT                   Dehydrogenases with different specificities (related to
FT                   short-chain alcohol dehydrogenases) [Kineococcus
FT                   radiotolerans SRS30216];; YP_004276.1| short chain
FT                   dehydrogenase [Thermus thermophilus HB27]). InterPro:
FT                   Short-chain dehydrogenase/reductase (SDR) superfamily
FT                   pfam00106, adh_short, short chain dehydrogenase. This
FT                   family contains a wide variety of dehydrogenases."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0081"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00100"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM16"
FT                   /protein_id="CAN00100.1"
FT                   /translation="MQIHDKVFVVTGGGNGMGRQVALEIMRRGGHVAAVDLNENGLADT
FT                   LQLAQSSTGRLTVHTANVTDRNAIAVLRDEVLMQHPHVDGVINIAGIIHSFAPFEELPI
FT                   DVTQRVMDVNFWGTVNVCRAFLPILRSRPSAALVNMSSLSALIPFASQTFYGASKGAVK
FT                   QFSEGLYAEALGTGLTVSTIFPGNISTNLTGNSGVAMIDAKGKKVKATTPEDAGRAIVD
FT                   GIERSKFRILVGSDARLLDRLVRLAPRWATGMIARQMASVL"
FT   CDS_pept        complement(120538..122925)
FT                   /transl_table=11
FT                   /gene="bglB"
FT                   /locus_tag="CMM_0082"
FT                   /product="putative beta-glucosidase"
FT                   /function="Beta-glucosidase-related glycosidases"
FT                   /EC_number="3.2.1.-"
FT                   /note="putative beta-glycosidase (ZP_00229019.1| COG1472:
FT                   Beta-glucosidase-related glycosidases [Kineococcus
FT                   radiotolerans SRS30216];; AAF43783.1|
FT                   xylosidase/arabinosidase [Thermoanaerobacter ethanolicus]).
FT                   pfam00933, Glyco_hydro_3, Glycosyl hydrolase family 3 N
FT                   terminal domain. pfam01915,Glyco_hydro_3_C, Glycosyl
FT                   hydrolase family 3 C terminal domain."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00101"
FT                   /db_xref="GOA:A5CM17"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM17"
FT                   /protein_id="CAN00101.1"
FT                   /translation="MTSPADTTEDHFLQHAPYRDASRPVVERIADLLGRMTAAEKAAQL
FT                   VSPFGAMVDTRTPPDTGWGIVTAGLCSMRMPPRETARLANELQRVHVEKTRLGIPVLFA
FT                   EEALVGFKVRDATMFPEAIAQASTWNPDLVERMSATIGAQMVSVGARQALSPLADVAQD
FT                   PRWGRVSETYGEDPYLVGQIASAFVRGIQGAVPDRPVIATLKHFVGYGASDGGRNTETA
FT                   NIGERELREVYGRPFEVAVREGGARAVMPSYNDLDGSPVSGSHDLLTGLLRDEYDFTGL
FT                   VISDLEAVPQLHTKHGTAENVVAAYAQAFTAGMDVDLANSNSADKILRALEEGLLHDAT
FT                   LDRAVTKVLSAKFELGLFENPYVDVEAVPQTLDSEEARELAMTVASESIVLLQNQAVNG
FT                   TPLLPLPADLSSIAVIGPNADRPLGQLGHYSYHVLDSMTVQFAAANDPQSRAADTEGLA
FT                   GAGPDDAKLLVESVPIVTFLDGIRSRAGADVDVLYASGSRIASHDRSGFDDAVRAARAA
FT                   EVAIVVVGDQSGINSLGTVGEGLDSSDLALPGVQRELVEAVVATGTPTVVVLSHGRPFA
FT                   VDWMAESVPAIVTTWFGGEEAGNATAAMLFGDSNPAGRLPIAMLGSSGAAPVTYGRSLQ
FT                   GPAYVDGSIRALFPFGHGLSYTAFDYSGLTLDSPTVPTDGTIRLAFTVRNTGQRAGEEV
FT                   IQVYGHDVHARTVRPPRVLLAFDRVPLAAGEARRLSVRIPTAMLALWDKREGWLIEPGR
FT                   VELFIGGSSADIRLTAETLLIGDSHNVEPSERTRPSRVTSDR"
FT   CDS_pept        complement(123070..124908)
FT                   /transl_table=11
FT                   /gene="bglC"
FT                   /locus_tag="CMM_0083"
FT                   /product="putative beta-glucosidase/beta-xylosidase"
FT                   /function="Beta-glucosidase-related glycosidases"
FT                   /EC_number="3.2.1.-"
FT                   /note="putative beta-glucosidase/beta-xylosidase
FT                   (ZP_00214214.1| COG1472: Beta-glucosidase-related
FT                   glycosidases [Burkholderia cepacia R18194];; S53805
FT                   beta-glucosidase/xylosidase - Erwinia chrysanthemi).
FT                   pfam00933,Glyco_hydro_3, Glycosyl hydrolase family 3 N
FT                   terminal domain."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00102"
FT                   /db_xref="GOA:A5CM18"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM18"
FT                   /protein_id="CAN00102.1"
FT                   /translation="MTTTSARTTAASRHFDGNDRMEPYEDPELSAQERTDDLLQRLSLE
FT                   EKIGLLFHTVIEIGPDGDLLEEPGAISKSPTTEVVRERFINHFNVHRINSAREAARWNN
FT                   SLQRLAAQTPHGIPVTISTDPRHAFVDNVGASFTAGPFSQWPDTLGMAALRDSATVREF
FT                   AEIARDEYRAVGISMALHPQVDLASEPRWTRQLQSFGADPDLAVDYTTAYLEGFQGPAL
FT                   DATSVACVTKHFPGAGPQKDGEDAHFPYGREQVYPADAFGVHLRPFEAALRNGTAAIMP
FT                   YYGMPVGLEIDGEPIEEVGFGYNKQILTGLLREKLGFEGVILTDWELVNDNIVGDRVLP
FT                   ARAWGVEHLDARQRMVKIIEAGADQFGGEQCTDLLLDLVHDGSISEARIDESARRLLLV
FT                   KFQLGLFDNPFVDEDAAAEHVGNAESRRAGLDAQSRSVVVLKNGRSESAPVLPVLPGMR
FT                   VYSEGIDVSALAQVGTPVAELEDADIAIIRIEAPYEPRDDLFLESYFHQGSLEMRPGLV
FT                   HHLQTIAETTPLILDVALDRPALLAPVVDALAGLTVTFGVSDEALLAALAGRVTPSGRL
FT                   PVEIPRSMEAIRLSAPDAPSSTRDPLFPIGFGLDLP"
FT   CDS_pept        complement(124978..125889)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0084"
FT                   /product="putative sugar ABC transporter, permease
FT                   component"
FT                   /function="ABC-type sugar transport system permease
FT                   component"
FT                   /note="putative sugar ABC transporter, permease component
FT                   (ZP_00225485.1| COG0395: ABC-type sugar transport
FT                   system,permease component [Kineococcus radiotolerans
FT                   SRS30216];; AAF37729.1| cellobiose transport permease BglB
FT                   [Thermobifida fusca]). InterPro: Binding-protein-dependent
FT                   transport systems inner membrane component
FT                   pfam00528,BPD_transp_1, Binding-protein-dependent transport
FT                   system inner membrane component."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0084"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00103"
FT                   /db_xref="GOA:A5CM19"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM19"
FT                   /protein_id="CAN00103.1"
FT                   /translation="MTAPSVPYIRQTAGPGAARSASKRRDKGATGDKPKWVTYAVLGAV
FT                   ILISVLPLYYTFLLASNTSAEVAQNPIPSVIPGGELVNNLTRLFQSDIDLMKAAWNSFF
FT                   VSAVTAVAVVFFSTLAGFAFAKLRFRGQVPLLAIVVATLAVPTQLGVVPLYIVMRELGL
FT                   VGNLWAVILPGIVTAFGVFWMTQYLSAALPFELIEAARIDGASTFRTFWSIALPAVRPA
FT                   ASMLGLFSFIGAWTNYFWPAIVLGPQNPTLPVALQLLQTGFFKDIPLIMTGVLVSIVPL
FT                   LVLFLILGKQLVAGVMQGAIKG"
FT   CDS_pept        complement(125886..126968)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0085"
FT                   /product="putative sugar ABC transporter, permease
FT                   component"
FT                   /function="ABC-type sugar transport systems permease
FT                   components"
FT                   /note="putative sugar ABC transporter, permease component
FT                   (AAF37728.1| cellobiose transport permease BglA
FT                   [Thermobifida fusca];; ZP_00226174.1| COG1175: ABC-type
FT                   sugar transport systems, permease components [Kineococcus
FT                   radiotolerans SRS30216];; NP_627026.1| putative cellobiose
FT                   transport permease [Streptomyces coelicolor A3(2)]).
FT                   pfam00528, BPD_transp_1, Binding-protein-dependent
FT                   transport system inner membrane component."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0085"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00104"
FT                   /db_xref="GOA:A5CM20"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM20"
FT                   /protein_id="CAN00104.1"
FT                   /translation="MSDPVANAAHRARSAPPPISPWKERLGRWDYKASPYAYIAPFFIV
FT                   FAIVGLFPLLYTAYVSLHDWDLISGQGDFVGLGNFTFVLSRPVFWVSLGNTLSIFVLST
FT                   VPQIAIALVLASVLNANIRAKTFWRMGVLLPYVVAPVAVTLIFSRLFADQSGLVNAVLE
FT                   LVGADAIGWHRDSLPAHVAIATMVNFRWTGFNTLVLLAAMQAIPRELYEAAIIDGAGRF
FT                   RQFVSITVPSVRPTIIFVTITSTIGGLQIFDEPRLYDAQGLGGNSGQWKTITLYLYELG
FT                   WNQQRLGRAAAVAWLLFLLIVIFALVSNWLSRRIASGDATPVSRKTRRKSRVDQVSASS
FT                   TPIVNTSLNVSADEVLERTP"
FT   CDS_pept        complement(127043..128320)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0086"
FT                   /product="putative sugar ABC transporter, binding protein"
FT                   /function="ABC-type sugar transport system periplasmic
FT                   component"
FT                   /note="putative sugar ABC transporter, binding protein
FT                   (ZP_00058384.1| COG1653: ABC-type sugar transport
FT                   system,periplasmic component [Thermobifida fusca];; T46602
FT                   cellobiose/cellotriose binding protein [imported]
FT                   -Streptomyces reticuli (fragment)). pfam01547,
FT                   SBP_bac_1,Bacterial extracellular solute-binding protein."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0086"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00105"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM21"
FT                   /protein_id="CAN00105.1"
FT                   /translation="MRSIPKALVLLAAAPLVLLAGCSASGSDDSSADGKVTLSISTFSE
FT                   WGYDDLIEEYQELNPDITIEQNKFATSDEAKEKFQTSLGAGSGLSDIVGVDNSWLPQVL
FT                   ENPDNFVDLSSPDVEGRWNQWNVDLATSADGKLLGYATDIGPSSITYRADLFEAAGLPS
FT                   DRESVAELFGGDDATWDDFFAVGEKFKAANTGVPFYDASASVATSWGDQYEVLWEDPEN
FT                   GDIIAGTNPELKKIYDTTMKHDDLSAHLARWTEDWNSSFQNDGFAVMLSPSWMLGVIEG
FT                   NAAGVTGWDVADVFPGGGGNSGGSYLTVPTQSEHPEEAQALAEWLTAPEQQLKAFESTG
FT                   NFPSQVEAQNSEELQQVTNEFFNNAPVGQILTDRSAAVKEIPYKGDNYFAITDAFNKAI
FT                   NRVSVDKTQNAQESWDMFLDELGNLE"
FT   CDS_pept        128542..129288
FT                   /transl_table=11
FT                   /locus_tag="CMM_0087"
FT                   /product="transcriptional regulator, TetR family"
FT                   /function="Transcriptional regulator"
FT                   /note="putative transcriptional regulator, TetR family
FT                   (ZP_00120758.1| COG1309: Transcriptional regulator
FT                   [Bifidobacterium longum DJO10A];; NP_793102.1|
FT                   transcriptional regulator, TetR family [Pseudomonas
FT                   syringae pv. tomato str. DC3000]). pfam00440,
FT                   TetR_N,Bacterial regulatory proteins, tetR family."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0087"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00106"
FT                   /db_xref="GOA:A5CM22"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM22"
FT                   /protein_id="CAN00106.1"
FT                   /translation="MPTSPRTRGPYRKGVERRREIVAAAAQLFSESGYTHASMRELAKR
FT                   VGLSQALLLHYFSDKEDLLVEVLNLRDASVAEYLADIADSDIATRSRKVARHAAEHEGL
FT                   TSLYIALSAEAIDPEHPAHEYFADHYRSAQEQTREPGADAGVVPAGVSPELVTALGIAV
FT                   MDGLQVQRQYRPDVDPVAAVDAFWELVAAARSWWSLTAQDPEIAAGAAPVPLITEHAEV
FT                   DASAQGGTEDAVLQGAPGPDGATSPS"
FT   CDS_pept        complement(129377..130822)
FT                   /transl_table=11
FT                   /gene="bglA"
FT                   /locus_tag="CMM_0088"
FT                   /product="putative beta-glucosidase"
FT                   /function="Beta-glucosidase/6-phospho-beta-glucosidase/beta
FT                   -galactosidase"
FT                   /EC_number="3.2.1.-"
FT                   /note="putative beta-glucosidase (NP_631601.1| putative
FT                   beta-glucosidase [Streptomyces coelicolor A3(2)];;
FT                   NP_826430.1| putative cellobiose hydrolase [Streptomyces
FT                   avermitilis MA-4680]). InterPro: Glycoside hydrolase family
FT                   1"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00107"
FT                   /db_xref="GOA:A5CM23"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017736"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM23"
FT                   /protein_id="CAN00107.1"
FT                   /translation="MSHPAFASSDLSIPEEFTLGAATAAYQIEGAASKDGRGPSIWDTF
FT                   SHTPGATAEGATGDTAAGHYDNVTTDLDLMASLHLDAYRFSISWSRVMPEGEGAVNGAG
FT                   LAFYSTLVDGLLARGIRPVVTLNHWDLPQMLEDKYGGWRGRETAYAFERYAEIVGAALG
FT                   DRVAIWSTHNEPWNNSFAGYGHGVFAPGVKSHEAALKAAHHLNLAHGLAVRALRRTITK
FT                   DDAKVSIVLNIFRVEPESPADAEAARLFDAIANRVFTGPVLDGAYPADLLEDTKAFTDW
FT                   HFLQPGDEQICNQPIDLLGVNYYEIMHIRRRPDYDPTTELMGGTEFPGSERVELFRPEG
FT                   FDSTAMGWTVEPWGLEDHLVALSARWPSLPIMVMENGAAFDDVLTEVDGQPAVLDRHRT
FT                   QYLIDHLTATLRARDRGANVDGYLVWSLLDNFEWAAGYGPRFGIIRVDYESFHRTPKLS
FT                   AHWFAEACSTRTVPALATVDLSA"
FT   CDS_pept        131048..132076
FT                   /transl_table=11
FT                   /gene="catR"
FT                   /locus_tag="CMM_0089"
FT                   /product="putative LacI-family transcriptional regulator"
FT                   /function="Transcriptional regulators"
FT                   /note="putative transcriptional regulator, LacI family
FT                   (AAP57290.1| CatR [Clavibacter michiganensis subsp.
FT                   michiganensis];; NP_826160.1| putative LacI-family
FT                   transcriptional regulator [Streptomyces avermitilis
FT                   MA-4680]). InterPro: Periplasmic binding proteins and sugar
FT                   binding domain LacI family pfam00532,
FT                   Peripla_BP_1,Periplasmic binding proteins and sugar binding
FT                   domain of the LacI family. This family includes the
FT                   periplasmic binding proteins, and the LacI family
FT                   transcriptional regulators. The periplasmic binding
FT                   proteins are the primary receptors for chemotaxis and
FT                   transport of many sugar based solutes. The LacI family of
FT                   proteins consist of transcriptional regulators related to
FT                   the lac repressor. In this case, generally the sugar
FT                   binding domain binds a sugar which changes the DNA binding
FT                   activity of the repressor domain (pfam00356)."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00108"
FT                   /db_xref="GOA:A5CM24"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM24"
FT                   /protein_id="CAN00108.1"
FT                   /translation="MEAQTAGRAPTLRDIARIAGVSVPTVSKVLNGRGDVSAETRERVQ
FT                   EATARVGYRRMPSAAVDALIAEQLVDLVLPAVGDSWASALIGGVERVAAQNSLDLVIIM
FT                   VRAGESQGRSWVERLVDHRSRGALIAVVQPTASERRLLERARIPFVLIDPAGTPERAAP
FT                   SVGASNWAGGADAASFLLDRGHTSFAVVAGDPHSLNCRERAGGFLSRIRELLPDSRPTV
FT                   LYGGWLMETTAQVVAELLGSPSRPTAVFACNDNMALGVYAAAHALELRIPEQLSVIGFD
FT                   DLVEARLASPPLTTVRQPVPEIGAAALRSLLDLRGGYPVARRLELATELIARDSVSSPP
FT                   RA"
FT   CDS_pept        complement(132170..133801)
FT                   /transl_table=11
FT                   /gene="tomA"
FT                   /locus_tag="CMM_0090"
FT                   /product="tomatinase, endo-1,4-beta-glycosidase"
FT                   /function="putative beta-14-xylanase"
FT                   /EC_number="3.2.1.-"
FT                   /note="tomatinase, glycosyl hydrolase, family 10
FT                   (ZP_00192175.3| COG3693: Beta-1,4-xylanase [Kineococcus
FT                   radiotolerans SRS30216];; CAA10112.1| tomatinase [Fusarium
FT                   oxysporum f. sp. lycopersici]). , pfam00331,Glyco_hydro_10,
FT                   Glycosyl hydrolase family 10."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0090"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00109"
FT                   /db_xref="GOA:A5CM25"
FT                   /db_xref="InterPro:IPR001000"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM25"
FT                   /protein_id="CAN00109.1"
FT                   /translation="MRTLTSAALATTVALGLTLIAAVPARASTGDGPTLRELAEPAGLT
FT                   IGSGSIKAAEWTKDDRPSNYLTDPRFADTLAEQFNGLSPENEMKWAFTQPEEGVYDFAG
FT                   LDRLVAFAEEHDMAVKGHGLISSCCDPEYVTSITDAGEMRAAMTEHFTTVMERYDGRID
FT                   RWDVVSEALESQGTTLQSTTFFKVLGPGYIADAFRIARAADPDAKLFINENLVEFDAAK
FT                   RQAFLDLLTGLVAEGVPVDGVALQMHETFAGPLPGVITEMVDSYRALGLDVEIAELDVH
FT                   TYDPVSQATIYGDVVAEALAAGVTEISTWGFTDKHLYTWLPGAKPLIFDEEYGPKPAYF
FT                   AVRDALQQFVTPTAAPGVASLSNTGRKSGLSDGDYDIKMNLTKGAPGSYYRLYENDVLV
FT                   SSQRLDSLATPRQSATTSFSGKAEGKYRYRAELINSQGVTSTKTTTVLVKHLAPSRPVV
FT                   SVDNRDGDGTFVATATLKSGINATSYAFKLDGRIVGTGPLTAATPNKQTAKVSLTGIAA
FT                   GRHALTAVFTNTKGSTESRSVTVRVR"
FT   CDS_pept        complement(134140..134811)
FT                   /transl_table=11
FT                   /gene="regB"
FT                   /locus_tag="CMM_0091"
FT                   /product="putative two-component system response regulator"
FT                   /function="two-component system response regulator"
FT                   /note="putative two-component system response regulator
FT                   (ZP_00199394.2| COG2197: Response regulator containing a
FT                   CheY-like receiver domain and an HTH DNA-binding domain
FT                   [Kineococcus radiotolerans SRS30216];; NP_625364.1|
FT                   putative two component system response regulator
FT                   [Streptomyces coelicolor A3(2)]). cd00156, REC, Signal
FT                   receiver domain. pfam00196, GerE, Bacterial regulatory
FT                   proteins, luxR family."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0091"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00110"
FT                   /db_xref="GOA:A5CM26"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM26"
FT                   /protein_id="CAN00110.1"
FT                   /translation="MIDVVLVDDQAMIRAGLRGILEDAGIRVIGEAADGRSAFAVIRGS
FT                   RPDVVLMDLRMPILDGVGATAALRADPDLNAVRILVLTTFDGDEEVLAALRAGADGFLA
FT                   KSADSESLIAAVEAVAKGDTSLSAGAAKTVVSDLRRRGRSATDVELIARTATLTHRETD
FT                   VVLGAARGLDNVSIARDLFISPATVKTHLNRAMTKLHARDRGQLVSIAFRSGLVNRAEH
FT                   P"
FT   CDS_pept        complement(134808..135962)
FT                   /transl_table=11
FT                   /gene="regA"
FT                   /locus_tag="CMM_0092"
FT                   /product="putative two-component system sensor kinase"
FT                   /function="Signal transduction histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="putative two-component system sensor kinase
FT                   (ZP_00192164.3| COG4585: Signal transduction histidine
FT                   kinase [Kineococcus radiotolerans SRS30216];; NP_827214.1|
FT                   putative two-component system sensor kinase [Streptomyces
FT                   avermitilis MA-4680])."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0092"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00112"
FT                   /db_xref="GOA:A5CM27"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM27"
FT                   /protein_id="CAN00112.1"
FT                   /translation="MTVHSRFGSRWEGLFDIVAVITAVAAVVISFHVGGVDRIAALTAT
FT                   VVSAALVAIRRRFPIAAAVGAIAASLIVFVAPDGALGVWVLAEICLFSVPLRRSRTATT
FT                   IVATIHAAVLYAGAMIAFGVGPADPFALILPVWTGAVVALGSAVRAYRDYAQAVEERLS
FT                   AVTAAKETELRRRMSEERVRIARDLHDSVANSLAVIALHSTDAERHVEDDPARARRALR
FT                   TVRTVSAGTLQELAAILAVLRDARSDEVENRTVAATSGIPTLIEMMQASGASVEVSLDA
FT                   LDGAALSTSGEAALYRALQEGLTNGHRYGSGPTHVTASATPTSVVLTIENAIQHRHPGA
FT                   DSGFGLIGMRERVELAGGSLDVREDRHSFGLRVELPRASHGAER"
FT   CDS_pept        complement(135959..138130)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0093"
FT                   /product="putative transport protein, RND family"
FT                   /function="Predicted drug exporters of the RND superfamily"
FT                   /note="putative exporter of the RND family (ZP_00229024.1|
FT                   COG2409: Predicted drug exporters of the RND superfamily
FT                   [Kineococcus radiotolerans SRS30216];; NP_631580.1|
FT                   putative integral membrane protein. [Streptomyces
FT                   coelicolor A3(2)]). InterPro: HMGCR/Patched 5TM box"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0093"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00113"
FT                   /db_xref="GOA:A5CM28"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM28"
FT                   /protein_id="CAN00113.1"
FT                   /translation="MSALLYRLGVLSARSRWAVVASWLLVLLIAAGVALSGMRFSSAGF
FT                   DVPGTDSSRALSTLESEFPTTGEATTSLQLVVQSSGGRVTDDAPSLTSALEQARVIPGV
FT                   LAVTDPLDPARPSISADGATAIAQVTVGDIDEEQADEVTSELDAVAAGLRDQGMAAEIG
FT                   GSLTSAVPEILGPTELVGALVAFLVLLLTFGSLVAAGANMLGALVGVGVGVLGILAFSA
FT                   IAPIGSVTPILAVMLGLAVGIDYCLFVLSRFRAELRSGRLVQDAIGRATATAGSSVVFA
FT                   GATVIIALVGLTVVGIPFLGEMGIAAAFAVAVAVLMSLTLLPALLSWMGRRALGRRERA
FT                   STRSAGGSPRWTTTWIGAVLRRPVIATFAVVGGLAVVALPLLGMQTSLVIPGGEDPDST
FT                   QRAAYTTVADAFGPGAQDPLVVLVRSDSDAASAVETVSTELGSLPNVATVSPGPVSADG
FT                   STAMLTVIAESGPLDTATTSLVRDIRALGDDSTSVQVTGSTAIALDSDEQLRSALIAYV
FT                   ALIVGLSFLLLVLLFRSFLVPLIATGGFLLSLGAALGSTVAVFQWGWLDPIVQAPQGNP
FT                   LLSLLPIIVTGILFGLAMDYQVFLVSRIHEAHRHGTSPREAVRAGFQQSAPVVVAAAAI
FT                   MAAVFFGFALSPSSLVGSIALALAVGVLADALLVRMILVPALLTLLGRSAWWIPRWLDK
FT                   LLPTIDVEGAAFDDDRREAAPNELASTRM"
FT   CDS_pept        138337..139557
FT                   /transl_table=11
FT                   /gene="cytA"
FT                   /locus_tag="CMM_0094"
FT                   /product="putative cytochrome P450"
FT                   /function="Cytochrome P450"
FT                   /EC_number="1.14.-.-"
FT                   /note="cytochrome P450 (ZP_00229013.1| COG2124: Cytochrome
FT                   P450 [Kineococcus radiotolerans SRS30216];; CAE53708.1|
FT                   putative cytochrome P450 [Streptomyces peucetius]).,
FT                   ,pfam00067, p450, Cytochrome P450. Cytochrome P450s are
FT                   involved in the oxidative degradation of various
FT                   compounds."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00114"
FT                   /db_xref="GOA:A5CM29"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM29"
FT                   /protein_id="CAN00114.1"
FT                   /translation="MPTLESAPVPRGALPQDRCPFDPSARYERLREEDPVTRVTTPAGF
FT                   DVWLVSRYDDARAVLGDGESFSNVDASSTHLMGNKDKLGATPPPGILLRHDGASHSRLR
FT                   LRLAREFMVKRVATLEPFIRSLVAEHIDRLASMSGPVDLYRNFGLPIPALVISEVLGVP
FT                   DEDRAEFGHFTASQVDLTLPLEEREAAGAAGQAFFARLVASKYENPGDDLLSRLIQEPS
FT                   DEPFGFEELMGLSLLLLAAGHDTTANMITLGTYALLRDPDQAARLGEPGMMSTGVDELI
FT                   RYLSIVHNGVLRKAVRDVTVGDQLVRAGEHVAVVLESANRDPRFMSDADRLDLDRRSAH
FT                   VGFGYGAHQCLGQHLARLELTVALPELFRRVQGLRAVQPESDIPFKNDMLVYGIRELLV
FT                   EWDEVVA"
FT   CDS_pept        139554..139751
FT                   /transl_table=11
FT                   /gene="cytB"
FT                   /locus_tag="CMM_0095"
FT                   /product="putative 3Fe-4S ferredoxin"
FT                   /function="Ferredoxin"
FT                   /note="putative 3Fe-4S ferredoxin (P18325|FER2_STRGO
FT                   Ferredoxin 2 (Fd-2);; P46374|FAS2_RHOFA Ferredoxin fas2)."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0095"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00115"
FT                   /db_xref="GOA:A5CM30"
FT                   /db_xref="InterPro:IPR001080"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM30"
FT                   /protein_id="CAN00115.1"
FT                   /translation="MRFALDIDRCVGAGVCALAAPDVFDQNDDDGIVVVLDQDPPAELD
FT                   EAVREAAARCPAAVIRLQAP"
FT   CDS_pept        139748..140950
FT                   /transl_table=11
FT                   /gene="cytC"
FT                   /locus_tag="CMM_0096"
FT                   /product="putative ferredoxin reductase"
FT                   /function="Uncharacterized NAD(FAD)-dependent
FT                   dehydrogenases"
FT                   /EC_number="1.18.1.-"
FT                   /note="Ferredoxin Reductase (P450 system) (NP_822785.1|
FT                   putative ferredoxin reductase [Streptomyces avermitilis
FT                   MA-4680];; ZP_00229012.1| COG0446: Uncharacterized
FT                   NAD(FAD)-dependent dehydrogenases [Kineococcus
FT                   radiotolerans SRS30216]). pfam00070, Pyr_redox, Pyridine
FT                   nucleotide-disulphide oxidoreductase. This family includes
FT                   both class I and class II oxidoreductases and also NADH
FT                   oxidases and peroxidases. This domain is actually a small
FT                   NADH binding domain within a larger FAD binding domain."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0096"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00116"
FT                   /db_xref="GOA:A5CM31"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM31"
FT                   /protein_id="CAN00116.1"
FT                   /translation="MSVRRTLIVGASAAGVTAAESLRSQGYAGSIEVIGAERHHAYDRP
FT                   PLSKQLLSGEWEGTRLQLRPDAHLASLDVHERLGSPAVDLDPIGRQVTTADGARTGYDA
FT                   LVIATGVRPRRLAGTEGTRGVHVLRTLEDAEALRAEVDVGKRVVVIGGGFLGAEIASVL
FT                   QASVGEVVLLTAGENLLERVIGRPVGAELMALHRSMGITVIPAPLSRVRSLVTDTGRVS
FT                   GVVLGDGSVLETGLVVIAIGSEPAVDWLRMSGLDLSDGVGCASDCSAAPGIYAAGDVAR
FT                   WWNPLFTTSMRVEHRTNAVDQAIHVAERIVRGDDVDYAPVPYFWSDQFGLRLQAHGWLK
FT                   EHDECVVVEGSVSDRRLVALYRRGGALTGVLAMGAAKALRTWRSRITEGITWRDALDAA
FT                   P"
FT   CDS_pept        complement(141009..143633)
FT                   /transl_table=11
FT                   /gene="bglD"
FT                   /locus_tag="CMM_0097"
FT                   /product="putative beta-glucosidase, glycosyl hydrolase
FT                   family 3"
FT                   /function="Beta-glucosidase-related glycosidases"
FT                   /EC_number="3.2.1.-"
FT                   /note="putative beta-glucosidase, glycosyl hydrolase family
FT                   3 (ZP_00229019.1| COG1472: Beta-glucosidase-related
FT                   glycosidases [Kineococcus radiotolerans SRS30216];;
FT                   AAF43783.1| xylosidase/arabinosidase [Thermoanaerobacter
FT                   ethanolicus]). pfam00933, Glyco_hydro_3, Glycosyl hydrolase
FT                   family 3 N terminal domain. pfam01915,Glyco_hydro_3_C,
FT                   Glycosyl hydrolase family 3 C terminal domain."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0097"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00117"
FT                   /db_xref="GOA:A5CM32"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM32"
FT                   /protein_id="CAN00117.1"
FT                   /translation="MPDLLPYRDPSLPTMERVRDLLGRMTLEEKAAQIACPFGTAVDVH
FT                   RPPQEGWGTAVAALAALGEVPREAARLGNELQRKHVEETRLGIPVLLAEEALIGLKVRS
FT                   ATTFPDALAQAATWDTDLIEAMAKTIGVQMARLGVRQALSPLADVSRDPRWGRVEETYG
FT                   EEPYLVGSMATAFVRGLQGAEEDTPLIATLKHFVAYGASDGGRNTDAAHLGHSELHEVY
FT                   ALPFEMAIRVGGAQGVMPAYNSIDGVPVTGSAEYLVGLLRDRLGFEGLITSDLEAVSQL
FT                   FTKHGTAADIPHAFAQALRAGVNADLDNTVSTRVILEAVHEGLLSIDELDAAAAGSLRA
FT                   KLELGLFERPYVDLDRVPETLDSESDRALSRAVAEKSVILLRNAPVNGTPLLPLPDSPQ
FT                   TIAVIGPNADRLMGQLGNYSYQVLDSMTRRFAQAANPQARMESAQAMGADNADLLVDSV
FT                   PVVTFLDGIRSRAHADSKIVYAAGCPVAAEDRSGIAAAVALARTADVVILVVGDQSGIG
FT                   AFGTVGEGLDSVTCELPGVQRELVEAVAASGTPTVAVLSHGRPFVLGWMTEKVPAIVSS
FT                   LFGGEEAGTAVASVLFGDVNPAGRLPIAMLTSVGAAPLPYWRTLQPSHYVDGTSTAVFP
FT                   FGHGLSYTDFAYRDLAIGSPEVSTDGVVRLEFTVENVGARAGEEVVQVYGQDVIGSTVR
FT                   RGRVLVGFRRFALEPGEAVRVCIDVPTSMFALWNGTRGWVVEPGLLRFYIGGSSARTPL
FT                   QARVTLTGGEHEPGDQRPLFSSITLRDVEPGDRLDGGADAFDAGAIQRVTAESTIREWL
FT                   DHPIGGPALRSALGGIEENLLSAAFGLTLTKMALYSQGAITDETVERLITVVERAYSDS
FT                   DRA"
FT   CDS_pept        complement(143748..144755)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0098"
FT                   /product="putative LacI-family transcriptional regulator"
FT                   /function="Transcriptional regulators"
FT                   /note="putative transcriptional regulator, LacI-family
FT                   (emb|CAD47864.1| putative LacI-family transcriptional
FT                   regulator [Arthrobacter nicotinovorans];; NP_963234.1|
FT                   hypothetical protein MAP4300 [Mycobacterium avium subsp.
FT                   paratuberculosis str. k10]). pfam00532,
FT                   Peripla_BP_1,Periplasmic binding proteins and sugar binding
FT                   domain of the LacI family. This family includes the
FT                   periplasmic binding proteins, and the LacI family
FT                   transcriptional regulators. The periplasmic binding
FT                   proteins are the primary receptors for chemotaxis and
FT                   transport of many sugar based solutes. The LacI family of
FT                   proteins consist of transcriptional regulators related to
FT                   the lac repressor. In this case, generally the sugar
FT                   binding domain binds a sugar which changes the DNA binding
FT                   activity of the repressor domain (pfam00356)."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00118"
FT                   /db_xref="GOA:A5CM33"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM33"
FT                   /protein_id="CAN00118.1"
FT                   /translation="MTSWAHVEGVDMATSTDVARHAGLSRSTVSQVLNGRGHLFAEETI
FT                   ARVHASAESLGYRPSLAGRTLARGTSDIVITVLPDATFNPRIRELVDIITKGMADAGLT
FT                   NLLQFIDRGHRLEHAVLGLKPFGIVSLVPLPAEQYERLRAQGVRIVVQPDHVQVAIDEA
FT                   IGRLQAEHLAAAGYTTMATVLPVSARESTFAAPRDAGARDWASRHGLRVLPTLHVALEP
FT                   GGAVDAIAGLPAEPIGLAAYNDEVAMALVGAAIKRGRTFPEDIGVIGIDNSPIARASTP
FT                   TITTVDFDISFSGEGILQLLLQEPDGPQPSDPAGLVTDRLTVIQGETTRTPPVL"
FT   CDS_pept        144980..147469
FT                   /transl_table=11
FT                   /gene="bglE"
FT                   /locus_tag="CMM_0099"
FT                   /function="Beta-galactosidase/beta-glucuronidase"
FT                   /note="putative beta-galactosidase/beta-glucuronidase
FT                   (ZP_00229015.1| COG3250:
FT                   Beta-galactosidase/beta-glucuronidase [Kineococcus
FT                   radiotolerans SRS30216];;ZP_00061173.1| COG3250:
FT                   Beta-galactosidase/ beta-glucuronidase [Clostridium
FT                   thermocellum ATCC 27405]). InterPro: Glycoside hydrolase
FT                   family 2 pfam02837,Glyco_hydro_2_N, Glycosyl hydrolases
FT                   family 2, sugar binding domain. pfam02836, Glyco_hydro_2_C,
FT                   Glycosyl hydrolases family 2, TIM barrel domain."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0099"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00119"
FT                   /db_xref="GOA:A5CM34"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032311"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="InterPro:IPR040605"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM34"
FT                   /protein_id="CAN00119.1"
FT                   /translation="MTEAALHTIAMTLTEWDFTVKGGGAGQPVRLPHDAMIHEHRDPRA
FT                   PGGADTAYFPGGAYRYSTNWDAPADRSSSVALRFEGVQGDATVTVNGTVVGSIRSGYTE
FT                   FEFEIGEHLAWGASNTFVVDVDNAAQPTGRWYPGSGLYRPVSLLLRPAVRFAPDGLKVR
FT                   TLSITAATAEVQIGYSVLGLEDRTARVAVELRDGKTLVSSADGVGVEGVLSLVVDRPRA
FT                   WSADSPHLYELIARVDSGDATYERRERVGLRTIAVDSRNGLRINGRRELLRGACMHHDN
FT                   GVLGAATHRAAEYRRIRLLKGAGFNAVRSAHHPMSRHLLDACDELGMYVVEELADYWVA
FT                   SKSAHDAADRFHETWREDADRMIRKDRNRPSVIMYAAGNEIPETATPQGVELTREITAH
FT                   LHAADPDRPVTLAINLFLNTLVSFNRSPYKEAAAAGDAGTSMAGSTEANVMINQIGRMM
FT                   DVVSRLPQADKASRDAFAEVDVAGYNYGIGRYDRDVRAYPDRVILGTETLPGDVARAWG
FT                   RVLKHPAVIGDFVWAGWEYLGEAGVAVWVPGKKAGLSKPYPYLIAGPGMFDLIGQPDIT
FT                   LRLAQLAWGDLHRPAIGVRPLDRSGMPMVRSAWRVTDAVESWSWRGSDGRKSEVQIYSA
FT                   DDHVELLLNGRRVGRRRAGRRRGFRADFTVPYEPGTLEAVGYRNGIEVSRSSLRSATGP
FT                   LRLRVEAESRDMIADGDDLLFAEITVVGENGVVEMLADEQVAVTVDGPGEVIGFGSSAP
FT                   SSEESYTTATHRTFRGRVLAVIRSTGAPGTVTVTARGRTLGTAELAIDAREPGQAPLPA
FT                   SPLSGDTNRLATTEPSH"
FT   CDS_pept        147484..149739
FT                   /transl_table=11
FT                   /gene="bglF"
FT                   /locus_tag="CMM_0100"
FT                   /product="beta-glucosidase, glycosyl hydrolase family 3"
FT                   /function="Beta-glucosidase-related glycosidases"
FT                   /EC_number="3.2.1.-"
FT                   /note="putative beta-glucosidase, glycosyl hydrolase family
FT                   3 (ZP_00229018.1| COG1472: Beta-glucosidase-related
FT                   glycosidases [Kineococcus radiotolerans SRS30216];;
FT                   ZP_00060124.1| COG1472: Beta-glucosidase- related
FT                   glycosidases [Clostridium thermocellum ATCC 27405]).
FT                   pfam00933, Glyco_hydro_3, Glycosyl hydrolase family 3 N
FT                   terminal domain. pfam01915, Glyco_hydro_3_C, Glycosyl
FT                   hydrolase family 3 C terminal domain."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0100"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00120"
FT                   /db_xref="GOA:A5CM35"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM35"
FT                   /protein_id="CAN00120.1"
FT                   /translation="MIDDNADERASSAAPTTAAELPAERKAALLSGRNFWETEAIPELG
FT                   LPSVVLADGTYGLRHQAGQHDHLALFESTPATCFPPGVAVGSSWDRRVAQRLGAALGRE
FT                   ARAQGVDIVLGPGVNIKRSPLCGRNFEYYSEDPLVSGVLGAAFTRALQSEGPGVSVKHF
FT                   AANNQETHRQTVSADVDERTLREIYLSAFERVVRDGEPATVMASYNRINGVFASENRWL
FT                   LTNVLREEWGFDGVVVSDWNAVTDRVAALRAGLDLEMPGGTGAHDDDVTGALATGELTS
FT                   EDLDASVTRVAALARYASSDRPSVDLDGHHLLAQELASECAVLLRNERGALPIPDGKQV
FT                   AVIGAFAQAPRYQGGGSAHVNATRVDSPLEALRDLTIEQGIAISSAEGFSLDGTGDDEG
FT                   LLAEALDVARHSDIAVVFAGLDEASESEGFDRGSLELPAQQVRLITEVAAVAQRTVVVL
FT                   ANGGVVSLEPWHDHVDAILEGFLLGQGGGVAIAQILLGRVNPSGHLAETIPLRLQDHPS
FT                   SLNFPGEQGHVRYGEGVMVGYRYFSTFQTPVRYPFGHGLSYTSFTTGEPRVEGSLEDGF
FT                   VVTVEVTNTGHRAGKHVVQVYVTTEAGPVVRPVRELRGFDKIELQAGETRSVSIELPRR
FT                   AFSYWDIKHQRWLVAPGNYSIEIATDALTVLHSAPIALDGDRVIVPVTMDTPLSTWFDH
FT                   PLVGTRVKEVLGLGAVEVSPEHLAMMASMTMRQFVAISGLPIATTALEELISASAPA"
FT   CDS_pept        149904..151076
FT                   /transl_table=11
FT                   /gene="bglG"
FT                   /locus_tag="CMM_0101"
FT                   /product="beta-glucosidase, glycosyl hydrolase family 1"
FT                   /function="Beta-glucosidase/6-phospho-beta-glucosidase/beta
FT                   -galactosidase"
FT                   /EC_number="3.2.1.-"
FT                   /note="Specificity unclear"
FT                   /note="putative beta-glucosidase, glycosyl hydrolase family
FT                   1 (ZP_00192144.3| COG2723:
FT                   Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase
FT                   [Kineococcus radiotolerans SRS30216];; CAA52344.1|
FT                   beta-glucosidase [Streptomyces rochei]). InterPro:
FT                   Glycoside hydrolase family 1. pfam00232, Glyco_hydro_1,
FT                   Glycosyl hydrolase family 1."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0101"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00121"
FT                   /db_xref="GOA:A5CM36"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM36"
FT                   /protein_id="CAN00121.1"
FT                   /translation="MIMNAAFPSGFLWGAATAAHQVEGNNLNNDWWELEKVAEGYIDAS
FT                   GDALDSYHRFAEDMRLLADSGLTTYRFSLEWSRIEPRPGKFSRAELAHYRRMIDTALDL
FT                   GLTPFVTLHHFTHPIWFGERGGWLAPDAADVFARYVEEACSILADVPYVCTINEPNVVA
FT                   MNHGAARIVAAGHAYPATPDPDPEYGDALIAAHRVAAPLVRRLTDAQVGWTVANQAFTP
FT                   TPGAELEYAEIQHRWEDKYLDAGREDDFIGVQSYTSQAVDENGVVPHPDASTNTLMGWA
FT                   YRPDALSIAIRHTHDVIGDVPIIVTENGIATDDDERRIEYTRAALEGMKAAMDDGIDVR
FT                   GYCHWSLLDNFEWGRWKPTFGLIAVDRDTFERRPKPSLAWLGSIAIANAI"
FT   CDS_pept        151096..152694
FT                   /transl_table=11
FT                   /gene="bglH"
FT                   /locus_tag="CMM_0102"
FT                   /product="putative beta-galactosidase"
FT                   /function="Beta-galactosidase"
FT                   /EC_number="3.2.1.23"
FT                   /note="putative beta-galactosidase, glycosyl hydrolase
FT                   family 35 (ZP_00229011.1| COG1874: Beta-galactosidase
FT                   [Kineococcus radiotolerans SRS30216];; NP_642855.1|
FT                   conserved hypothetical protein [Xanthomonas axonopodis pv.
FT                   citri str. 306]). pfam01301, Glyco_hydro_35, Glycosyl
FT                   hydrolases family 35."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0102"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00122"
FT                   /db_xref="GOA:A5CM37"
FT                   /db_xref="InterPro:IPR001944"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031330"
FT                   /db_xref="InterPro:IPR040719"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM37"
FT                   /protein_id="CAN00122.1"
FT                   /translation="MTTTTSAQWTEHYLRTDDGPFIVLGAEVHNSSSSSLPAITESFAT
FT                   VHRLGANTVLAPVAWDLFEPEEGRFDTTLIDAMIETATDLGLRLVPLWFGAWKNAVSTY
FT                   APGWVKTDQQRFPRALSKDGARLDHLTPFCDATRDADGRAFAALMRRITEKDRDGTVLM
FT                   VQIENEIGLLGATRDYSDLAEAAFAGLVPDAVVTAVQGEPGTPVHLAWMDMGRLSSGTW
FT                   TDVFGDHAVAHEAFMAAAYAAYVQEVAAAGREETDLPYFVNAWLDADSVLDGPVALAGG
FT                   KEPGEYPSGGPVARVAGIWEALAPQLDLLAPDMYVADADPVFTAFAGRRNRLFIPELRA
FT                   DAVGIGQMFAALGSYRAIGVSPFGIDSLDPDDPSSAQVVDTYGLLAIAAELLRRDPAAR
FT                   TMGFMLDDEHPDVVISFPSAELRINTRSPWIPAQPVYPAYGIAIEDGDGVFVIGRGFWV
FT                   TVEPSDTGTPSLLSADEYSLIDRELVVTRRLNGDETAAGTLVPFPFANSPMLTDRVIPT
FT                   RLPDAGAVRFRVFHY"
FT   CDS_pept        complement(152728..154494)
FT                   /transl_table=11
FT                   /gene="bglI"
FT                   /locus_tag="CMM_0103"
FT                   /product="putative beta-xylosidase, glycosyl hydrolase
FT                   family 43"
FT                   /function="Beta-xylosidase"
FT                   /EC_number="3.2.1.37"
FT                   /note="putative beta-xylosidase, glycosyl hydrolase family
FT                   43 (14-beta-D-xylan xylohydrolase) (NP_244550.1| xylan
FT                   beta-1,4-xylosidase [Bacillus halodurans C-125];;
FT                   ZP_00066469.1| COG3507: Beta-xylosidase [Microbulbifer
FT                   degradans 2-40]). pfam04616, Glyco_hydro_43, Glycosyl
FT                   hydrolases family 43. cd00057, FA58C, Coagulation factor
FT                   5/8 C-terminal domain, discoidin domain; Cell
FT                   surface-attached carbohydrate-binding domain, present in
FT                   eukaryotes and assumed to have horizontally transferred to
FT                   eubacterial genomes."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0103"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00123"
FT                   /db_xref="GOA:A5CM38"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM38"
FT                   /protein_id="CAN00123.1"
FT                   /translation="MDAHRTVICNPIDLPYRYQDFGRGPVRAVFREAADPSVVLFRGRY
FT                   YLFASMTGGFFHSDDLASWVFVATPQLPEGDYAPDVRDMDGSLYVTASRRRGPCPVLRS
FT                   RDPLVEPFALVAESSFAYYDPNYFQDRDGRRYLYWGCSNKEPLRGVEVDQDFRPLGSAV
FT                   DLLSGQPDEHGWERPGESNVVRPPSTIREKLSARLFGTHSTTPFIEGAWMTEHDGTYYL
FT                   QYAGPGTEYNVYSDGYYTASNPLGPYTYSPDSPFSSKPGGFVTGAGHGSTFQDAHGNWW
FT                   HAATMRVSVNHHFERRIGLFPAGFDEDGTLFCNQTFGDYPTVVPDGPADPWHDHSPRWM
FT                   LQSYRSATSATSHAQGHGPELAVDEDIRTWWAAGSTRPGEALTLDMGTPRTVHAIQVNL
FT                   ADHEMVKHKPARPLRDPDEARDAFRAVVVEDVPVRYLLEASEDGTTWVTLHDGGVDPSD
FT                   APHRLIRPQQPFPVRFIRVTGISMPWGGVFAISGLRVFGHDGRPRPAAVVPRLQRTQPT
FT                   AARVRWQADDSADGVVIRYGRRPDRLYHSWQVWGAAELELPTLNAGEDYWIAVDAYNAG
FT                   GVTPGEAVALSA"
FT   CDS_pept        154629..156008
FT                   /transl_table=11
FT                   /locus_tag="CMM_0104"
FT                   /product="putative sugar permease (MFS superfamily)"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /note="putative sugar permease (MFS superfamily)
FT                   (ZP_00229022.1| COG0477: Permeases of the major facilitator
FT                   superfamily [Kineococcus radiotolerans SRS30216];;
FT                   CAD47966.1| hypothetical protein [Arthrobacter
FT                   nicotinovorans]). pfam00083, Sugar_tr, Sugar (and other)
FT                   transporter."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0104"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00124"
FT                   /db_xref="GOA:A5CM39"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR018043"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM39"
FT                   /protein_id="CAN00124.1"
FT                   /translation="MSEDERGTRRADSPRNALVNISPLTDPNIEATQREAAGAFGGDPV
FT                   VTGTSESNEPPRVGAGFVAVYSLTYFGFFLVLFVPSLFSLAYKVQLIEPEGKEAALGLI
FT                   VGIGALFNLILGPIFGVLSDATRLRWGRRRPFLVFGLGVAALAACLIAIAPSVPLVLAG
FT                   WIIAQVAASAISAALNPTLPERVPAEQRGKLGALSGVAASIAGVSATLVGSLLTGDLVL
FT                   LFLLPVAVLAVGVVLWLFVVPDAPAPAGAQRPIGAALRSLLFDPRKHPDFAWVWIGKFC
FT                   LQIGLAFFTTYQLYFLLDRLGFTAEEAGRQLAVVGGISLLATMLFTIAGGTLSDRLRRR
FT                   KPFIYLASAMIAAGMITAAFSSDFVIYAVAGALLAAGTGAFNSVDLALASDVLPDKAES
FT                   GKWMSIYHLSGALSTAVGPAIAPLVLSTGASGANYTLLFVSGGILALGSVITVIRVRGA
FT                   R"
FT   CDS_pept        156005..158506
FT                   /transl_table=11
FT                   /gene="ramA"
FT                   /locus_tag="CMM_0105"
FT                   /product="putative alpha-rhamnosidase"
FT                   /EC_number="3.2.1.40"
FT                   /note="putative alpha rhamnosidase (ZP_00229021.1|
FT                   hypothetical protein Krad06000075 [Kineococcus
FT                   radiotolerans SRS30216];; AAR96046.1| alpha-L-rhamnosidase
FT                   A [Thermomicrobia bacterium PRI-1686]). , weak similarities
FT                   to: COG3408, GDB1, Glycogen debranching enzyme; pfam05592,
FT                   Bac_rhamnosid, Bacterial alpha-L-rhamnosidase. This family
FT                   consists of bacterial rhamnosidase A and B enzymes.
FT                   L-Rhamnose is abundant in biomass as a common constituent
FT                   of glycolipids and glycosides, such as plant pigments,
FT                   pectic polysaccharides, gums or biosurfactants."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0105"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00125"
FT                   /db_xref="GOA:A5CM40"
FT                   /db_xref="InterPro:IPR008902"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013737"
FT                   /db_xref="InterPro:IPR016007"
FT                   /db_xref="InterPro:IPR035396"
FT                   /db_xref="InterPro:IPR035398"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM40"
FT                   /protein_id="CAN00125.1"
FT                   /translation="MTAHDWQARFVGSSTPSSAGDPALYVRHTFSLRDDVLNATLHVTA
FT                   LGIVEPSLNGAKVGNELLAPGWTSYRHRLGVSSYDVTSSLQPGENVLGAVVGEGWAAGL
FT                   LSYEGIRHNYIDRPAVFLQLEVEYADRTETIVSGEASRCSTGAVKAHGLYEGEEYDARL
FT                   EPTGWDQPGFDDGAWQSAVVIEWDLATLRADIAPPIRAMEEIEPVAITTTPAGRTVVDF
FT                   GVNLVGWVRIRVSGDRGATVVLRHAETLTPGGEPEYESNRGAAATDRYTMRGGEVPETW
FT                   EPRFTFHGFRYVDVEGWPGTLSAEDIRAIVVHSDMARSGWFETSNDLVTKFHGNVVRSM
FT                   RGNFVGVPTDCPQRDERMGWTGDLNAFAPSAAFLYDVRGVLRSWLEDLAAEQTEKGFVP
FT                   WVVPDILTHPSAPTALWSDVAISLPWVLYNEYGDLEILRRSYPSMVAFMTQVEPLLDED
FT                   GLWSKGYQFGDWLDPDAPPENAAAGKTDKHLVASAYLCKTTRELAATAGLLGEEDDAAH
FT                   FSALAERVRAAFRHQYVTPAGRVTNESSTAYALAIVFEILQGEQRRKAGDRLAELVAQS
FT                   GYRISTGFAGTPHVADALTSTGHVQEAYLLLLEEGCPSFLYPVTMGATTIWERWDSVLP
FT                   DGTLNSTGMTSLNHYALGSVADWLHRVVGGLERIEPGWQRIKIAPIPGGNLTSARVAHD
FT                   TVLGRAEVGWQLESGHMELNVVIPEGATATVVLPLHPDNLVEEVGPGGHSWRYATTQDA
FT                   RRTYGLDTPLAVLVENRRAWQEVLKVFATHLPGISIDSNVPEAAAMTLDMIMVHLPVQL
FT                   MTAGPEALRRDLEATLERLSN"
FT   CDS_pept        complement(159396..161624)
FT                   /transl_table=11
FT                   /gene="aglA"
FT                   /locus_tag="CMM_0106"
FT                   /product="putative alpha-glucosidase, glycosyl hydrolase
FT                   family 31"
FT                   /function="Alpha-glucosidases family 31 of glycosyl
FT                   hydrolases"
FT                   /note="putative alpha-glucosidase, glycosyl hydrolase
FT                   family 31 (NP_733521.1| putative sugar hydrolase
FT                   [Streptomyces coelicolor A3(2)];; ZP_00227763.1| COG1501:
FT                   Alpha-glucosidases, family 31 of glycosyl hydrolases
FT                   [Kineococcus radiotolerans SRS30216]). InterPro: Glycoside
FT                   hydrolase family 31 pfam01055, Glyco_hydro_31, Glycosyl
FT                   hydrolases family 31."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0106"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00126"
FT                   /db_xref="GOA:A5CM41"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025887"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM41"
FT                   /protein_id="CAN00126.1"
FT                   /translation="MKFTDGYWEILPGVTALYAQETHDVWEQDGGLVAYAPTKRIETRG
FT                   DTLNLPMLTVSLTSPAEGIIRVRIEHHRGTRGRGGFTLPGDKGQRMGDATVVDSVGTLT
FT                   SGPLTATIREGAPWSLEFHSGGTRLTGSGHRSVGYMHDTAGRAFVHEQLDLGVGEHIYG
FT                   LGERFGPLVKNGQSIDIWNADGGTSSEQAYKNIPFYLSDRGYGVLVNDPGAVSYEVGTE
FT                   TVERVQFSVEGETLEYLVIAGPTGKDVLERYTALAGRPALVPAWSYGLWLTTSFTTSYD
FT                   EETVNSFIDGFAERDLPLSAFHFDCFWMREFNWTDFVWDPRAFPDPDGMLKRLHERDLK
FT                   VCVWINPYIAQRSRLFDEGAAAGYLVRKPDGDVWQWDMWQAGMALVDFTNPDAVTWYQG
FT                   YLRQLVAQGVDSFKTDFGERIPTDVIWHDGSHPEAMHNLYAQLYNKAVHEVLVEERGER
FT                   DAVLFARSATVGGQAMPVHWGGDNSSSHVSMAETLRGGLSLSMGGFGFWAHDMGGFEGL
FT                   PDAGVFKRWLAFGLLSSHSRLHGSSSYRVPWLFDEEAVDVTRSFTKLKLSLMPYLFQAG
FT                   VEANERGVPVMRPMALEFFGDRAVTHLDTQYMLGGDLLVAPVFSADGTAELYLPHGRWT
FT                   NWFTDEVVQGGAWRTEKHGFDTLPLYVREGAVIPVGGRDDRPDHDYLAGLTLHVFPGPD
FT                   GARDVTVTDARTAEATTYRVERRGGFVEVTPPAGVPEPRVVLRGTQES"
FT   CDS_pept        complement(161748..162659)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0107"
FT                   /product="putative sugar ABC transporter, permease
FT                   compound"
FT                   /function="ABC-type sugar transport system permease
FT                   component"
FT                   /note="putative sugar ABC transporter, permease compound
FT                   (NP_822503.1| putative binding-protein dependent transport
FT                   protein [Streptomyces avermitilis MA-4680];; ZP_00121009.2|
FT                   COG0395: ABC-type sugar transport system,permease component
FT                   [Bifidobacterium longum DJO10A])."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0107"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00127"
FT                   /db_xref="GOA:A5CM42"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM42"
FT                   /protein_id="CAN00127.1"
FT                   /translation="MATTLPAPAPATAVVRTGDRQPRRRRTTAKRPRLATIILILGALY
FT                   CLIPVAWVVIASSKSPRELFTSFSFAPGTGLLDNFANLSSYGGGQFWLWSLNSLLYAGV
FT                   GAVLSTLISAMGGYALSKFRFRGREALFTVILAGVLVPGIVLAVPQYLLMAAIGLAGTH
FT                   WSVLLPVLINPFGIFLCRVFATAAVPEDTLEAARLDGAGEVRIFGFIALPMMTQGLVTV
FT                   FLLQFVGIWNNFLLPFIMLSDQDKYPLTLGLYTFLSKGAGDTSLYPLVIIGSAVSVIPL
FT                   IILVLVLQRFWRADLLAGGLKG"
FT   CDS_pept        complement(162659..163621)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0108"
FT                   /product="putative sugar ABC transporter, permease
FT                   component"
FT                   /function="ABC-type sugar transport systems permease
FT                   components"
FT                   /note="putative sugar ABC transporter, permease component
FT                   (NP_822502.1| putative binding-protein dependent transport
FT                   protein [Streptomyces avermitilis MA-4680];; ZP_00227865.1|
FT                   COG1175: ABC-type sugar transport systems,permease
FT                   components [Kineococcus radiotolerans SRS30216])."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0108"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00128"
FT                   /db_xref="GOA:A5CM43"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM43"
FT                   /protein_id="CAN00128.1"
FT                   /translation="MSSPTATIAPPPRPTTGRPRRRRPLRGALTPWMFAAPAIILFAAF
FT                   LIIPIIYAIYLSFRGFRVSAGGAFGRREETFIGFENYITALTDTEFVAGLGRVLLYGAI
FT                   SIPSVLGLALLFALLLDTPRIRLQSFSRTAIFLPFAVPGVIASLLWGFLYLPSTSPLSD
FT                   ISRALGGGALNFFGTPTLYFSLANIALWSGVGFNMIIIYTSLRAIPTEIYEAARIDGAT
FT                   ELQVALRIKVPLVAPALVLTGLFSVIGTLQLYSEPQTLRPFTPRISSTWVPLMKIYQDA
FT                   FTNDNLGAAAAASVILAAAILAFSLLVLRFFQRRTFGDA"
FT   CDS_pept        complement(163695..165053)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0109"
FT                   /product="putative sugar ABC transporter, binding protein"
FT                   /function="ABC-type sugar transport system periplasmic
FT                   component"
FT                   /note="putative sugar ABC transporter, binding protein
FT                   (NP_822501.1| putative solute-binding lipoprotein
FT                   [Streptomyces avermitilis MA-4680];; ZP_00227866.1|
FT                   COG1653: ABC-type sugar transport system, periplasmic
FT                   component [Kineococcus radiotolerans SRS30216]). pfam01547,
FT                   SBP_bac_1, Bacterial extracellular solute-binding protein."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00129"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM44"
FT                   /protein_id="CAN00129.1"
FT                   /translation="MSAPRPHARRTASKARRRRPLVLALAAAGALTLSLSACSAGASGD
FT                   AAADGPVTLDFWTYSVKGNDPKAQAIVDRYNELNPDVTVKLSEVGGTADTSSKLLAADR
FT                   ADETPDIVQVEYRALPSLVVAGVVKDITDDVADAKGDVADNIWDLTTFDDRVYGVPQDI
FT                   GPAMFTYRKDLLEQYGVEVPTTWAEYADAAEKIHTADPTVYISSFDPGEFQFFAAQAAQ
FT                   AGAEWWTNDGDTWKVGIDSEESLATADFWQDLVERDLVKVEALVTPEWNAEINDGKVLS
FT                   WAAASWVPSVINAVAPDTAGKWESAPLPQWTEGDASVPFIGGSAYFVPEKSSDSEAAAK
FT                   FATWLSTSDEGSKLLLTLDLYPGGNGGREATAESSPPALMPDQADFYQIADQVIEDTTI
FT                   PVTWGPNVNVAQTVFNDAMNAAALNGTSFRDVYTATQDAVVADLKKTGYSVKE"
FT   CDS_pept        165201..166802
FT                   /transl_table=11
FT                   /locus_tag="CMM_0110"
FT                   /product="putative xylosidase, glycosyl hydrolase family
FT                   43"
FT                   /function="Beta-xylosidase"
FT                   /EC_number="3.2.1.-"
FT                   /note="putative xylosidase (NP_693008.1| xylosidase;
FT                   arabinofuranosidase [Oceanobacillus iheyensis HTE831];;
FT                   XYLB_BUTFI Xylosidase/arabinosidase [Includes:
FT                   Beta-xylosidase (1,4-beta-D-xylan xylohydrolase) (Xylan
FT                   1,4-beta-xylosidase); Alpha-N-arabinofuranosidase
FT                   (Arabinosidase)]). pfam04616, Glyco_hydro_43, Glycosyl
FT                   hydrolases family 43."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0110"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00130"
FT                   /db_xref="GOA:A5CM45"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="InterPro:IPR041542"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM45"
FT                   /protein_id="CAN00130.1"
FT                   /translation="MSTFQNPVLTGMNPDPSLCAVGDEFFLVTSSFAYWPGIPVHRSRD
FT                   LVHWEQIGHVLDRPEQIDLSGIDTSDGIWAPTIRHHDGIFYVVSTVARDRRGGVNFVTT
FT                   ALDAAGPWMQPVVLDAEGIDPSLFFDDDGRCWFTACRDAEDPFLRGPAELYIQELDLET
FT                   LQLTGPLHVLWNGAVAGAWAEAPHIYKRDGVYYLIAAEGGTERNHSVTAARSATVTGPY
FT                   RTDPRSPLLTHRHLGPEAVFQNVGHADIVETPAGETWALVLATRPLDGAHTLGREVFLV
FT                   PAEWTDDGLLLAPGFGHVREMERAPISMLSDAPTPDAPSVERELFEGAGLPPGWRSLRG
FT                   PVRGQEQACGAGVSLRASSDDLSDRGTPSFLARRQEHQSFEARTSVSFRPQSSSNEAGL
FT                   AVFYDERHFATLAVTLDEDGRPIVRFQRSGTSGTSGEVAVTPDGEMLLRVIGDLDAYVF
FT                   SCWDERQGDWLTLGKVPRAWFSTEHAGGFVGVHVGLYAVGAGEDAAETALFPWFEYISA
FT                   SGQARMPSSRAVLAIS"
FT   CDS_pept        166885..167691
FT                   /transl_table=11
FT                   /locus_tag="CMM_0111"
FT                   /product="putative sugar phosphate isomerase/epimerase"
FT                   /function="Sugar phosphate isomerases/epimerases"
FT                   /note="putative sugar phosphate isomerase/epimerase
FT                   (ZP_00229027.1| COG1082: Sugar phosphate
FT                   isomerases/epimerases [Kineococcus radiotolerans
FT                   SRS30216];; NP_774276.1| bll7636 [Bradyrhizobium japonicum
FT                   USDA 110])."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0111"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00131"
FT                   /db_xref="GOA:A5CM46"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM46"
FT                   /protein_id="CAN00131.1"
FT                   /translation="MTAPSVQLYTVRDAVSADLQGAVARVAEIGYTQVEPYAFVERADE
FT                   FAAAFAASGVTAPSGHAPVIDGDDDQAARTFDAAAKLGIRTVIDPFIPSERWQTADDAH
FT                   RIADRVNELQVQAAARGLAFGYHNHQWEFANKVDGRPIYELFVERLDADVVLELDAFWS
FT                   TVGGMDTPALLEQLGDRVRFLHVKDGKISDAIAKVLPSAESALVVPPELAQAFKMQEPA
FT                   GQGDVDVAAVLAAAPHALRVVEFDDYEHDVFDGIAASYAWLQENDK"
FT   CDS_pept        167688..168797
FT                   /transl_table=11
FT                   /locus_tag="CMM_0112"
FT                   /product="putative dehydrogenase/oxidoreductase"
FT                   /function="Predicted dehydrogenases and related proteins"
FT                   /note="putative dehydrogenase/oxidoreductase
FT                   (ZP_00227973.1| COG0673: Predicted dehydrogenases and
FT                   related proteins [Kineococcus radiotolerans SRS30216];;
FT                   NP_241574.1| BH0708~unknown conserved protein [Bacillus
FT                   halodurans C-125]). pfam01408, GFO_IDH_MocA,Oxidoreductase
FT                   family, NAD-binding Rossmann fold. This family of enzymes
FT                   utilise NADP or NAD."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0112"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00132"
FT                   /db_xref="GOA:A5CM47"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM47"
FT                   /protein_id="CAN00132.1"
FT                   /translation="MTGGTGRVGVGVIGAGVISGTYLENMTAMPDLEVLFVADIDLDRA
FT                   RSRAEEHGVPNHGTVDELLAMDEIEIVVNLTLPATHAEVGRRIVAAGKHVWSEKPLALD
FT                   HESGQDLLEAARAAGVQVACAPDTVLGAGIQSAMRAIARGDIGEPLTATTLFHVPGPDA
FT                   WHPNPEFLFARGAGPLFDMGPYYVTTLVHAFGAAETVSAVSSTSRTTRTIGSGPRAGTD
FT                   FPVEVPTHHAALISFAGGQSAQSTFSFQNALPRMGFVEISGSEGTIVLPDPNTFEGDSQ
FT                   LWRFGQEGPETLTAAGSTYGRGSGVLDLARSIRGGDPVRASGEVAAHVLDVLLAIRDAA
FT                   DSREVVEVASSVAKPTPLAEDWDPAAATL"
FT   CDS_pept        168891..169622
FT                   /transl_table=11
FT                   /locus_tag="CMM_0113"
FT                   /product="putative hydrolase"
FT                   /function="Predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily)"
FT                   /note="putative hydrolase (ZP_00194950.1| COG0596:
FT                   Predicted hydrolases or acyltransferases (alpha/beta
FT                   hydrolase superfamily) [Mesorhizobium sp. BNC1];;
FT                   ZP_00024553.1| COG0596: Predicted hydrolases or
FT                   acyltransferases (alpha/beta hydrolase superfamily)
FT                   [Ralstonia metallidurans])."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0113"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00133"
FT                   /db_xref="GOA:A5CM48"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM48"
FT                   /protein_id="CAN00133.1"
FT                   /translation="MQLHRVTTGSGARHVGLVHGLGADGATWAPVVERLVATGRFTVTT
FT                   VDLRGHGQSDRAPAYGIEDMADDLVASLPRELDAVVGHSLGGSVLVRAVARLEPARAVY
FT                   LDPGFRLALPTTGIRGRLFWAAPLVGLAAAQIPRARAAARVRAAYPASVRASLDAAQAR
FT                   FDRGMAVGVFRDVAFHPLAVSAPAVPSTIVLSEDAPSVLPDACAADLERHGWDVRRLPG
FT                   IHHDMQLEDPDRVLAAIEDVL"
FT   CDS_pept        169619..170332
FT                   /transl_table=11
FT                   /locus_tag="CMM_0114"
FT                   /product="hypothetical protein"
FT                   /function="unknown"
FT                   /note="hypothetical protein (NP_624727.1| hypothetical
FT                   protein SCF51.05 [Streptomyces coelicolor A3(2)];;
FT                   NP_601349.1| hypothetical protein NCgl2067 [Corynebacterium
FT                   glutamicum ATCC 13032]). contains COG1413, FOG: HEAT
FT                   repeat."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0114"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00134"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM49"
FT                   /protein_id="CAN00134.1"
FT                   /translation="MTDDARPDRPADAEIAARLAAALRSPDPSARLQAALTAGTRPDPA
FT                   LVEGLIHRCRVEPDLNVREMLTWALIRHDEELTIPPLIAELASPIPQARSQALHTLSKI
FT                   GDRRALPAITPALLRDPDDHVARTAWRTASGLVDGDRDPAGARWLSQQLASQLGRGDRD
FT                   TQASLARAFASVGRAALPVLERSRRAADARVRIHALAVIALHDDPDLRFDEAVDEARRS
FT                   SFGAHLARRPGLHLP"
FT   CDS_pept        170415..171371
FT                   /transl_table=11
FT                   /locus_tag="CMM_0115"
FT                   /function="putative transcriptional regulator, MerR family"
FT                   /note="putative transcriptional regulator, MerR family
FT                   (ZP_00191993.3| COG0789: Predicted transcriptional
FT                   regulators [Kineococcus radiotolerans SRS30216];;
FT                   NP_822962.1| putative MerR-family transcriptional regulator
FT                   [Streptomyces avermitilis MA-4680]). pfam00376,MerR, MerR
FT                   family regulatory protein."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0115"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00135"
FT                   /db_xref="GOA:A5CM50"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM50"
FT                   /protein_id="CAN00135.1"
FT                   /translation="MTATPIPMPTPPRRVRIGDAAAFVGITPRTIRHYHQIGLIPEPER
FT                   GTDDRRRYGYADMVRLMWIRRMADAGIALEDIRAAFADPEAGEAAAAAADAAAPAAAPA
FT                   GDDDVADVLGRLEATLAAQEAELRRQRDAVRRLRARGSRLGLLSDLVARRLDGLPEGSL
FT                   RQADLDALLVMERSLGTLVAALNATRYIAVATLPGLREASDRVDAAEEALDDTVAVDDP
FT                   RVAEVAAERRAFEEALQAAIDASDLPRQDEELIAAWDELHPDGDGDEDDARGGSGRPAR
FT                   SLSTMDAFTKMPYDFSPARLRSMELAMDFVVWGPPAR"
FT   CDS_pept        171496..172086
FT                   /transl_table=11
FT                   /locus_tag="CMM_0116"
FT                   /product="putative dienelactone hydrolase"
FT                   /function="Dienelactone hydrolase and related enzymes"
FT                   /EC_number="3.1.1.-"
FT                   /note="putative dienelactone hydrolase (ZP_00210010.1|
FT                   COG0412: Dienelactone hydrolase and related enzymes
FT                   [Magnetospirillum magnetotacticum];; ZP_00228563.1|
FT                   COG0412: Dienelactone hydrolase and related enzymes
FT                   [Kineococcus radiotolerans SRS30216]). pfam01738,
FT                   DLH,Dienelactone hydrolase family."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0116"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00136"
FT                   /db_xref="GOA:A5CM51"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM51"
FT                   /protein_id="CAN00136.1"
FT                   /translation="MAEIVLFHHVQGATPGVHAFADALRDGGHTVHVPDLFDGALPESI
FT                   EAGLALMAGLADHVVAERTARALDGLPADLVYAGFSWGGSIAQRLAQTRPGARVALLYE
FT                   SFVSLSAEWSFGPWPAGLPVQVHGMARDPFFAGEGDLDAARELVAVVGPELAEVFVYDG
FT                   DAHLFTDASLPSSDPVATALVLERSLELLARIG"
FT   CDS_pept        complement(172096..173580)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0117"
FT                   /product="putative MFS-type efflux protein"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /note="putative drug-resistance MFS transporter (S70171
FT                   integral membrane protein - Streptomyces
FT                   pristinaespiralis;; NP_628206.1| putative integral membrane
FT                   efflux protein [Streptomyces coelicolor A3(2)]). InterPro:
FT                   General substrate transporters 14 transmembrane helices"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0117"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00137"
FT                   /db_xref="GOA:A5CM52"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM52"
FT                   /protein_id="CAN00137.1"
FT                   /translation="MSTPTITTAPPRGYASLRAAAIPLAALCLAFFVEMVDNTLLSIAL
FT                   PTIGRALDSGTTGLQWVTSAYSLTFGGLLLTAGSAADRFGRRRVLLIGLAAFGLISVAV
FT                   VLVTDIGQLIALRAALGAAAAAMAPVTMSLIFRLFDDEKLRMRSITIVMVVGMSGFVLG
FT                   PLLGGSILGAVSWQWLLVINAPLALLVWIGVRLGIPADRRDDLTSERLDLPGTVLTVAA
FT                   IGLGCYTLTSGVERGWLAPVTLACALGAVAAVAGFVLRERRTASPMIDLAIFRAGPVRG
FT                   AALTQLGASVAFASILFGLILHFQYAYGWSPMRAGLANLPIIVTMIAASPIAERLASRL
FT                   GHRMACLVGTGFLVGGLVGLAWAVEHGYLAIMASMIVFTIGLRTIMTICAVALVEAMPA
FT                   NRTSIGAALNDTAQELGTSLGTAVVGTLIAALVTTALPAGAWSAELVRSFFAGERAAYL
FT                   VVAVLTGVIATVGALSLSDSRTTEEPAAPEAAHVAA"
FT   CDS_pept        173663..174409
FT                   /transl_table=11
FT                   /locus_tag="CMM_0118"
FT                   /product="putative TetR-family transcriptional regulator"
FT                   /function="Transcriptional regulator"
FT                   /note="putative TetR-family transcriptional regulator
FT                   (NP_631278.1| putative TetR-family transcriptional
FT                   regulator (NP_631278.1| putative TetR-family
FT                   transcriptional regulator [Streptomyces coelicolor A3(2)];;
FT                   NP_792454.1| transcriptional regulator, TetR family
FT                   [Pseudomonas syringae pv. tomato str. DC3000]). pfam02909,
FT                   TetR_C, Tetracyclin repressor, C-terminal all-alpha
FT                   domain."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0118"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00138"
FT                   /db_xref="GOA:A5CM53"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM53"
FT                   /protein_id="CAN00138.1"
FT                   /translation="MAANGSPKTESTRTPPARARGRQRASHSLDTVLAEAIGILDESGE
FT                   RALTFRALAARLGGGVASIYWYVASRDELLEKVTEEVMGRVLADTEPLTHGSDPVDNVR
FT                   AVALALFDELVRRPWFGQYMLRNNGLQPNSMLMYERIGQQLLGLDLTSRQRFHAVSSIV
FT                   SYVVGVAADLAEPPPQEFLDSGLDREGFLGTLADRWRELDPDEYPFAHDAAGEMATHDD
FT                   LDVFRSGLDLLLAGVRQQAGLPPASS"
FT   CDS_pept        complement(174435..175130)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0119"
FT                   /product="transcriptional regulator, TetR family"
FT                   /function="Transcriptional regulator"
FT                   /note="putative transcriptional regulator, TetR family
FT                   (NP_827877.1| putative TetR-family transcriptional
FT                   regulator (NP_827877.1| putative TetR-family
FT                   transcriptional regulator [Streptomyces avermitilis
FT                   MA-4680];; NP_737549.1| transcription regulator AmtR
FT                   [Corynebacterium efficiens YS-314]). pfam00440,
FT                   TetR_N,Bacterial regulatory proteins, tetR family."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0119"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00139"
FT                   /db_xref="GOA:A5CM54"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM54"
FT                   /protein_id="CAN00139.1"
FT                   /translation="MAKDDKPARVGRPRAVPDAGSPLSPREQILDAAAALFAEHGLSGT
FT                   STRAIAERVGIRQASLYYHFAGKDDLLVELLTRSVRPSLDVVRGIEDLVPDRATAAAAL
FT                   HALVMVDFRTLADTPHNIGTLYLLPEVQGERYDGFRTQRRELQDAYGRIGTAAATADVR
FT                   ATIGPDALGAVLIQLAELVIQLRRRGEPGGADRDAIAATCLRACGLGTAGIAEARREAQ
FT                   ELLATVPAP"
FT   CDS_pept        complement(175154..178837)
FT                   /transl_table=11
FT                   /gene="uahA"
FT                   /locus_tag="CMM_0120"
FT                   /product="putative urea amidolyase"
FT                   /function="Biotin carboxylase"
FT                   /EC_number="6.3.4.6"
FT                   /note="putative urea amidolyase (NP_923904.1| probable urea
FT                   amidolyase [Gloeobacter violaceus PCC 7421];; NP_946755.1|
FT                   putative urea amidolyase [Rhodopseudomonas palustris
FT                   CGA009]). domain combination of urea hydrolase related
FT                   proteins: pfam00289, CPSase_L_chain, Carbamoyl-phosphate
FT                   synthase L chain, N-terminal domain. pfam02786,CPSase_L_D2,
FT                   Carbamoyl-phosphate synthase L chain, ATP binding domain.
FT                   pfam02785, Biotin_carb_C, Biotin carboxylase C-terminal
FT                   domain. pfam02626, AHS2,Allophanate hydrolase subunit 2.
FT                   pfam02682, AHS1,Allophanate hydrolase subunit 1. pfam00364,
FT                   Biotin_lipoyl,Biotin-requiring enzyme."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0120"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00140"
FT                   /db_xref="GOA:A5CM55"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR014084"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM55"
FT                   /protein_id="CAN00140.1"
FT                   /translation="MSGGGERIALVSGAGGERRALDLDTVLVANRGEIACRVIRTAKAM
FT                   GMRTVAVFSDADRAAPHVREADEAVRLGPAAPRESYLRIDAIIEAARATGAGLIHPGYG
FT                   FLSENLEFASACEEAGIRFVGPTADQILAFGAKHTARELAEAAGVPLLAGTGLLADADE
FT                   AVAEAERIGLPVMLKATGGGGGIGMQACATADEVREAFGRVTRLAESAFGSTDVFLERL
FT                   VRPARHVEVQLVGDGQGRVAVIGDRDCSLQRRNQKVIEEAPAPALPDRVRAQLHDSARA
FT                   LAESVSYRSAGTVEFVYDPVREEAAFLEVNTRLQVEHPVTEEVHGVDLVELMLLLARDG
FT                   AAGLPDDLFTRQWIPEGHAVEARVYAEDPAKGSLPSSGLVTQAVLPAGPGIRVDGWIET
FT                   GLEVSASYDPLLAKVIATGETRDDALDLLGEALDGSRIDGIVTNIGLLRALTDDIELRT
FT                   ATHSTSTLDETDDPAPRIDVVSPGTMTTVQDLPGRLGYWQVGVPPSGPFDPVSLAEANL
FT                   AVGNPEGAPGLEITADGPVLRFSTASVAAVTGAPAPVTIDGEPAAMWEPLEVAAGQTLA
FT                   IGRADGPGLRLFLAVRGGIDVPSYLGSASTFTLGRFGGHAGRALLAGDVLRPGSPDSDA
FT                   AHPAFRAGARLGIIGGPTPAHRRPALTSTWEIGVTEGPHAAPDFFTRADIDVLYATDYG
FT                   VHHNSARTGIRLIGPRPGWAREDGGEAGLHPSNIHDTPYAVGAIDFTGDTPIILGPDGP
FT                   SLGGFVCPAVVASGELWKLGQLRPGDTVRFVPVTEAAAASLVDARASLQVIRAGGDGDD
FT                   GVIGRLEPTDARPGVAYRRDGDDNVLVEYGDMTLDIALRMRVHALMTRLQEHMPPGVLE
FT                   LTPGIRSLQVRTDARVLKATAVTRLLQELEDEIPPTGQLVVPSRKVRLPLSWDDPATRL
FT                   AIERYMAGVRDDAPWTPWNIEFIRRINGLDSVDDVFRTVFDASYLVLGLGDVYLGAPVA
FT                   TPLDPRHRLVTTKYNPARTWTAENSVGIGGAYLCIYGMEGPGGYQFVGRTVQIWNRFRR
FT                   GGLFQEDPWALRFFDRIEWYPVGAEELLELRAETDAGRGRYETEDGEFSIADHHAFLAA
FT                   NDASIRDFRDTQTRAFEEEKARWRLSGEFDVRDEPPVVEAATVPIPPGATAVTAPFTST
FT                   VWRVDVRPGDLLGVGDAVLAVEAMKMESVVGAPVAGRVLDVHIRPGEQVAPGQVLAVIG
FT                   AG"
FT   CDS_pept        complement(178834..179526)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0121"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /note="conserved hypothetical protein (NP_737324.1|
FT                   conserved hypothetical protein [Corynebacterium efficiens
FT                   YS-314];; ZP_00225763.1| COG3665: Uncharacterized conserved
FT                   protein [Kineococcus radiotolerans SRS30216])."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0121"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00141"
FT                   /db_xref="InterPro:IPR017791"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM56"
FT                   /protein_id="CAN00141.1"
FT                   /translation="MTRTVASPVPTGAVHAPDAVLDWGSSLVEGTVVRDDRVAPLAPWS
FT                   AVVRAGEVLTIVDVGGNQSADCLIYDAQDPDERYSVPDTLVAQGNAYIRTGTVLMSSEG
FT                   RPLMTVVGNEIDRQDTLGGACSKESNTLRYGHHTAYQHGCRENFLTEASRHGLGAPDIV
FT                   SNINWFMNVPVEEDGSLGIVDGMSAPGKRVALRAERDVLVIVSNCPQMNNPCNDFSCTP
FT                   LRMIVVQP"
FT   CDS_pept        complement(179523..180365)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0122"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /note="conserved hypothetical protein (ZP_00225764.1|
FT                   COG3665: Uncharacterized conserved protein [Kineococcus
FT                   radiotolerans SRS30216];; NP_737325.1| conserved
FT                   hypothetical protein [Corynebacterium efficiens YS-314])."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0122"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00142"
FT                   /db_xref="InterPro:IPR017792"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM57"
FT                   /protein_id="CAN00142.1"
FT                   /translation="MRDQRTTDSVTASRADARAQADRRSEWMPYVPASSSPFRPDGVAA
FT                   DELTWAETVAPGGYAHRVLARGSRLRFDDPTGDACAHLVLHDALAPWERLNVADTVKIP
FT                   WQAYLGEGWPLLSGDGRILASIVEDDSGHHDALCGTSTDALNDRRYGGSAPEGPTPSGR
FT                   SLLVKAAAKHGLTRRDLPPGVSLFQGVRVEADGALRPTGSAGPGTHVTLVAEMPLIVLI
FT                   ANVPHPLDPRPDHVVGPLRIHAWRGSPTGPGDARFHATPELTRAYLNSIDHCEARGTR"
FT   CDS_pept        complement(180362..181945)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0123"
FT                   /product="putative amino acid permease, APC family"
FT                   /function="Amino acid transporters"
FT                   /note="putative amino-acid permease, APC family
FT                   (ZP_00225765.1| COG0531: Amino acid transporters
FT                   [Kineococcus radiotolerans SRS30216];; NP_827885.1|
FT                   putative amino acid/metabolite permease [Streptomyces
FT                   avermitilis MA-4680])., pfam00324, AA_permease, Amino acid
FT                   permease."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0123"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00143"
FT                   /db_xref="GOA:A5CM58"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM58"
FT                   /protein_id="CAN00143.1"
FT                   /translation="MSTPNLPPHPSAPTPVIPPGYAQELHRGVGPFSSFAAGFSFVSIL
FT                   TTVFQLFGLGFGLGGAAFFWAWPIVFVGQLLVALNFAQLAASWPISGAIFQWSSRLAGT
FT                   TFGWFTGWTMIVGQILTVAVAAIAVQAVLPSIWAGFQIVGGPGADPSVASPTGSANAVL
FT                   LGIIMLAITTVVNILSVRLMARVTTAGVAIEMVGVVALVAVLFLLPKRGPEVVFTTAGS
FT                   ASEEPYVWAFLASSLMAAYVMVGFDSAGELAEETHSPRKTTPKTIIRALTVSGLGGALL
FT                   IVGALVAAPSLTDGNLATQGLAWVITSVAGEVGGRLLLCAVAVAVFACTLAVQTSGTRM
FT                   IYSMAREKALPFHRQLAKVSPRTGTPVLTSVVVGVGAVLALAVNAGQSAIFTALSSLCI
FT                   AMLYLAYLGVTGPLLVARIRGRFPAGGVDEDGEPLFTLGRWGIPINAVAVLFQAAMAVN
FT                   LIWPRPEIYDLTGESWWLQYSALLFIGATLLVGWGYHAWRHRSDGPIRLTEVPTTATIP
FT                   VVEPAGASIR"
FT   CDS_pept        complement(182195..185590)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0124"
FT                   /product="putative acyl-CoA synthetase"
FT                   /function="Acyl-CoA Synthetase and dehydrogenase component
FT                   of non-ribosomal peptide synthetases and related enzymes"
FT                   /EC_number="6.2.1.-"
FT                   /note="putative acyl-CoA synthetase (AAR91681.1|
FT                   ATP/NADPH-dependent carboxylic acid reductase [Nocardia sp.
FT                   NRRL 5646];; NP_959974.1| FadD9 [Mycobacterium avium subsp.
FT                   paratuberculosis str. k10])., N-terminal domain:
FT                   COG1022,FAA1, Long-chain acyl-CoA synthetases
FT                   (AMP-forming),pfam00501, AMP-binding, AMP-binding enzyme.
FT                   pfam00550, PP-binding, Phosphopantetheine attachment site.
FT                   A 4'-phosphopantetheine prosthetic group is attached
FT                   through a serine. , C-terminal domain: COG3320, COG3320,
FT                   Putative dehydrogenase domain of multifunctional
FT                   non-ribosomal peptide synthetases and related enzymes
FT                   acyl_carrier: acyl carrier protein, may be involved in the
FT                   activation of fatty acids or part of a PKS/NRPS."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0124"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00144"
FT                   /db_xref="GOA:A5CM59"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010080"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM59"
FT                   /protein_id="CAN00144.1"
FT                   /translation="MSTEQMGTEQMGSQHEDTSIEAIFAQHADRTALRQRSGPDITDMG
FT                   FRELWDRAGALAAALGETVSAGDRIAVLGTATADAVTLDLAAWILGAVSVPLQASAPVA
FT                   ALRAIVEETTPVWIAATADQAATARAVAEASGDGIRTMRLDTDTDADTDTDAALTLGAL
FT                   VARGAGLRRRSPWHPAPGDDPLALLLYTSGSTGTPKGAMYTRSMVERMWHALRPDPAAP
FT                   ADASTTADDGDAAAIVGYAYLPMSHLTGRSSLLATLGRGGTVALATSTDLSTLFDDLRT
FT                   FAPTEFVFVPRVAELVRQEGDREEQRRLTAGSTDRDAVRAEVQADLRARAFGGRIHRAI
FT                   CTSAPLTPELRTYIEGCLGLTLHDLYGSTEAGGILHDGVIQQPPVTEHKLVDVPELGYR
FT                   TTDRPHPRGELLVKSASVIAGYFRRPDVTAAVFDEDGFYRTGDVMAQTGPGTYEYVDRR
FT                   NNVIKLSQGEFVAVASLEATYGGTPEVHQIALHGDSRHAFLVAVVVPADPAASERDILA
FT                   ALQRTAREHGLAPYEVPRGVIVEPDPFTVDGGMLSDAGKLLRLRLTQRYGERLAALYDA
FT                   LEEQQSGTLVAALRERADDEPTVDTVVRAALLLLGAEVSPATAAAARFSDLGGDSLSAL
FT                   TFSGILEDVFGTEVPVGVLTDPTNDLAAVAAYVERSASDDRPTVTRVHGAGASTLRVGD
FT                   LRLDRMLGGIPTPVPRASAARPGSRTVLLTGANGYLGRFLAIDWLERLAATGGTLVCIV
FT                   RGADDADARRRLEAAFAADPAFARRFAELSGSLEVLAGDVSEHRLGLDDERWIDLAARV
FT                   DLVAHAAALVNHVLPYSALFGPNVVGTAEAIRLAIAAGSVPVTFVSSVAVAGGARPGAT
FT                   ADAEPSAPGALDEHADIRATIPEWAVGDEYANGYGASKWASEVLLREAHEHHGVPVAVF
FT                   RSDMILAHPRWRGQVNLPDVFTRLIWSVLTTGLAPASFVRRGPDGERQRSHYDGLPADF
FT                   TAAAIDGIGAALTEGHRTFNVVNPHDDGVSLDTFVDWIREDGHDIARVDDHAEWVDRFR
FT                   AALGALPDADRARSVLPLMHAFASPEEPHAGSAIPADAFAEAVRAVRPLGSPDIPSLDH
FT                   ALIAKVADDLAFLGLLAPARAAAA"
FT   CDS_pept        complement(185595..186320)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0125"
FT                   /product="putative 4-phosphopantetheinyl transferase"
FT                   /function="Phosphopantetheinyl transferase component of
FT                   siderophore synthetase"
FT                   /EC_number="2.7.8.-"
FT                   /note="putative 4-phosphopantetheinyl transferase
FT                   (Enterobactin synthetase component D) (NP_822924.1|
FT                   putative phosphopantetheinyl transferase [Streptomyces
FT                   avermitilis MA-4680];; AAR92400.1| Sfp-type
FT                   phosphopantetheinyl transferase [Saccharopolyspora
FT                   erythraea])."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0125"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00145"
FT                   /db_xref="GOA:A5CM60"
FT                   /db_xref="InterPro:IPR003542"
FT                   /db_xref="InterPro:IPR041354"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM60"
FT                   /protein_id="CAN00145.1"
FT                   /translation="MSVQLLSRIPWGELLPDSVVVAAADHDVDGGLAGDESDAVATALP
FT                   GRRAEFVTGRVLARRALAALGRRPGSIPVARDGAPVWPAGIVGSITHCVGLRACAVGRR
FT                   DEHAGIGIDATPARPLPGGVLARVADLGSAPVAAGLDALRATGVEAPGSVLFAAAEAVA
FT                   KARTSAQGGWHGIDGAEIVLHPDGSFAVRARRGPDFTGTGRWAVAGGLALAGIALDEHW
FT                   SRRAGARRDERREDGHIGD"
FT   CDS_pept        complement(186504..187316)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0126"
FT                   /product="hypothetical protein"
FT                   /function="unknown"
FT                   /note="hypothetical protein (EAM74364.1| hypothetical
FT                   protein KradDRAFT_1431 [Kineococcus radiotolerans
FT                   SRS30216];; ZP_00413143.1| hypothetical protein
FT                   ArthDRAFT_2026 [Arthrobacter sp. FB24])."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0126"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00146"
FT                   /db_xref="GOA:A5CM61"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM61"
FT                   /protein_id="CAN00146.1"
FT                   /translation="MTDDRTPDPDAPHALEQPGREPDDRRGELIAAALADDLSPAETVE
FT                   LHAMRAADPSVDEEMALLGGLPGALGALGGWREEEPSDELARRIGLIADGRGEVEPMAA
FT                   TTATTAADGPADLDAHRPRRGSGPRRTAFLIAGAAACLAVGAAGGAFLATPRADVATGP
FT                   AGTLGAVEDVTFAGAPAGVDVEGDVVAHTWGTETLLTVDGLTAGDSYSVVVVDAAGGEH
FT                   SSGTMLGSAVRIDCRLNADVLRRDAASVEIRDAAGDRIAVAELPPVNA"
FT   CDS_pept        complement(187313..187864)
FT                   /transl_table=11
FT                   /gene="sigX"
FT                   /locus_tag="CMM_0127"
FT                   /product="putative RNA polymerase ECF-subfamily sigma
FT                   factor"
FT                   /function="DNA-directed RNA polymerase specialized sigma
FT                   subunit sigma24 homolog"
FT                   /note="putative RNA polymerase ECF-subfamily sigma factor
FT                   (NP_627178.1| putative RNA polymerase sigma factor
FT                   [Streptomyces coelicolor A3(2)];; YP_121728.1| putative
FT                   sigma factor [Nocardia farcinica IFM 10152]).
FT                   pfam04542,Sigma70_r2, Sigma-70 region 2. Region 2 of
FT                   sigma-70 is the most conserved region of the entire
FT                   protein. pfam04545,Sigma70_r4, Sigma-70, region 4."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0127"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00147"
FT                   /db_xref="GOA:A5CM62"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM62"
FT                   /protein_id="CAN00147.1"
FT                   /translation="MALVLTRPAPAPERSTMSASPPGFDVREAFAEHGGALLGFAVNAL
FT                   QDRQLAEDCVQETFLRAWRARDSFDGERGNARTWLFAIERRVILDVHRARARAPRIVAE
FT                   DEAPEQATREADPLDRLGIVEGLARLSDAHREAVVAVHLTGLSYQELSTATGVPVATLR
FT                   TRVFHALRALRTHLDEVDPA"
FT   CDS_pept        188085..188795
FT                   /transl_table=11
FT                   /locus_tag="CMM_0128"
FT                   /product="conserved hypothetical protein"
FT                   /function="unknown"
FT                   /note="conserved hypothetical protein (XP_390017.1|
FT                   hypothetical protein FG09841.1 [Gibberella zeae PH-1];;
FT                   NP_923811.1| hypothetical protein gll0865 [Gloeobacter
FT                   violaceus PCC 7421])."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0128"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00148"
FT                   /db_xref="GOA:A5CM63"
FT                   /db_xref="InterPro:IPR010895"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM63"
FT                   /protein_id="CAN00148.1"
FT                   /translation="MTHTRLVRNMTIGGAAAAALALLAATPASAETTVPEPDRFTSAFT
FT                   VMATPDQVLNADGVATPGEPGATGRFDLRLDSASNTICYDITLTGVTGEYQSPAKTATH
FT                   IHQAAVGKAGPPRIAFPNPVDAGNGTRTSSGCMQGPFTTGIMNAQDQDTGTGFTVAQIE
FT                   ADPASFAADTHTASFTAGAVRGQLTQVPVGGVDTGAGGSATTTSALPLVAGGGAVALAA
FT                   AGVVLMRRRLAQES"
FT   CDS_pept        188801..189469
FT                   /transl_table=11
FT                   /locus_tag="CMM_0129"
FT                   /product="putative sortase"
FT                   /function="Sortase (surface protein transpeptidase)"
FT                   /note="putative sortase (NP_631498.1| putative secreted
FT                   protein [Streptomyces coelicolor A3(2)];; NP_693584.1|
FT                   hypothetical protein OB2663 [Oceanobacillus iheyensis
FT                   HTE831]). cd00004, Sortase, Sortase domain; transpeptidase
FT                   of Gram-positive bacteria, cleaves surface proteins at the
FT                   LPXTG motif between Thr and Gly and catalyzes the formation
FT                   of an amide bond between the carboxyl group of Thr and the
FT                   amino group of cell-wall crossbridges. In two different
FT                   classes of sortases the N-terminus either functions as both
FT                   a signal peptide for secretion and a stop-transfer signal
FT                   for membrane anchoring, or it contains a signal peptide
FT                   only and the C-terminus serves as a membrane anchor.
FT                   pfam04203, Sortase, Sortase family. The founder member of
FT                   this family is S.aureus sortase, a transpeptidase that
FT                   attaches surface proteins by the threonine of an LPXTG
FT                   motif to the cell wall."
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00149"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042001"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM64"
FT                   /protein_id="CAN00149.1"
FT                   /translation="MHHGPADASPARRARRAAVLAGALIPLAVLAGCAPADPGPAPAAP
FT                   PAAATAAPSAPPTTAPSDPPTSAPTVVQGLGAVPTRVAIPAIDLDQPLIDLGIAADGRM
FT                   EVPVDFDDVGWFTGGGRPGGRGPTVIAAHVDSRVGPAAFGRLAELGVGDEVSVQDVDGG
FT                   STRYVVTEVADFPKADFPTARVFGAQATDQLRLITCGGIFDRSVGHYEDNRVVFAEPVG
FT                   "
FT   CDS_pept        complement(189495..189755)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0130"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein ("
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0130"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00150"
FT                   /db_xref="GOA:A5CM65"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM65"
FT                   /protein_id="CAN00150.1"
FT                   /translation="MESTEPPSILLPAAYDVVWSVVAVVVIVAIVIALVALVRFARAGR
FT                   RARAASAALDEARLELVRERTARLRAGLPDAGGADPEDPAA"
FT   CDS_pept        complement(189769..190011)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0131"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00151"
FT                   /db_xref="GOA:A5CM66"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM66"
FT                   /protein_id="CAN00151.1"
FT                   /translation="MISSGIGFGLTWYLFVTLAVVVLAVILAVVLIRLALAARRTLLVT
FT                   ATLQEARLELIREQTARLQADRPGAPDAGPVDPIA"
FT   CDS_pept        complement(190129..191409)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0132"
FT                   /product="hypothetical protein"
FT                   /function="unknown"
FT                   /note="hypothetical protein (only weak similarities to RTX
FT                   toxins (ZP_00116833.1| COG2931: RTX toxins and related
FT                   Ca2+-binding proteins [Cytophaga hutchinsonii]) and phage
FT                   capsid proteins (NP_861884.1| Hoc head outer capsid protein
FT                   [Enterobacteria phage RB69]))."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0132"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00152"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM67"
FT                   /protein_id="CAN00152.1"
FT                   /translation="MIRTTGGRRLPLTALAVVVAAGTAFAGVAPAQAATTTAPAADAVP
FT                   AAASTTAAVRIPAPVVRPEWFDFGTQPVFHGLFEVDLTGIPEGADLHYEYQLDGTGPWR
FT                   TGGSGSVTGYTDEVYLPGTAGTHLLSVRVAGTVDGAAVVGAASAPQEARFVGGSLEYTP
FT                   EVIVDGPSVTFRWDVRSALNGFTPEESAIYYSVDGAPLIEVGGVGSLTVTPGYGKRVSF
FT                   DLTFGYIADSYREVHVDGLTADAPGAKALTAPLPSIVGTAEYGQTLSVRSGTWQPAPVE
FT                   LEYRWFRDGERIRGAEDPTYTVTAYDAGHRITVSVRGSRDGYISQTRTSGPTKRIAAPV
FT                   ITAGTPRITGNPVVGRTLTAQPGVWKPSSLELGYQWKRDGKAIAGATAKTYTLTEADRG
FT                   HTVTAVVSAVIYLYDNQARASAGVKVR"
FT   CDS_pept        191551..192192
FT                   /transl_table=11
FT                   /locus_tag="CMM_0133"
FT                   /product="putative pyroglutamylpeptidase"
FT                   /function="putative peptidase"
FT                   /note="putative cysteine peptidase, family C15
FT                   (NP_931479.1| Pyrrolidone- carboxylate peptidase
FT                   (5-oxoprolyl-peptidase) [Photorhabdus luminescens subsp.
FT                   laumondii TTO1];; ZP_00024570.1| COG2039:
FT                   Pyrrolidone-carboxylate peptidase (N-terminal pyroglutamyl
FT                   peptidase) [Ralstonia metallidurans]). pfam01470,
FT                   Peptidase_C15,Pyroglutamyl peptidase."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0133"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00153"
FT                   /db_xref="GOA:A5CM68"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="InterPro:IPR016125"
FT                   /db_xref="InterPro:IPR029762"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5CM68"
FT                   /protein_id="CAN00153.1"
FT                   /translation="MPTVLLTGFEPFDGDTSNPSWTAVQEVRDRWDGDAEIQVRQLPVD
FT                   FAKVDDALRAALAEVDPDVVISVGLAGGIETLEVERVAINVDDARIPDNTGFQPIDEPV
FT                   VDGGPAAYFSTLPIKAAVAAVRTKGIPAVVSQTAGTYTCNHVFYLLMHELRDRPGTRGG
FT                   FVHIPYSTEEAIGTDRPYMRMDQLATALTAVVRATLANATDVKVGSGSLD"
FT   CDS_pept        192438..193625
FT                   /transl_table=11
FT                   /locus_tag="CMM_0134"
FT                   /function="FAD-dependent monooxygenase"
FT                   /EC_number="1.14.13.-"
FT                   /note="putative FAD-dependent monooxygenase (ZP_00216251.1|
FT                   COG0654: 2-polyprenyl-6-methoxyphenol hydroxylase and
FT                   related FAD-dependent oxidoreductases [Burkholderia cepacia
FT                   R18194];; NP_771617.1| blr4977 [Bradyrhizobium japonicum
FT                   USDA 110]). pfam01360,Monooxygenase, Monooxygenase. This
FT                   family includes diverse enzymes that utilise FAD."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00154"
FT                   /db_xref="GOA:A5CM69"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM69"
FT                   /protein_id="CAN00154.1"
FT                   /translation="MHVVIAGGGIAGLAAAIAVRRAGHEATVLERRSAAEEPGSWLQVA
FT                   SNGMVALDALGLGDAASELGEATPRVRISAADGRRTADLPLGPQPGEGLATRSLRRAEL
FT                   HSLLREEATRVGARTVHAARVTSVAQDERGATLVTEYGERHAGDLVIGADGVGSAVRAG
FT                   LGAQAAGPAERVTGLVYVGGTARAGALPASASSPGTLQFRFGRDCFLAYAILEDGTTGW
FT                   FANPRVPVSRRGSAPDAPLTSEGWARLLLRLGARDALPLEQLIPATTDLDSRLPRREAP
FT                   PAWGARRVVLVGDAAHAISPSSGQGASLALEDAAVLGRLLALGTDPADLVAQLARRRQE
FT                   RVAYVIEQGRWLDRIKLLGPLGAAFRDRVIMPLADRQAARGGAGAGSELYDFVLA"
FT   CDS_pept        complement(193999..194973)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0135"
FT                   /product="conserved hypothetical protein"
FT                   /note="conserved hypothetical protein, weakly ;
FT                   ZP_00239107.1| GTP pyrophosphokinase [Bacillus cereus
FT                   G9241])., , pfam04607, RelA_SpoT, Region found in RelA /
FT                   SpoT proteins."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0135"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00155"
FT                   /db_xref="GOA:A5CM70"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM70"
FT                   /protein_id="CAN00155.1"
FT                   /translation="MSQESEDLGRRYRESAELLQAALESYKGHVGNAVSSGVGDYILSA
FT                   RVKTARSLIRKARSDPNNPRSWASIQDKVGLRVTCSTSEDVRTVDELLQGESWIIVERT
FT                   VKSGKEDRLFYPGIHYIVEVGSVVDSRGEPILAEIQLRTRAQDAWAVVSHKLLYKGLVR
FT                   PPKTMRRVITRLSVLVELFDDEVQRMLKKRRRLPMYEPALALEALELEYESLSGEVSPA
FT                   STDGVLIRLLMKAYAHEEQALSECVRAFCRAHRDTIQSSLIELAPDSSGYIDSRDWLYS
FT                   HPEILAVLERAHAKPYLLIDAVRDSDYEDVIRKSCVSAGIILP"
FT   CDS_pept        complement(194970..196007)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0136"
FT                   /product="hypothetical protein"
FT                   /function="unknown"
FT                   /note="hypothetical protein (AAN62299.1| hypothetical
FT                   protein [Pseudomonas aeruginosa];; AAW89695.1| hypothetical
FT                   protein, putative phage associated protein [Neisseria
FT                   gonorrhoeae FA 1090])."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0136"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00156"
FT                   /db_xref="GOA:A5CM71"
FT                   /db_xref="InterPro:IPR007358"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM71"
FT                   /protein_id="CAN00156.1"
FT                   /translation="MPYVDALTLDQTMLHEIPRGRQQASGGQQPLYSSAPTPLNADTDR
FT                   FIREEMLQPAFAFAREVVATEDYGSPVPDLVRAALNDSTQLADSSRDIADWMHKKQTNG
FT                   SSAGVFMAALASSSSGPKFIILKAEHQEGVRLNHQTSGGSVVFEVEHLSELIMGQNSRV
FT                   YKIALMWVNEDGQLVGLMVDKQNGASFADYFLQQFLGCDLTHRAEVQTEAFVKTVTAFI
FT                   NSPLLAEEKRTRYATAAVAVLESPAPQLNPKAFIAEFMDAEDRDSFAEMLPLQIRSSTF
FT                   AKDTRLVKQNIGGLKLKTSSGVTITASSEAMQNGTVTVDSNANAGPQIVIKGTAESLQL
FT                   SGPPR"
FT   CDS_pept        complement(196333..197721)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0137"
FT                   /product="putative MFS transporter"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /note="putative MFS transporter (CAF21275.1| Permease of
FT                   the major facilitator superfamily [Corynebacterium
FT                   glutamicum ATCC 13032];; NP_961251.1| hypothetical protein
FT                   MAP2317c [Mycobacterium avium subsp. paratuberculosis str.
FT                   k10])."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0137"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00157"
FT                   /db_xref="GOA:A5CM72"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR024671"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM72"
FT                   /protein_id="CAN00157.1"
FT                   /translation="MTTAAPGRIDEPAAPPRRRVAAWALWDWGSAAFNAVVTTFVFSTY
FT                   LASSLFVDPAIVAAAGDDTRNPSLVAAKADTSGVISLALTIAGLLIAVLAPVLGQRSDG
FT                   SGRRRLWLGINTGIVVLAMLGMVFVEPVPSYLWLGAVLLATGNVFFEFASVNYNAMLVQ
FT                   VSTPRTVGRVSGLGWGMGYVGGIVLLALLLGLFLFDFGTPGASGLLGLPSGEAGGALDV
FT                   RIAILVAAIWCAVFSIPVLVGVPEIPAAAGRTRQGILASYRTLFRRIAELYRESPRVIV
FT                   FLVASAVFRDGLAAVFTFGAIIAAQVFGFTTTEVLLFGVAANVVAGIGTFAAGWFDDRF
FT                   GAKPVILVSLVCLILGGSAVLAVGDAKAGFWATGLFLCLFVGPVQSSSRTFLARISPAG
FT                   REGEMFGLYTTTGRAVSFLAPGLFGIAVAITGDTRFGIIGIVIVLLAGLLLMLRVRGAD
FT                   AHRL"
FT   CDS_pept        197794..198540
FT                   /transl_table=11
FT                   /locus_tag="CMM_0138"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative kinase/phosphotransferase (weak similarity
FT                   to COG3173, Predicted aminoglycoside phosphotransferase
FT                   [General function prediction only]; ZP_00200969.1| COG3173:
FT                   Predicted aminoglycoside phosphotransferase
FT                   [Exiguobacterium sp. 255-15];; NP_655042.1| Choline_kinase,
FT                   Choline/ethanolamine kinase [Bacillus anthracis A2012])."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0138"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00158"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM73"
FT                   /protein_id="CAN00158.1"
FT                   /translation="MDGPLDGGNMNRVDREGETVTRDAGPWTPTVHRWLRHLALAGVDG
FT                   IPQPLGIEGGRERLTFMHGDVPVYPLPRWIWADDVLVQAGRRLRELHDASVGFALDGAV
FT                   WQSVTKVPSEVICHNDFAPHNLVFAEGRLVGVIDMDMASPGPRIWDIAYLATRAVPLSG
FT                   SAQDGAPGMDDARRRVELLLDAYGSDATWADVLRITILRLHDLAGISLAKADELGKPHL
FT                   RADAACYSADAASLRGILDAERAHPA"
FT   CDS_pept        complement(198545..198928)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0139"
FT                   /product="conserved hypothetical protein"
FT                   /note="conserved hypothetical protein (ZP_00074096.1|
FT                   COG0494: NTP pyrophosphohydrolases including oxidative
FT                   damage repair enzymes [Trichodesmium erythraeum IMS101];;
FT                   NP_765595.1| mutator protein mutT [Staphylococcus
FT                   epidermidis ATCC 12228]). pfam00293, NUDIX, NUDIX domain."
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00159"
FT                   /db_xref="GOA:A5CM74"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM74"
FT                   /protein_id="CAN00159.1"
FT                   /translation="MVLVDAAGRILLQLRDDIPTIPFPGMWAIPGGMLEPGETPLACIV
FT                   REVEEELGVRIAPAEVAHLMTRTRSYGIEHTFTARLDVAAEDIRLTEGQRVAWFPVADA
FT                   VGMELAYEDADVLREVAGRVARG"
FT   CDS_pept        complement(198943..199437)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0140"
FT                   /function="transcriptional regulator, MarR family"
FT                   /note="transcriptional regulator, MarR family (NP_977771.1|
FT                   transcriptional regulator, MarR family [Bacillus cereus
FT                   ATCC 10987];; ZP_00037950.1| COG1846: Transcriptional
FT                   regulators [Enterococcus faecium]). pfam01047, MarR, MarR
FT                   family. The Mar proteins are involved in the multiple
FT                   antibiotic resistance, a non-specific resistance system."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0140"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00160"
FT                   /db_xref="GOA:A5CM75"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM75"
FT                   /protein_id="CAN00160.1"
FT                   /translation="MTPERTARRRDDAAAVDALANALHMIETAQRHLRTRIAQDIGVNV
FT                   TDLTVISVVGDLGRMTPKLLASEISMGTGAVTAVIDRLVGAGHLDRVPNPKDRRSVFLE
FT                   LTAAGRKTLARMEADYRTAAAVALRASPALGTEETAEDIARAAIAMTAHTIDGPDATAT
FT                   A"
FT   CDS_pept        199666..200331
FT                   /transl_table=11
FT                   /locus_tag="CMM_0141"
FT                   /product="putative secreted protein"
FT                   /function="unknown"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0141"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00161"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM76"
FT                   /protein_id="CAN00161.1"
FT                   /translation="MSHHIAAAKTKRVRFAPLAIAGGVAAAVLLSVSMSGTLSGFVASI
FT                   TNDTNTAASGSLVMQESQAGATGAPTVTCLSTSATSGVDSNAATCSTINKFGGSTTMTP
FT                   GQTVTSVVNIKNVGTSKASTFTLTPGAACTQTKNGTVNGSATDFCAKLNVVITAAGSAT
FT                   PVYSGTAAALAGSSAKTLTALAANGSTDFTFAVTLDASAGNTYQGLGASLPLTWTFAA"
FT   CDS_pept        200413..201393
FT                   /transl_table=11
FT                   /locus_tag="CMM_0142"
FT                   /product="hypothetical protein"
FT                   /function="Signal peptidase I"
FT                   /note="hypothetical protein; putative serine
FT                   peptidase,family S26 (NP_563211.1| signal peptidase type I
FT                   [Clostridium perfringens str. 13]), ,
FT                   pfam00461,Peptidase_S26, Signal peptidase I."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00162"
FT                   /db_xref="GOA:A5CM77"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM77"
FT                   /protein_id="CAN00162.1"
FT                   /translation="MTDIQDRATGSAIAALELDLIELDLVTEEADLDPASPVLPVRGAT
FT                   RRAARTSRTIRRRTVLMWAATVLLTALVAVTLLFQASGGRWFVVQTPSMGTTAPVGTLL
FT                   LTTPVLLEDLHVGDVVSFHPSTTPDETYTHRVIAVDADGITTRGDINGAVDPWKTDQAH
FT                   LVGEATTILPGFGWLAKGVPLLLAGLVIVMVLTRPIGSPTHRASLRMLGGALVAALTVF
FT                   LLKPFVGLVVLDAATRGDDVEATVVSTGMLPIRIAAEGGTHTTLAAGQVGTITAPAGEA
FT                   GRFYDVTSTLDLPLWGWILFFGLCALPLITTLVVGLPAEREERRA"
FT   CDS_pept        201390..202232
FT                   /transl_table=11
FT                   /locus_tag="CMM_0143"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein , cd00110, LamG, Laminin G
FT                   domain; Laminin G-like domains are usually Ca++ mediated
FT                   receptors that can have binding sites for steroids, beta1
FT                   integrins, heparin, sulfatides, fibulin-1, and
FT                   alpha-dystroglycans."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0143"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00163"
FT                   /db_xref="InterPro:IPR006558"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM78"
FT                   /protein_id="CAN00163.1"
FT                   /translation="MTVAARVAAIAASVSAVALGAVLLLAPGTSGAYTAAITNSNNTAA
FT                   SSAAFFTCSSAFAADKANALFAYPLNEATGSTTAVDAATGSYPGTYRGGMTSDTTSSRA
FT                   CSRDTGGAYVLDGSDSVTNALQAQGPATFSTEVWFKTTVKGGKLIGFGNSQAGSSSAYD
FT                   RHTYVSTTGQLSFGTYNGGYQTITSSANVADGAWHHVVATMSPSTGMTLYLDGARVAQN
FT                   TGFTAPESNSGYWRIGYDNTSGWPNAGSAYFVGSMRFAAVYKTALTATQVQNHYNAGR"
FT   CDS_pept        complement(202285..203268)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0144"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /note="conserved hypothetical protein (NP_929594.1|
FT                   hypothetical protein [Photorhabdus luminescens subsp.
FT                   laumondii TTO1];; AAM97361.1| RubK [Streptomyces
FT                   collinus])."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00164"
FT                   /db_xref="GOA:A5CM79"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM79"
FT                   /protein_id="CAN00164.1"
FT                   /translation="MSVQRIPVSLLARGTAALAGVVVLAGCSAPGAASAASDTTPDATT
FT                   AVATTAPSAAGDGGTTADRTDSDTDDRNATIISTLFTAAFPDPASAGAQAAVLAAVAPD
FT                   STANGVGAKAGPSGVLDEFAMAHQRVPGAHAVIKHIAADGDLVAVHWQVASNPDDERTG
FT                   EAAVDLFRLADGKVTARWTFDQPIPQGKPASGNTNTMFSDLYQGEADAPELTEQQEEAN
FT                   RQLAVGAYDTLFRDHDASVLDRSFDPAYLQHNTVAANGTAALKAFFSGGAQFPAQQSVI
FT                   SIADDDLVWTFSQPVGAKADDPFLAADIFRVDGGLIREHWDVVPAS"
FT   CDS_pept        complement(203637..204329)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0145"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein (NP_925435.1| unknown protein
FT                   [Gloeobacter violaceus PCC 7421])."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0145"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00165"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM80"
FT                   /protein_id="CAN00165.1"
FT                   /translation="MRNLTKSVFGLATAGFLVVGLAACSTPAESPSSSASSAPSATATT
FT                   EANPTPLATIPTLTGVDTQVTLDSGFTGALTTLGLTPGVIGTATLDGSTGTLAFPITGG
FT                   NVKYFDPEQSYRPYVQGEIDHAGSGISLTAGSTVVKLTDFVIDPGTSRLTGSVQVGDGE
FT                   VMKDVYIFNLDGTTLKPLQMEGDNAVLEGTTVKVSPDAASLLNSTFGTTAVTDQLVVGI
FT                   AKITVNTK"
FT   CDS_pept        complement(204455..205099)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0146"
FT                   /product="hypothetical protein, putative peptidase"
FT                   /note="hypothetical protein weak similarity to:
FT                   NP_831063.1| Cell envelope-bound metalloprotease
FT                   (camelysin) [Bacillus cereus ATCC 14579]"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0146"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00166"
FT                   /db_xref="InterPro:IPR022121"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM81"
FT                   /protein_id="CAN00166.1"
FT                   /translation="MPRHRAAPDAPARPVPHGRRAARRPVRRRRTLLVTAIAVTLALAG
FT                   AGTAYAVFADRATSRVTVRAGAVELDWGGGGADQLAVPITGLRPGDAQVRLVDLANTGT
FT                   VRASELMVTLGGTAVASTSDGLQVAFDRCTVAWTGAPGTATCSGTITSVVADRPVVGRV
FT                   ALPGSPARAVGGRDHLRLTVRLAASAPTGAQNVTGSVTLRVDGNQRPGLQR"
FT   CDS_pept        complement(205099..205731)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0147"
FT                   /product="conserved hypothetical protein"
FT                   /function="putaive signalpeptidase"
FT                   /note="putative signal peptidase I (Leader peptidase I)
FT                   (AAN08877.1| signal peptidase type I [Leishmania major];;
FT                   AAF02220.1| signal peptidase type I [Bacillus
FT                   amyloliquefaciens]). pfam00461, Peptidase_S26, Signal
FT                   peptidase I."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0147"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00167"
FT                   /db_xref="GOA:A5CM82"
FT                   /db_xref="InterPro:IPR001733"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM82"
FT                   /protein_id="CAN00167.1"
FT                   /translation="MIRDRAARTAEPAPTATAPTAAPTLRSPARRALGVLGGLVTAAVG
FT                   LAVIAVVALSALGVTRFVPVLSNSMAPGMPVGSLAITAPTPRGEVAEGDVVVFTAPSGP
FT                   RVRVIHRVTHVFGPEDAERLDGWSDDRLAIQTKGDNNPSGDPWIVTIGDDAVWERTSVV
FT                   PFLGWPFVWLGDPITRAIAFAVVGATGTIWLLTVIWRRPPRTTGGPA"
FT   CDS_pept        complement(205728..206537)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0148"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00168"
FT                   /db_xref="GOA:A5CM83"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM83"
FT                   /protein_id="CAN00168.1"
FT                   /translation="MRAHHGTGSIAAAALCLTLVASAPAAPARADARPTAIDSPSLEVE
FT                   ELTGPDIPLDDLAPGDTVDWAADVTNVSGNSSPLSVRLDAMRSMALTGDALGGIQLSVR
FT                   LCEDGFETLTAPMRCRGPVEPLGSGPAATLDSVVTRTPLGAGETVGIAVRVRFPAGADN
FT                   GMESTAGMVRIGFALVDDAGTGQDPDPSTGGGTGTGSGSGSGSGGGSGSGTSPAGSAPA
FT                   ADAPRDLLPVTGRDIASALAGALLALLGGGILLLAGRRRRRTAEAAS"
FT   CDS_pept        complement(206653..207351)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0149"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein, weak similarity to:
FT                   NP_834566.1| Cell envelope-bound metalloprotease
FT                   (camelysin) [Bacillus cereus ATCC 14579]"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0149"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00169"
FT                   /db_xref="GOA:A5CM84"
FT                   /db_xref="InterPro:IPR022121"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM84"
FT                   /protein_id="CAN00169.1"
FT                   /translation="MSTTTAPQRRRPWKKIVATGAVVAVGTIITGGAFAIFTDSDTATL
FT                   QADAGQLDIELATGDYTITDIAPGDTVQRPIVLSLPNATNDGNLVESVTFAYEVTDETL
FT                   GTEDPAVPGPSESLVTGTEGLQYTLQTCSTAWTPSAADPAGPYTCSGTATTTGTGTLAS
FT                   LTGAGTTFTPANFGVAPSADGTFPSDTADVTLNTLMVLQLPDTADNDYENAAATLTFTA
FT                   SAIQRDGLQR"
FT   CDS_pept        complement(207498..210902)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0150"
FT                   /product="putative cell wall surface anchor family protein"
FT                   /note="hypothetical protein (EAL12040.1| cell wall surface
FT                   anchor family protein, putative [Bacillus cereus G9241];;
FT                   ZP_00117602.1| COG2931: RTX toxins and related Ca2+-binding
FT                   proteins [Cytophaga hutchinsonii]). , weak similarity to
FT                   cell surface proteins and invasin."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0150"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00170"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM85"
FT                   /protein_id="CAN00170.1"
FT                   /translation="MVGTRARHAAGPGHVASGARSRPGIRRLAALAAAAVAAALLVTLP
FT                   AQTATAASQLVAESFSGTSVADAAWKPLGSACLTRATSAPTSGSTIGVCSSRNQSLPAS
FT                   ANPGALQLTDNRASAVGGVVYDNAIPASGGLDIKFDQYQYGTSSGGADGIGFFLTDGSV
FT                   PLTAAGPAGGGLGYAQTTTAAGVAGGYLGVGLDAFGNFSSPTEGRGTGCTTPVAGVGQR
FT                   PNAIALRGPGTGLAGYCYLTGASPATSLRATTDLSTPTTSLGRTIRITVSSARLPVVTV
FT                   YMGAAAGASTASLTQVLQYRMTTPAPSSYKLGYLASTGTFTDTHLIREVSVSSLDNLTA
FT                   LTLVKQIDRSTAQPTAYAEGQTIPYQFVVTNTGGLTLSNLSLTDPLVSPISCPGGLLGL
FT                   GLFLVGTSVTCTGTHVVTPAEAMSGTLVNTASARGVNTLLASVTSNSSSVTAQIVAPAP
FT                   ALALTKTGTLTDSNGNGRADVGERIAYSFVAQNSGNVSLYTVAVADPRVTGISPASTTL
FT                   APGASQTFTSAAYTVTQADVDAATPIVNTATVSGKTFAGVAAPTASSSTSTPVSGSAAL
FT                   TLTKGATLTGGSKAGSTVAYSFSIRNTGTVPLTGVALTDPLPGLSAVTYTWPGTAGTLA
FT                   AGATATATASYTVRQADVDAGQIANTATVRGASSGGTQAQATATRTLTLDRTATLAFTK
FT                   TATPGNVPAAGGVVTYAFRLQNTGSTTLTSVSIADPRAGVSALSYTWPGTAGTLAPGQV
FT                   VTATATYTATTADVAAGSIVNTATATATAPTGQVSGTATATVLAVADPLPDAATTPQGV
FT                   PVVIDVLANDGRAATGATLSRAQLSATPALVGGAVGPVPASPTAGSATCVASGTDRGKC
FT                   TYRPAEGFTGVDVFDYALQSGAGTWNVRVTITVTAVNRDAVARADRLVATIGGPAVTID
FT                   PRANDTDVDGDSLAITGATPPAALPGSFGCTAVLCTYQPPATGTPGSSVVAYAITDRPA
FT                   APGTGIVASSTITVFLDPAPLVPRGFTHRDDASLGASTGTWTSTTTVTGATASCVAGRP
FT                   VTALAWTAVPGATDQLVERRVAGTTPGAWITVTRLAGTVTSFSDDRLGESRSYQWRVRP
FT                   DLQRWVGIPSAPSPAVAQPATVSAVGC"
FT   CDS_pept        211308..213179
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="CMM_0151"
FT                   /product="chaperone (HSP70)"
FT                   /function="Molecular chaperone"
FT                   /note="Chaperone (Heat shock protein 70) (HSP70)
FT                   (Q83N74|DNAK_TROWT Chaperone protein dnaK (Heat shock
FT                   protein 70) (Heat shock 70 kDa protein) (HSP70);;
FT                   ZP_00225598.1| COG0443: Molecular chaperone [Kineococcus
FT                   radiotolerans SRS30216])., , pfam00012, HSP70, Hsp70
FT                   protein. Hsp70 chaperones help to fold many
FT                   proteins.,InterPro: Heat shock protein hsp70"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0151"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00171"
FT                   /db_xref="GOA:A5CM86"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5CM86"
FT                   /protein_id="CAN00171.1"
FT                   /translation="MARAVGIDLGTTNSVVSVLEGGEPTVIANAEGARTTPSVVAFTKD
FT                   GEVLVGETAKRQNVTNVDRTISSVKRHMGTDWTVGIDDKKYTSQELSARILGKLKRDAE
FT                   QYLGDSVTDAVITVPAYFNDAERQATKEAGEIAGLNVLRIINEPTAAALAYGLDRGKED
FT                   ELILVFDLGGGTFDVSLLEVGKDDDFSTIQVRSTAGDNRLGGDDWDQRIVDHLVKRFKE
FT                   STGVDVSNDKIAKQRLKEAAEQAKKELSSSTSTSIQLPYLSLTENGPANLDETLTRAKF
FT                   EELTNDLLERTRKPFEDVIREAGVSVGDVAHVVLVGGSTRMPAVVDLVKKLTGGKEPNK
FT                   GVNPDEVVAVGAALQAGVLKGERKDVLLIDVTPLSLGIETKGGIMTKLIERNTAIPTKR
FT                   SETFTTADDNQPSVAIQVFQGEREFTRDNKNLGTFELTGIAPAPRGIPQVEVTFDIDAN
FT                   GIVHVSAKDKGTGKEQSMTITGGSSLGKEDIERMVREAEEHAAEDKTRREQAEVRNNAE
FT                   QLAYSIDKLIKENDDKLPEDVKSEVQGDVDGLKSALAGDDEDAVKTAFDKLSASQTKLG
FT                   EAIYAQGQQEQAAGETPEGASEAKKDDEDIVDAEVVDEDDEDKKTDR"
FT   CDS_pept        213176..213829
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="CMM_0152"
FT                   /product="heat shock chaperone"
FT                   /function="Molecular chaperone GrpE (heat shock protein)"
FT                   /note="heat shock chaperone (HSP-70 cofactor)(NP_695711.1|
FT                   GrpE protein [Bifidobacterium longum NCC2705];;
FT                   NP_787877.1| HSP-70 cofactor GrpE [Tropheryma whipplei str.
FT                   Twist]). Stimulates jointly with dnaJ the ATPAse activity
FT                   of dnaK. Helps to release ADP from dnaK thus allowing dnaK
FT                   to recycle more efficiently (By similarity). pfam01025,
FT                   GrpE, GrpE."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0152"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00172"
FT                   /db_xref="GOA:A5CM87"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM87"
FT                   /protein_id="CAN00172.1"
FT                   /translation="MTEDTANGEGRGPEDEGAEQSVPASSDGPDATADQAADQASVPGE
FT                   DGAFVEAEGPDVETTDPMDEELQDLIEQTRAEPVEGDSEHLADLKRVTAEYANYRKRTE
FT                   ANREIERQRAVGDVVKGILPVLDDLDRAEKHGDLAEGGPLTAIVAKLRTNVERIGLVKV
FT                   GAVGDAFDPQVHEAIFQKPNPEVQVDTVADVVESGYYIGETLLRAAKVVVDKPE"
FT   CDS_pept        213950..214963
FT                   /transl_table=11
FT                   /gene="dnaJ1"
FT                   /locus_tag="CMM_0153"
FT                   /product="chaperone, curved DNA-binding protein"
FT                   /function="DnaJ-class molecular chaperone with C-terminal
FT                   Zn finger domain"
FT                   /note="chaperone (NP_789681.1| molecular chaperone DnaJ
FT                   [Tropheryma whipplei TW08/27];; ZP_00225596.1| COG0484:
FT                   DnaJ-class molecular chaperone with C-terminal Zn finger
FT                   domain [Kineococcus radiotolerans SRS30216]).
FT                   pfam00226,DnaJ, DnaJ domain. DnaJ domains (J-domains) are
FT                   associated with hsp70 heat-shock system and it is thought
FT                   that this domain mediates the interaction. , pfam01556,
FT                   DnaJ_C, DnaJ C terminal region."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0153"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00173"
FT                   /db_xref="GOA:A5CM88"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM88"
FT                   /protein_id="CAN00173.1"
FT                   /translation="MASQDWFDKDFYKVLGVSKDVSEADLKKAYRKLARQYHPDSNPDP
FT                   SAEARFKEISEAHAVLADKEQRKEYDQIRAMGSGARFSAPGAGASGGGFEDVFGGMFGQ
FT                   QAGGRGRRTAGFGSGQPQYSQGGFEDILGGMFGNGGFGQSTGGYRGYGAPTKGRDVTAT
FT                   TTIDFLTAVQGDVVRLQDSDGRPLTVRVPAGVSDGQKIRLAGKGEPSGDGGASGDIILT
FT                   VHVRPHPVFERDGLNLRVNVPVTFPEAALGATIEVPTLGGDPVRLKVAPGTSSGKVLRV
FT                   KGRGVTTPKGTGDLLARIEVAVPSRLTDAQRVALDAFASSGPGEDPRRELIERARS"
FT   CDS_pept        214965..215438
FT                   /transl_table=11
FT                   /gene="hspR"
FT                   /locus_tag="CMM_0154"
FT                   /product="heat shock regulator, transcriptional
FT                   regulator,MerR family"
FT                   /function="Predicted transcriptional regulators"
FT                   /note="putative transcriptional regulator, MerR family
FT                   (ZP_00056688.1| COG0789: Predicted transcriptional
FT                   regulators [Thermobifida fusca];; NP_825664.1| putative
FT                   HspR protein [Streptomyces avermitilis MA-4680]). PUTATIVE
FT                   HEAT SHOCK REGULATOR pfam00376, MerR, MerR family
FT                   regulatory protein."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0154"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00174"
FT                   /db_xref="GOA:A5CM89"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM89"
FT                   /protein_id="CAN00174.1"
FT                   /translation="MDPRDAMDEDAPVFVISVAAELSGMHPQTLRQYDRLGLVSPTRTA
FT                   GRSRRYSMRDIVQLREVARLGAEGVSLEGIARILELENQVTELRGRVRQLESALADELL
FT                   SRPGRRVFAARGDGDVVSLRAGVRPSRPTEVVLYRAALAMPGDERDGSGRDAR"
FT   CDS_pept        215435..216658
FT                   /transl_table=11
FT                   /locus_tag="CMM_0155"
FT                   /product="putative methyltransferase"
FT                   /function="putative 16S RNA methylase"
FT                   /note="putative methyltransferase (NP_625336.1| conserved
FT                   hypothetical protein SCG20A.21 [Streptomyces coelicolor
FT                   A3(2)];; ZP_00138173.1| COG2813: 16S RNA G1207 methylase
FT                   RsmC [Pseudomonas aeruginosa CBPP-PA14]). , ,
FT                   pfam05175,MTS, Methyltransferase small domain., InterPro:
FT                   SAM (and some other nucleotide) binding motif."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0155"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00175"
FT                   /db_xref="GOA:A5CM90"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR017237"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM90"
FT                   /protein_id="CAN00175.1"
FT                   /translation="MSDAPAPAPASAADGLLDLGALRRRPDVEAENLFAVDAADRLLLD
FT                   ELVALLAAASDAGHPVLSEELVVVGDQYGALALGAAAALRRAGAADPVRIRVHQDALAS
FT                   ETALRLNAELIGETAEIAHHGLDDALAAGARVVVARLPRSLDALDEWAGVLARAAADDV
FT                   TVLAGGRVKHMTPAMTDVLRRRFGEVHATLARQKSRILVAREPVRPTADAAAAYPRRES
FT                   HPDLGLEVRAHGAAFAGARIDIGTRFLLSFLPDLPAGAATAVDLGCGTGVIASAVALAR
FT                   PDLRLIATDQSWAAVDSARATVAANGLADRVTVVRDDAGSTVPDGSADLVLLNPPFHTG
FT                   ATVHAGLAPRLFAAAARMLRPGGQLWTVYNSPLGYRPQLTRIVGPTREAGRNAKFTVAV
FT                   STKPESRA"
FT   CDS_pept        216711..217151
FT                   /transl_table=11
FT                   /locus_tag="CMM_0156"
FT                   /product="conserved hypothetical protein"
FT                   /note="conserved hypothetical protein (ZP_00067078.1|
FT                   hypothetical protein [Microbulbifer degradans 2-40];;
FT                   NP_266258.1| hypothetical protein L103661 [Lactococcus
FT                   lactis subsp. lactis Il1403])."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0156"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00176"
FT                   /db_xref="InterPro:IPR015018"
FT                   /db_xref="InterPro:IPR037079"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM91"
FT                   /protein_id="CAN00176.1"
FT                   /translation="MPTFRTRVLQARVNATGLPVPPEALDELGAGKRPAVVVTVAGYTY
FT                   RTSVGAMGGQHLIPLSAAHRAASGVAADDDVEVTIELDEQPREAVIPDEVAAALAAEPA
FT                   LAAAFRALSSSRQRAVVDPIAEAKTAETRARRVEKALAALHG"
FT   CDS_pept        complement(217183..217419)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0157"
FT                   /product="transcriptional regulator, Cro/CI family"
FT                   /function="Predicted transcriptional regulator"
FT                   /note="putative transcriptional regulator, Cro/CI family
FT                   (ZP_00225419.1| COG3655: Predicted transcriptional
FT                   regulator [Kineococcus radiotolerans SRS30216];;
FT                   NP_656871.1| HTH_XRE, Helix-turn-helix XRE-family like
FT                   proteins [Bacillus anthracis A2012]). smart00530,
FT                   HTH_XRE,Helix-turn-helix XRE-family like proteins.
FT                   pfam01381,HTH_3, Helix-turn-helix. This large family of DNA
FT                   binding helix-turn helix proteins includes Cro and CI."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0157"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00177"
FT                   /db_xref="GOA:A5CM92"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM92"
FT                   /protein_id="CAN00177.1"
FT                   /translation="MGADDDGPTGVHCRLDELLAARGMTLTRLSAIVGVSQVNLSVLKN
FT                   DRARAIRYSTLVAVCRALECEIGDLLVLDPPTS"
FT   CDS_pept        complement(217419..218057)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0158"
FT                   /product="putative membrane protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0158"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00178"
FT                   /db_xref="GOA:A5CM93"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM93"
FT                   /protein_id="CAN00178.1"
FT                   /translation="MARTPLAGTGSAARVTRGVLWTALAIAVLVLLAVAVSAVVSAVET
FT                   VRTGVVHTSLEMRGSLPTEADAGPADLRSGAYRTAEVAVGELSGGIVALHVVRIALDAS
FT                   VGMALAGTVAILARRLLRPDPLARRLSLVVTLAGGTVMIAALLSLAARTGVAWMVGDAL
FT                   NDPAEGLDGFWPVVAEVDASTIALGFALMIVGLVVEHGETLQRDTRGLV"
FT   CDS_pept        complement(218138..218584)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0159"
FT                   /product="conserved hypothetical protein"
FT                   /note="conserved hypothetical protein, FAD binding protein
FT                   (AAQ61023.1| conserved hypothetical protein
FT                   [Chromobacterium violaceum ATCC 12472];; NP_738977.1|
FT                   hypothetical protein [Corynebacterium efficiens YS-314]).
FT                   pfam04940, BLUF, Sensors of blue-light using FAD. The BLUF
FT                   domain has been shown to bind FAD in the AppA protein."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0159"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00179"
FT                   /db_xref="GOA:A5CM94"
FT                   /db_xref="InterPro:IPR007024"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM94"
FT                   /protein_id="CAN00179.1"
FT                   /translation="MGSQHQGGTMRTTVYTSTATRQMSDDDLAELLGQCIHNNEQTGLT
FT                   GLLLHRDGKFMQVLEGPHDAVESVFATIEADARHTDVRLLLDEEIPARQFPAWSMGFRT
FT                   VDDATLRQLRGYDDFLDRPASAAARPDAPSRARWLLEWFRTHPA"
FT   CDS_pept        complement(218974..219702)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0160"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00180"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM95"
FT                   /protein_id="CAN00180.1"
FT                   /translation="MDHDDPTAYALAAPDTAPASASRVEMRPSLLPRDDSDPYRYGIFL
FT                   RPDARTCRAVTVVTDQIRAQYGLVSAGAFPPHATLIGSQPFGHDEARVIEAVSELLADR
FT                   PAFPVHNAGVREHGFGFVYDVDGLPDGSQNAELLALAADIDRVAAPFRRPMDSPEHHSF
FT                   DPARFRAHLSLASHDLLVRPDLHDEVGAFIRELDEPVPTGFVGDTVVMYRTASPDWSGR
FT                   WWTTLTWEHVRTWTLGGAAL"
FT   CDS_pept        complement(219867..220895)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0161"
FT                   /product="putative transcriptional regulator, LacI-family"
FT                   /function="Transcriptional regulators"
FT                   /note="putative LacI-family transcriptional regulator
FT                   (NP_936186.1| transcriptional regulator [Vibrio vulnificus
FT                   YJ016];; AAC82367.1| catabolite control protein A
FT                   [Thermoactinomyces sp. E79]). pfam00356, LacI, Bacterial
FT                   regulatory proteins, lacI family. pfam00532,
FT                   Peripla_BP_1,Periplasmic binding proteins and sugar binding
FT                   domain of the LacI family. The LacI family of proteins
FT                   consist of transcriptional regulators related to the lac
FT                   repressor. In this case, generally the sugar binding domain
FT                   binds a sugar which changes the DNA binding activity of the
FT                   repressor domain (pfam00356)."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0161"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00181"
FT                   /db_xref="GOA:A5CM96"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM96"
FT                   /protein_id="CAN00181.1"
FT                   /translation="MSRPGAAPTIHDVAARAGVSKSVVSRALSGTPGVAPATQQTVRDA
FT                   AAALGYVANAHARGMSAHRTHTLGVLVRDASTPFYGHLLTALQQRASERGYRVVTATGF
FT                   GAFDVVEERKALETLVSLQVEGLIVCSGALPVADILPSARRIPTVVAGRPEVDASLSSV
FT                   YCDETAGGRGLADHVASLGHRRVAVLTLPPAISLTMSARTRAMLDRLRELGLDAVHVRG
FT                   EEHRGGHIEGADGIAQAIVDAGGVTAIMAPSDGWALAILDGLCRRGITAPDGVSITGYD
FT                   GLPPFTSALLDFTTWRQPIPVIGALAVDAVVDRIDGTVTGTCHTAVDGALIPGRTAARL
FT                   RA"
FT   CDS_pept        complement(221482..222105)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0162"
FT                   /product="conserved hypothetical protein"
FT                   /function="Conserved protein/domain typically associated
FT                   with flavoprotein oxygenases DIM6/NTAB family"
FT                   /note="conserved hypothetical protein, possible
FT                   flavoprotein oxygenase (ZP_00217975.1| COG1853: Conserved
FT                   protein/domain typically associated with flavoprotein
FT                   oxygenases, DIM6/NTAB family [Burkholderia cepacia
FT                   R18194];; NP_244852.1| BH3984~unknown conserved protein
FT                   [Bacillus halodurans C-125])."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0162"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00182"
FT                   /db_xref="GOA:A5CM97"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM97"
FT                   /protein_id="CAN00182.1"
FT                   /translation="MDAAHVRIDPAILYFGTPVALLSTVGVDGRVNLAPMSSLFWLGST
FT                   AVLGMGSRSQTAANLRDTGEVVINLPSADQVDAVDRLALTTGRDPVPADKAAVGYRHVA
FT                   DRFAHAGLTPHASETVAPPRALECPVALEGRVIAAHPLEEGGAATYEVRVTRVHVHRAV
FT                   LGERTDRIDPDRWRPLIMVFQRFYGLTAEVHPSRLATIDEEWYR"
FT   CDS_pept        222222..223250
FT                   /transl_table=11
FT                   /locus_tag="CMM_0163"
FT                   /product="conserved hypothetical protein"
FT                   /function="Imidazolonepropionase and related
FT                   amidohydrolases"
FT                   /note="conserved hypothetical protein, putative
FT                   amidohydrolase (BAA85881.1| organophosphorus insecticide
FT                   hydrolase [Arthrobacter sp.];; JC1378
FT                   aryldialkylphosphatase (EC 3.1.8.1) - Nocardia sp. (strain
FT                   B-1)). only weak similarity to pfam04909,
FT                   Amidohydro_2,Amidohydrolase."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0163"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00183"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM98"
FT                   /protein_id="CAN00183.1"
FT                   /translation="MDHEDAGAGRGAPSGVWRVRELRLDRIHREVAVRIAGGRVTLADP
FT                   AEAVVGRLDLAISDGVVDRHVHLGLVDRAALAGSPVTAVVDLGWDPAEIARIAARPPAG
FT                   VDVRYAGPFHTAMGGYPSDRAWAPAAAVREVARAEDAAAAVAEARAGGSGAVKIVLHDG
FT                   GPLLADDVLAALVDAAHAAGLPAAVHAEGAGQAARAIRAGADVLVHVPWTERLDDATLR
FT                   ESVARDVLWISTLAIHDGTDLATALENARGYVALGGRIAYGTDLGNGDLPVGLNAREVE
FT                   LLGEVGLRGPALLDAVLGSAPGVIAHALASADPLPSSADATAGELVAWLRGAHRLASAD
FT                   LR"
FT   CDS_pept        223454..224224
FT                   /transl_table=11
FT                   /locus_tag="CMM_0164"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein (only very weak similarities to
FT                   e. g. ZP_00213268.1| COG2755: Lysophospholipase L1 and
FT                   related esterases [Burkholderia cepacia R18194])."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0164"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00184"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A5CM99"
FT                   /protein_id="CAN00184.1"
FT                   /translation="MRRLLAPLVHVLALPGIAARVGEFLYRRADVSGDIHPDDAAHGTV
FT                   EGPDPDRIAVVGETGMISLGVRTHQIALPAFLARHHATRTGRGVAWSIASLPGSRLREA
FT                   PAVIAGAEADLARADAVVLLAGITDVLRVTSTGAWSRQMRVAIEALRAHLPEGAWILVA
FT                   DIPPLDNAGSLSRPARLAAGVHAQALNRHTRDVVDGLPLTRAVTFPEELARALWRPDGE
FT                   ESRYQRTYRSWGAHLSAALVDARAGAAAAGAPAG"
FT   CDS_pept        224275..225177
FT                   /transl_table=11
FT                   /gene="fhuC"
FT                   /locus_tag="CMM_0165"
FT                   /product="putative Fe3+-siderophore ABC transporter,ATPase
FT                   component"
FT                   /function="ABC-type cobalamin/Fe3+-siderophores transport
FT                   systems ATPase components"
FT                   /note="putative Fe3+-siderophore ABC transpoter, ATPase
FT                   component (NP_631450.1| putative ABC-transport
FT                   protein,ATP-binding component [Streptomyces coelicolor
FT                   A3(2)];; ZP_00203479.1| COG1120: ABC-type
FT                   cobalamin/Fe3+-siderophores transport systems, ATPase
FT                   components [Anabaena variabilis ATCC 29413]). pfam00005,
FT                   ABC_tran,ABC transporter."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0165"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00185"
FT                   /db_xref="GOA:A5CMA0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMA0"
FT                   /protein_id="CAN00185.1"
FT                   /translation="MTSPASTAPIARAADPDPAPASPAASALEARGITVAYGDTEVVHG
FT                   AGLEIRPGCVTALVGPNGSGKSTLLRTMARLQAARSGSLVLREEGAEAGESDALDLSLR
FT                   RFARRVALLTQGRPTPGGLSVRDVVEFGRYPHRGRFGGADPEGRAAVDRALDLTGLVAL
FT                   ADRGVDQLSGGQLQRVWLASCLAQETGVLLLDEPTTYLDLRYQVELLDLVRDLADDASI
FT                   AVGVVLHDLDQAAALADTVALLSDGRIVKTGTPSEVLTPDLLTEVYGIPVEVHADPTTG
FT                   SLRTRAVARHHHRNERLHP"
FT   CDS_pept        225174..226163
FT                   /transl_table=11
FT                   /gene="fhuD"
FT                   /locus_tag="CMM_0166"
FT                   /product="putative Fe3+-siderophore ABC transporter,binding
FT                   protein"
FT                   /function="ABC-type Fe3+-hydroxamate transport system
FT                   periplasmic component"
FT                   /note="putative Fe3+-siderophore ABC transporter, binding
FT                   protein (NP_631449.1| possible binding-protein-dependent
FT                   transport lipoprotein [Streptomyces coelicolor A3(2)];;
FT                   YP_038579.1| iron compound ABC transporter, iron
FT                   compound-binding protein [Bacillus thuringiensis serovar
FT                   konkukian str. 97-27])."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0166"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00186"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMA1"
FT                   /protein_id="CAN00186.1"
FT                   /translation="MITRRRTLAMTALAAATALTLTACGTTEEASTGAGTTPAGEQITL
FT                   TDGTGAEVTLDGPATKVVGTEWNVVENLVSLGVDPVGVADVAGYSAWSSAVPLVNEPAD
FT                   IGTRGEPSVETIASLAPDLIVATTDLPADAITQLKAIAPVLQVNSADGSKQIQQSEDNL
FT                   ELIAKATGTEDKATEVIGAYDQAVTDAKAKLDAAGLAGSKFLFADAYVDAGAVAIRPFG
FT                   TGSLIGDVTTELGLENAWTGEVDPAYGLGSTDVEGLTTVGDVQFLYNSNSTQGDDPFAS
FT                   TLAGNAVWQSLPFVTAGDVHRMPDGIWAFGGPASMTAYAKAVSDLLAG"
FT   CDS_pept        226198..228354
FT                   /transl_table=11
FT                   /gene="fhuB"
FT                   /locus_tag="CMM_0167"
FT                   /product="putative Fe3+-siderophore ABC
FT                   transporter,permease component"
FT                   /function="ABC-type Fe3+-siderophore transport system
FT                   permease component"
FT                   /note="putative Fe3+-siderophore ABC transporter, permease
FT                   component (NP_631448.1| putative membrane transport
FT                   protein. [Streptomyces coelicolor A3(2)];; ZP_00162770.2|
FT                   COG0609: ABC-type Fe3+-siderophore transport
FT                   system,permease component [Anabaena variabilis ATCC
FT                   29413]). pfam01032, FecCD, FecCD transport family (twice)."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0167"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00187"
FT                   /db_xref="GOA:A5CMA2"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMA2"
FT                   /protein_id="CAN00187.1"
FT                   /translation="MTAPVRTAPPSADAPHASAAAASIPGPVPSLAAVARADGAGRIPV
FT                   RAVAVVALLALVVAVLAVIDVTQGTAAVGPREVWQALTGRATPGDASVVVASRLPRMAA
FT                   GILVGLALGAAGAALQTVSRNVLASPDTLAVNAGAYAALAVAAVTGLTLPVLAGAGVAF
FT                   VGGLVAAAVVLAVSGLGSGTVRLVLAGSALALGLGSVTSALLLLFPQQTSGLYRWGQGG
FT                   IGQNGFDAVAQMAPVVVVALGILLLITRRLDALGLGDDAARSLGVDVRATRVIAVLASV
FT                   LLAAAAVTVAGPIGFVGLYAPAFVRPLRRLVPGVRRSWVFIPVAGLMGAAVVLLADVLL
FT                   RAVVGAEASVAVPTGLVTSLIGAVVLVVLAVRTRDSATPAPTERHGVVTRRRVALVVGA
FT                   LVAVLVGLLLASVLLGDAKLLLGDVVNGIRGTAGPVVSYVLDTRVPRVLAAVLAGAALA
FT                   LAGVLVQAVTRNPLADPAILGVSGGAGLGAVLFVTTAPLASGWGIAGAAGLGALAAAAV
FT                   VFGLAARGGFPQNRLVLIGVGVSAGTAAAISMIIVLTDPFNGAKALTWLSGSTYGRGVD
FT                   DALPVLVALVLAVAVAAPRHRMLDLVALDDDTPRLLGLSLGRSRLLALSIAVVLTSTAV
FT                   AAVGVIGFVGLVAPHAARALVGSRHARVVPVAILLGAALVTLADLLGRTVIAPGQLGAG
FT                   LVTALVGTPYFVWLLWRGRAARGR"
FT   CDS_pept        228475..228960
FT                   /transl_table=11
FT                   /locus_tag="CMM_0167a"
FT                   /product="putative membrane protein"
FT                   /note="putative membrane protein (ZP_00299182.1| COG2259:
FT                   Predicted membrane protein [Geobacter metallireducens
FT                   GS-15];; ZP_00187970.1| hypothetical protein Rxyl02000785
FT                   [Rubrobacter xylanophilus DSM 9941]). weak similarity to:
FT                   pfam07291, MauE, Methylamine utilisation protein MauE."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0167a"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00188"
FT                   /db_xref="GOA:A5CMA3"
FT                   /db_xref="InterPro:IPR009908"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMA3"
FT                   /protein_id="CAN00188.1"
FT                   /translation="MLGTLLVIARMCAGGFFVWTGSAKLSRSRHFWSQIMGYKIVGPRQ
FT                   ARLLAAALPPVEFVAGLFFAAGLWPAVTGCVLLLLLAAFTAAIASSLLRGLENDCGCAG
FT                   SDRVSPLLIVRNVMLASLAVAGMSSAAPAYSGEIIVVACGCLLVVVISSNSYRAIGR"
FT   CDS_pept        229937..231484
FT                   /transl_table=11
FT                   /locus_tag="CMM_0168"
FT                   /product="putative two-component system sensor kinase"
FT                   /function="Signal transduction histidine kinase"
FT                   /note="putative two-component system sensor kinase
FT                   (NP_628759.1| putative two-component system sensor kinase
FT                   [Streptomyces coelicolor A3(2)];; NP_826056.1| putative
FT                   two-component system sensor kinase [Streptomyces
FT                   avermitilis MA-4680]). pfam02518, HATPase_c, Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0168"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00189"
FT                   /db_xref="GOA:A5CMA4"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMA4"
FT                   /protein_id="CAN00189.1"
FT                   /translation="MNETSPTTEAESTPVPPEDLPAAPADADDRADTDEGAGTPPPAVR
FT                   RRSFYADAWRHLPRDLGYLALTALLLATVYFALPTAVYSLFDSLLWSASGLFAAVALLV
FT                   ALFAARGLGAVERVRIGWAEPRPIRPVDWTPRWQQNRAMRILSAVANPHYWLHLLHAVV
FT                   VYPLVSFVTLGAGALLVAGFLGPIAGGIAILGYGWRFEQVLTDHGYDAGRTFALAAVLG
FT                   IVAMVLSVVLLPLWARGAVLAHYWTDHALLGGFKSDALERRVQGLEQSRAGAVTAEGQT
FT                   LRQIERDLHDGPQQRLVRLRMDLAAAERALDTDPERARTLIAEASEHAHDTLEELRALS
FT                   RGFAPPILLDRGLVAALEALASRATVPVALDVHLPEALVLPTEVERNVYFTVSELLTNV
FT                   AKHSEATRADVTLVLMRDFDGARILVARVTDDGRGGASVQEGHGLEGLVGRIGALDGDV
FT                   SISSPQGGPTRITARVPLLTLNGVPTDGSGTGTGTGTGTGPGAEAGGPVASSPDPAA"
FT   CDS_pept        231511..232173
FT                   /transl_table=11
FT                   /locus_tag="CMM_0169"
FT                   /product="putative two-component system response regulator"
FT                   /function="Response regulator containing a CheY-like
FT                   receiver domain and an HTH DNA-binding domain"
FT                   /note="putative two-component system response regulator
FT                   (NP_826055.1| putative two-component system response
FT                   regulator [Streptomyces avermitilis MA-4680];;
FT                   ZP_00198576.2| COG2197: Response regulator containing a
FT                   CheY-like receiver domain and an HTH DNA-binding domain
FT                   [Kineococcus radiotolerans SRS30216]). pfam00196,
FT                   GerE,Bacterial regulatory proteins, luxR family.
FT                   pfam00072,Response_reg, Response regulator receiver
FT                   domain."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00190"
FT                   /db_xref="GOA:A5CMA5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMA5"
FT                   /protein_id="CAN00190.1"
FT                   /translation="MDDGRDAARIRAVVVDDAVLLREGLARVLVEAGIDVVAQHADAAG
FT                   FLAALADDAPDVVVMDVRMPPTFSDEGIRATVEARRRVPGIGVLLLSQYVEAAYAEEVF
FT                   RSGTAGIGYLLKDRVTRLEEIDDAVRRIASGGTVLDPEVVTQLMARRRDPLSALTPRER
FT                   EVLALMAEGRTNAAIARALVIGTGAIEKHVTSIFSKLGLEDTGEDHRRVLAVLAYLG"
FT   CDS_pept        232240..232644
FT                   /transl_table=11
FT                   /locus_tag="CMM_0170"
FT                   /product="putative tautomerase"
FT                   /EC_number="5.3.2.-"
FT                   /note="putative tautomerase (ZP_00209270.1| COG1942:
FT                   Uncharacterized protein, 4-oxalocrotonate tautomerase
FT                   homolog [Magnetospirillum magnetotacticum];;
FT                   P94502|YRDN_BACSU Probable tautomerase yrdN).
FT                   pfam01361,Tautomerase, Tautomerase enzyme. This family
FT                   includes the enzyme 4-oxalocrotonate tautomerase that
FT                   catalyses the ketonisation of 2-hydroxymuconate to
FT                   2-oxo-3-hexenedioate."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0170"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00191"
FT                   /db_xref="GOA:A5CMA6"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="InterPro:IPR037479"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMA6"
FT                   /protein_id="CAN00191.1"
FT                   /translation="MPLIRIDLVEGRPDAQITAIGDVLMRTLVDVYGLPERDRFQIVTE
FT                   HAPGRLTALDVGLGIERSEQVVIIQIFTQAGRSTEEKQEFFRTLAASLAEVGVAGEDLV
FT                   IGFVENTAADWSFGFGRAQYVTGELQKPGS"
FT   CDS_pept        complement(232668..233180)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0171"
FT                   /product="putative acetyltransferase"
FT                   /function="Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /note="putative acetyltransferase, GnaT family
FT                   (NP_899804.1| probable putative acetyltransferase
FT                   [Chromobacterium violaceum ATCC 12472];; ZP_00058960.1|
FT                   COG0454: Histone acetyltransferase HPA2 and related
FT                   acetyltransferases). pfam00583,
FT                   Acetyltransf_1,Acetyltransferase (GNAT) family. This family
FT                   contains proteins with N-acetyltransferase functions."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0171"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00192"
FT                   /db_xref="GOA:A5CMA7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMA7"
FT                   /protein_id="CAN00192.1"
FT                   /translation="MPTRIRLATAADLDALQRIEDDADRLLVDLLRPEVWPPAPTGASR
FT                   AAEPGFLLVAEDAAVADGALVGFAHVLEIDGLAHLEQVSVPPEHGRRGRGRALVEASAD
FT                   EARRRGHRRITLRTFADVPWNATAYARAGFAEEPPATTFHLALVETEARLGLDRLGRRI
FT                   QMGRALG"
FT   CDS_pept        complement(233252..234946)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0172"
FT                   /product="conserved hypothetical protein"
FT                   /function="Predicted hydrolase of the
FT                   metallo-beta-lactamase superfamily"
FT                   /note="conserved hypothetical protein (AAD02119.1| unknown
FT                   [Streptomyces toyocaensis];; ZP_00226047.1| COG0595:
FT                   Predicted hydrolase of the metallo-beta-lactamase
FT                   superfamily [Kineococcus radiotolerans SRS30216]).
FT                   pfam00753, Lactamase_B, Metallo-beta-lactamase
FT                   superfamily."
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0172"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00193"
FT                   /db_xref="GOA:A5CMA8"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041636"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMA8"
FT                   /protein_id="CAN00193.1"
FT                   /translation="MPPTSHAHALDIAKPGRLPRGGLRVTPLGGLGDVGRNMTLFEYEG
FT                   ELLIVDCGVLFPEESQPGINVILPDFSTLRGRLDKITGIVLTHGHEDHIGGVPYLLQER
FT                   PDIPVIGSRLTLAFISAKLEEHKIKPVTRQVKEGDRITAGKFDLEFVAVNHSIPDGLAV
FT                   AIRTGAGMVLHTGDFKMDQFPMDRRLTDLGAFARLGEEGVDLFLTDSTNAEVPGFTTAE
FT                   KDLTPAIEKVFRTAPKRIVVSSFASHVHRIQQVLDSAEQYGRKVSFVGRSMVRNMKIAS
FT                   DLGYLRIPKGLVIDLKALNKLPDDKVTLICTGSQGEPMAALSRMARREHIIEVGEGDTI
FT                   LLASSLIPGNENAIYGVINGLIRWGADVVHKGNAKVHVSGHASAGELVYCYNLVKPRNV
FT                   LPVHGEWRHLVANAALAESTGVKNALVIEDGVSVDLVNGRATISGRVPAPYVFVDGMTI
FT                   GVATEEALEERRTLAAEGQITVLGIFDEKEQKLIHPAELITRGFVEHDGWIPEAEAAIS
FT                   TALKNAAAKRHLDGVAAERAMSDGLQRWLQRRHRRTPVVTVIVVDAD"
FT   CDS_pept        235445..236977
FT                   /transl_table=11
FT                   /gene="sulP"
FT                   /locus_tag="CMM_0173"
FT                   /product="putative sulfate MFS permease"
FT                   /function="Sulfate permease and related transporters (MFS
FT                   superfamily)"
FT                   /note="putative sulfate MFS permease (NP_627488.1| putative
FT                   integral membrane transporter [Streptomyces coelicolor
FT                   A3(2)];; NP_862402.1| putative integral membrane
FT                   transporter [Micrococcus sp. 28]).
FT                   pfam00916,Sulfate_transp, Sulfate transporter family.
FT                   TIGRFAM (TIGR00815): sulfate permease sulP. pfam01740,
FT                   STAS, STAS domain. The STAS (after Sulphate Transporter and
FT                   AntiSigma factor antagonist) domain is found in the C
FT                   terminal region of Sulphate transporters and bacterial
FT                   antisigma factor antagonists. It has been suggested that
FT                   this domain may have a general NTP binding function."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0173"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00194"
FT                   /db_xref="GOA:A5CMA9"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMA9"
FT                   /protein_id="CAN00194.1"
FT                   /translation="MASGTATPTVPAPPVRHPSPTVLQALRSPRLLSREVLAGLVVALA
FT                   LIPEAISFSIIAGVDPRVGLFSSFVMAVSIAFLGGRPAMITAATGAIALVVAPVVRDHG
FT                   LDYLIATVILGGLLQIVLGLLGVAKLMRFIPRSVMVGFVNALAILIFSAQIPNLVGVPW
FT                   LVYPLVAVGIAIIVVMPRITKVVPAPLVAIVVITVAVVVTALAVPTVGDEGALPDSLPT
FT                   LFIPDVPLTFDTLRIIAPYALALALVGILESLMTAKLVDDITDTPSRKTRETLGQGGAN
FT                   ILSGLFGGMGGCAMIGQTMINVKASGARTRISTFLAGVFLLILVVGLGDVVAIIPMAAL
FT                   VAVMIMVSVGTFDWHSIRPSTLRRMPVGETLVMVLTVIVVVLTDNLAIGVIIGVIAAMI
FT                   VFARRVAHFATVERTERTDEDGAPVAHYAVIGELFFASSNDLTTQFDYAGDPERVVIDM
FT                   TGSHVWDASTVAALDAITYKYERHGKRAVISGMNDSSAAMHGRLAGELGAGH"
FT   CDS_pept        complement(237042..237698)
FT                   /transl_table=11
FT                   /gene="mntA"
FT                   /locus_tag="CMM_0174"
FT                   /product="putative Mn2+/Zn2+ ABC-type transporter, ATPase
FT                   component"
FT                   /function="ABC-type sulfate/molybdate transport systems
FT                   ATPase component"
FT                   /note="putative Mn2+/Zn2+ ABC-type transporter, ATPase
FT                   component (NP_624795.1| ABC transport protein, ATP-binding
FT                   subunit [Streptomyces coelicolor A3(2)];; NP_599281.1|
FT                   ABC-type transporter, ATPase component [Corynebacterium
FT                   glutamicum ATCC 13032]). most likely involved in Zn2+
FT                   and/or Mn2+ uptake. pfam00005, ABC_tran, ABC transporter."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0174"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00195"
FT                   /db_xref="GOA:A5CMB0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMB0"
FT                   /protein_id="CAN00195.1"
FT                   /translation="MPSSRPTAPAAVLRGIRVELGTHPALAGVDLDLMPGALTVIAGPN
FT                   GAGKSTLLEVVAGTRPPTSGTRTAADPAAFVPQRTAVSDRLPVTVRDVVTVGAWGRVHR
FT                   WRRLDPDARRAVDDALDRLGLVPLASQGFAALSGGQRQRALLAQGIARGAGLLLLDEPT
FT                   TGLDTASAKRIRAIMRSEASRGVAVVCVSHDRAVIDDADRVVRLEDGLVVADAVR"
FT   CDS_pept        237755..238624
FT                   /transl_table=11
FT                   /gene="mntB"
FT                   /locus_tag="CMM_0175"
FT                   /product="putative Mn2+/Zn2+ ABC-type transporter,permease
FT                   component"
FT                   /function="ABC-type Mn2+/Zn2+ transport systems permease
FT                   components"
FT                   /note="putative Mn2+/Zn2+ ABC-type transporter, permease
FT                   component (NP_599280.1| ABC-type transporter, permease
FT                   component [Corynebacterium glutamicum ATCC 13032];;
FT                   NP_624794.1| ABC transporter protein, integral membrane
FT                   subunit [Streptomyces coelicolor A3(2)])."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0175"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00196"
FT                   /db_xref="GOA:A5CMB1"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMB1"
FT                   /protein_id="CAN00196.1"
FT                   /translation="MSFLTRGILEPFALDFLQRALLGGALVAILCGVVGTWVVIRGMAF
FT                   LGEALAHGMLPGVALATVLGLPVLVGGALSAVAMSLGIAALQRRGRLSYDTSIGLLFVA
FT                   MLALGVVVISHSGSFATDATAILFGDILAIAPVDIALLAGAAVVGLAVAWAFHRPLVAL
FT                   ALDPRIAAVLGLGPRSAQAALVGLVTLAVVASYQAVGSLLVVGLLLAPAVAAGHWTTRI
FT                   PTRMALAAALGIAAVFVGLLVSWHAATAAGASVSATAIAVAGLSGAARAGLTALRSRPV
FT                   PASPAAPA"
FT   CDS_pept        238675..239907
FT                   /transl_table=11
FT                   /locus_tag="CMM_0176"
FT                   /product="conserved hypothetical protein"
FT                   /note="conserved hypothetical protein, putatively secreted
FT                   (NP_599278.1| hypothetical protein NCgl0025
FT                   [Corynebacterium glutamicum ATCC 13032];; NP_624793.1|
FT                   putative lipoprotein [Streptomyces coelicolor A3(2)])."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0176"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00197"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMB2"
FT                   /protein_id="CAN00197.1"
FT                   /translation="MRSRTTAPALLAGLALALTACSTAPTDAPATDRTADEQGEGHGAV
FT                   TGAAELSEPRLGLTSIDPTGAVTHLDLLDESVTDLGSIGAPTAMTSDGRYLFAQTDAGV
FT                   EIVDSGVWTWDHVDHFHYYRADPRLLGTVEGAGTATVATTNLSTTGGTGLFFPDSGEAV
FT                   LLDTEALSKGEVEELFRLDGEPGPGMVVPVGSSALVTEGQGADATVVGHTAEGERTGLV
FT                   EPCPDPAGTITTRVGAVIGCGNGALLATLTDDELAVERIPYPEGTTTPPATSFDNREGR
FT                   PTVAGLAGDQGIWLLDTRERAWTLLPAPAPLVHVTAVDDSDDHLLALTVDGRVLVMSAG
FT                   DGAVLADTGPLVADSLAAGRIPTLVADQQRAYLAGPVEQRLHEIDFADGARVSRTFDTA
FT                   TEPAFTAESGR"
FT   CDS_pept        239904..240830
FT                   /transl_table=11
FT                   /gene="mntC"
FT                   /locus_tag="CMM_0177"
FT                   /product="putative Mn2+/Zn2+ ABC-type transporter,substrate
FT                   binding protein"
FT                   /function="ABC-type metal ion transport system periplasmic
FT                   component/surface adhesin"
FT                   /note="putative manganese ABC transporter,
FT                   substrate-binding lipoprotein (NP_599279.1| ABC-type
FT                   transporter,periplasmic component [Corynebacterium
FT                   glutamicum ATCC 13032];; NP_624792.1| putative
FT                   solute-binding lipoprotein [Streptomyces coelicolor
FT                   A3(2)]). InterPro: Adhesion lipoprotein family pfam01297,
FT                   SBP_bac_9, Periplasmic solute binding protein family."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0177"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00198"
FT                   /db_xref="GOA:A5CMB3"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMB3"
FT                   /protein_id="CAN00198.1"
FT                   /translation="MSGRGIRRALAATAAAAATALGLTGCAAAGDDRPTVYVSTNILGD
FT                   VVEELVGEEAEVVTLMKPNADPHSFEISAQQAAGLRSADLVVSNGLGLEEGLQQHLDAA
FT                   SAADVPTFVAGDAIEVLDYGEGDAAGMPDSHFWTDPARMVDVVDALEPVLSGIDGVDRA
FT                   GLAARTAAYRGELEALDAEMTAAFAAIPAERRALVTNHHVFGYLADRFDFEVVGAVIPG
FT                   GTTLAAPSASDLADLVSAVEETGVPTIFAESSQPDRLVQALASEADIRVEVVELFTESL
FT                   TGPEGGAPDYLSMMRVNTQRIATGLSP"
FT   CDS_pept        240866..242077
FT                   /transl_table=11
FT                   /locus_tag="CMM_0178"
FT                   /product="conserved hypothetical protein"
FT                   /note="conserved hypothetical protein (NP_624791.1|
FT                   putative secreted protein [Streptomyces coelicolor A3(2)];;
FT                   NP_599278.1| hypothetical protein NCgl0025 [Corynebacterium
FT                   glutamicum ATCC 13032])."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0178"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00199"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMB4"
FT                   /protein_id="CAN00199.1"
FT                   /translation="MRTPRLRRAGYSAVALGLAATLAACSTPAPEGSPTSGSAAGSGEA
FT                   VGPRVAVSYEGGILVLDGETLETVSDFDSEEFTRLNPAGDDRHVMVTMSEGFQVLDTAA
FT                   GTGDEPELTDMVFEADTPGHVVRHAGKTILYAEGTSDTTVFDTADLASADGMPEVETID
FT                   GVEAHHGVSIVLEDGTFLTTVGNADGRNGIEARDASGAVMAQSDQCPGVHGEGTAAGEV
FT                   VVFGCEDGALLYDDGAITKLTAPDQPYGRMGNAYVSETSPIIVGDYKSDRDAEGYLLEA
FT                   LTLIDTEARTYEVVDMPEGVGYTFRDVARGPDDKAYIIASDGRIHVLDPATGELTDAYP
FT                   VMDAWDGPAEWQDPHPSIVVADGIGYVSEPSANTVHAVDLATGEVLTSATLDVTPNEMA
FT                   VAAG"
FT   CDS_pept        242217..243596
FT                   /transl_table=11
FT                   /locus_tag="CMM_0179"
FT                   /product="NAD-dependent aldehyde dehydrogenase"
FT                   /function="NAD-dependent aldehyde dehydrogenases"
FT                   /EC_number="1.2.1.-"
FT                   /note="NAD-dependent aldehyde dehydrogenase (AAN37492.1|
FT                   6-oxohexanoate dehydrogenase; ChnE [Rhodococcus sp. Phi2];;
FT                   O32507|GABD_DEIRA Succinate-semialdehyde dehydrogenase
FT                   [NADP+] (SSDH)). pfam00171, Aldedh, Aldehyde dehydrogenase
FT                   family."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0179"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00200"
FT                   /db_xref="GOA:A5CMB5"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMB5"
FT                   /protein_id="CAN00200.1"
FT                   /translation="MSSYAVTDPTTGGTVAEHPEITDQELQEAIAAAEGAYRGWSRRTS
FT                   IAERAALVARVAELHVERRDELARIIVREMGKPLDQALGEVDFAADIHAYYARNAEEFL
FT                   ADEAIELADGTGSAFVRRSGLGVLLGIMPWNFPYYQVARFAAPAIVTGNAILLKHAPQC
FT                   PESAEAIQRMYRDAAAELGADAGVYVSVLASNAQIEGVIADPRVQGVSVTGSERAGAAV
FT                   AEIAGRHLKKVVLELGGSDPFILLSTDDLDAAVTDAVNARLDNNGQSCNGAKRFLVIDH
FT                   LYDDFAARFTEQLTAAQPADPMADGTLLGPLSSRAATERLTEQLARAVDQGATVLASGE
FT                   PDGNLFPPAVLADVTPEMDAYREEFFGPVAALYRVASEEEAVELANDTPFGLGSYVYTT
FT                   DPEQALRVADGIDAGMVWVNLVLGDAAELPFGGVKRSGSGRELGRHAVDEFANRKLIRI
FT                   A"
FT   CDS_pept        243680..244027
FT                   /transl_table=11
FT                   /locus_tag="CMM_0180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0180"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00201"
FT                   /db_xref="GOA:A5CMB6"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMB6"
FT                   /protein_id="CAN00201.1"
FT                   /translation="MTDPPDTALRPRSRAWRLGWLSLIGPVGVVASIVAAYWGLQPQLL
FT                   IGVFPFSAASIATFVIGVVGVRRGIGDARRHPAERPRLIGGGIAVASLGLLASAAVVLV
FT                   IGGILFALSQY"
FT   CDS_pept        complement(244054..245394)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0181"
FT                   /product="putative glycosyltransferase"
FT                   /function="Glycosyl transferases related to
FT                   UDP-glucuronosyltransferase"
FT                   /note="putative glycosyltransferase (YP_051468.1| putative
FT                   glycosyltransferase [Erwinia carotovora subsp. atroseptica
FT                   SCRI1043];; AAN01207.1| putative glycosyltransferase
FT                   [Lechevalieria aerocolonigenes]). pfam00201, UDPGT,
FT                   UDP-glucoronosyl and UDP-glucosyl transferase."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0181"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00202"
FT                   /db_xref="GOA:A5CMB7"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMB7"
FT                   /protein_id="CAN00202.1"
FT                   /translation="MPSYLLCAPPIYGHVAPLVAVGRGLVARGADVTLLTGAKYREAVA
FT                   DAGLAFAPLPADVDFDDAQLDGRLAEARAARGVAAIRKGMIAMFVRVIPGQHRAMRALL
FT                   DEGRFDAVLVESAFTGIAPYLSLPRADRLPVLGIATTPVTLTSVDAAPFGPAVPPGRGP
FT                   LGHLRDRALTAAIRPGLTRPLRRAVDAVLAEIGAPLSETDTFDYPYLSYDGLFQLSVAD
FT                   LEYPRRELPDTVLFVGPLRAAPGSADDATLPDWWPELVGDRPVVHVTQGTIDNTDLGRL
FT                   VAPTLRALADEDVLVIASTGGPPVEEVERALGGPLPANARVAEFLPHDLLLPHCSAVVT
FT                   NGGFGGVQRMLANGVPLVVAGSTEDKPEVAARVAWAGCGRDLRTGTPRPEAIRRAVRDV
FT                   LTTPSYRARSRELAATIAALPDPLDVIAAGLDAAVSARRGRSATHDA"
FT   CDS_pept        complement(245483..245749)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0182"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00203"
FT                   /db_xref="GOA:A5CMB8"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMB8"
FT                   /protein_id="CAN00203.1"
FT                   /translation="MDRSADLQGPLATVHHLAAVSPRTRSRSPSMRHPLHRGLPLVCAA
FT                   AALGAGCVAALVVGTSLVSGTVGLQRLVLADPTEPEPVLAACT"
FT   CDS_pept        245857..247074
FT                   /transl_table=11
FT                   /locus_tag="CMM_0183"
FT                   /function="putative aminotransferase"
FT                   /note="putative aminotransferase (Q9CBM9|YM94_MYCLE
FT                   Putative aminotransferase ML1794;; NP_625035.1| putative
FT                   transferase [Streptomyces coelicolor A3(2)]).
FT                   pfam00155,Aminotran_1_2, Aminotransferase class I and II."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0183"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00204"
FT                   /db_xref="GOA:A5CMB9"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMB9"
FT                   /protein_id="CAN00204.1"
FT                   /translation="MVEVTTAPIEQIRGQRTSIKWTRFPADVLPLFVAEMDYAIAEPVV
FT                   EELVRRVRASDVGYLDGPGPLAPAFARFARERWGWVVDERRVRIATDVSVGIVETLRLA
FT                   VPRGGRVVVAPPVYPPFFELVEEAGARVEEVPLLVADGRASLDLAGLERAFASGVDAFL
FT                   LCNPHNPMGLVHDASTLAAVARLAARHDVLVISDEVHAPLTLPGATFTPFAPLAEALGA
FT                   SSVCVTSASKGWNLAGAKCSLVIAGDPRTHELLDGLVEEVACRTSILGLHANRVAFSCT
FT                   DWLDDAIARIVANDRLLASLLAEHLPGVVHHRPSAGYLAWLDLRPLGLGADPAAVLLER
FT                   ARVALNAGHCYGTGGAGHARLNLACDPDVLREAVRRIAAAVGSAASARTPARVPTPAVI
FT                   HRGAPA"
FT   CDS_pept        247071..248258
FT                   /transl_table=11
FT                   /gene="metE1"
FT                   /locus_tag="CMM_0184"
FT                   /function="putative methionine synthase II"
FT                   /EC_number="2.1.1.14"
FT                   /note="putative methionine synthase II (ZP_00093248.1|
FT                   COG0620: Methionine synthase II (cobalamin-independent)
FT                   [Novosphingobium aromaticivorans];; CAF20466.1|"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0184"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00205"
FT                   /db_xref="GOA:A5CMC0"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMC0"
FT                   /protein_id="CAN00205.1"
FT                   /translation="MTDRILTTHAGSLPRTPELTRLLVARDQRRAFDAGELADVTASAV
FT                   ADTVRRQLETGLDIVNDGEVPRVGFSTYVLERIDGFGGAGHRKPTLDSIKFPEYAAFQA
FT                   KQIVEGADVARVWDPPVAQGLLEYDPVLAGITEDLDGFDRELAVQAGRGLAPAGTFFSA
FT                   ATPGIVSTTLLLDAANPHYGDDRAYVFALADQLKLEYDAIVARGHTLQLDAPDLAMERV
FT                   IQFGDATLEEFLAAVDLHVDALNHAIRDIPRERVRLHVCWGNWQGPHQDDVPVDVLLPH
FT                   LYRADVGAFSVPLGNPAHQHEAPSFRAHPLPEGAVLIPGVVDVTTNYLEHPQVIANRIL
FT                   EVVDAVGDPTRVIAGTDCGLSTFASYEFVATDVAWAKLGALVEGAAIASRRAFGA"
FT   CDS_pept        248261..249622
FT                   /transl_table=11
FT                   /gene="metC"
FT                   /locus_tag="CMM_0185"
FT                   /product="O-acetylhomoserine (thiol)-lyase"
FT                   /function="O-acetylhomoserine sulfhydrylase"
FT                   /EC_number="2.5.1.49"
FT                   /note="O-acetylhomoserine (Thiol)-lyase (EC 2.4.1.49)
FT                   (Homocysteine synthase) (ZP_00228435.1| COG2873:
FT                   O-acetylhomoserine sulfhydrylase [Kineococcus radiotolerans
FT                   SRS30216];; ZP_00293095.1| COG2873: O-acetylhomoserine
FT                   sulfhydrylase [Thermobifida fusca]). Transforms
FT                   O-acetylhomoserine into homocysteine.
FT                   pfam01053,Cys_Met_Meta_PP, Cys/Met metabolism PLP-dependent
FT                   enzyme."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0185"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00207"
FT                   /db_xref="GOA:A5CMC2"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMC2"
FT                   /protein_id="CAN00207.1"
FT                   /translation="MLDGIRAAAPVASASGSGAAAPVTAGFTTRQVHAGSAIDGDHGAR
FT                   VSPVHLSAGFVFDSFAEARDRFAGVDEGYLYTRNGNPTTDEVERRLAELEGGTEAILLA
FT                   SGQAATTTALLAILQAGDRILSSSSIYEGNRGLFRQNLGRLGIGVDFVDDHRDLDEWAR
FT                   RITPETRVLFGEPIPNPKNDLLDLAGIADVAHRHGLPFVVDDTLATPYLLRPIEHGADV
FT                   VVHSTSKFLAGHGSVLGGVVVDGGSFDWAARPDLFPHLNQPERSFGGASWADRFGRGAL
FT                   VAYAREVVASRFGPTPAPFSSFLLRQGIETLSLRVERHSANALAVARFLEARPEVSSVD
FT                   YAGLESSPSHDLALRYLPDGQGSVFSFTLAGGEPAAEAFTDAVRLFSRMTHLGDVRSLV
FT                   LHPASTTHAGRTPEERDAAGIWPGLLRVSIGIEDIADILRDLERGLAAARAIGS"
FT   CDS_pept        249625..250932
FT                   /transl_table=11
FT                   /locus_tag="CMM_0186"
FT                   /product="putative oxidoreductase/monooxygenase"
FT                   /function="Coenzyme F420-dependent N5N10-methylene
FT                   tetrahydromethanopterin reductase and related
FT                   flavin-dependent oxidoreductases"
FT                   /note="putative oxidoreductase/monooxygenase
FT                   (ZP_00228434.1| COG2141: Coenzyme F420-dependent
FT                   N5,N10-methylene tetrahydromethanopterin reductase and
FT                   related flavin-dependent oxidoreductases [Kineococcus
FT                   radiotolerans SRS30216];; NP_693700.1| thermophilic
FT                   desulfurizing enzyme [Oceanobacillus iheyensis HTE831];;
FT                   AAK63173.1| thiophene oxidizing enzyme [Tsukamurella
FT                   wratislaviensis])."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0186"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00208"
FT                   /db_xref="GOA:A5CMC3"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMC3"
FT                   /protein_id="CAN00208.1"
FT                   /translation="MARRQHLGWFLSRGFGPQGWGHPYREWNHDWTRPELYQQSARELE
FT                   QAGFELIVMEDAVSLGSPETLDLRVRSAYGGPKHDPLLLAPWLFAATSRIGLVPTVNAG
FT                   ITPPYLAARQAQTLQHLSAGRFGINLVTDVGSARHVGLAPLPHDGAYDRADEWMEVVRR
FT                   LWHSWDGGALVEDPATDRFADGSLLDAFQHRGAHFSVDGPLNAVPSAFGDPVIVSPGGS
FT                   PRGLSFAGTQSDVQLGLAPLEPAELLAYRANVLDAAAAHGRGPGGIRILFVVKPEIVAS
FT                   EEEARRVVDASRHPTDEQLRAIALGWSSDLETDLTGLDLDRPVDRGVFGEHVSHGTIAG
FT                   LYGGTEDAPLRELLTRKAGKGLVSERAGFVGTAEAFADFVEELGDDADNDGLLLSGDLH
FT                   PVTLHRMLDDLVPVLRRRGILRDELAPGGLRANLFD"
FT   CDS_pept        complement(250962..251618)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0187"
FT                   /product="putative transcriptional regulator, TetR-family"
FT                   /function="Transcriptional regulator"
FT                   /note="putative tetR-family transcriptional regulator
FT                   (NP_824466.1| putative TetR-family transcriptional
FT                   regulator [Streptomyces avermitilis MA-4680];; NP_960670.1|
FT                   hypothetical protein MAP1736 [Mycobacterium avium subsp.
FT                   paratuberculosis str. k10]). InterPro: Bacterial regulatory
FT                   proteins TetR family pfam00440,TetR_N, Bacterial regulatory
FT                   proteins, tetR family."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0187"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00209"
FT                   /db_xref="GOA:A5CMC4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMC4"
FT                   /protein_id="CAN00209.1"
FT                   /translation="MSAASDPADAAGTGATGLRERRRMATTTEISEAALALFEQRGMAA
FT                   TTIHDIAQAAGVSDRTCFRYFPSKEESVLTLHPVFDAPLDAWLADVDRGSAPLPQLEAV
FT                   YERVLASLDGDLSAIAHQQLRVRRLMADEPQLRSTAVSIDATRSWELAERITTAFGGRI
FT                   TAQEARLVTELAGVAVRAAFDEWADARTAGLDATLVASFAAVRRRLRDIAGTGAA"
FT   CDS_pept        251762..253300
FT                   /transl_table=11
FT                   /locus_tag="CMM_0188"
FT                   /product="putative multi-drug efflux MFS permease"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /note="putative multi-drug efflux MFS permease
FT                   (ZP_00226170.1| COG0477: Permeases of the major facilitator
FT                   superfamily [Kineococcus radiotolerans SRS30216];;
FT                   NP_739141.1| putative lincomycin-resistance protein
FT                   [Corynebacterium efficiens YS-314]). pfam00083,Sugar_tr,
FT                   Sugar (and other) transporter. InterPro: General substrate
FT                   transporters efflux_EmrB: drug resistance transport"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0188"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00210"
FT                   /db_xref="GOA:A5CMC5"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMC5"
FT                   /protein_id="CAN00210.1"
FT                   /translation="MTTPPTADTRRDATSRDETLPAAARAASDRAVAPEDERLPHGAPL
FT                   VIGLLVVAAFVVILNETIMSVALPSLMADLDITTATAQWLTTGFMLTMAVVIPATGFIL
FT                   QRFSTRQVFGAAMTLFSIGTLIAAIAPGFGILLVGRIVQASGTAIMMPLLFTTVLNLVP
FT                   AARRGRLMGVISIVIAVAPAIGPTVSGLILSSLSWRWMFWIVLPIALVALTLGLWKITN
FT                   LTTPRKLPFDILSVVLSTLAFGGLIFGLSSLGESAEGDAPLPLWIPITVGVLALAAFIT
FT                   RQIALQRQDRALMDLRTFRSRPFVVAIIMVSVSMMALFGSLIVLPLYLQNVLELGTLET
FT                   GLLLLPGGALMAILSPIVGRLFDRVGPRPLVIPGAIIVSIALWGMTTMLHEGTSIGWVI
FT                   AVHLVLNAGLAFMFTPLLTSALGSLPPRLYSHGSATVSTMQQLAGAAGTALFVTVLTTT
FT                   TVAGLADGQSEVTATAAGVQAAFMIGGFISLAAIVASFFVRRPAEPLPEGVAAH"
FT   CDS_pept        253394..254248
FT                   /transl_table=11
FT                   /locus_tag="CMM_0189"
FT                   /product="putative hydrolase"
FT                   /function="Predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily)"
FT                   /note="putative hydrolase (ZP_00191747.2| COG0596:
FT                   Predicted hydrolases or acyltransferases (alpha/beta
FT                   hydrolase superfamily) [Kineococcus radiotolerans
FT                   SRS30216];; NP_624748.1| putative hydrolase [Streptomyces
FT                   coelicolor A3(2)]). pfam00561, Abhydrolase_1, alpha/beta
FT                   hydrolase fold. This catalytic domain is found in a very
FT                   wide range of enzymes."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0189"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00211"
FT                   /db_xref="GOA:A5CMC1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMC1"
FT                   /protein_id="CAN00211.1"
FT                   /translation="MSDTLSIGAETLAYDLVGDGPLVVLAHGMGDSRRSYRFLVPGLVA
FT                   AGYRVANVDVRGCGESSTGWTGYSRTDIAGDLVALVRHLGGPAVVVGQSISGGAATIAA
FT                   ADAPDVITGVVELAPFTRAQSADIGGLLRAKAHRAATVQLARVLLAGSLAGWMKYLDLA
FT                   FPTKPAVWAAESARIRTSLERPERMAVLRAMAKTTPADAGARLADVRCPVLVIEGGADP
FT                   DWADPRAEGERILADLPDGLGELAVIDGAGHYPHTETPDRVLVLLLPFLGRTLAATTPG
FT                   ARA"
FT   CDS_pept        254241..254825
FT                   /transl_table=11
FT                   /locus_tag="CMM_0190"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /function="Transcriptional regulator"
FT                   /note="putative transcriptional regulator, TetR family
FT                   (ZP_00191859.2| COG1309: Transcriptional regulator
FT                   [Kineococcus radiotolerans SRS30216];; NP_624749.1|
FT                   putative tetR family transcriptional regulator
FT                   [Streptomyces coelicolor A3(2)]). pfam00440,
FT                   TetR_N,Bacterial regulatory proteins, tetR family."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0190"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00212"
FT                   /db_xref="GOA:A5CMC6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMC6"
FT                   /protein_id="CAN00212.1"
FT                   /translation="MPRAGLDAATVTEAGAALADEIGLAGLSMGAVAERLGVKTPSLYK
FT                   HVASLADLQHRIAVLATAEAGDAMRDATQGRSGEEALTGAAHALRDYVTSHPGRYAATV
FT                   GARSTGDGDPLDPARERALDALSAVLHGYRLGEADRIHALRMLRSVLHGFATLEVADDF
FT                   QMATDIDVSFGWIVAFLDGGLRATAGGGRAS"
FT   CDS_pept        254831..255229
FT                   /transl_table=11
FT                   /locus_tag="CMM_0191"
FT                   /product="putative membrane protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0191"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00213"
FT                   /db_xref="GOA:A5CMC7"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMC7"
FT                   /protein_id="CAN00213.1"
FT                   /translation="MRPGTRTAARPGTRPPGHDPLAGGLRFLAELIAWVATPWALWPHS
FT                   IPLAVCAVVLLIGLPAVFSTPGDRPGGDGLVPTPGIVTIVLVLLQLVAASLAAWAIWPT
FT                   WIAVAVTALCLAVVVTEQPRWRALTRRR"
FT   CDS_pept        complement(255226..255621)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0192"
FT                   /product="putative membrane protein"
FT                   /note="putative membrane protein weak similarity to:
FT                   pfam04235, DUF418, Protein of unknown function (DUF418).
FT                   Probable integral membrane protein."
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0192"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00214"
FT                   /db_xref="GOA:A5CMC8"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMC8"
FT                   /protein_id="CAN00214.1"
FT                   /translation="MRRRDPERGPRIVRILWIAGFGIGTTTHVLDIVIGGADVYAGFPL
FT                   ALRAFWLSLTVLDPLVIALLARRRRTGVALGIAVIVADIAVNWTVFATIGGLSVWGVVD
FT                   QTLFAILVLTTAPTLLRWWRRPEAAAR"
FT   CDS_pept        complement(255632..256381)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0193"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /function="Transcriptional regulator"
FT                   /note="putative transcriptional regulator, TetR family
FT                   (ZP_00126009.1| COG1309: Transcriptional regulator
FT                   [Pseudomonas syringae pv. syringae B728a];; ZP_00192174.3|
FT                   COG1309: Transcriptional regulator [Kineococcus
FT                   radiotolerans SRS30216]). pfam00440, TetR_N, Bacterial
FT                   regulatory proteins, tetR family."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0193"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00215"
FT                   /db_xref="GOA:A5CMC9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMC9"
FT                   /protein_id="CAN00215.1"
FT                   /translation="MTESRSAAPRRRASSVTTENFPHAGADAGTDPGPGEPPGSTARGL
FT                   YSTGVRRRAEIVAAAVRVFGVRGYGAATIKEIADEVGVSPAAVLRYFRKEELLTEVLRQ
FT                   WDRQQPFVSEAAPGLPALRAFVDLMRYHVEHRGFLELYLTFATETSDATHPAHEYMRGR
FT                   YARTIAQIRRRIGEAVALGQVPPMDDATLDYESACFLAILDGLEIQWIHNPSLDLPALV
FT                   GEYVEQSIARWRGGTRAAVAPGSASWG"
FT   CDS_pept        256493..257581
FT                   /transl_table=11
FT                   /locus_tag="CMM_0194"
FT                   /product="putative oxidoreductase"
FT                   /function="Predicted dehydrogenases and related proteins"
FT                   /note="putative oxidoreductase (NP_579646.1| putative
FT                   dehydrogenase [Pyrococcus furiosus DSM 3638];; NP_103783.1|
FT                   NADH-dependent dyhydrogenase [Mesorhizobium loti
FT                   MAFF303099]). pfam01408, GFO_IDH_MocA, Oxidoreductase
FT                   family, NAD-binding Rossmann fold. This family of enzymes
FT                   utilise NADP or NAD."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0194"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00216"
FT                   /db_xref="GOA:A5CMD0"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMD0"
FT                   /protein_id="CAN00216.1"
FT                   /translation="MGEEVFGVGLVGAGPVGQAIHLPTLARMADRFRVVHVMDVDADVA
FT                   ERVAARAGARHSTDADALIQDPAVDVVVIGSPNRFHAEQVIASCRAGKRAVLCEKPLAV
FT                   SAEEGRAIARASAEHGVPVIVGTMHAFDPAWIAAVDAWDASGRAPHTVRISAVIPPNPD
FT                   SEDSATEIVGRPAPRVAGEPDVEAQALAVTGGVLGLAIHDLPLARRLLPDARPRVLSAR
FT                   ALRPWGYEIVAMVGESVLEIHGIGGASWDPEWTLDAVARDRSLHVDFSLSYVHAGSSTA
FT                   TLTDTRGTTGWGPYPDNGYVGEWEHVHDVITGRAGAVPMEAQLADLDLATDIAEQSAAI
FT                   IRSGGAVPTATGVDAPRTEVAA"
FT   CDS_pept        257578..258390
FT                   /transl_table=11
FT                   /locus_tag="CMM_0195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0195"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00217"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMD1"
FT                   /protein_id="CAN00217.1"
FT                   /translation="MTALTLRIDGGGSATHAHAAVATLASLPESFRRTDDAGDVVVVAG
FT                   GAGWAGRATAAARSGARALLVLDPGPASDPELADLAAAGVPVVLDVPWRHDEAVRRVAP
FT                   RIHRLAAPGALFEARATVASTDDLAGAARALALTAQVLVGSPLTELAPLARTPDHLMLS
FT                   GQTASGVHVIVSAVVTAHAHACATFRLVVGDRAAHVALPAPGTAAPGRASVTDAAGRED
FT                   LPVVFESGHRTAMRLARDGAHGRQVPDDVADLRSLLAAAPALAADARP"
FT   CDS_pept        258445..259767
FT                   /transl_table=11
FT                   /locus_tag="CMM_0196"
FT                   /product="putative sugar ABC transporter, binding protein"
FT                   /function="ABC-type sugar transport system periplasmic
FT                   component"
FT                   /note="putative sugar ABC transporter, binding protein
FT                   (P_627687.1| putative secreted sugar-binding protein
FT                   [Streptomyces coelicolor A3(2)];; YP_014349.1| ABC
FT                   transporter, substrate-binding protein [Listeria
FT                   monocytogenes str. 4b F2365]). pfam01547,
FT                   SBP_bac_1,Bacterial extracellular solute-binding protein.
FT                   InterPro: Bacterial extracellular solute-binding protein
FT                   family 1"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0196"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00218"
FT                   /db_xref="GOA:A5CMD2"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMD2"
FT                   /protein_id="CAN00218.1"
FT                   /translation="MPQQSSSAFGNGLTRRSLLSAGVGAAAVGLLAACSGGGGGASGAA
FT                   GDLKFWNMPWGAPAFLTEDKVISAAYKPASGFGKVSYQQVQWANFTQTFSTAVAANNGP
FT                   AVSSGGGTTAFLFESQGKIAYADDLIETWKGNGIYDDFLPGLVDTLKTANGYAAVPYNL
FT                   DMRMYWYRKDLLEKAGADVPTDWDSYEAACAALKKIGVYGYGTRSGAGAFTGFHQIVAH
FT                   MINNGGGLFDGDQNPDVVTDKNIEAVEWVLGMVKNGYVDPRSATYTSDNAYQQMDAGTF
FT                   GMFWDGAGATANVTPETAAQMVVGDPLVGPGGEKGALYFPNNIMMYKSTPSQENSEAFL
FT                   TYYYQNMKSLWTKQTGIGLPPLKSIADEAYADDPNTTKILNDWQPISKTWGAPGSNTVF
FT                   QNVTKVDGTQPTISFTQAVLAGTVTAKAALETLQKELEAGA"
FT   CDS_pept        259819..260805
FT                   /transl_table=11
FT                   /locus_tag="CMM_0197"
FT                   /product="putative sugar ABC transporter, permease
FT                   component"
FT                   /function="ABC-type sugar transport systems permease
FT                   components"
FT                   /note="putative sugar ABC transporter, permease component
FT                   (NP_627686.1| putative integral membrane transport protein
FT                   [Streptomyces coelicolor A3(2)];; NP_346128.1| ABC
FT                   transporter, permease protein [Streptococcus pneumoniae
FT                   TIGR4]). pfam00528, BPD_transp_1, Binding-protein-dependent
FT                   transport system inner membrane component."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0197"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00219"
FT                   /db_xref="GOA:A5CMD3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMD3"
FT                   /protein_id="CAN00219.1"
FT                   /translation="MAVDTRVADKIGSARRGVGVAGPGRPPAAPRKGRGKTPLGRAGKT
FT                   LALFALPSLILLVLLNVYPVVYSFLQSLQQGTPSTLPWQTPFVGLENYANVLTSESFRN
FT                   ATTFTIVFTVVGVFGSWIVGLALALLLRTRIPANGFFKVLLLLPWIVPVVVSATSWNWL
FT                   VATPQSPVPIILERLGFPDANFLGDPVLAQVVVCVFKVWISFPFMLMMMSSALASVDTN
FT                   VYEAAKMDGASAWQAFRGVTLPIISRTTYISWVLMTIFCVNDFPTIFLLTQGGPVNATT
FT                   SLIVLAYQQAFQNLQTGPATAVAFMMTAVLVIVSTLLYRQIKKADIE"
FT   CDS_pept        260802..261683
FT                   /transl_table=11
FT                   /locus_tag="CMM_0198"
FT                   /product="putative sugar ABC transporter, permease
FT                   component"
FT                   /function="ABC-type sugar transport system permease
FT                   component"
FT                   /note="putative sugar ABC transporter, permease component
FT                   (NP_627685.1| putative sugar-permease [Streptomyces
FT                   coelicolor A3(2)];; ZP_00192766.2| COG0395: ABC-type sugar
FT                   transport system, permease component [Mesorhizobium sp.
FT                   BNC1]). pfam00528, BPD_transp_1, Binding-protein-dependent
FT                   transport system inner membrane component."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0198"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00220"
FT                   /db_xref="GOA:A5CMD4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMD4"
FT                   /protein_id="CAN00220.1"
FT                   /translation="MSQALAVGGATSATLGDVKRTSAKQREQKGQWWRFLLIAIITLVV
FT                   ITPILAVLFLSTQPGQNSTATGFTLENFQRVLGGTDVMIWLGNSLIVALVTVLVSVVIA
FT                   APAGYVLSRSRSKLVSGYSLVLFVVQALPVVTAAIPLFITFSAMGLINTLQGVAIIYIG
FT                   STMSVAIWMMAAYIDSIPITLEEAAWMDGASVFSGFIHVVLRNSLPGILSTAIFSFLLA
FT                   WNDYLIALLFLQDFTKYTLPIGLNTFFQQNAADWGSVMAVAVIMMLPPVLIFALLNKYF
FT                   SVGGIGGSLAGR"
FT   CDS_pept        complement(261760..262104)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0199"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein (CAF18736.1| hypothetical
FT                   protein [Corynebacterium glutamicum ATCC 13032];;
FT                   NP_898810.1| hypothetical protein PBD2.195 [Rhodococcus
FT                   erythropolis])."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0199"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00221"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMD5"
FT                   /protein_id="CAN00221.1"
FT                   /translation="MAKDPQVPRPTRKSEYTIVFASEGARKGWQDLAATIRGPLADTWD
FT                   FLIRTPTERTPTNYPLKGEELGIITRAGTRHVRWQHKPTARGDARIWFYVAGQTVFLEQ
FT                   VHTRHPNQTK"
FT   CDS_pept        complement(262107..262565)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0200"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein (CAF18735.1| hypothetical
FT                   protein [Corynebacterium glutamicum ATCC 13032];;
FT                   NP_898809.1| hypothetical protein PBD2.194 [Rhodococcus
FT                   erythropolis])."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0200"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00222"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMD6"
FT                   /protein_id="CAN00222.1"
FT                   /translation="MSLLHGARTTTRRSSDLSKHSADVFAEAEQHPVQVTRRDRETLVL
FT                   MSQSAADANSQLLQFAADLITVTLDDAGSLSSRMTQRFPWMLALSPKDRETCSRELVDA
FT                   ARASFSTGQPHLAIAELTSWRETATAIAAGLASSPVEWLAHPAPVERP"
FT   CDS_pept        complement(262610..264466)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0201"
FT                   /product="putative glycosyl hydrolase, family 2"
FT                   /function="Beta-galactosidase/beta-glucuronidase"
FT                   /note="putative glycosyl hydrolase, family 2 (NP_631552.1|
FT                   putative hydrolase [Streptomyces coelicolor A3(2)];;
FT                   ZP_00226612.1| COG3250:
FT                   Beta-galactosidase/beta-glucuronidase [Kineococcus
FT                   radiotolerans SRS30216]). pfam02837, Glyco_hydro_2_N,
FT                   Glycosyl hydrolases family 2,sugar binding domain.
FT                   pfam00703, Glyco_hydro_2, Glycosyl hydrolases family 2,
FT                   immunoglobulin-like beta-sandwich domain. pfam02836,
FT                   Glyco_hydro_2_C, Glycosyl hydrolases family 2, TIM barrel
FT                   domain. This family contains beta-galactosidase,
FT                   beta-mannosidase and beta-glucuronidase activities."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0201"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00223"
FT                   /db_xref="GOA:A5CMD7"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMD7"
FT                   /protein_id="CAN00223.1"
FT                   /translation="MTDSTATATATPAVPKPEHPRPQSTRPDWLNLNGPWQFERDHGDS
FT                   GLERGLLERDLAEEIVVPFAPESTASGIGDVDFLTAVWYRRTVRIPAGWSGRRVLLHFG
FT                   AVDHDATVWVGGEEVARHRGGFTSFTADLGVRADEEELTVVVRARDTRDEPQARGKQAT
FT                   WFENTSCFYTRTTGIWQTVWLEPVPEAHIRSAHIEPQRADSSFTVTPELSHRTAGLVFE
FT                   AVLADAAGEITRSRIPAGDMGARVTLRIPEDRVRLWSPEDPHLYDITLRLVDASGDDDR
FT                   VVDEVASYGGLRSIAIDGRDVLLNGRRVFQRLVLDQGYWPDTLMTSPDDAALVRDIELS
FT                   MAAGFNGARLHQKVFEERFLFHADRLGYLVWGEFGDWGAGGGLGKDAQQPTASFITQWI
FT                   EAVTRDRSHPSIVGWCPLNETYQAIHDRITQLDDVTAGMYQATKAADPSRPVLDASGYS
FT                   HRVRSSDVYDSHSYEQDPDAFRREQAGLADGRPFVNDLDSRAISVPYAGQPFFVSEYGG
FT                   IWWNPDEIDRPQADASDPARAVSWGYGERVASVEEWHARFRGLTEVLLEDPLMFGYCFT
FT                   QLTDTFQEQNGIYDFHRRPKFDIARIRAVQEQRAAYEVRDDA"
FT   CDS_pept        complement(264565..265752)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0202"
FT                   /product="putative dehydrogenase/oxidoreductase"
FT                   /function="Predicted dehydrogenases and related proteins"
FT                   /note="putative dehydrogenase/oxidoreductase
FT                   (ZP_00226130.1| COG0673: Predicted dehydrogenases and
FT                   related proteins [Kineococcus radiotolerans SRS30216];;
FT                   NP_534841.1| conserved hypothetical protein [Agrobacterium
FT                   tumefaciens str. C58]). pfam01408,
FT                   GFO_IDH_MocA,Oxidoreductase family, NAD-binding Rossmann
FT                   fold. pfam02894, GFO_IDH_MocA_C, Oxidoreductase family,
FT                   C-terminal alpha/beta domain."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0202"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00224"
FT                   /db_xref="GOA:A5CMD8"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMD8"
FT                   /protein_id="CAN00224.1"
FT                   /translation="MTTSDRRPGAADAPASDRLPVVVVGAGVMGALWIRMLADSPHAAL
FT                   VGVVDLDVPLAESAVRAAGLDGIAVGASVAEVAARSGARAVVNVTVPQAHRVVNEQALR
FT                   AGLPVLCEKPLAPTVAEALRQVALADITGGLLMVSQSRRYFTHLTAFREAVAQVGPLAV
FT                   VHAQFLHEDHEPGFRELMAHPLLVDMSIHHFDQLRYATGEEPVAVRCSSWNPPWSWFAG
FT                   DAAATADFELASGARFAYVGSRCTPGMPTSWNADWCAYGERGAAHWDGDDVVGLDVAGG
FT                   RFEVPEHPEGIAASLEEFVGSLRAGTTPPTEVRHNVLSLAMVEGAIRSSERGGERVVIA
FT                   DLLEDALAQAIADERSADVADLLRSWTSAADGIRTPAWGSAPAATPPATAARDAR"
FT   CDS_pept        complement(265809..268430)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0203"
FT                   /product="putative drug exporter, RND family"
FT                   /function="Predicted drug exporters of the RND superfamily"
FT                   /note="putative multidrug efflux MFS permease (NP_627382.1|
FT                   putative membrane transport protein [Streptomyces
FT                   coelicolor A3(2)];; YP_044552.1| putative transport protein
FT                   [Staphylococcus aureus subsp. aureus MSSA476]). pfam00529,
FT                   HlyD, HlyD family secretion protein. actII: Transport
FT                   protein"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0203"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00225"
FT                   /db_xref="GOA:A5CMD9"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMD9"
FT                   /protein_id="CAN00225.1"
FT                   /translation="MASVLYRLGSMAARRAWLVIVSWVVILGIGVGSFLAFAGTLGNSF
FT                   DIPGTASGAVTDELAQTLPDTAGGTGTVVYRTTDGSAFTAAQEQAISALATSAGDLPGV
FT                   ARVVDPFAVTQQRADQAAQLASGDDQITAGRAQLDAAQQQLDAGRAQLEAGQQQLTAAR
FT                   QQAEAAGAPAAQLAPLDAQQAQLDQQTAALQEQQATVDASRAQLDSGAEQAELGRTLLG
FT                   LTDGIGVVSADGSTAIVNVSFTDPRLELSEETKQGTIAHFQDSPVDGTSVDFATDLAQG
FT                   VPEIFGIGEVVGLVFAAIVLIVMLGTVIAASLPIVTAVVGVGVGVTASLAFSGIVDMAS
FT                   VTPVLGVMLGLAVGIDYSLFIVNRHRKQMLAGTGVRESIGLANGTSGTAVVFAGSTVIV
FT                   ALLALNITGVPFLALMGTVGAVCVLVAVLVAITLTPAVLGLAGTRVLRKRDRARASAAD
FT                   PARPQEAATTLKPMSNARAVLTVLGTVVALLVIAIPSLSMRLGLPDGSSEPAGSTSERA
FT                   FTTVADEFGEGANGPLLVVADVPAGVADGDLLATQVEVAQALHDLDDVVAVAPVANTDD
FT                   GTVLAFQVLPQEGPNSASTEELVQDIRALPELDGGITLGVAGQAATNIDISEALAAVLP
FT                   LYLLVVVGLSLLILIVVFRSILLPLIATGGFVLSLFATYGLIVAVFQFGWGASLIGLES
FT                   SGPILSFLPVILVGILFGLAMDYQLFLASGMREAYVHGAEARLAVVQGFRAGRAVVTAA
FT                   ALIMVSVFGGFVFSESTIIRSIGFGLAFGVLLDAFVVRMLLMPALMHLLGRSAWWLPRW
FT                   LDRILPDVDIEGAALERTHPHASASAPDLPAGLPADGGHGAHAAPPTASTIEAETAAAP
FT                   RD"
FT   CDS_pept        268492..269082
FT                   /transl_table=11
FT                   /locus_tag="CMM_0204"
FT                   /product="putative transcriptional regulator, TetR-family"
FT                   /function="Transcriptional regulator"
FT                   /note="putative transcriptional regulator,TetR-family
FT                   (NP_626528.1| putative TetR-family transcriptional
FT                   regulator. [Streptomyces coelicolor A3(2)];; NP_350067.1|
FT                   Transcriptional regulator, AcrR family [Clostridium
FT                   acetobutylicum ATCC 824]). pfam00440, TetR_N, Bacterial
FT                   regulatory proteins, tetR family. InterPro: Bacterial
FT                   regulatory proteins TetR family"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0204"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00226"
FT                   /db_xref="GOA:A5CME0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A5CME0"
FT                   /protein_id="CAN00226.1"
FT                   /translation="MQVNEHRTGRVRSEAAREAILGATVRLIHAVGYDHLTIEGVAKEA
FT                   GVGKQTIYRWWPSRGALIAECMTEGRLIPVEFAVPDTGDLLADIEGWLTHVLAEIDAPT
FT                   GGPLVRSLVAAAAEDAAVGDSLSASLGVDRDLSERLASGIRAGQLPADAPVDELGQAIL
FT                   GVIVLRVLGRKGDHAESVTRLVRFVLGGGAAGA"
FT   CDS_pept        complement(269099..270904)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0205"
FT                   /product="putative membrane protein"
FT                   /note="putative membrane protein (CAF20404.1| putative
FT                   membrane protein [Corynebacterium glutamicum ATCC 13032]).
FT                   weak (N-terminal similarities) to serine proteases
FT                   (Subtilisin subfamily)."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0205"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00227"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5CME1"
FT                   /protein_id="CAN00227.1"
FT                   /translation="MANAPVLLFLHGVGDGDMENTWRAHLERGLRELGYPDLDGAEVVA
FT                   PKYAHALRGWDEKQSVPGLTAKQPVREAARTNRREFEQRMGAIEFRLGREDAGSGVPFA
FT                   EAAFDVVSRNSRFAQAHNYATDAQIRAQVLNLILARVPSNGDIVLVGHSLGSVIAADLL
FT                   RRLPAEVRVTGFITIGSPLAHGSVNVDKLRDVLQEPPANLGWWVNFWNFGDPVSSHRGL
FT                   SSVFPWMIDFRINTRQVGIPAHAAAAYLAHERVATAIGYALFGSLSREVARVERGVDVP
FT                   LDASEGLTLLALRYGHLTAHQLEGSDRDRFVGALRLVQAAAVDQMKRRNETDGRPLASR
FT                   IAELDFDVADAEAVAPEPTPSRHLSKEDAVVVMTVLATENVIRPFEISVARDKRQRAME
FT                   DLTAEMGLSSRYGTDVFEAAKEAQDVLTASRNVNWLKWGAVGAGAAAIVVATGGLALAA
FT                   GAGLAGAAALTSALAAFGPGGMIGGLLTAGTLVSAGGGGIAFGLANSGTAAETLESVVQ
FT                   TRLAATILRNRQGLEPDRAVWDLLVQTEIAVRREHERLDEFSDETSPALKELKRKIVTI
FT                   ERALEYLADNGMEPEISEYPDGDRD"
FT   CDS_pept        complement(271019..271876)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0206"
FT                   /product="3-hydroxyacyl-Coenzyme A dehydrogenase"
FT                   /function="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.-"
FT                   /note="3-hydroxyacyl-CoA dehydrogenase (NP_285467.1|
FT                   3-hydroxyacyl-CoA dehydrogenase, putative [Deinococcus
FT                   radiodurans];; NP_688664.1| 3-hydroxyacyl-CoA dehydrogenase
FT                   family protein [Streptococcus agalactiae 2603V/R]).
FT                   InterPro: 3-hydroxyacyl-CoA dehydrogenase pfam02737,
FT                   3HCDH_N, 3-hydroxyacyl-CoA dehydrogenase, NAD binding
FT                   domain. pfam00725, 3HCDH, 3-hydroxyacyl-CoA dehydrogenase,
FT                   C-terminal domain."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0206"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00228"
FT                   /db_xref="GOA:A5CME2"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5CME2"
FT                   /protein_id="CAN00228.1"
FT                   /translation="MPASANVTVLGAGVLGAQIAFQAANHGKTVTSYDVDDAALEAARG
FT                   RLDAIVAQFVSESGEETRESATAAAAGITLTSDLAASVADADLVIEAVPERLDLKQDVY
FT                   RRIAEAAPERTVFATNSSTLLPSDIADSTGRPDRFLALHFANHVWRQNTAEIMGTERTS
FT                   PEVFDRVVAFAEEIGMVPIPLKKEQPGYVLNSLLVPLLGAASGLVLTGVADPKTVDTTW
FT                   RIATGAPLGPFQIFDLIGLRTAYAVSAASDEPGAQAWAAHLKSEYLDKGKLGRESGEGF
FT                   YAYR"
FT   CDS_pept        complement(272021..272632)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0207"
FT                   /product="conserved hypothetical protein"
FT                   /note="conserved hypothetical protein (NP_624907.1|
FT                   conserved hypothetical protein [Streptomyces coelicolor
FT                   A3(2)];; ZP_00296064.1| COG0655: Multimeric flavodoxin WrbA
FT                   [Methanosarcina barkeri str. fusaro];; NP_882980.1|
FT                   NADPH-dependent FMN reductase [Bordetella parapertussis
FT                   12822])."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0207"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00229"
FT                   /db_xref="GOA:A5CME3"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A5CME3"
FT                   /protein_id="CAN00229.1"
FT                   /translation="MTTAIVLNCTLKPSPAPSSTSKLAGEVLAELATHGVTGREIRLVD
FT                   HDIKPGVEKDMGDGDAWPTVREAVLAADILILATPTWMGHMSSVASRVLERLDAELSET
FT                   REDGNPILFGKVALAVVVGNEDGAHKITADFLQGLNDVGFSVPAQGGVYWNGEAMNSVD
FT                   YNDLDEVPERVASVTATAARNAAHLAEFLSQHDYPAAPAE"
FT   CDS_pept        272795..273652
FT                   /transl_table=11
FT                   /locus_tag="CMM_0208"
FT                   /product="putative membrane-associated phospholipid
FT                   phosphatase"
FT                   /function="Membrane-associated phospholipid phosphatase"
FT                   /note="putative membrane-associated phospholipid
FT                   phosphatase (NP_960199.1| hypothetical protein MAP1265
FT                   [Mycobacterium avium subsp. paratuberculosis str. k10];;
FT                   H69903 conserved hypothetical protein yodM - Bacillus
FT                   subtilis). InterPro: PA-phosphatase related
FT                   phosphoesterase. pfam01569, PAP2, PAP2 superfamily. This
FT                   family includes the enzyme type 2 phosphatidic acid
FT                   phosphatase (PAP2), Glucose-6-phosphatase
FT                   EC:3.1.3.9,Phosphatidylglycerophosphatase B EC:3.1.3.27 and
FT                   bacterial acid phosphatase EC:3.1.3.2."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0208"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00230"
FT                   /db_xref="GOA:A5CME4"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A5CME4"
FT                   /protein_id="CAN00230.1"
FT                   /translation="MSDTPGRRPLAPLDPADQGVAGELRRDRFLGDRDLTRWVTPVGRI
FT                   LARVVERIMRVLGPHAALVITLLVGLVLAFGLAAIAAQVYDNVTDADGVAGLDKPLLAF
FT                   MIGIRTPWLNDVATAYTDVAGVVVMPIIAVVTMLFLAVRRRSWTPIILVVAAGGGSLLL
FT                   TIAGKDLIGRARPALADAVPPYETSPSFPSGHTLNAVAIAGILAYLLLLRQLRRVTRVL
FT                   SIAVAVVFAVTIGISRVYLGHHWFTDVLAAFFLSGAWLAVVITAHRLYLTARRPGAVEA
FT                   AEVR"
FT   CDS_pept        273681..273920
FT                   /transl_table=11
FT                   /locus_tag="CMM_0209"
FT                   /product="hypothetical membrane protein"
FT                   /function="unknown"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0209"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00231"
FT                   /db_xref="GOA:A5CME5"
FT                   /db_xref="UniProtKB/TrEMBL:A5CME5"
FT                   /protein_id="CAN00231.1"
FT                   /translation="MDDRRTFEHDSAAQKRLTGQLSARQELVLIAVTAFMSASALAFVE
FT                   LDFVMRIVLMVVVMLVLVLIGRVVIRRSNLRLNR"
FT   CDS_pept        273960..274382
FT                   /transl_table=11
FT                   /locus_tag="CMM_0210"
FT                   /product="conserved hypothetical protein"
FT                   /function="Protein chain release factor B"
FT                   /note="putative protein chain release factor B(NP_875617.1|
FT                   Protein chain release factor B [Prochlorococcus marinus
FT                   subsp. marinus str. CCMP1375];; ZP_00225589.1| COG1186:
FT                   Protein chain release factor B [Kineococcus radiotolerans
FT                   SRS30216]). pfam00472, RF-1,Peptidyl-tRNA hydrolase domain.
FT                   This domain is found in peptide chain release factors such
FT                   as RF-1 and RF-2, and a number of smaller proteins of
FT                   unknown function. This domain contains the peptidyl-tRNA
FT                   hydrolase activity. InterPro: Class I peptide chain release
FT                   factor prfB: peptide chain release factor 2"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0210"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00232"
FT                   /db_xref="GOA:A5CME6"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:A5CME6"
FT                   /protein_id="CAN00232.1"
FT                   /translation="MDLEVGPALTIPAAELRWRFSRSSGPGGQHVNTSDSRVQLTWSPV
FT                   ESLVLNDQQRARILERLGRRLVGGAITVTVSEQRSQLRNRVAALDALREIVADALAPDA
FT                   APRRPTRPTKGSQKRRLAAKTQRSATKQQRKRPTGD"
FT   CDS_pept        complement(274410..275459)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0211"
FT                   /product="putative monooxygenase"
FT                   /function="Coenzyme F420-dependent N5N10-methylene
FT                   tetrahydromethanopterin reductase and related
FT                   flavin-dependent oxidoreductases"
FT                   /note="putative monooxygenase (ZP_00225458.1| COG2141:
FT                   Coenzyme F420-dependent N5,N10-methylene
FT                   tetrahydromethanopterin reductase and related
FT                   flavin-dependent oxidoreductases [Kineococcus radiotolerans
FT                   SRS30216];; NP_534605.1| monooxygenase [Agrobacterium
FT                   tumefaciens str. C58 (U. Washington)]).
FT                   pfam00296,Bac_luciferase, Luciferase-like monooxygenase."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0211"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00233"
FT                   /db_xref="GOA:A5CME7"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A5CME7"
FT                   /protein_id="CAN00233.1"
FT                   /translation="MATKIGFLSFNHWQDVRGSRVRTAQDSLLQSIDLAVAAEEIGIDG
FT                   AYFRVHHFAPQQASPFPLLAAIASRTSRIEIGTGVVDMRYENPLYMAEEAAMTDLISNR
FT                   RVQLGISRGSPEQVEAGYESFGYVPRDGETDADMARRHTGLFLRALEGEELATAAPQRG
FT                   IIAGGVAITPQSPGLRERIWWGAGTRATGQWAAEQGMNLMSSTLLSEDTGVPLDVLQAE
FT                   QIQLFRDGWAAAGHAWEPRVSVSRSIIPIVDDESEAFFGIRSQIEGKDQVGQVGGEKWR
FT                   FGRSYIGSPERLIEELGADQAIAAADTLLVTIPNQLGVDFNLRSLAAIKQIGEALGWDR
FT                   ADVAVGASA"
FT   CDS_pept        complement(275539..275694)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0212"
FT                   /product="conserved hypothetical protein"
FT                   /note="conserved hypothetical protein, putative antitoxin
FT                   (ZP_00204491.1| COG2161: Antitoxin of toxin-antitoxin
FT                   stability system [Actinobacillus pleuropneumoniae serovar 1
FT                   str. 4074];; ZP_00177056.1| COG2161: Antitoxin of
FT                   toxin-antitoxin stability system [Crocosphaera watsonii WH
FT                   8501]). pfam02604, DUF172, Uncharacterized ACR, COG2161."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0212"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00234"
FT                   /db_xref="UniProtKB/TrEMBL:A5CME8"
FT                   /protein_id="CAN00234.1"
FT                   /translation="MSEDDETSYLLRNPAGAKTLLEALERARHGESIERELIEPSDDAE
FT                   PYDPRE"
FT   CDS_pept        275764..276108
FT                   /transl_table=11
FT                   /locus_tag="CMM_0213"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /note="conserved hypothetical protein (ZP_00018531.1|
FT                   hypothetical protein [Chloroflexus aurantiacus];;
FT                   ZP_00227133.1| COG4898: Uncharacterized protein conserved
FT                   in bacteria [Kineococcus radiotolerans SRS30216])."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0213"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00235"
FT                   /db_xref="InterPro:IPR014580"
FT                   /db_xref="InterPro:IPR023204"
FT                   /db_xref="UniProtKB/TrEMBL:A5CME9"
FT                   /protein_id="CAN00235.1"
FT                   /translation="MHRIFTTPFAAVYPLYVKKVERKGHTQAEVDQVITWLTGFDAAEL
FT                   QHHLDAETTFEDFFAAARLNPLADAVRGVICGVRIEELDDPLMKEIRILDKLVDEVARG
FT                   RAMTKVLRGS"
FT   CDS_pept        complement(276105..276335)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0214"
FT                   /product="conserved hypothetical protein"
FT                   /note="conserved hypothetical protein (CAF21348.1|
FT                   hypothetical protein predicted by Glimmer/Critica
FT                   [Corynebacterium glutamicum ATCC 13032];; NP_828735.1|
FT                   hypothetical protein [Streptomyces avermitilis MA-4680])."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0214"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00236"
FT                   /db_xref="InterPro:IPR019270"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMF0"
FT                   /protein_id="CAN00236.1"
FT                   /translation="MMRVTYDAVADAAYVELAGPLGDGEAATTIHSIATPGDRGEVALD
FT                   FDADGRLLGIEVLRASAVLRASVLADAVRVG"
FT   CDS_pept        complement(276332..276907)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0215"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /function="Transcriptional regulator"
FT                   /note="putative transcriptional regulator, TetR family
FT                   (NP_624661.1| putative transcriptional regulator
FT                   [Streptomyces coelicolor A3(2)];; NP_624835.1| putative
FT                   TetR family transcriptional regulator [Streptomyces
FT                   coelicolor A3(2)]). pfam00440, TetR_N, Bacterial regulatory
FT                   proteins, tetR family. InterPro: Bacterial regulatory
FT                   proteins TetR family"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0215"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00237"
FT                   /db_xref="GOA:A5CMF1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR041347"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMF1"
FT                   /protein_id="CAN00237.1"
FT                   /translation="MSRWQPDTRERLAAAALELFRERGFAETTVPEITARAGLTTRTFF
FT                   RHFADKREVLFAEEDELPALVTRIIREASPDRSPLQVVEDGFPEVVASQFSEGRATLLA
FT                   RKRIIGDDPGLQEREMRKVQAMQEAVRAGFVERGSDPLTAVLVAHATATVFGVSIGRWL
FT                   SDGGGTTDLAEVLRETLAAFRALMGAGG"
FT   CDS_pept        277004..278119
FT                   /transl_table=11
FT                   /locus_tag="CMM_0216"
FT                   /product="putative Zn-dependant oxidoreductase"
FT                   /function="NADPH:quinone reductase and related Zn-dependent
FT                   oxidoreductases"
FT                   /note="putative Zn-dependant oxidoreductase (XP_387934.1|
FT                   hypothetical protein FG07758.1 [Gibberella zeae PH-1];;
FT                   XP_405167.1| hypothetical protein AN1030.2 [Aspergillus
FT                   nidulans FGSC A4]). pfam00107, ADH_zinc_N, Zinc-binding
FT                   dehydrogenase. InterPro: Zinc-containing alcohol
FT                   dehydrogenase superfamily"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0216"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00238"
FT                   /db_xref="GOA:A5CMF2"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMF2"
FT                   /protein_id="CAN00238.1"
FT                   /translation="MPTETAAWLASSAADLTVGPAPRTAPRDGEVAIRVRAVAINPLDT
FT                   MKQHMGDLMYRWLPHPAVLGEDVAGEVEEVGPGVTRFAVGDRVVAYAVGMEKGRRHAPE
FT                   GGFQSRVVVRTDLASPIPDATRFEDAAVLPLGISTAASGLFGAGQLGLRMPDATTPSTG
FT                   ETVVVWGGSTSVGMNAIQLAVAAGYDVVTTASPRNHELVRSLGASRAFDYRSPTAVRDI
FT                   KQHLAGRRVAGVLAIGTGSGGPAVDIAIATGATRVSMASPPVSFEALPRGGRVGLPLVR
FT                   LGIRMGTATPALMIRARARGIRATFIWGSALMHDEVGPMLWERFLPAALADGRYVAAPA
FT                   AEVVGSGLEAIQPAMDRLRAGVSARKLVVAL"
FT   CDS_pept        complement(278116..278919)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0217"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein (NP_898693.1| hypothetical
FT                   protein PBD2.078 [Rhodococcus erythropolis])."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0217"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00239"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMF3"
FT                   /protein_id="CAN00239.1"
FT                   /translation="MIVEAPPLRRAQAEAWHALFEVHERIPTGWALVGGQMIQALCWER
FT                   GAHANRPTVDADTALDVRAHPRMLMTFTTALRDIGFEPDGTSFEGHQHRWVRGEALIDV
FT                   LIPRFLGERADGRRGAGGGTTVSAPGAQGALDRSADVLFRVEGQVGTIRRPTLQGAILS
FT                   KAAALEITGDDTTRHLVDIATLGALVTRRDDVGANITATERRRALTAAALIRRDATYAR
FT                   LAGVDPSVSERLRLAFTEPPLAAPRTSDGGRIRRADPGHPADRGR"
FT   CDS_pept        complement(278916..279569)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0218"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein (ZP_00657923.1| hypothetical
FT                   protein NocaDRAFT_1855 [Nocardioides sp. JS614])"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0218"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00240"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMF4"
FT                   /protein_id="CAN00240.1"
FT                   /translation="MAEISAAEYAKGQSISARRVQAAAAAGVLPARKIAGRWVIDAAEA
FT                   RHDQVGRPLSSRSVRALLARLSGDDAWRAGLSASEASRVIGRLTKLRDAPNAAEVLAAW
FT                   MRSARPAARSFLVADEDLEDLRADPRLVAGGISDLRSGLSDARELEAHVHVDDLDPIIH
FT                   EYLLVSGDRPNVLLHVQERPVQRPLPLGELIADLSQHRGPRERAAAAHLLGEVA"
FT   CDS_pept        279717..280016
FT                   /transl_table=11
FT                   /locus_tag="CMM_0219"
FT                   /product="Conserved hypothetical protein"
FT                   /function="Rhodanese-related sulfurtransferase"
FT                   /note="putative sulfurtransferase (NP_266940.1|
FT                   hypothetical protein L193291 [Lactococcus lactis subsp.
FT                   lactis Il1403];; NP_601905.1| rhodanese-related
FT                   sulfurtransferase [Corynebacterium glutamicum ATCC 13032]).
FT                   pfam00581, Rhodanese, Rhodanese-like domain. InterPro:
FT                   Rhodanese/cdc25 fold"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0219"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00241"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMF5"
FT                   /protein_id="CAN00241.1"
FT                   /translation="MSRITVDQLAALDSPVLIDVREPDEYAAGHAPGAVNLPMSQLDAR
FT                   VDEVPTDAPVHVICQSGGRSARATEALAARGVDAVDVEGGTSAWISAGHSVDRA"
FT   CDS_pept        280058..280642
FT                   /transl_table=11
FT                   /locus_tag="CMM_0220"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /note="conserved hypothetical protein (ZP_00228399.1|
FT                   COG4430: Uncharacterized protein conserved in bacteria
FT                   [Kineococcus radiotolerans SRS30216];; ZP_00274169.1|
FT                   COG4430: Uncharacterized protein conserved in bacteria
FT                   [Ralstonia metallidurans CH34])."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0220"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00242"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMF6"
FT                   /protein_id="CAN00242.1"
FT                   /translation="MPAAAHELLTVPDRAAWRAWLDAHEESSDGVWLVLAKKGTTDPTS
FT                   LTYAEALDEALCSGWIDGQTASIDERIFRRRFTPRRKASLWSERNIGLVATLTAEGRMR
FT                   PAGIREVERAQADGRWDRAYAGQASAAEPEDLTAALAASPAAAATFAALTKVNRYAVIH
FT                   RVTTAPNATVRANRLAKLVAMLERGETPHPQ"
FT   CDS_pept        complement(280668..280982)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0221"
FT                   /product="putative multidrug resistance membrane protein"
FT                   /function="Membrane transporters of cations and cationic
FT                   drugs"
FT                   /note="putative multidrug resistance membrane protein
FT                   (ZP_00293737.1| COG2076: Membrane transporters of cations
FT                   and cationic drugs [Thermobifida fusca];; AAL07365.1|
FT                   putative small multidrug resistance protein
FT                   [Stenotrophomonas maltophilia]). pfam00893,Multi_Drug_Res,
FT                   Small Multidrug Resistance protein. This family is the
FT                   Small Multidrug Resistance (SMR) family."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0221"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00243"
FT                   /db_xref="GOA:A5CMF7"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMF7"
FT                   /protein_id="CAN00243.1"
FT                   /translation="MAWLLLGIAIVTEVAATISLKLATDGRKRWYAVVAVGYVTAFSML
FT                   AGALSLGLPIGVAYGIWAATGVALTAILGRVLFRDPLTRTMLAGIALIIGGVLLIELGH
FT                   "
FT   CDS_pept        complement(280982..281377)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0222"
FT                   /product="putative multidrug resistance membrane protein"
FT                   /function="Membrane transporters of cations and cationic
FT                   drugs"
FT                   /note="putative multidrug resistance membrane protein
FT                   (ZP_00293737.1| COG2076: Membrane transporters of cations
FT                   and cationic drugs [Thermobifida fusca];; ZP_00173962.2|
FT                   COG2076: Membrane transporters of cations and cationic
FT                   drugs [Methylobacillus flagellatus KT]).
FT                   pfam00893,Multi_Drug_Res, Small Multidrug Resistance
FT                   protein. This family is the Small Multidrug Resistance
FT                   (SMR) family. Several members have been shown to export a
FT                   range of toxins, including ethidium bromide and quaternary
FT                   ammonium compounds, through coupling with proton influx.
FT                   InterPro: Integral membrane protein DUF7"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0222"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00244"
FT                   /db_xref="GOA:A5CMF8"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMF8"
FT                   /protein_id="CAN00244.1"
FT                   /translation="MRWLLLGAAIVSEVAAALALQAAVDVPGWYALVVAGYLTAFWFLT
FT                   RVLKAGMAVGVAYGIWGASGVALTAVGATVLFGQPLTGLMILGLVLIVAGVLLVELGSQ
FT                   RAHAARAAAASAATAAPIRATPTGEAR"
FT   CDS_pept        complement(281510..282169)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0223"
FT                   /product="putative phosphatase"
FT                   /function="Predicted phosphatase/phosphohexomutase"
FT                   /note="putative phosphatase (NP_533751.1| haloacid
FT                   dehalogenase-like hydrolase [Agrobacterium tumefaciens str.
FT                   C58];; ZP_00267448.1| COG0637: Predicted
FT                   phosphatase/phosphohexomutase [Pseudomonas fluorescens
FT                   PfO-1];; NP_827006.1| putative hydrolase [Streptomyces
FT                   avermitilis MA-4680]). pfam00702, Hydrolase, haloacid
FT                   dehalogenase-like hydrolase. TIGR00099: conserved
FT                   hypothetical prote"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0223"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00245"
FT                   /db_xref="GOA:A5CMF9"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMF9"
FT                   /protein_id="CAN00245.1"
FT                   /translation="MSSPVTLTTRALLLDMDGTLVDSTALVEEIWTMLAVRFGHDPADL
FT                   LRRIHGVRAADSIARFAPAGSDVPALLAELDRLELDGSPATVEIPGARDLVAALPAGSH
FT                   ALVTSAGRELARARLTGAGVRVPDLLVTAEDVENGKPHPDGYLLAASRLGVDPADAIVY
FT                   EDAEAGIQAGLAAGMRVVVVGDHASDATVGLPRVRDHRGTTVEVRDGILTLTLPGV"
FT   CDS_pept        282255..283451
FT                   /transl_table=11
FT                   /locus_tag="CMM_0224"
FT                   /product="putative glycosyl transferase"
FT                   /function="Glycosyl transferases related to
FT                   UDP-glucuronosyltransferase"
FT                   /note="putative glycosyl transferase (AAM70336.1| CalG1
FT                   [Micromonospora echinospora];; BAD08357.1|
FT                   glycosyltransferase [Streptomyces halstedii]).
FT                   pfam03033,Glyco_transf_28, Glycosyltransferase family 28
FT                   N-terminal domain. This N-terminal domain contains the
FT                   acceptor binding site and likely membrane association site.
FT                   pfam04101, Glyco_tran_28_C, Glycosyltransferase family 28
FT                   C-terminal domain."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0224"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00246"
FT                   /db_xref="GOA:A5CMG0"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMG0"
FT                   /protein_id="CAN00246.1"
FT                   /translation="MPLPLRILFSFARGQGHLNPLMPFARAARARGHETALAGPRELVA
FT                   GRADFAPLFPSDTGAARTEGGTGRLVVADPRRPYAQVEEVFLGEAARTAARSVDEAIAG
FT                   WTPSLVVCDEFDFGAMVAAERAGVPLVVVEVTASAYSGWRPSVAHALDALRTEAGLAPD
FT                   PGLAMLAGDLLVVPFPESVAGAGPGAASGSAYGAEPAPRSVLRVRPEAPETADDHPAVR
FT                   WLAAGDEPWRVYATLGTQFNTRSGDLLHRILDGLATTDARVLATIGPCVDPAAFPGATP
FT                   RRRLEGYVPQGAVLERVDVVITHGGSGTVAGALAAGVPLLVLPMGADQRLNGERIAQLG
FT                   VGRMLDAATATPEEIADAAGEIRGVPSFADAAGRIRDQIAALPPAADALPAFEALARR"
FT   CDS_pept        283730..284890
FT                   /transl_table=11
FT                   /locus_tag="CMM_0225"
FT                   /product="putative sarcosine oxidase"
FT                   /function="Glycine/D-amino acid oxidases (deaminating)"
FT                   /EC_number="1.5.3.-"
FT                   /note="putative sarcosine oxidase (ZP_00227998.1| COG0665:
FT                   Glycine/D-amino acid oxidases (deaminating) [Kineococcus
FT                   radiotolerans SRS30216];; Q827H4|MSOX_STRAW Monomeric
FT                   sarcosine oxidase (MSOX)). pfam01266, DAO, FAD dependent
FT                   oxidoreductase."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0225"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00247"
FT                   /db_xref="GOA:A5CMG1"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMG1"
FT                   /protein_id="CAN00247.1"
FT                   /translation="MAGSTGRGRASHHVVIGAGLAGAATAWQLASRGHEVTVLERDRPA
FT                   GMLGSSHGSARILRYAYDDPFYVRLMRDARVLWDRLERTTGSRLVTPTGSVDSGLVRRP
FT                   AELARVLERVGIEHELMGAREAEDRWPEMSFDSDVLFHPAAGVVDAETAVRTMLDLAVV
FT                   HGAVVHEGWEAVSVERVGAGFAVRSVDGRRVEGDSVIVGAGAWLPELLGGALPLPRAAL
FT                   DRIPPLRVRQEQVFHFPYRQGAYMDGPPARSVPTSIHMDERMQVYALPGGRDADHRGHK
FT                   VAEFDGGRVIPSAAHQDGVVDPANRARVVDWVRRNLPGVEPVPYAEATCLFTSTPTEDF
FT                   VIDRVEGITIVSPCSGHGAKFAPLVGVLAADAATGERVEPRFALAP"
FT   CDS_pept        complement(284921..285598)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0226"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0226"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00248"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMG2"
FT                   /protein_id="CAN00248.1"
FT                   /translation="MPRPRIRPAKPSKPGAPPPSVAARVAADPAQKEVLVEEALLLVGV
FT                   ALRIQMVNLIILRTLRERRPYDEESLIEALRGELAELIGEKRGEAERLRMARDRAALRD
FT                   GKGRRPDDYREGDVPGLRLRAEIAEEIVERLGALSRDPEALREVLVIARDSALEQIVRA
FT                   RLSPQLLPGAFPAEGRDDRVDELRAELARLAADRERAAERAEERAPGRTRVRTGGRGRP
FT                   QKV"
FT   CDS_pept        complement(285732..286691)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0227"
FT                   /product="putative acetyl xylan esterase"
FT                   /function="Acetyl esterase (deacetylase)"
FT                   /note="putative acetyl xylan esterase (NP_822477.1|
FT                   putative cephalosporin C deacetylase [Streptomyces
FT                   avermitilis MA-4680];; NP_107393.1| acetyl xylan esterase
FT                   [Mesorhizobium loti MAFF303099]). , pfam05448, AXE1,Acetyl
FT                   xylan esterase (AXE1)."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0227"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00249"
FT                   /db_xref="GOA:A5CMG3"
FT                   /db_xref="InterPro:IPR008391"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR039069"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMG3"
FT                   /protein_id="CAN00249.1"
FT                   /translation="MLIEPVDAARAHVSSHVDPDDFDAFWADTLAEAARHDLDVRLAPV
FT                   ETDLALVDVQDVTFAGSGGTDVRAWLRTPAGATGPLPTVVSYVGYGGGRGRAEETLIYA
FT                   AAGFAHLQMDTRGQGSYWSAGDTADHGEAGPAIPGFMTRGIASRDTYYYRRLFTDAVRA
FT                   VDVARSLDVVDPARIAVQGGSQGGGMALAVAGLRDDVAAVSAYVPFLCDIERATHITDA
FT                   YPYHEVVDYLKTHRGRGEDVHAVLRYFDGVAFSRRATAPARFSVGLMDATCPPSTVYGA
FT                   FNSYAGEKEIVEWEYNGHDGGGIDDELGTLAFLWRRMG"
FT   CDS_pept        complement(286773..287369)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0228"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /function="Transcriptional regulator"
FT                   /note="putative transcriptional regulator, TetR family
FT                   (NP_822813.1| putative TetR-family transcriptional
FT                   regulator [Streptomyces avermitilis MA-4680];; CAB07159.1|
FT                   PROBABLE TRANSCRIPTIONAL REGULATORY PROTEIN (PROBABLY
FT                   TETR-FAMILY)[Mycobacterium tuberculosis H37Rv]).
FT                   pfam00440,TetR_N, Bacterial regulatory proteins, tetR
FT                   family. InterPro: Bacterial regulatory proteins TetR
FT                   family"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0228"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00250"
FT                   /db_xref="GOA:A5CMG4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMG4"
FT                   /protein_id="CAN00250.1"
FT                   /translation="MRRAMIVEAARAVILRQGLTATGLRDIAAEGGVSVGTVTYHFASV
FT                   AEILDEVVVLETDRFYASIVEEVDADVDPVHGIRLLVEPLFTGAEEAEAHWRLWSDYWT
FT                   AVARQPGLSADRLERIRVWEACLVRTIRRGVEGGAFRTVDAPEVALKLAAYSDGIATQL
FT                   SQKAPGLDHARALEWIWTFLDAELADPADGTPLFR"
FT   CDS_pept        complement(287456..289510)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0229"
FT                   /product="putative acyl esterase"
FT                   /function="Predicted acyl esterases"
FT                   /EC_number="3.1.1.-"
FT                   /note="putative acyl esterase (NP_826040.1| hypothetical
FT                   protein SAV4863 [Streptomyces avermitilis MA-4680];;
FT                   NP_105843.1|"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0229"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00251"
FT                   /db_xref="GOA:A5CMG5"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR005674"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013736"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMG5"
FT                   /protein_id="CAN00251.1"
FT                   /translation="MTDAAHETTANATETGDAVTHRDVWIPMPDGTPLHARVWAPATDE
FT                   PVPALLEYLPYRLDDWTAPRDSERHPWYAAHGYASIRVDIRGTGSSDGLFVDEYSAQEL
FT                   DDGVAVIEWIAAQAWCTGAVGVFGISWGGFNGLQLAARAPEALKAVVTVCSTDDRFDND
FT                   VHYMGGAVLGIDMAAWGATMFAFNSRPPRPEVVGDCWVGRWRERLEANRPMTPTWLAHQ
FT                   ERDDYWRHGSVCEDYSSIDAAVLAVGGWADPYRDAVLRLVENLPGPAKGIVGPWSHQYP
FT                   DRGLAPGPSIGFLQETLRWWDRWLKGVDTGVESDPALRAFLSDSEPPATSYPERTGRWV
FT                   AAESWPPPESVAAQPVLPLAAFHGPAAAGDAVVVRSPQRTGLDAGRFFPFGNPTDLPPD
FT                   QRAEDGLSVCFDLLLEEPLDMLGNVLVDLAVTSDLPDANLVVRLCDVAPDGASTLVTRG
FT                   ALNLNKRVDRARIDPMVPGEEETVRVPLVSTGHAFPAGHRLRIAVSSAYWPWIWPHARE
FT                   ATLALAPSRSAVTLPVWTRTEDDGVRFEEAVQATPIAIQRIPDDSGLPERSVTHDVATG
FT                   EWTLDVDPGYGGSRIYPDGLVFTESSRETYRITDGDPTSAVAESRWAIGLEQPTWRARL
FT                   ETTSRVTADADAFRVVNTLRAWARDGGPGAPEVLVADRVFDDLVPRTSA"
FT   CDS_pept        complement(289507..291240)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0230"
FT                   /product="putative peptide ABC transporter, ATP-binding
FT                   protein"
FT                   /function="ATPase components of various ABC-type transport
FT                   systems contain duplicated ATPase"
FT                   /note="putative peptide ABC transporter, ATP-binding
FT                   protein (NP_790103.1| peptide ABC transporter, ATP-binding
FT                   protein [Pseudomonas syringae pv. tomato str. DC3000];;
FT                   NP_415350.1| putative ATP-binding component of a transport
FT                   system; putative oligopeptide transport protein (ABC
FT                   superfamily, atp_bind) [Escherichia coli K12]).
FT                   cd00267,ABC_ATPase, ABC (ATP-binding cassette) transporter
FT                   nucleotide-binding domain (twice)."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0230"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00252"
FT                   /db_xref="GOA:A5CMG6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMG6"
FT                   /protein_id="CAN00252.1"
FT                   /translation="MMPGNVEDTLTGQVRLGTVVRVADLAISYAAGRTDVPVVRGVSFE
FT                   IRAGRALGLVGESGSGKSTVARTLLAHLRRGSRIVGGAVEVAGDDVFALSPAATRELRG
FT                   GTAAVVAQNAGQALTPSMRVGRQLREALESHGLPSEDERVEELIRLVRLPDPATIVRRY
FT                   PHQLSGGQQQRIAIAMAVAARPRVLVLDEPTTALDVVTQAAVLTLIRDLARELGMAVLL
FT                   VSHDLGVVSTMVDEIAVMRDGVIVEHRPTAELFASPEHPYTRELLAAIPDGPGSAGPAP
FT                   AEDQVTPMVVADGLVVRYARGLPPAVSDVSFTIAPRETLAVVGESGSGKTTLATALAGL
FT                   VPTESGTFRFQGDGVEGDLTSAVAGRSPALRRAVQLVFQNADTSLNPRRTVGAAIARPL
FT                   KLFTGRASAERVGEILTEVGLSPDFAARLPNQLSGGQRQRVGIARALAADPQLVIADEI
FT                   TTALDVRVQAEILDLLAGLQRDKGLSCLFISHDLAVVRGVADRVAVMTGGRIVEIGPTE
FT                   RVFQGPNHPYTRQLLAATLEPGATELPRVEDVTATWRDAAGGGWRELGDGHRIRDWEDA
FT                   R"
FT   CDS_pept        complement(291237..292118)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0231"
FT                   /product="putative peptide ABC transporter, permease
FT                   component"
FT                   /function="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems permease components"
FT                   /note="putative peptide ABC transporter, permease component
FT                   (CAG20639.1| hypothetical ABC transporter permease
FT                   [Photobacterium profundum];; NP_846941.1| oligopeptide ABC
FT                   transporter, oligopeptide-binding protein [Bacillus
FT                   anthracis str. Ames]). pfam00528,
FT                   BPD_transp_1,Binding-protein-dependent transport system
FT                   inner membrane component. InterPro:
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0231"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00253"
FT                   /db_xref="GOA:A5CMG7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMG7"
FT                   /protein_id="CAN00253.1"
FT                   /translation="MTATPLPTRRGGRLRGWTTPLRASTALSVGLAIISIHVVLAVLAP
FT                   WIAGHDPVATDSTDVLSGTTWAHWLGTDQYGRDVLSRVLNGGRYALVVTFLATTIAVAV
FT                   GTVVGCVTAYAEGWLDEVVMRIVDALLSVPSILALLVVVTVFGSGLWVIVLAVTVVYAP
FT                   AVTRVVRGAARTVITQDYVTASRTRGERPLSIVFREILPNVLDVVLVEYAMRASWIVLL
FT                   ISSLSFLGFGANPPTPDWGLMVQENRTALTVVPLGTLAPIVALATLVVGLNLSADGLSK
FT                   SLGVDRAQRGIA"
FT   CDS_pept        complement(292115..293134)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0232"
FT                   /product="putative peptide ABC transporter, permease
FT                   component"
FT                   /function="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems permease components"
FT                   /note="putative peptide ABC transporter, permease component
FT                   (CAG20638.1| hypothetical ABC transporter,permease protein
FT                   [Photobacterium profundum];; NP_085756.1| dipeptide
FT                   transport system permease protein [Mesorhizobium loti
FT                   MAFF303099]). pfam00528, BPD_transp_1,
FT                   Binding-protein-dependent transport system inner membrane
FT                   component."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0232"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00254"
FT                   /db_xref="GOA:A5CMG8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMG8"
FT                   /protein_id="CAN00254.1"
FT                   /translation="MNVSAQVARRLGTAILTIVLASLFVFLAIQLLPGDVAQQLLGQDA
FT                   TPEAVATLRESLGLDRNVWLRYGDWLLGAARGDFGTSLVSGDPVAPALLVAFRNSMLIA
FT                   VPAMLVGVTLSLVLGVVAGVRRGRASDSVISIVSLVVMSVPEFMVATVLVLLFAITIPV
FT                   FPAVVLRGSDATVAELLPSVALPVIVLTLAMAAYIVRTMRSSTIDVMASEFVTTAELKG
FT                   LTTRQVVWRHAVPSALLPTLNVVALNVAWLLGGVVVVENVFNYPGMGKLMLESVFTRDL
FT                   PTIQAIALLSAAVYVVCNLAADLIALALDPRLRTRQSARPTRPARSAARPSPRRKARA"
FT   CDS_pept        complement(293131..294786)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0233"
FT                   /product="putative peptide ABC transporter,
FT                   substrate-binding protein"
FT                   /function="ABC-type dipeptide transport system periplasmic
FT                   component"
FT                   /note="putative peptide ABC transporter, substrate-binding
FT                   protein (CAG20637.1| hypothetical ABC
FT                   transporter,periplasmic solute-binding protein, family 5
FT                   [Photobacterium profundum];; NP_357196.1| AGR_L_2824p
FT                   [Agrobacterium tumefaciens str. C58]). pfam00496,SBP_bac_5,
FT                   Bacterial extracellular solute-binding proteins, family 5."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0233"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00255"
FT                   /db_xref="GOA:A5CMG9"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMG9"
FT                   /protein_id="CAN00255.1"
FT                   /translation="MPSIVTTRTAFADASSRTIRIADRAARPDRPNTPSRRAILAGTAG
FT                   IAGLGLLALTGCATGASSTTIPEAAATGTPVQGGRLRVARPAASAAETLDSASSLSAYE
FT                   YLGALYNRLVKLDEKGETIPDLAEEWSASADGVTWTFRLRRDVRFHDGTRFTAADAIAS
FT                   IQHVIDPATASPQGGVLGDMLDPGSMSAPDAHTLVFQLKTPNAEFPSLLTAYQCYIVPA
FT                   DAIATIGSTGIGTGPFRLSSFHPAGSGSVEAFDDHFAGRPVLDGIDFSSIQDTTARVNA
FT                   LLAGQIDLISQTNLDFATARVVSASSRATVARVENAQWYTIPMLATSAEFQDPLVRQAM
FT                   KLAYDPEQILATALQGTGTAGWDNPVPPSLAAFVDVDRAYDPDQAKALLAKAGVSGLRT
FT                   TIHTSSYESVFTPMAVAYRDQVKAAGIDLTVTNASSDSYYTEIWMQKPLMVSYWFTGRP
FT                   IDQLLNQIFRTGSSYNESAWSNPTFDALLDDARATMDDAKRLTLYQDAQRIVVEDSADM
FT                   TPMFGDRLVGISRDVVNYREFGFEFDHLTIGFRR"
FT   CDS_pept        complement(294887..295393)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0234"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00256"
FT                   /db_xref="GOA:A5CMH0"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMH0"
FT                   /protein_id="CAN00256.1"
FT                   /translation="MALGACWALASFLLDARERRRGQGATTSGSGRSTVYLELHPLMLA
FT                   AAGVIAFVRRDDVAVVLITTGIAAGLSTVLDMLEGRASAGARCHGRERHLDGFRHARRS
FT                   PLVLAAVFLMAMGGLCVSIPDDPGAVTAAASGGFAALLLLTALVVRDRRHRLATTGTGA
FT                   GVGEG"
FT   CDS_pept        complement(295483..296382)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0235"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00257"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMH1"
FT                   /protein_id="CAN00257.1"
FT                   /translation="MPIRPRSAIALLALTIAVAANGLTAEAASAADTAGDTSTQALVAR
FT                   ALDAVGQGAESTADWTAPDAVDPPALPHTAGGDVGVTPSDTDDSLVRVAPGETQAVTVL
FT                   RDGADVTSFALDLPDGFRAVPRGAGYDIVAALGSGSGSISAGHIADPWAVDAAGRSIPT
FT                   RFALEGDTLVQTIDAEGAAYPVVVDPLVTFGLANAPQGVGFYVNLLGSQMREVTAVAAL
FT                   LLSAGYFGICKAAGRLAAPAAKLIGWLCAAIGSPNVFSIVDLVHRIYQSNRFGFYACYQ
FT                   TRIGSGRAFVWTEHANCA"
FT   CDS_pept        complement(296480..298468)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0236"
FT                   /product="conserved membrane protein"
FT                   /note="conserved membrane protein, putative amino acid
FT                   permease, APC family (NP_825946.1| putative membrane
FT                   protein [Streptomyces avermitilis MA-4680];; ZP_00110752.1|
FT                   COG0531: Amino acid transporters [Nostoc punctiforme])."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0236"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00258"
FT                   /db_xref="GOA:A5CMH2"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMH2"
FT                   /protein_id="CAN00258.1"
FT                   /translation="MSAPKLLRAPEQRRARDGITAWLLDGLPGASGAHPGPHAETVEKT
FT                   HSWWRVMCLTGVDYFSTLGYQPAIAAVAAGLLSPLATLVLILLTLLGALPVYRRVARES
FT                   PRGEGSIAMLERLLPWWGGKLFVLVLLGFAATDFLITITLSAADATAHAVENPFAPDWF
FT                   QGNEVLLTLVLLAALAFVFLRGFKEAISIAVVLVGAFLLLNAIVIVVSLFHVAGNLQVI
FT                   DDWWLALTAQHGNPLVMVGIALIVFPKLALGLSGFETGVAVMPQARGEDDADGVPRARI
FT                   HGTKRLLTVAALIMSAFLITSSFVTTLLIPQAEFQDGGKASGRALAYLAHQFLGDGFGT
FT                   LYDISTICILWFAGASAMAGLLNIVPRYLPRYGMAPHWAAAVRPLVLVFTAIAVIVTLV
FT                   FQADVDAQAGAYATGVLVLITSASVAVTLSARKAGQRKRTIGFAVIATVFAYTTVVNVI
FT                   ERPDGVRIAALFILGILVVSIVSRVQRSFQLRATSLTMDERARAFVIEDAEDYGAVSII
FT                   AHEPDEPDEALTEEERIAEYRRKASDERRDSGLPARAPVIFLEVTPGDSSEFEEDLVVR
FT                   GIVRCGFRVLQVTSGNVPNTIAAVLLAVRDLTGVKPGVYFEWTEGSPVGNLLRFLVTGT
FT                   GEVAPVTREVLRRAEPVRSRRPDVHVS"
FT   CDS_pept        complement(298681..299049)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0237"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0237"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00259"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMH3"
FT                   /protein_id="CAN00259.1"
FT                   /translation="MDTDDDRRLFLEHLRQEDLPFADARFTISSVVLEGRADGQPAVRW
FT                   DLPRGSVTRAIAVLGRSGRGIWRHASPRTTAFRLLSIHMEEWISVPDTDPDSDEERRYV
FT                   LVDGRFDRVPPRSAPASP"
FT   CDS_pept        complement(299132..300355)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0238"
FT                   /product="putative bicyclomycin efflux MFS permease"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /note="putative efflux MFS permease (NP_827094.1| putative
FT                   bicyclomycin resistance protein [Streptomyces avermitilis
FT                   MA-4680];; NP_830072.1| Bicyclomycin resistance protein
FT                   [Bacillus cereus ATCC 14579]). pfam00083, Sugar_tr, Sugar
FT                   (and other) transporter. TIGRFAM (TIGR00710): drug
FT                   resistance transporter"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0238"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00260"
FT                   /db_xref="GOA:A5CMH4"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMH4"
FT                   /protein_id="CAN00260.1"
FT                   /translation="MSDDARHPEPDPRTSWTARRGPLLTVALIVGISPFATDLYIPGLP
FT                   AIAADLDASTASVQLTLTAFLVAFAVGQLVIGPISDGAGRRRILLAGTALFTLASIVCA
FT                   ISPDATTLILARVVQGLGGAAAAVSARAMVGDASTGALRSRLFATLAVVNSVGPVVAPL
FT                   VGGVVLTVWSWRAAFVVLAALGLALTIAAARLLPETLVRTGAGGTSPRAVLGRMAELLR
FT                   IPRFRWYLITGCAATIGFFSYIATSSFVFQEQYGFGEGLYTLVFASNASCMIASTLVFR
FT                   RLIGRFDEDRLFTIGLLTCAVGSALVLVGAIGGIGPAVVWPALALVTAGWGWVIPGSIT
FT                   LTQALGHRHPGTASALVGGLQFGLGGLATPLAGALGGTATAMGALMSGFIAVGLAAQLW
FT                   ASRARSGG"
FT   CDS_pept        300554..300775
FT                   /transl_table=11
FT                   /locus_tag="CMM_0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0239"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00261"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMH5"
FT                   /protein_id="CAN00261.1"
FT                   /translation="MPIRRTRSITARSALAVGALAGALALTPLAATAVQAAPVVQGAAA
FT                   YVFHPKGADVCVPKNDLSKYFFCHDIHH"
FT   CDS_pept        300958..301788
FT                   /transl_table=11
FT                   /locus_tag="CMM_0240"
FT                   /product="putative short-chain alcohol dehydrogenase"
FT                   /function="Short-chain alcohol dehydrogenase of unknown
FT                   specificity"
FT                   /note="putative short-chain alcohol dehydrogenase
FT                   (ZP_00226165.1| COG1028: Dehydrogenases with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenases) [Kineococcus radiotolerans SRS30216];;
FT                   ZP_00193775.1| COG1028: Dehydrogenases with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenases) [Mesorhizobium sp. BNC1]).
FT                   pfam00106,adh_short, short chain dehydrogenase. This family
FT                   contains a wide variety of dehydrogenases."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0240"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00262"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMH6"
FT                   /protein_id="CAN00262.1"
FT                   /translation="MTTWLITGCSTGLGRAFAVEALERGHDVVVTARDAANAQDLADTY
FT                   PEHALALDLDVTDPAQVSLAVDEATARFGGVDVLVNNAGYGYRAAVEEGDDEDVARLFD
FT                   TQFHGSVRMIKAVLPGMRERRSGTIVNLSSIGAARTGAGSGYYGAVKAAIEQMTMALRT
FT                   ELEPLGIVATVVAPGSFRTDFSGRSLTQSSTVIDDYAETAGKRRKENDTTDGTQPNDPA
FT                   LGAKVLVDAVEQGAPFYLLLGGDAVEIVTGALDDLRTDVDAWAERSRSTAYDAS"
FT   CDS_pept        complement(301826..302098)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0241"
FT                   /product="putative membrane protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0241"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00263"
FT                   /db_xref="GOA:A5CMH7"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMH7"
FT                   /protein_id="CAN00263.1"
FT                   /translation="MSEPTTPADPAAPPAEEEDSSSTNASLGITFAMLGLVLMLTLDDT
FT                   RVAGLPFIILGITFFVMSVRPKRARTRPAATGSDAPSQPPEADDR"
FT   CDS_pept        complement(302169..302795)
FT                   /transl_table=11
FT                   /gene="ogtA"
FT                   /locus_tag="CMM_0242"
FT                   /product="6-O-methylguanine-DNA methyltransferase"
FT                   /function="Methylated DNA-protein cysteine
FT                   methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /note="Putative methylated-DNA-protein-cysteine
FT                   methyltransferase (O-6-methylguanine-DNA-alkyltransferase)
FT                   (ZP_00228907.1| COG0350: Methylated DNA-protein cysteine
FT                   methyltransferase [Kineococcus radiotolerans SRS30216];;
FT                   NP_602199.1| methylated DNA-protein cysteine
FT                   methyltransferase [Corynebacterium glutamicum ATCC 13032]).
FT                   pfam02870, Methyltransf_1N, 6-O-methylguanine DNA
FT                   methyltransferase, ribonuclease-like domain. pfam01035,
FT                   Methyltransf_1, 6-O-methylguanine DNA methyltransferase,
FT                   DNA binding domain."
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0242"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00264"
FT                   /db_xref="GOA:A5CMH8"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMH8"
FT                   /protein_id="CAN00264.1"
FT                   /translation="MTDPDDTIPFLDAAALERADPTAPALDALRLRLADRAEADGALDV
FT                   GFTTIDSPVGPLLLAATDRGLIRVAYSREDHDTVLGDLARRLGPRILRAPKRLDQAARQ
FT                   LDEYFAGRRRAFDLPLDRRLSTGFRDRVQRLLPEIPYGSTRTYREVAETAGSPAATRAV
FT                   GTACSTNPLPVVIPCHRVLRSDGTLGGYIGGLAAKTTLLELEGRF"
FT   CDS_pept        complement(302792..303322)
FT                   /transl_table=11
FT                   /gene="sigY"
FT                   /locus_tag="CMM_0243"
FT                   /function="DNA-directed RNA polymerase specialized sigma
FT                   subunit, ECF family"
FT                   /note="DNA-directed RNA polymerase specialized sigma
FT                   subunit, ECF family (ZP_00228908.1| COG1595: DNA-directed
FT                   RNA polymerase specialized sigma subunit, sigma24 homolog
FT                   [Kineococcus radiotolerans SRS30216];; ZP_00293287.1|
FT                   COG1595: DNA-directed RNA polymerase specialized sigma
FT                   subunit, sigma24 homolog [Thermobifida fusca]).
FT                   pfam04542,Sigma70_r2, Sigma-70 region 2. Region 2 of
FT                   sigma-70 is the most conserved region of the entire
FT                   protein. All members of this class of sigma-factor contain
FT                   region 2. pfam04545,Sigma70_r4, Sigma-70, region 4. Region
FT                   4 of sigma-70 like sigma-factors are involved in binding to
FT                   the -35 promoter element via a helix-turn-helix motif."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0243"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00265"
FT                   /db_xref="GOA:A5CMH9"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMH9"
FT                   /protein_id="CAN00265.1"
FT                   /translation="MQPFDRVVTEHGAVVLRVCRAVLGGHADAEDAWSETFLSALVAYP
FT                   RLGPRADVRAWLVTIAHRKALDAIRARGRRAIPVDEVPERVSDLGVPDSGDPDLWRAVA
FT                   ALPERQRLAVAYRYLGGLPHAEVAAIVGGTPEAVRRAAADGVASLRRTMGADPPPSPRE
FT                   PSPASASTLGGRP"
FT   CDS_pept        303648..304385
FT                   /transl_table=11
FT                   /locus_tag="CMM_0244"
FT                   /product="putative two-component system response regulator"
FT                   /function="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /note="putative two-component system response regulator
FT                   (NP_825375.1| putative two-component system response
FT                   regulator [Streptomyces avermitilis MA-4680];; NP_628202.1|
FT                   putative two component system response regulator
FT                   [Streptomyces coelicolor A3(2)]). pfam00072,Response_reg,
FT                   Response regulator receiver domain. This domain receives
FT                   the signal from the sensor partner in bacterial
FT                   two-component systems. It is usually found N-terminal to a
FT                   DNA binding effector domain. InterPro: Response regulator
FT                   receiver domain"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0244"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00266"
FT                   /db_xref="GOA:A5CMI0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMI0"
FT                   /protein_id="CAN00266.1"
FT                   /translation="MGSTLSSAARDDEQAVPGDAPRVLRVFVVDEEAPITQLLSLALRM
FT                   EGWDVRVFATGRAAIDAAVEAAPDAILLDMTLPDVSGVEVVGELRRAGVASPVLFLTGR
FT                   DSLEDRLAAFGAGADDYVTKPFGLEEVVETLRVLFRRRGLAPAMVTAGDLVLDPATGEA
FT                   WLAGVPLELDPMDLVVVQALAEEPTRRLSRRELVHRLTDAGWDLVAPRALLDLPSVTGR
FT                   RAGRDQVALLAVAGDDLVLAPAV"
FT   CDS_pept        304664..305953
FT                   /transl_table=11
FT                   /locus_tag="CMM_0245"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein, , only weak N-terminal
FT                   similarities to RTX toxins."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0245"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00267"
FT                   /db_xref="GOA:A5CMI1"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMI1"
FT                   /protein_id="CAN00267.1"
FT                   /translation="MTRPTPAAGRGRSFRRAAAGACLSASLVILPLAMAPAAHAETAPV
FT                   GSAPVAVETPAVEASAVETPAATPTPAVETPAADATPTPAPTETADETAPVADAPVETT
FT                   PTPAVPTVPGAPTTGLPTLEPTVPVVELPFTWTTPDRGVALPINEAVPFAGTGTAGSIV
FT                   TASYFNAVGVKSIAGIGIVGEDGTYAFPASFTELLQDSKTASVTLTQVGLDLTVKGEIR
FT                   GLVRFAEAPVGPFVRAEASFSTISPTTVAEATSLLGGLKVTATGYLRYEAVQVTVTAPD
FT                   GRVIQLSDANSGVGVSTRSLKDLVRADVDGTFAQPIILFGDIQPGTYQVSVLGLESGLA
FT                   QGGTVELTAADAGGPVIPGVPTPTPTTPSIDPAGTAPTPITKPAAQHGDTLPVTGTDGA
FT                   AALGLGGLGTLLALVGAGALVARRRLRSAE"
FT   CDS_pept        306397..310155
FT                   /transl_table=11
FT                   /locus_tag="CMM_0246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0246"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00268"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMI2"
FT                   /protein_id="CAN00268.1"
FT                   /translation="MGRVKLKKPRKNRHVPLAAAMRAFDNTALWTLVIAGGASPLLRER
FT                   WPTMGQLAYLASTATSTGSKPTSPSLLSSLMDSVTIEYPSVVRSEDFTPKDPRDEVRAR
FT                   VGDLTYRLFSGLIERPVADIDRALLVADSVDSEVIKHHGFGIRTIVEICLSYTDWAVSR
FT                   LAPTWPSRETDEEPFELTIEELDAARALVDFGTPPHLVNTKAKQRALEWMTCSALDIPY
FT                   DAHHAKSAFGRFVRVIPVGSTEPQWMPLAFIPESMAFAIADLLESTPLSPEMHFQFAQN
FT                   SAAMVRNCLWSFTDAVIGSPEMTSGPAVSPSNVVQWAIPVREDLILLIQITSSLNADLM
FT                   PFPDEPVVLTIARSLPRNEPTEVPFAGGGITLPPGTRAIPIVVFSTPDHIMALQAEGLL
FT                   SMSLDDLRWIAATAEGKLDLLNFSQDMSDPDRPRTMGFETIDYWEMWKANGKTLFSGGR
FT                   KPSFVVIAPHWGDAEWDRAAALCELENALAVLQFHGLRDFVGVRASDREPYMVYSRSGG
FT                   PARELDPPKRFSGVHVRPDALGASITIGICPVGVIAGDGNLYSEQDGQILHDMSGSLTH
FT                   GVLRIGRAWLEAHDGTSVRGHRITLTPKHSSSSSSSSSPARAALHASSVEVNGAGIAVS
FT                   NIDVDIDVFLENADGNSGWIRSQFSSVLYEILCRVGATEPGAAAVRNIWDSASPTMTLN
FT                   LLTTATQLNNLEQPQGLDPAFVSSVDRIIAEKVYQRGVTVDLYEGPAALALERDILAPI
FT                   ALNHLKEQLGAYESDAVIRYGMRQLQRSLENSTRHIRNVRTSARELDLDWDPIARVSEV
FT                   SGESFELRRCNEILVEACMLAAPSGTKSIDASGWATLLAAASAYFNATMRSESLYYQVT
FT                   PTSILIDGTYQISTQVARSDSTSPGGRASYRIDDQFALSLAGEGFVLSDAAAAPSSLDS
FT                   SGVDDEIKRAFGASASEIYLVLYALAGWHCTPGEGEVASASPRSVTAWVLENTELQDQP
FT                   DGPSVVEAAIALLTSTSAELQKDSWKPWHARTRKRRLLIQPLPLMSTGELLIAPHYLLA
FT                   ALSAYKNYIDQGMLPWSQPAPPGRLDRALESFRNAKNRALEVDVIDALVKDDWRVLGNV
FT                   KESKAQRLNVPNLSTEIDAVAGKAGNRIIYVLEAKDPVSAHATPQLRGQLDDFYADGGK
FT                   KPSYAAQLDRKLADVAPFADNVAEALGLPPSGENWNYEVHALFVTRHPIVAAFVGERFE
FT                   FTTIGGMLERLNATNVDSGSDDHSRGD"
FT   CDS_pept        310377..311591
FT                   /transl_table=11
FT                   /locus_tag="CMM_0247"
FT                   /product="putative oxidoreductase/dehydrogenase"
FT                   /function="Predicted dehydrogenases and related proteins"
FT                   /note="putative oxidoreductase/dehydrogenase (NP_823001.1|
FT                   putative oxidoreductase [Streptomyces avermitilis
FT                   MA-4680];; ZP_00226131.1| COG0673: Predicted dehydrogenases
FT                   and related proteins [Kineococcus radiotolerans SRS30216]).
FT                   pfam01408, GFO_IDH_MocA, Oxidoreductase family, NAD-binding
FT                   Rossmann fold. pfam02894,GFO_IDH_MocA_C, Oxidoreductase
FT                   family, C-terminal alpha/beta domain. InterPro:
FT                   Oxidoreductase C-terminal redox_disulf_1: redox-active
FT                   disulfide"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0247"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00269"
FT                   /db_xref="GOA:A5CMI3"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMI3"
FT                   /protein_id="CAN00269.1"
FT                   /translation="MSDTQPAATPTETGGALGVAMVGHGFMGAAHSQAWRVAPAFFDLP
FT                   LAPRMVSVVGRDRARTQESADRWGWDRAETDWRAAIERDDIDVVDICSPGSTHVEIAVA
FT                   ALEAGKHVLCEKPLANTVEEAEIMAAAAEKAAAKGIRAMVGFSYRRVPAITFARDLVAQ
FT                   GAIGELRQVRALYLQDWLTDAEGPMTWRLDKEAAGSGALGDIGAHIVDAVQFITGERLD
FT                   AVSGLLRTFVEERPLLAETRGLGGVASSERGQVTVDDAAYFTGKLAGGALASFEATRMA
FT                   TGRKNALRLEFSGSDGAISFDLERLNEIELYDATASADRLGFRRILVTEPEHPYTAAWW
FT                   PTGHGLGYEHAFTHQVRDLVHDIAAGRGPQPSFADGLRVQRVLDAVERSSADGSAWKTV
FT                   DPTAS"
FT   CDS_pept        311642..312358
FT                   /transl_table=11
FT                   /locus_tag="CMM_0248"
FT                   /product="conserved membrane protein"
FT                   /note="conserved membrane protein (NP_625282.1| putative
FT                   integral membrane protein [Streptomyces coelicolor A3(2)];;
FT                   NP_823511.1| putative membrane protein [Streptomyces
FT                   avermitilis MA-4680])."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0248"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00270"
FT                   /db_xref="GOA:A5CMI4"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMI4"
FT                   /protein_id="CAN00270.1"
FT                   /translation="MQARQERTLRAALSAFVCTLVTATLHAAAGGGIPHPLVLALALVL
FT                   GVALCFGLGGRRVTLAHLVLAIGATQGVLHAAFTFGGSAIGSGPGPGSGMDMGGAASGA
FT                   ASASVGHSHAHAAADAARALAGPSAMAGMPADHDGAMLLAHVIAGLVSVCSLRAGADAI
FT                   RRVVRALALRVGAAVGGAVGMLVGAAVALAAALAEPAAAPRPRRLATDLRPVRLESLLA
FT                   ARIRGRRGPPLAALAA"
FT   CDS_pept        312537..313244
FT                   /transl_table=11
FT                   /locus_tag="CMM_0249"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /note="conserved hypothetical protein (NP_823510.1|
FT                   hypothetical protein SAV2334 [Streptomyces avermitilis
FT                   MA-4680];; ZP_00171355.2| COG4549: Uncharacterized protein
FT                   conserved in bacteria [Ralstonia eutropha JMP134]).
FT                   Mtu_fam_11: Mycobacterium tuberculosis p"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0249"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00271"
FT                   /db_xref="GOA:A5CMI5"
FT                   /db_xref="InterPro:IPR012533"
FT                   /db_xref="InterPro:IPR038507"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMI5"
FT                   /protein_id="CAN00271.1"
FT                   /translation="MPSRTTRTPSASRRVIAGAAVGLALALSAPLAASAHVELDASSTA
FT                   PATLSVLTFAVGHGCEGSATTSLAIRFPTDVQAVKPTLAPGWSVAEQEAADATTVTYTA
FT                   DTPLPDALRATVQVEALLPVDGAAGDVVTFPTLQTCVAGSTDWAETPAAGTEPDHPAPA
FT                   ITLTDAASAGGTGMAGMGSTSATGTAAAAGSTAVTPVDPVARLLGLGALVVGVVAVMLL
FT                   TIGMRRPQQGGRR"
FT   CDS_pept        313241..314725
FT                   /transl_table=11
FT                   /locus_tag="CMM_0250"
FT                   /product="conserved membrane protein"
FT                   /function="Uncharacterized iron-regulated membrane protein"
FT                   /note="conserved membrane protein (ZP_00126878.2| COG3182:
FT                   Uncharacterized iron-regulated membrane protein
FT                   [Pseudomonas syringae pv. syringae B728a];; ZP_00293139.1|
FT                   COG3182: Uncharacterized iron-regulated membrane protein
FT                   [Thermobifida fusca];; YP_049875.1| putative iron-regulated
FT                   membrane protein [Erwinia carotovora subsp. atroseptica
FT                   SCRI1043]). pfam03929, DUF337, Uncharacterized
FT                   iron-regulated membrane protein (DUF337). bcl-2: Apoptosis
FT                   regulator"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0250"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00272"
FT                   /db_xref="GOA:A5CMI6"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMI6"
FT                   /protein_id="CAN00272.1"
FT                   /translation="MTAVDDRAAAAGPAGSADAPISTDASAATPAVTRPQRGWFIPLLL
FT                   RLHFLAGILVGPFILTAALSGAAYALAPTAEQIVYADELHAPATGSTVPLAQQVEAAEA
FT                   VVGGSGTLVAVRPAPAPGDTTRVMFTGDGLIPSQTRAIFVDPADASIRGDLPVYGTSGA
FT                   LPLRTAISDFHRRLGLGDAGRLYSELAASWLGIVTLAGLGLWVARWRRSPRKRDLVRPD
FT                   AKATGYRRILSWHASTGVWLVAGALFLSATGITWSQFGGQNVTDLRAALSWQAPTLTTA
FT                   LPGAGAGAASAADPHVGHHASAAPTTTPAVDPATFDDVLRVARGVNVNTGLVEITPPKD
FT                   ASTAWTVSEIQRSFPTEVDQVAVDGSTLQVVGRTDFADYPLPAKLARWGIDTHQGSMFG
FT                   LPNQLLLAVTALGIATMVVFGYLMWWKRRPGVARPGRPAPAGALVRAPWWGIAAVVAVG
FT                   VGVGLFLPLVGIPLVGFVLLDALITAARVHRAGAPA"
FT   CDS_pept        complement(314775..315788)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0251"
FT                   /product="putative transcriptional regulator, LacI-family"
FT                   /function="Transcriptional regulators"
FT                   /note="putative LacI-family transcriptional regulator
FT                   (ZP_00049013.1| COG1609: Transcriptional regulators
FT                   [Magnetospirillum magnetotacticum];; NP_823745.1| putative
FT                   LacI-family transcriptional regulator Streptomyces
FT                   avermitilis MA-4680]). pfam00532, Peripla_BP_1,Periplasmic
FT                   binding proteins and sugar binding domain of the LacI
FT                   family. This family includes the periplasmic binding
FT                   proteins, and the LacI family transcriptional regulators.
FT                   The LacI family of proteins consist of transcriptional
FT                   regulators related to the lac repressor."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0251"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00273"
FT                   /db_xref="GOA:A5CMI7"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMI7"
FT                   /protein_id="CAN00273.1"
FT                   /translation="MREVAARAGVSIATVSFVVNGTKAVSEPTRRAVTEAMQELGYRNN
FT                   VVARALASKRTRIVALLFPADVQRLSRIALEIFMSAATRASELGYHLVLWPTGTSPDDV
FT                   SDLVSGRLVDGVIVMEVRMDDSRIRELAALEVPFVSIGRTADTHDLPFVDMDFERTVAD
FT                   GIDHLQALGHRRFGLMVEDLERGPLRGYGPTTRTERAFLQETAARGLGGAVARCAPTPV
FT                   GGRAAAGELLAADPGITAVMLLNDQAARGLISGLDAAGRRVPEDVSILSLASSTEVGAL
FT                   VEPALSTMDAPGPELGRLAVEMLLARLDGTATELPHALLPCLLHVAASTGPAPAAR"
FT   CDS_pept        complement(315851..316573)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0252"
FT                   /product="conserved membrane protein"
FT                   /note="conserved membrane protein (ZP_00239707.1| integral
FT                   membrane protein [Bacillus cereus G9241];; NP_825757.1|
FT                   putative membrane protein [Streptomyces avermitilis
FT                   MA-4680])."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0252"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00274"
FT                   /db_xref="GOA:A5CMI8"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMI8"
FT                   /protein_id="CAN00274.1"
FT                   /translation="MGTSSVRILFSVVRIATAIAAVIGVIAQYHVNYAYWQDLGITGIA
FT                   GKSLDFALFFTVDANLLGAVVLIVGGVRLARGRVADPGAGWVTLRLASTVYLVITGIVW
FT                   NALLRGQPQPEPLKLDWADQIVHVAVPLIVLLDWILAPDRRPLRAGAIGRVIAFPLAWI
FT                   LVTLARGPFTGDEVFRTATYYPYGFLNPDSSPGGYGMVAAYVVGLTLAVCAITGALILV
FT                   SRFRAPTDPRRRATPAIR"
FT   CDS_pept        complement(316624..317823)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0253"
FT                   /function="putative glycosyltransferase"
FT                   /note="putative glycosyl transferase (ZP_00329344.1|
FT                   COG0438: Glycosyltransferase [Moorella thermoacetica ATCC
FT                   39073];; NP_294949.1| mannosyltransferase, putative
FT                   [Deinococcus radiodurans R1]). pfam00534,
FT                   Glycos_transf_1,Glycosyl transferases group 1. Members of
FT                   this family transfer activated sugars to a variety of
FT                   substrates,including glycogen, Fructose-6-phosphate and
FT                   lipopolysaccharides. Members of this family transfer
FT                   UDP,ADP, GDP or CMP linked sugars."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0253"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00275"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMI9"
FT                   /protein_id="CAN00275.1"
FT                   /translation="MNTLRPLLVMDYAFSYLGGAQTAVVQQALALARAGHAVTVAAPDA
FT                   TSVRELHGTGVALYDVAPTLPVPLLGLPVIRADAATRRDLGALMDRSGTDLVLTHSEHG
FT                   LAATALRLGRERGIPTLHTVHTFFLRGPAWGGFLAPAVTAVHRAMTGLPDPRVQLAPRR
FT                   LDSALRGMTLAVCREADLVLSPSAHQAVALRRAGRPAVEVLSNTSCTARGASAELPASG
FT                   ALRLVWAARFAPEKRLDVMLEAMGLVAELSGPDAVHLDLAGGRPRGAVPPGVTVHGRVS
FT                   TATVTALLRGAHAAVITSLGFDNQPMIAMEAFAEGRPALVSDPVLATEFGGATLLADDT
FT                   DAEGLAASILRLAADRRLLDGPAREARHLAAEVAPAAHARGVEEACRRVAGARRGSAPA
FT                   "
FT   CDS_pept        complement(317976..318227)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0254"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein (NP_821697.1| hypothetical
FT                   protein SAV522 [Streptomyces avermitilis MA-4680];;
FT                   NP_436996.1| HYPOTHETICAL PROTEIN SMb20474 [Sinorhizobium
FT                   meliloti 1021])."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0254"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00276"
FT                   /db_xref="InterPro:IPR025629"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMJ0"
FT                   /protein_id="CAN00276.1"
FT                   /translation="MSPHGIVAPPPPPDRQKAKGPASYFPSIETTYGQPVQHWIDLADA
FT                   RLDAEPHMQVVAWLKAEHGLGHGHANAVVAFVKAARSA"
FT   CDS_pept        318363..319832
FT                   /transl_table=11
FT                   /locus_tag="CMM_0255"
FT                   /product="putative MFS permease"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /note="putative efflux MFS permease (ZP_00190381.2|
FT                   COG0477: Permeases of the major facilitator superfamily
FT                   [Kineococcus radiotolerans SRS30216];; NP_628802.1|
FT                   putative transmembrane efflux protein [Streptomyces
FT                   coelicolor A3(2)]). pfam00083, Sugar_tr, Sugar (and other)
FT                   transporter. efflux_EmrB: drug resistance transport"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0255"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00277"
FT                   /db_xref="GOA:A5CMJ1"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMJ1"
FT                   /protein_id="CAN00277.1"
FT                   /translation="MSRDLAERPPRGVVLAVTAASLPMFMAALDSLVMTFALPIIKQDL
FT                   DATVEQLQWFVNSYSVVFTAFMLPVAALGDRIGRRRVFLAGVALFTLASMGAALSTSSD
FT                   MLIAMRALQGLGAAGIVPLSLALVSASTTPKVRPIAIGVWGGVNGLGIAAGPIIGGAVV
FT                   EGFTWPGIFWLNVPIGVVTIALVALALRESKGTGLGFDGAGSVLGIVFTLPLIWAVVEG
FT                   EERGWSAPEIIGAFAVSAAGLAAFIWHEHRSPRAFLPLRFFRERAFALANVGGLLFSAG
FT                   VFGAIFLLSQFLQVSMGYGALEAGLRAAPWTLAPMVVAPLSGFIVQRFGVKPVLITGLA
FT                   LQAGAILVIASVVEAQTEYGTVVVPMVVAGIGMGLTLAPLANAVLTGRRDSEHGIASSV
FT                   NSTLRQLGMAVGIALATAIFVGNGDYLPGQPFVDGMRPALITCGIITGVGAIAMSALPR
FT                   TARSAAAPTPSSTGGDAVADPARPARAGATV"
FT   CDS_pept        complement(320052..320687)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0256"
FT                   /product="conserved hypothetical protein"
FT                   /function="Predicted NAD/FAD-binding protein"
FT                   /note="conserved hypothetical protein (ZP_00280805.1|
FT                   COG2907: Predicted NAD/FAD-binding protein [Burkholderia
FT                   fungorum LB400];; ZP_00150213.1| COG2907: Predicted
FT                   NAD/FAD-binding protein [Dechloromonas aromatica RCB])."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0256"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00278"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMJ2"
FT                   /protein_id="CAN00278.1"
FT                   /translation="MRPAGFAQAVERSRRGVRPVNVLERAIRAGPHLLYTPRICCGALE
FT                   DHVAAGRVARALVTRDAVVATAVRGGHVGYALTVTTAAGDAEGADGPVPYVAWYLNKLQ
FT                   GFESATDYVVTLDYAGEIAPEHVIADHRVQHPIIDLPLRQLQREIHRLTTSDRVALAGS
FT                   YFHSSDLGWDVIGSHEAGFTSGTRAARTLLAARAAAAPAAAPSDAVPA"
FT   CDS_pept        complement(320698..321345)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0257"
FT                   /product="putative transcriptional regulator, MerR family"
FT                   /function="Predicted transcriptional regulators"
FT                   /note="putative transcriptional regulator, MerR family
FT                   (NP_629684.1| putative transcriptional regulator
FT                   [Streptomyces coelicolor A3(2)];; NP_828502.1| putative
FT                   transcriptional regulator [Streptomyces avermitilis
FT                   MA-4680]). smart00422, HTH_MERR, helix_turn_helix, mercury
FT                   resistance."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0257"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00279"
FT                   /db_xref="GOA:A5CMJ3"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMJ3"
FT                   /protein_id="CAN00279.1"
FT                   /translation="MTALPISELAERSGCSVATIKYYLREGLLHPGVKVNARRTAFDET
FT                   HLARLRLVRGLIHVVGVTIEQAGTILDLVADPHQSVVGAMRKATAALPTGDRSSSAAGE
FT                   AAPARSTAATEALLDRLGVQHTADSVPVAQLDRALELAEEAGIPLDESQIRTYVDAVRD
FT                   IADADFSRVPWSDPQGAVEFAVLGTALYEPVLLALRRVAHHEKGLTMERGEA"
FT   CDS_pept        complement(321541..322134)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0258"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /note="conserved hypothetical protein (NP_901178.1|
FT                   probable transmembrane protein [Chromobacterium violaceum
FT                   ATCC 12472]; NP_623732.1| conserved hypothetical protein
FT                   [Thermoanaerobacter tengcongensis])."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0258"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00280"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMJ4"
FT                   /protein_id="CAN00280.1"
FT                   /translation="MRTRPLLVAAGASAAVAFVASEVAHRLASTRGLDPRRPGTEVGRE
FT                   AIVVLGYGNRGPRANAINRYRVRAGLRSMDPRATSSTLILCGGSVMGTEPEARILARYA
FT                   RDELGYRGPLVLEDTSTSTRENIANAIPFLEDADTIRIVSDSVHAAKARPYLRELRPDL
FT                   AERLARAEEYRVGEVPWMKPTVLVVLLLKRWGWA"
FT   CDS_pept        322313..322837
FT                   /transl_table=11
FT                   /gene="crcB1"
FT                   /locus_tag="CMM_0259"
FT                   /product="putative membrane protein involved in chromosome
FT                   condensation"
FT                   /function="Integral membrane protein possibly involved in
FT                   chromosome condensation"
FT                   /note="putative membrane protein involved in chromosome
FT                   condensation (AAK73171.1| putative CrcB-like protein
FT                   [Brevibacterium sp. HCU];; AAL42476.1| conserved
FT                   hypothetical protein [Agrobacterium tumefaciens str. C58
FT                   (U. Washington)]) pfam02537, CRCB, CrcB-like protein. CRCB
FT                   is a putative integral membrane protein possibly involved
FT                   in chromosome condensation. crcB: crcB protein"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0259"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00281"
FT                   /db_xref="GOA:A5CMJ5"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMJ5"
FT                   /protein_id="CAN00281.1"
FT                   /translation="MTDHPQHLDGVPLDSVPLDSDVEVDDDPGRPVHLRWSSLGLVALG
FT                   GAVGTGIREALALTWPAPAGAIPVTILLINVVGAFVLGALLESLARRGPDEGRRRAIRL
FT                   LVGTGVLGGFTTYSSLATDAASLTGSALGVAFAYAGLSLVVGAAASVAGIAAGAAIHRR
FT                   TAAGRATGAAS"
FT   CDS_pept        322834..323214
FT                   /transl_table=11
FT                   /gene="crcB2"
FT                   /locus_tag="CMM_0260"
FT                   /product="putative membrane protein involved in chromosome
FT                   condensation"
FT                   /function="Integral membrane protein possibly involved in
FT                   chromosome condensation"
FT                   /note="putative membrane protein involved in chromosome
FT                   condensation (Q9FC37|CRB2_STRCO Protein crcB homolog 2;;
FT                   ZP_00043418.1| COG0239: Integral membrane protein possibly
FT                   involved in chromosome condensation [Magnetococcus sp.
FT                   MC-1]). pfam02537, CRCB, CrcB-like protein. CRCB is a
FT                   putative integral membrane protein possibly involved in
FT                   chromosome condensation. crcB: crcB protein"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0260"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00282"
FT                   /db_xref="GOA:A5CMJ6"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMJ6"
FT                   /protein_id="CAN00282.1"
FT                   /translation="MTGPLVLALICVAGGIGSALRLLLDGAIRGRLGAAYPWGTTVINV
FT                   TGSLGLGLLTGAAAQAGLPHELLLILGGGLMGGYTTFSTASLETVRLAQAGRVGAALAN
FT                   GVGMLVVCVAAAGLGIAVGGAL"
FT   CDS_pept        323211..323687
FT                   /transl_table=11
FT                   /locus_tag="CMM_0261"
FT                   /product="putative acetyltransferase"
FT                   /function="Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /EC_number="2.3.1.-"
FT                   /note="putative acetyltransferase (NP_294404.1|
FT                   hypothetical protein [Deinococcus radiodurans];;
FT                   ZP_00186452.1| COG1246: N-acetylglutamate synthase and
FT                   related acetyltransferases [Rubrobacter xylanophilus DSM
FT                   9941]). pfam00583, Acetyltransf_1, Acetyltransferase (GNAT)
FT                   family. This family contains proteins with
FT                   N-acetyltransferase functions."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0261"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00283"
FT                   /db_xref="GOA:A5CMJ7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMJ7"
FT                   /protein_id="CAN00283.1"
FT                   /translation="MTALAPVGPADVEALHAFLAAADLTVTGLDDPGVRLWIQRDGDGR
FT                   ITGSTGFELSADGRHALIRSVAVDPALRSAGLGSTLARHALAEAAAAGAGRAWLFSRRS
FT                   GPFWRGLGFQEADRDALAAALPDARQVVAFRATGQLAREVAWSRSLGAAEDDAP"
FT   CDS_pept        323697..324284
FT                   /transl_table=11
FT                   /locus_tag="CMM_0262"
FT                   /product="putative NTP pyrophosphohydrolases"
FT                   /function="NTP pyrophosphohydrolases including oxidative
FT                   damage repair enzymes"
FT                   /note="putative NTP pyrophosphohydrolases (ZP_00188287.1|
FT                   COG0494: NTP pyrophosphohydrolases including oxidative
FT                   damage repair enzymes [Rubrobacter xylanophilus DSM 9941];;
FT                   ZP_00330170.1| COG0494: NTP pyrophosphohydrolases including
FT                   oxidative damage repair enzymes [Moorella thermoacetica
FT                   ATCC 39073]). pfam00293, NUDIX, NUDIX domain."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0262"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00284"
FT                   /db_xref="GOA:A5CMJ8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMJ8"
FT                   /protein_id="CAN00284.1"
FT                   /translation="MSSAEPHPDPELVWATTDRRDLHRGRVVLVEHDVLLPDGSASRYE
FT                   VDESVPFAVATLVIDGDAVILSRQYRHPLGRWILDLPGGAGDAAERPVDAARRELEEEL
FT                   GLVAPEIRPLRTYAVNPGRASWLVHVFACTTPTTAGTADRSDPSEQVRLVRMPVVELDA
FT                   LIAAGGIEDPTLLIARAAAAEQGLLPPVAPAR"
FT   CDS_pept        complement(324294..325301)
FT                   /transl_table=11
FT                   /gene="ddlA"
FT                   /locus_tag="CMM_0263"
FT                   /product="putative D-alanine--D-alanine ligase"
FT                   /function="D-alanine-D-alanine ligase and related ATP-grasp
FT                   enzymes"
FT                   /EC_number="6.3.2.4"
FT                   /note="putative D-alanine-D-alanine ligase (ZP_00137683.2|
FT                   COG1181: D-alanine-D-alanine ligase and related ATP-grasp
FT                   enzymes [Pseudomonas aeruginosa UCBPP-PA14];;
FT                   ZP_00212274.1| COG1181: D-alanine-D-alanine ligase and
FT                   related ATP-grasp enzymes [Burkholderia cepacia R18194]).
FT                   Cell wall formation (By similarity).
FT                   pfam01820,Dala_Dala_ligas, D-ala D-ala ligase. InterPro:
FT                   D-alanine--D-alanine ligase."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0263"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00285"
FT                   /db_xref="GOA:A5CMJ9"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMJ9"
FT                   /protein_id="CAN00285.1"
FT                   /translation="MRISVLFGGESEERDVSIASAAQVVPALRALGHEVVAVDTARGAL
FT                   DAAAEARILTPDVGVRPPTSAELATAAAGGSAAVLRLPADLRDGDLVFLALHGGSGEDG
FT                   RLQALLELAGIPFTGSGSLGSALAMDKDVAKTLLRAGGVRTPDWIIDPEPDAVEPALGF
FT                   PVVVKPTGQGSTVGLSVVRAAEELPAALELARRHGTVMVERFVRGRELTVGVLDGEALA
FT                   VGEIGVPVDEAFTYAAKYQAGAIAETFPADLPSEVAEEARAAALAAHRILRLAGYSRSD
FT                   FRLDDAGALWIIEANSLPGLTATSLLPQSAAAVGIGYPELCDRIARIALRGRAG"
FT   CDS_pept        complement(325348..326058)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0264"
FT                   /product="conserved hypothetical protein"
FT                   /function="Predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily)"
FT                   /note="conserved hypothetical protein (NP_630443.1|
FT                   hypothetical protein SC3A7.19 [Streptomyces coelicolor
FT                   A3(2)];; ZP_00034039.1| COG0596: Predicted hydrolases or
FT                   acyltransferases (alpha/beta hydrolase superfamily)
FT                   [Burkholderia fungorum]). pfam00561,
FT                   Abhydrolase_1,alpha/beta hydrolase fold. This catalytic
FT                   domain is found in a very wide range of enzymes."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0264"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00286"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMK0"
FT                   /protein_id="CAN00286.1"
FT                   /translation="MELVFVHGALVRDGAWWWGATAELLRERTGIRSRALALPSCGETT
FT                   AGEMAGGLVADAAALRRALDGIDDGQAIVVGHSYGGTVIAEAGPHAAVAHLVLISSYLP
FT                   DVGQAQAQILGGEADPVTLEDAGDGALRVAGLDAASFGARFLQDADPATQQEAWARVTR
FT                   QAAGAFVTPTTAAGWRGVDSTYLVCADDRSTSVELQRAHAARATRAVELPTGHHPFLTR
FT                   PDLVVDAIAALLRG"
FT   CDS_pept        complement(326061..326615)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0265"
FT                   /product="conserved hypothetical protein"
FT                   /function="Dihydrofolate reductase"
FT                   /note="conserved hypothetical protein (NP_631701.1|
FT                   putative secreted protein [Streptomyces coelicolor A3(2)];;
FT                   ZP_00049640.1| COG0262: Dihydrofolate reductase
FT                   [Magnetospirillum magnetotacticum]). pfam01872, RibD_C,RibD
FT                   C-terminal domain. The function of this domain is not
FT                   known, but it is thought to be involved in riboflavin
FT                   biosynthesis."
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0265"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00287"
FT                   /db_xref="GOA:A5CMK1"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMK1"
FT                   /protein_id="CAN00287.1"
FT                   /translation="MRRITAGLFASVDGVVEAPDLFQFDSFDAELGAGMARLMETVTTA
FT                   VLGRHGYEEWSSYWPQAPADDAFGAFINPIEKLVASTTLTGELDWHATLIEGDVVDALA
FT                   DLKRTDGGDIGVFASISLARELLFAGVLDELTLMIHPVVAGAGRRLFEPSDPVTRLELR
FT                   RSEITSAGNALLTYALRDGGS"
FT   CDS_pept        326881..328224
FT                   /transl_table=11
FT                   /locus_tag="CMM_0266"
FT                   /product="conserved membrane protein"
FT                   /note="conserved membrane protein (NP_791711.1| membrane
FT                   protein, putative [Pseudomonas syringae pv. tomato str.
FT                   DC3000];; NP_901555.1| hypothetical protein CV1885
FT                   [Chromobacterium violaceum ATCC 12472])."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0266"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00288"
FT                   /db_xref="GOA:A5CMK2"
FT                   /db_xref="InterPro:IPR021450"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMK2"
FT                   /protein_id="CAN00288.1"
FT                   /translation="MTTTVGERTRSVVGLRGVAPVAVAALVIALVAQVIGSRTLPLGSA
FT                   SIVFFPMVWGLLIAAALSFQRIRPVGLGFQRIANAFVGVAVLFLVARLAFNIGPNIPTL
FT                   LQAGPALLLQEIGHLLGTVALALPLAVLLRMGKATIGATFSLDREPAFAMVSEKYGSDS
FT                   DQYRGVLAMYVFGTLFGAVYITLLTSLVASADVFDPLALAMGAGVGSGSMMAASTASII
FT                   AAYPGQQDAILGIAAVSNLITTVLGVYVGIYVALPLADRFYRFLTRKQAAAEAASGPAP
FT                   VSAATEEANRAFRERVAEAAAPVDIRPWITIPILAVVGIGTASIFAGGVSWSIVGGYAI
FT                   LIALLLVSQLLAKVTRKVSAIVFVTTIGALASSPYSPIGAELTAVVTSIDFLSIACATL
FT                   TFAGLSLGKDAALLKTVGWRIVPVGLVAITASFLLSAVIAEFALGFWA"
FT   CDS_pept        328221..329078
FT                   /transl_table=11
FT                   /locus_tag="CMM_0267"
FT                   /product="Putative transcriptional regulator, RpiR family"
FT                   /function="Transcriptional regulators"
FT                   /note="putative transcriptional regulator, RpiR family
FT                   (NP_781945.1| transcriptional regulator, rpiR family
FT                   [Clostridium tetani E88];; NP_519498.1| CONSERVED
FT                   HYPOTHETICAL PROTEIN [Ralstonia solanacearum]).
FT                   pfam01418,HTH_6, Helix-turn-helix domain, rpiR family. This
FT                   domain contains a helix-turn-helix motif. The best
FT                   characterised member of this family is RpiR, a regulator of
FT                   the expression of rpiB gene. pfam01380, SIS, SIS domain.
FT                   SIS (Sugar ISomerase) domains are found in many
FT                   phosphosugar isomerases and phosphosugar binding proteins."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0267"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00289"
FT                   /db_xref="GOA:A5CMK3"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMK3"
FT                   /protein_id="CAN00289.1"
FT                   /translation="MSAADPLADWLDELEPTKGHTPSHARIARVLLENQQLASYSEIAE
FT                   IAQRAEVNASTVVRFAQALGFRGWPELQQELRMRYLATLTSEETLREHPAAASGAVHAS
FT                   IQRDVANLGRALESIDPAEGDAAIVALASAGRILVVGMGSFGAPASILAHLGSVMGYPI
FT                   SFEGRGGAHLAAAMTALGADDVLVVVSLWRPMRDVLAAATAAHAAGTTVVAITDMRRGR
FT                   LAASADHVLVVPSEGVSFLQSTAATTSVVYGLLSGMESAHPERSRAALRRTQELWQQLG
FT                   TFTG"
FT   CDS_pept        329139..330083
FT                   /transl_table=11
FT                   /locus_tag="CMM_0268"
FT                   /product="putative hydroxyacid dehydrogenase"
FT                   /function="3-hydroxyisobutyrate dehydrogenase and related
FT                   beta-hydroxyacid dehydrogenases"
FT                   /EC_number="1.1.1.-"
FT                   /note="putative hydroxyacid dehydrogenase (ZP_00127342.1|
FT                   COG2084: 3-hydroxyisobutyrate dehydrogenase and related
FT                   beta-hydroxyacid dehydrogenases [Pseudomonas syringae pv.
FT                   syringae B728a];; YP_044837.1| putative
FT                   3-hydroxyisobutyrate dehydrogenase [Acinetobacter sp.
FT                   ADP1]). pfam03446, NAD_binding_2, NAD binding domain of
FT                   6-phosphogluconate dehydrogenase."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0268"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00290"
FT                   /db_xref="GOA:A5CMK4"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMK4"
FT                   /protein_id="CAN00290.1"
FT                   /translation="MSPTDPLDPTTPRRIGVVGLGSMGGAMAASLAGRGWDVVGCDPSA
FT                   AAREAAEARGLATVAGVSALAGIPYVVLSLPSARVVEATVPALLAVPGTVAVVDTTTSE
FT                   PGTSAAMAALAAAHGAAFVDAPVSGGNTGAAAGTLASFVGGSAPAVDAARPVLEALTSG
FT                   GWRHVGPAGSGNVVKLLNNMLVSVNLLAVAEAMDVAAAHGIDLDTAVAALNTATGASTV
FT                   SQRMFPDQILNGRFGSGFALGLMARDVALAHDVARATGATPGLFAETDARWQQALAALG
FT                   PRADFVAATSTFTTATTALDPAQLPARKDDTAR"
FT   CDS_pept        330080..331660
FT                   /transl_table=11
FT                   /locus_tag="CMM_0269"
FT                   /product="putative aldehyde dehydrogenase"
FT                   /function="NAD-dependent aldehyde dehydrogenases"
FT                   /EC_number="1.2.1.-"
FT                   /note="putative aldehyde dehydrogenase (ZP_00166104.1|
FT                   COG1012: NAD-dependent aldehyde dehydrogenases [Ralstonia
FT                   eutropha JMP134];; NP_791704.1| aldehyde dehydrogenase
FT                   family protein [Pseudomonas syringae pv. tomato str.
FT                   DC3000]). pfam00171, Aldedh, Aldehyde dehydrogenase family.
FT                   This family of dehydrogenases act on aldehyde substrates.
FT                   Members use NADP as a cofactor. InterPro: Aldehyde
FT                   dehydrogenase family."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0269"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00291"
FT                   /db_xref="GOA:A5CMK6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMK6"
FT                   /protein_id="CAN00291.1"
FT                   /translation="MTAPDPTSRTPLLDAVDPTAHPARRARDLIAHAFSDGIGTWADGR
FT                   VHPGSGPAIDLVDAATGELVTSYADPGAEGAETALAAATRGARTWGAMDPYDRAAILRD
FT                   VARAIGEHQEELAVLETVTTGKPIRDARVEAGRVAQMFGYYAGWADKVTGQTIPVPGDW
FT                   LTYTTRVPWGVVVAVTPWNSPLFTAGWNSSAPLAAGNAVILKPSEYTPLSTIRLAQLAE
FT                   EAGLPAGVLSVAVGAGTTVGAALSTDRRVGKLSFIGSVPVGRTVAQAAAGAGIPVVLEL
FT                   VGKSANIVFADADLDQAARGAVSAVFSGAGQSCVAGSRLLVERGVHDELVARIVAQVDA
FT                   LRLGDPLDPDTEIGPIISRRQVATIRSLIQAGQEDGATRLSGATPAASVADGALADGSW
FT                   IMPTILDGVEPGHRLETTEVFGPVLGVSVFDTEEEVVARANATGFGLAGAVWTSDVSRA
FT                   HRVAAAVDAGTFWINAYKSIHVAVPFGGFGESGHGRSSGPGVLDEYTQQKAVWVPTTAP
FT                   AAPFPSMRG"
FT   CDS_pept        331874..333112
FT                   /transl_table=11
FT                   /locus_tag="CMM_0270"
FT                   /product="putative sugar ABC transporter, substrate binding
FT                   protein"
FT                   /function="ABC-type sugar transport system periplasmic
FT                   component"
FT                   /note="putative sugar ABC transporter, substrate binding
FT                   protein (ZP_00192200.3| COG1653: ABC-type sugar transport
FT                   system, periplasmic component [Kineococcus radiotolerans
FT                   SRS30216];; NP_625350.1| putative sugar transport sugar
FT                   binding protein [Streptomyces coelicolor A3(2)]).
FT                   pfam01547, SBP_bac_1, Bacterial extracellular
FT                   solute-binding protein. InterPro: Bacterial extracellular
FT                   solute-binding protein family 1"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0270"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00292"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMK7"
FT                   /protein_id="CAN00292.1"
FT                   /translation="MSPRSTARRRLVGAAALAATVPLVLAGCSGGGGGGSSSGGDPTTI
FT                   TVTDYYNEGNDDTVIGDTLTKCGESLGVTIERTSIPGSSLIQKVLQQASSKTLPDVLML
FT                   DNPDLQQIAATGALAPLEDFGISTDGYAKGVVDAGTYEGKTYGLAPTVNTIALFYNKAM
FT                   LADAGIQPPTTWDELKTAAAALKDGDRYGIAMDANATYEGTWQFLPFMWSNGGDEKDIA
FT                   TPETAEALQLWTDLVKDGSASQSVVNWTQSDVNDQFMAGKTAMMINGPWQIPALTESGV
FT                   DYGIAKLPAPEAGGTAVAPLGGEVWTVPQTGDKAKQATAAKVVECLNSDENQLDMATKR
FT                   YTIPSKTAVATEFGQQVPEEQVFVDLVADARARTGELGAEWPKAATKIYTAVQSALTGQ
FT                   SSPEDALKNAEQG"
FT   CDS_pept        333112..334101
FT                   /transl_table=11
FT                   /locus_tag="CMM_0271"
FT                   /product="putative sugar ABC transporter, permease
FT                   component"
FT                   /function="ABC-type sugar transport systems permease
FT                   components"
FT                   /note="putative sugar ABC transporter, permease component
FT                   (ZP_00226127.1| COG1175: ABC-type sugar transport
FT                   systems,permease components [Kineococcus radiotolerans
FT                   SRS30216];; NP_625351.1| putative sugar transport integral
FT                   membrane protein [Streptomyces coelicolor A3(2)]).
FT                   InterPro: Binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0271"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00293"
FT                   /db_xref="GOA:A5CMK8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMK8"
FT                   /protein_id="CAN00293.1"
FT                   /translation="MATTAVPARPTAQAAGRARGAGEAAVARGPVRRRPRFRWERFFQV
FT                   MFLVPAVVYLVLFFGFPVVKNIVMSFQEYTTTTFYTGEAPWVGFANYASVLSSGIFSTA
FT                   LLNTFLFTAGSIAGQFVIGLVLALFFRRSFPLNGLLRALLLLPWLLPLIVSSAVWKWIL
FT                   DQDSGVLNQALLGSGLVQDPVPWLTSPAFALITVIAVNVWIGIPFNTTILYGGLQDIPP
FT                   ELYEAGSLDGATGWRGFRHITWPLLRPVVGVVLVLGVVYTIKVLDIILGLTNGGPANST
FT                   QTIATQSYTLSFQQFDFGSGAALSNILIAISAVFAVVYLRANRKAVDD"
FT   CDS_pept        334094..334969
FT                   /transl_table=11
FT                   /locus_tag="CMM_0272"
FT                   /product="putative sugar ABC transporter, permease
FT                   component"
FT                   /function="ABC-type sugar transport system permease
FT                   component"
FT                   /note="putative sugar ABC transporter, permease component
FT                   (ZP_00226128.1| COG0395: ABC-type sugar transport
FT                   system,permease component [Kineococcus radiotolerans
FT                   SRS30216];; NP_625352.1| putative sugar transport integral
FT                   membrane protein [Streptomyces coelicolor A3(2)]).
FT                   pfam00528,BPD_transp_1, Binding-protein-dependent transport
FT                   system inner membrane component. InterPro:
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0272"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00294"
FT                   /db_xref="GOA:A5CMK9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMK9"
FT                   /protein_id="CAN00294.1"
FT                   /translation="MTDTAERLAPAPARRVSSGSRRPRADRSWIGTVVGIALLAVMLFP
FT                   VYWMVNISLQPAGPAIQAAWFPFEAQFNGYATALSEQGQALGTSLVIALGSVVLSLAIA
FT                   TPAAYALAQFKFRWINLVLFGILISQMIPGIVVANALYAAYNDLGLLNSIPGLILADST
FT                   AGIPFAILIMRAFMAGIPPSIIEAAKVDGAGNFRAFRSIVLPVSLNAVITAGLFTFLFT
FT                   WSDFLFALTLTTTDDVRPITLGIYQYIGTYTADWSTVMATAVLASLPAIVLLLAAQRFI
FT                   AAGATGGAVK"
FT   CDS_pept        335052..335822
FT                   /transl_table=11
FT                   /locus_tag="CMM_0273"
FT                   /product="trehalose utilization-related protein"
FT                   /function="Trehalose utilization protein"
FT                   /note="conserved hypothetical protein (ZP_00226129.1|
FT                   COG4813: Trehalose utilization protein [Kineococcus
FT                   radiotolerans SRS30216];; NP_693487.1| hypothetical protein
FT                   OB2566 [Oceanobacillus iheyensis HTE831]). pfam06283,
FT                   DUF1037, Protein of unknown function (DUF1037). This family
FT                   consists of several bacterial ThuA like proteins. The
FT                   function of the family is unknown."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0273"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00295"
FT                   /db_xref="InterPro:IPR009381"
FT                   /db_xref="InterPro:IPR029010"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMK5"
FT                   /protein_id="CAN00295.1"
FT                   /translation="MTDTASPLRVTVWGENRHEQIEQHVRDRYPTGMHGAVAEGVQENL
FT                   PDAHVEIATMDQPEHGLTEELLARTDVLTWWGHAAHAEVDDEVVARVHRHVLDGMGLIV
FT                   LHSGHWSKIFTKLMGTTCTLRWRSEHDRELVWTVNPQHPITRGVPNPIVIDEQEMYGEY
FT                   FDVPTPDELVFISGFTGGEVFRSGMTYRRGFGRIFFFSPGDQDFPVYHHRDVRRVIANA
FT                   CEWARPDRRETPTLLRYELGEYYDGTDYAGALER"
FT   CDS_pept        335819..337048
FT                   /transl_table=11
FT                   /locus_tag="CMM_0274"
FT                   /product="putative dehydrogenase"
FT                   /note="putative dehydrogenase (ZP_00226130.1| COG0673:
FT                   Predicted dehydrogenases and related proteins [Kineococcus
FT                   radiotolerans SRS30216];; NP_534841.1| conserved
FT                   hypothetical protein [Agrobacterium tumefaciens str. C58]).
FT                   pfam01408, GFO_IDH_MocA, Oxidoreductase family, NAD-binding
FT                   Rossmann fold. This family of enzymes utilise NADP or NAD.
FT                   pfam02894, GFO_IDH_MocA_C, Oxidoreductase family,C-terminal
FT                   alpha/beta domain."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0274"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00296"
FT                   /db_xref="GOA:A5CML0"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5CML0"
FT                   /protein_id="CAN00296.1"
FT                   /translation="MTAVEERTGPAHRIVAPADGARLRVVQVGAGGMGRQWLQTIAEDP
FT                   DVELVGVVDLDEEAARAGASAHGASAEASTDLGELIARVRPDAVIDVTIPRAHHPVTTQ
FT                   ALFAGIPVLGEKPVALTVAEGLSLAAAAEITGELFMVSQSRRYNDHLVALKRRAADLGG
FT                   VGIVTTEFFKAPRFGGFREEMDDVLLLDMAVHQFDAVRYLLDADPVSVYCESYNPAWSW
FT                   YRGDAGATAVFAFEGGVRYVYTGSWCSPGAETSWNGSWRVSGAHGTALWDGDHDPTSEI
FT                   PEAPVGPPAEPAAAESVGVEIAGSLRAFVRALRTGERPHGEVHGNVMSLAMVEAAIESK
FT                   DTGRRLAIDDVLERAYATALADERRDDVRARLEAWRERGVREALQGSPATAGRAGPEGV
FT                   AAVARPAAAG"
FT   CDS_pept        337069..338382
FT                   /transl_table=11
FT                   /locus_tag="CMM_0275"
FT                   /product="putative ROK-family transcriptional regulator"
FT                   /function="Transcriptional regulator/sugar kinase"
FT                   /note="transcriptional regulator, ROK family
FT                   (ZP_00227613.1| COG1940: Transcriptional regulator/sugar
FT                   kinase [Kineococcus radiotolerans SRS30216];; NP_623501.1|
FT                   Transcriptional regulator [Thermoanaerobacter
FT                   tengcongensis]). InterPro: ROK family ROK_glcA_fam: ROK
FT                   family protein (puta"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0275"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00297"
FT                   /db_xref="GOA:A5CML1"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5CML1"
FT                   /protein_id="CAN00297.1"
FT                   /translation="MTGHETGDAARAPEPLASVVDPARSVPLAPDPRSRGTTPDHVRRS
FT                   NLATVLQIVHETGPASRSELTRETGLNRSTIAALVGELQELGLVVESEPPGTNRVGRPS
FT                   PIVSADPRVVVFAVNPEIDAVTVGLVGLDGVVQERVRRDTDGIPTAAQAADLAGAIIAE
FT                   LRAHLRATRPDARVLGIGVAVPGLVRFDGGLVRLAPHLGWVDEPFAALLAEATGLPALA
FT                   ANDASLAAVAEGRFGSGRDVDDLVYLNGGASGVGGGVLIGRRPFGGAEGYGGELGHTLV
FT                   DSGGELCHCGAVGCLETTVGQDALLEVTGLERARADELGDVLAAALEAGDPAVTAEVER
FT                   QIDNLAVALRNVVNIFNPSLVVLGGFLGSLHAADPDRILARATAQALPGAREALRIRRA
FT                   ALGPDRLMIGAAELAFARVLVDPSAVMRAAADAERTTA"
FT   CDS_pept        338379..339035
FT                   /transl_table=11
FT                   /locus_tag="CMM_0276"
FT                   /product="conserved hypothetical protein"
FT                   /function="Predicted phosphatase/phosphohexomutase"
FT                   /note="conserved hypothetical protein, putative phosphatase
FT                   (ZP_00163802.1| hypothetical protein Selo236801
FT                   [Synechococcus elongatus PCC 7942];; NP_945802.1| possible
FT                   hydrolases/phosphatases [Rhodopseudomonas palustris
FT                   CGA009]). pfam00702,Hydrolase, haloacid dehalogenase-like
FT                   hydrolase. This family are structurally different from the
FT                   alpha/ beta hydrolase family (pfam00561). This family
FT                   includes L-2-haloacid dehalogenase, epoxide hydrolases and
FT                   phosphatases."
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0276"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00298"
FT                   /db_xref="GOA:A5CML2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A5CML2"
FT                   /protein_id="CAN00298.1"
FT                   /translation="MSAPVDLVILDCDGVLVDSEVLAVEVDKRVLAELGWDVTTEEIVE
FT                   RFVGKSHATFTAEVAAHLGRDLADDWDAPYAHWYADAFAEHLRPVDGIEEALDAIALPT
FT                   CVASSGGHHKIRANLARTGLLPRFDGRISSATEVAHGKPAPDLFLLAASRMGVDPARCV
FT                   VVEDSPYGVQGALAAGMRALGYAGGLTPADRLRDAGALVFDDMRDLPRLLRGRAG"
FT   CDS_pept        complement(339073..340074)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0277"
FT                   /product="hypothetical membrane protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0277"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00299"
FT                   /db_xref="GOA:A5CML3"
FT                   /db_xref="UniProtKB/TrEMBL:A5CML3"
FT                   /protein_id="CAN00299.1"
FT                   /translation="MTTPDTAPAPGTTLDRPADRAVPGVRGALLALAAGVAAAALGLLP
FT                   WILAGLRLPPQDLWADDVTSAADMPFALLPFDQYTAGLLAAVILVGGGLAGTAARVLRT
FT                   RLPRHGSWLVVAGLLAAQVVSLVQTSAVTADGLGMDDVSGAGDRTGASISEAQVYLVAF
FT                   VGGTAAMILLAAVVAALLACAPAGLAVVAAAFPVVLLGEWLGGLVSPGPTGVLGDAAYA
FT                   ILPVISWVPPVVLGIAVALTGLRSVGRVVGSVIAVLLLWLGTAIVVGVTYALGNRVLLR
FT                   YPLELLDAGGMVGGAVLRGEGGVLGRLAVAMVVGILGALVVRAVRRRAVGAG"
FT   CDS_pept        340257..340847
FT                   /transl_table=11
FT                   /locus_tag="CMM_0278"
FT                   /product="putative chorismate mutase"
FT                   /function="Chorismate mutase"
FT                   /note="putative chorismate mutase (ZP_00041424.1| COG1605:
FT                   Chorismate mutase [Xylella fastidiosa Ann-1];;
FT                   ZP_00217335.1| COG1605: Chorismate mutase [Burkholderia
FT                   cepacia R18194]). pfam01817, Chorismate_mut, Chorismate
FT                   mutase. InterPro: Chorismate mutase"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0278"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00300"
FT                   /db_xref="GOA:A5CML4"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008240"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="UniProtKB/TrEMBL:A5CML4"
FT                   /protein_id="CAN00300.1"
FT                   /translation="MPRRALLTTSAFAVTLAALLGAAAPAQACPRDPAEQQVVTAVASA
FT                   ALDRLEIADDVAASKYLSGKAVADPAREQAVVDATIAAAKADGVDPVAAERIIRAQITA
FT                   SKQVQYALIAFWHANPAQAPTTAPDLTTSVRPRINAVDARLVPAIGAASAALADPACGH
FT                   LVKDARGQLGQGLDDAHRKAFRTALATVCTPES"
FT   CDS_pept        complement(340959..341297)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0279"
FT                   /product="conserved membrane protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /note="conserved membrane protein (CAB02345.1| PROBABLE
FT                   CONSERVED INTEGRAL MEMBRANE PROTEIN [Mycobacterium
FT                   tuberculosis H37Rv];; NP_825933.1| hypothetical protein
FT                   SAV4756 [Streptomyces avermitilis MA-4680]).
FT                   pfam02694,UPF0060, Uncharacterized BCR, YnfA/UPF0060
FT                   family."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0279"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00301"
FT                   /db_xref="GOA:A5CML5"
FT                   /db_xref="InterPro:IPR003844"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5CML5"
FT                   /protein_id="CAN00301.1"
FT                   /translation="MLLRTVILFALAAVAEIGGAWLVWQAVREGRPWWWAGLGVMALGA
FT                   YGFIASLQADASFGRILAAYGGVFVAGSLVWGAVVDGYRPDRWDVIGAVVCLLGVAVIM
FT                   FGPRGQGA"
FT   CDS_pept        complement(341356..341847)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0280"
FT                   /product="conserved hypothetical protein"
FT                   /note="conserved hypothetical protein (NP_828610.1|
FT                   hypothetical protein SAV7434 [Streptomyces avermitilis
FT                   MA-4680];; ZP_00225717.1| hypothetical protein Krad06004549
FT                   [Kineococcus radiotolerans SRS30216])."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0280"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00302"
FT                   /db_xref="InterPro:IPR032330"
FT                   /db_xref="UniProtKB/TrEMBL:A5CML6"
FT                   /protein_id="CAN00302.1"
FT                   /translation="MLPLTESDIRASLVNASQRERRDIHLPEGFADLAWDRLDFLGWRD
FT                   PKAPQRGIVVAPVGDELIGVLLQQSATAPRSRAQCTWCQDVRLPNPVVFYGARRAGAAG
FT                   RNGNTVGTLVCTDFECNANVRKPRPIPYLGFDPAAATAQLIDDLRDRVAAFAADIASTA
FT                   "
FT   CDS_pept        complement(342105..342899)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0281"
FT                   /product="putative acetyltransferase"
FT                   /note="putative acetyltransferase (NP_295640.1|
FT                   hypothetical protein [Deinococcus radiodurans R1];;
FT                   NP_822402.1| hypothetical protein SAV1227 [Streptomyces
FT                   avermitilis MA-4680];; NP_935421.1| acetyltransferase
FT                   [Vibrio vulnificus YJ016]). weak similarities to:
FT                   COG3153,COG3153, Predicted acetyltransferase [General
FT                   function prediction only];; pfam00583,
FT                   Acetyltransf_1,Acetyltransferase (GNAT) family. This family
FT                   contains proteins with N-acetyltransferase functions. nadC:
FT                   nicotinate-nucleotide pyrophosphor"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0281"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00303"
FT                   /db_xref="GOA:A5CML7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A5CML7"
FT                   /protein_id="CAN00303.1"
FT                   /translation="MPTTDAAALLAAYDAQLRTDAETPSALDVRLLGPLRLVVFPGGRG
FT                   FITYADLGGLDEAGLRDLVPAALARYRDDPAITTVEWKTRGHDHAPGLDGMLRANGFVA
FT                   EERESIMLGEARALAVDVPLPAGVTLRRVTAEADVRAMSAMQDEVFGDAVSADRADAIL
FT                   HRLRLDDGMELWVAEAEGRIVSAGRLEPVAGSDFAGLWGGATVPEWRGRGIYRALTAAR
FT                   ARSALAAGRTLMHSDSTDFSRPILERSGLIACSTTTPYAWSR"
FT   CDS_pept        complement(342905..345463)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0282"
FT                   /product="conserved hypothetical protein"
FT                   /note="conserved hypothetical protein (ZP_00294435.1|
FT                   hypothetical protein Tfus02000641 [Thermobifida fusca];;
FT                   NP_624665.1| putative large secreted protein [Streptomyces
FT                   coelicolor A3(2)])."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0282"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00304"
FT                   /db_xref="GOA:A5CML8"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR027414"
FT                   /db_xref="UniProtKB/TrEMBL:A5CML8"
FT                   /protein_id="CAN00304.1"
FT                   /translation="MVPPTTHGRPTVRPSDRKDPIIRSPSRDDAHRPTSPASTTATAFT
FT                   TATAAPTWEEGIVVGSGRLGAVAHGPADAITVSLAHERWFPPVNPRPHAPDLRPRLDAI
FT                   RRALLAGDPDTATAELMAGARDSGYGDDLVWTDPLGICATLVIRTAGGVADMCRTMDPA
FT                   GGESAIAWTDVAGGRHALRLVAPRDGSACWLALESDRDSVTAVELGLGAGDTTALYTGG
FT                   PDASAAVRTSLAGGARGILAAEAGAGDDALRSVTAVDAPGAGSAEGAGSTGGAGSAWEV
FT                   DGGSARTTVRTGPGATALLRLAVAVGPASAAPTPDGPPATTPAWDELRTAQRATHGRLV
FT                   AASALDLHGEAPADDADADPHPTTEGLWAAARAGDPAARRRVVEVTYTSGRAAIISSTG
FT                   ELPATLQGVWQGTWRPAWSADYTLNGNVQNGGIASLIPTGTPELARTLLELVLPHLDDF
FT                   RENARRIYGAEGTLLPARMSTHGRADHFDADYPMPFWQGCGGWILRVAADAVATTGDRG
FT                   IVDDRLWELAEGVLRFAETATVMVGGVRRLVPSYSPENTPGGERMPAATDATMDVSILR
FT                   DAARATALLGRARGDDSLDARWAAVVRDLPPYRVADDGTLAEWLDPRWRERIAHRHASQ
FT                   LHPLWDEIDPAFVGDGDESARLRAAAAATVAAKIAWRAEDPTAPPGRMGMAFGLVQVGL
FT                   AAAALGDGEAALTCVEWLAVDHWSPALTSRHDAGRIFNLDASGGLPALVAAMLLGSDAG
FT                   SLAVLPALPVAWARGSVTGLRARGGLVVDRLDWDPDGASLTVRRVPGADWLAPAGGTAL
FT                   RLPRAASVRVDGREHDAGARIAFVKDAVRIEIRWLPEPVR"
FT   CDS_pept        345561..346151
FT                   /transl_table=11
FT                   /locus_tag="CMM_0283"
FT                   /product="putative adenylate kinase"
FT                   /function="Adenylate kinase and related kinases"
FT                   /note="putative adenylate kinase (NP_599567.1| putative
FT                   adenylate kinase [Corynebacterium glutamicum ATCC 13032];;
FT                   NP_293926.1| hypothetical protein [Deinococcus radiodurans
FT                   R1])."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0283"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00305"
FT                   /db_xref="GOA:A5CML9"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5CML9"
FT                   /protein_id="CAN00305.1"
FT                   /translation="MLGPLQRLDPPARRILIGAPSGAGKTTLARRIQERTGTPHTEMDS
FT                   LFHGPAWTELPTFRDDVEAFSSRDAWVTEWQYTTQLGDLVPSRADTLVWLDLPVAVQMG
FT                   RLIRRTVVRRWRREPLWHGNVEPPMRTVLTDPDHIVRWGWRGRAKVRKRVVLAAVEHPH
FT                   LRIVRLRSTREVDVWLRGLPAVGQPPVPPAAAG"
FT   CDS_pept        complement(346118..346705)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0284"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00306"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMM0"
FT                   /protein_id="CAN00306.1"
FT                   /translation="MSAPRITVAWAGLCAAAVLTMSGCATPGGADGLAAEDPPVVLPTA
FT                   DPTPTPTPTPDSAAGGGYAECDDASPAALAAVNASIAAHDGPFPGLRLDGLETRWDDEQ
FT                   QVWTLAGTIGPVGDDPDGGPVSDDRVALWATDRDPTREDFAGTLWSAVNGADMVSDAPQ
FT                   LGSFPQLTMDGPVPAGMWCSDLYPAAAGGTGG"
FT   CDS_pept        complement(346723..347499)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0285"
FT                   /product="putative permease, DMT family"
FT                   /function="Permeases of the drug/metabolite transporter
FT                   (DMT) superfamily"
FT                   /note="putative permease, DMT family (ZP_00198666.1|
FT                   COG0697: Permeases of the drug/metabolite transporter (DMT)
FT                   superfamily [Kineococcus radiotolerans SRS30216];;
FT                   NP_629665.1| putative integral membrane protein
FT                   [Streptomyces coelicolor A3(2)]). pfam00892, DUF6,Integral
FT                   membrane protein DUF6. This family includes many
FT                   hypothetical membrane proteins of unknown function."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0285"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00307"
FT                   /db_xref="GOA:A5CMM1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMM1"
FT                   /protein_id="CAN00307.1"
FT                   /translation="MLGRQALIGAFAQLGYCAFVYAAIGAGIATGTTALIDAVQPLVVA
FT                   TLVGPLLGLRVHGAQRAGLALGAVGVVLVVRSQAGAADADPVAYLLPAAAMACLVAGTF
FT                   LERRSSGRPPVLVTLTVHVVVTSVALVVAAVATGTLVPPTDPAFWITTVVAALVPTLAA
FT                   YGLYWWLLERVGITALNALLFLVAPTTAAAGALLLGERITPVTLAGFVLCGTGVAAVLV
FT                   TEARRAAPARGSSDTGPADDHPSPGADRREPAARAA"
FT   CDS_pept        347748..348374
FT                   /transl_table=11
FT                   /locus_tag="CMM_0286"
FT                   /product="putative transcriptional regulator, TetR-family"
FT                   /function="Transcriptional regulator"
FT                   /note="putative transcriptional regulator, TetR family
FT                   (NP_629666.1| putative transcriptional regulator
FT                   [Streptomyces coelicolor A3(2)];; NP_940577.1| Putative
FT                   TetR-family transcriptional regulator [Corynebacterium
FT                   diphtheriae]). InterPro: Bacterial regulatory proteins TetR
FT                   family"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0286"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00308"
FT                   /db_xref="GOA:A5CMM2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMM2"
FT                   /protein_id="CAN00308.1"
FT                   /translation="MKTPVPDLAPLTPGARRVLDAASELFYARGIHVVGVDAIAAAAGV
FT                   TKKTIYDRFGSKEQLVVAYLQHRDARWREHVAARLARTPEPGIDRVLAVFDAAITWAVA
FT                   NTPKGCSAINARAELGAGDLGADDDGHDVLPEVMRQKAWLHELLRDLCHEAGVPDAAAT
FT                   ARTLMLIYEGGLVTLGMGTFAHPMAVARDAARALLEAAASTGAGR"
FT   CDS_pept        348371..348868
FT                   /transl_table=11
FT                   /locus_tag="CMM_0287"
FT                   /product="putative diadenosine tetraphosphate (Ap4A)
FT                   hydrolaseHIT family"
FT                   /function="Diadenosine tetraphosphate (Ap4A) hydrolase and
FT                   other HIT family hydrolases"
FT                   /note="putative diadenosine tetraphosphate (Ap4A)
FT                   hydrolase, Hit family (NP_539734.1|
FT                   BIS(5'-NUCLEOSYL)-TETRAPHOSPHATASE (ASYMMETRICAL) [Brucella
FT                   melitensis];; NP_102422.1| probable Hit-like protein
FT                   involved in cell-cycle regulation [Mesorhizobium loti
FT                   MAFF303099]). cd01277, HINT_subgroup, HINT (histidine triad
FT                   nucleotide-binding protein) subgroup: Members of this CD
FT                   belong to the superfamily of histidine triad hydrolases
FT                   that act on alpha-phosphate of ribonucleotides."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0287"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00309"
FT                   /db_xref="GOA:A5CMM3"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMM3"
FT                   /protein_id="CAN00309.1"
FT                   /translation="MSDQATCPFCALLRDEPLVAPLPQDVVAERDRAVAVIAPRWWPRN
FT                   RGHALVIPRVHVRDLYSVTPDDLHAVMDLVQEVAVAMRAAYGCAGISVRQHNETAGGQD
FT                   VWHLHVHVFPRAEGDDLYGSAPLPGFASPEERLPFSGPLREELSARQRRGPATGTPRPD
FT                   PA"
FT   CDS_pept        348940..349608
FT                   /transl_table=11
FT                   /locus_tag="CMM_0288"
FT                   /product="putative oxidoreductase"
FT                   /function="Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /note="putative oxidoreductase/dehydrogenase (NP_823521.1|
FT                   putative oxidoreductase [Streptomyces avermitilis
FT                   MA-4680];; CAC14507.1| putative oxidoreductase
FT                   [Streptomyces coelicolor A3(2)]). pfam00106, adh_short,
FT                   short chain dehydrogenase. This family contains a wide
FT                   variety of dehydrogenases."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0288"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00310"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMM4"
FT                   /protein_id="CAN00310.1"
FT                   /translation="MTTIAIVGAGAGLGAAVARRFGAEGFAVALISRSQERVDELARTL
FT                   ADEGITARGYAANVRDHVALAAALDRAAQELGPVEVLQYSPLPQKEFLRPVLETTPGDL
FT                   VGAFEFSIQAPVAAVHQVLQGMRVLGRGTVLFINGGTAVQPLPKYAGTSIAFAGESAYG
FT                   QMIHEALAGDGIHVGQLIIPGAIIPGHEEKDPRVLADTLWSMHQERGDFRRFAADMDDE
FT                   "
FT   CDS_pept        complement(349694..350386)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0289"
FT                   /product="conserved secreted protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /note="conserved secreted protein (ZP_00227777.1| COG2353:
FT                   Uncharacterized conserved protein [Kineococcus
FT                   radiotolerans SRS30216];; NP_939578.1| Putative secreted
FT                   protein [Corynebacterium diphtheriae]). pfam04264,
FT                   YceI,YceI like family. E. coli YceI is a base-induced
FT                   periplasmic protein. Its function has not yet been
FT                   characterised."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0289"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00311"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMM5"
FT                   /protein_id="CAN00311.1"
FT                   /translation="MQKKTKIILGTSAAVVVVLGVSAAAFGPAFYRDVIVGAPAAAPSV
FT                   SAAPADSTLDTSDLSGEWQIGTGSTAGYRVAEVLNGTDVTVVGKTEDVTGSITVDGSTL
FT                   SAATVKVDVASIATDAAPRDEYFRGTAMEVSKYPDATFTLTQPVDAAVPADGQVATVQA
FT                   TGELTMHGVTQTVTVPLQAALSGDGVQVSGSIPVTFSDYGVHAPSLGFVSVEDQGTVEF
FT                   LVKATPTK"
FT   CDS_pept        350578..351084
FT                   /transl_table=11
FT                   /gene="sigL"
FT                   /locus_tag="CMM_0290"
FT                   /product="putative RNA polymerase ECF-subfamily sigma
FT                   factor"
FT                   /function="DNA-directed RNA polymerase specialized sigma
FT                   subunit sigma24 homolog"
FT                   /note="RNA polymerase sigma factor, ECF-subfamily
FT                   (NP_215249.1| sigL [Mycobacterium tuberculosis H37Rv];;
FT                   ZP_00225475.1| COG1595: DNA-directed RNA polymerase
FT                   specialized sigma subunit, sigma24 homolog [Kineococcus
FT                   radiotolerans SRS30216]). pfam04542, Sigma70_r2, Sigma-70
FT                   region 2. Region 2 of sigma-70 is the most conserved region
FT                   of the entire protein. All members of this class of
FT                   sigma-factor contain region 2. The high conservation is due
FT                   to region 2 containing both the -10 promoter recognition
FT                   helix and the primary core RNA polymerase binding
FT                   determinant. pfam04545, Sigma70_r4, Sigma-70,region 4.
FT                   Region 4 of sigma-70 like sigma-factors are involved in
FT                   binding to the -35 promoter element via a helix-turn-helix
FT                   motif."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0290"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00312"
FT                   /db_xref="GOA:A5CMM6"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMM6"
FT                   /protein_id="CAN00312.1"
FT                   /translation="MTTESTARMRALHDAHAPALQRYALRLTGDPALAEDVVQEALLRA
FT                   WRSPAILAEDDESARRWLFTVVRNLVIDDRRSAWRGRETPTDVLPEDPVADASDAIIDR
FT                   LLVAEALASLSAEHRRAVVSCYHLGRTVVETAEREGVPPGTIKSRLHYALKALRLALQE
FT                   RGVTR"
FT   CDS_pept        351081..351872
FT                   /transl_table=11
FT                   /locus_tag="CMM_0291"
FT                   /product="conserved membrane protein"
FT                   /note="conserved membrane protein, putative anti-sigma
FT                   factor (NP_215250.1| hypothetical protein Rv0736
FT                   [Mycobacterium tuberculosis H37Rv];; NP_826301.1| putative
FT                   membrane protein [Streptomyces avermitilis MA-4680]).
FT                   similarity to anti-sigma factors (COG5662, Predicted
FT                   transmembrane transcriptional regulator (anti-sigma factor)
FT                   [Transcription])"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0291"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00313"
FT                   /db_xref="GOA:A5CMM7"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMM7"
FT                   /protein_id="CAN00313.1"
FT                   /translation="MNDRADDIHEWDAAYVLGSLSATDRALFEAHLEGCDACMRSLAEL
FT                   SGLPGVLRMLPVEEAIALMDEPEAPAVPQPVAPAQDAPGHRVPRRRRRPLAGGARPPLS
FT                   RRTGGWILAAAAVVLLVGGAGLGSALRAGVSGPVADPSPASSSAAGDPSGDLSEGLPAD
FT                   AVSMRSDLDEGVTAKLALTPQPWGTRFDWSCEYAGGGVGQGAYDLVAIEDDGTRTVVAS
FT                   WGAGQAESRLLAATSSLPMDRIRTVQITPSDSDVVLASRDL"
FT   CDS_pept        complement(352171..352761)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0292"
FT                   /product="hypothetical protein"
FT                   /function="unknown"
FT                   /note="hypothetical protein (ZP_00410568.1| hypothetical
FT                   protein ArthDRAFT_3888 [Arthrobacter sp. FB24])."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0292"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00314"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMM8"
FT                   /protein_id="CAN00314.1"
FT                   /translation="MGGDSAQASDDPVDGCPTPWPSTMDCSVAGLRGAGFEGFVPFDRA
FT                   VDDAPEASGVYVVARPALTPPAFLPVSPAGSFTGRDPSYPPERLEAEWVAGSAVVYVGK
FT                   AGRAPGIRRGLRARLREYAAFGSGKAIAHRGGRAIWHLDDAAQLLVAWRETAPARRASD
FT                   EECEMLSDSMAHHEGRLPFANMRGPSRRGRLPD"
FT   CDS_pept        352835..354202
FT                   /transl_table=11
FT                   /locus_tag="CMM_0293"
FT                   /product="putative MFS permease"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /note="putative MFS permease (ZP_00098466.1| COG0477:
FT                   Permeases of the major facilitator superfamily
FT                   [Desulfitobacterium hafniense];; NP_834739.1|
FT                   Macrolide-efflux protein [Bacillus cereus ATCC 14579]).
FT                   pfam05977,DUF894, Bacterial protein of unknown function
FT                   (DUF894). This family consists of several bacterial
FT                   proteins, many of which are annotated as putative
FT                   transmembrane transport proteins."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0293"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00315"
FT                   /db_xref="GOA:A5CMM9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMM9"
FT                   /protein_id="CAN00315.1"
FT                   /translation="MSDPAAQADVPAMSDADAAVVAARWKRNAALFLSGQTVSLFGSML
FT                   VQYAVMWYVTFETRSGLAVALYAVCAFLPQGIVSIFGGTLADRMNRRVLVIVSDSSIAI
FT                   VTLALALLMMNGVTDLWIILLAVAVRSVGAGFQTPAVQAMIPQIVPPEQLLRVNGIFGT
FT                   IQSAMALLAPAAAGAIFAAYGLVPLFFVDAITAAIGIAFLLSVAVPTLASIADKTSTYR
FT                   EDLVEGIRYIGGDPVVRWLLVVFAFVFLLTVAPTIITPLLVARTYGTEVWMVAVLEIAF
FT                   SVGMLGGGALVSTLFAKSDRMTLILVSCFGFAVFTAGLGLSPDLWVFYGFTFAIGLFVP
FT                   LFSAPFMTLVQETVAPEMHGRVFSYVGIVMALATPIGAVAFGPLADVLSVQTLLVAAGI
FT                   ITVVVITVAISLPSGRAAIRLARAKRSGADAEDADAGPGAGPGGTPIDPARAAPGS"
FT   CDS_pept        complement(354199..354702)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0294"
FT                   /product="conserved hypothetical protein"
FT                   /function="FOG: TPR repeat"
FT                   /note="conserved hypothetical protein (NP_294991.1|
FT                   hypothetical protein [Deinococcus radiodurans R1];;
FT                   NP_827164.1| hypothetical protein SAV5987 [Streptomyces
FT                   avermitilis MA-4680]). PPR: pentatricopeptide repeat
FT                   domain"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0294"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00316"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR041656"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMN0"
FT                   /protein_id="CAN00316.1"
FT                   /translation="MDHDDWDARVAAFWATADDERADETVAAMRALAAERPADDPRALF
FT                   ELACAHDFVGREAEAVPLYRTALDGGLDPEHRPLAVIQLASSLRNVGEAEQAVALLEAM
FT                   PDDAHAPGRDAFLALALHDAGRPTEALAVALRRLAATLPEYGRAVAAYADELTECGRTE
FT                   PAED"
FT   CDS_pept        complement(354731..355741)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0295"
FT                   /product="putative transcriptional regulator, LacI family"
FT                   /function="Transcriptional regulators"
FT                   /note="HTH-type transcriptional repressor, LacI family
FT                   (NP_823290.1| putative transcriptional regulator
FT                   [Streptomyces avermitilis MA-4680];; ZP_00330608.1|
FT                   COG1609: Transcriptional regulators [Moorella thermoacetica
FT                   ATCC 39073]). pfam00356, LacI, Bacterial regulatory
FT                   proteins, lacI family. pfam00532, Peripla_BP_1,Periplasmic
FT                   binding proteins and sugar binding domain of the LacI
FT                   family. This family includes the periplasmic binding
FT                   proteins, and the LacI family transcriptional regulators."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0295"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00317"
FT                   /db_xref="GOA:A5CMN1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMN1"
FT                   /protein_id="CAN00317.1"
FT                   /translation="MSRRATIHDVASAAGVSVSTVSKAVNGRYGISAETSRRVMEVVER
FT                   LGYESSLVASSMRSHRTGVIGVLVAGFEPFSAEILKGVGAALRSSRYDLLAYSGSRQMD
FT                   NTGWERRSLSRLSGTLIDGAIMVTPTVVTAQTDIPVVSIDPHTGPADLPSVESDSLGGA
FT                   LQATRHLLELGHRRIGFLAGRPDLRSASLREAGYRRALQDAGIAFDPALVRAGLFLTAA
FT                   AREPARALLSMPDRPTAIFAANDLSGIAILQVAAELGIRVPEDLSVIGFDDIPEASQMS
FT                   PALTTIRQPMQRLGTTAVDLLMSLMSGTGPEAMHVQLPTRLVRRATTGPPPARSR"
FT   CDS_pept        355969..357261
FT                   /transl_table=11
FT                   /locus_tag="CMM_0296"
FT                   /product="putative sugar ABC transporter, substrate-binding
FT                   protein"
FT                   /function="ABC-type sugar transport system periplasmic
FT                   component"
FT                   /note="putative sugar ABC transporter, substrate-binding
FT                   protein (ZP_00121433.1| COG1653: ABC-type sugar transport
FT                   system, periplasmic component [Bifidobacterium longum
FT                   DJO10A];; NP_826156.1| putative sugar transporter
FT                   solute-binding protein [Streptomyces avermitilis MA-4680]).
FT                   pfam01547, SBP_bac_1, Bacterial extracellular
FT                   solute-binding protein."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0296"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00318"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMN2"
FT                   /protein_id="CAN00318.1"
FT                   /translation="MKARKILTGSAALLVGALALAGCSGSGSGSGDDGGPVEMTLWHNS
FT                   TTGPGKAFWDKTTADFNAAHPGVTVTPTSIQNEDLDGKLQTALNSGDAPDIFLQRGGGK
FT                   LAATVAAGQVMDITDGISADVKGQIAQSAFDANSIDGKAYAMPVAVLPSGIFYSQDLFT
FT                   AAGITETPKTMDELDAAVEKLKATGVAPIALGAKDAWPAAHWYFNFALRECSSATLEKA
FT                   ATDKDFSDDCWIKAGQDVEDLVGTNPFNDGFLTTAAQQGAGSSAGLIANKKAAMELMGA
FT                   WDPGVIAGLTPDTKPLADLSWFPFPEISGGAGEPGSIMGGIDGYSCSAQSPKACVDFLN
FT                   YIGTADVQKEYYAAFNAPPVNTEAQTAVTEPYLKEIIAAYNDAPYVSQWLDTVYGLNVG
FT                   NAMNVGVVDLMAGDGSPEKLIQTVGDAAKKA"
FT   CDS_pept        357272..358297
FT                   /transl_table=11
FT                   /locus_tag="CMM_0297"
FT                   /product="putative sugar ABC transporter, permease
FT                   component"
FT                   /function="ABC-type sugar transport systems permease
FT                   components"
FT                   /note="putative sugar ABC transporter, permease component
FT                   (NP_826157.1| putative binding protein-dependent
FT                   transporter [Streptomyces avermitilis MA-4680];;
FT                   NP_533738.1| ABC transporter, membrane spanning protein
FT                   [sugar] [Agrobacterium tumefaciens str. C58]).
FT                   pfam00528,BPD_transp_1, Binding-protein-dependent transport
FT                   system inner membrane component."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0297"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00319"
FT                   /db_xref="GOA:A5CMN3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMN3"
FT                   /protein_id="CAN00319.1"
FT                   /translation="MAIRESSLDEQRPAADPAHPEGGVATTPPSAVRARRRGLGWSGRL
FT                   EVLILVGPALLFFLGFVIYPVVMAAYYGFFSWQGFGPPTVFVGFRNYITILQDPTFHEA
FT                   LMHNAVIVVLSLVLQGPVAILVALLLNRKLRGQSIIRVLIFVPYVISEVVVGTGWSLML
FT                   QGSGALNGFLANIGLADLQQDWLANPDIAIWSLMTIITWKYIGFAVILFLAGLQGIPEE
FT                   LSEAAAIDGASYWQIQRRITLPLLAPTLRIWAFLSIIGSLQLFDLVYIIWGQYISATAG
FT                   TSTMATYLVANGRGSGNYGYGNAVAVVLFLISLVVALIYQRFVLNRDTAGALTGAGRKK
FT                   K"
FT   CDS_pept        358294..359199
FT                   /transl_table=11
FT                   /locus_tag="CMM_0298"
FT                   /product="putative sugar ABC transporter, permease
FT                   component"
FT                   /function="ABC-type sugar transport system permease
FT                   component"
FT                   /note="putative sugar ABC transporter, permease component
FT                   (NP_826158.1| putative binding protein-dependent
FT                   transporter [Streptomyces avermitilis MA-4680];;
FT                   NP_533737.1| ABC transporter, membrane spanning protein
FT                   [sugar] [Agrobacterium tumefaciens str. C58]).
FT                   pfam00528,BPD_transp_1, Binding-protein-dependent transport
FT                   system inner membrane component."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0298"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00320"
FT                   /db_xref="GOA:A5CMN4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMN4"
FT                   /protein_id="CAN00320.1"
FT                   /translation="MTAVTAAPRNADLDPTYSAKAPKPTRAKTPGQGNNPIPYLVAVVL
FT                   IALMLTPVAYIILGGFRTNAQITTDPAGFPSPFQIQNYLDVLGGSMFWRQVGNSLIAAI
FT                   GTTVGAVVLGLMASYVLARYTFFGRGALYALFASGLMFPITVAITPLYIVIRSLGLTNS
FT                   LPGIILPQIAFALPTTIIILVPFLRAIPDEIQEAAFIDGCSRIGFFFRMVVRLSMPGVI
FT                   TVGILAFIGSWNSYLLPLFLLSDASIYTLPLGVQSFSSQYSVDTAKVLAFTSLSMIPAL
FT                   IFFSIFERRIVGGLTGAVKG"
FT   CDS_pept        359196..361577
FT                   /transl_table=11
FT                   /gene="bglX"
FT                   /locus_tag="CMM_0299"
FT                   /product="putative beta-glycosidase"
FT                   /function="Beta-glucosidase-related glycosidases"
FT                   /EC_number="3.2.1.-"
FT                   /note="putative beta-glycosidase, putative xylosidase
FT                   (ZP_00226641.1| COG1472: Beta-glucosidase-related
FT                   glycosidases [Kineococcus radiotolerans SRS30216];; JC7728
FT                   xylan 1,4-beta-xylosidase (EC 3.2.1.37) - Streptomyces
FT                   thermoviolaceus). pfam00933, Glyco_hydro_3, Glycosyl
FT                   hydrolase family 3 N terminal domain.
FT                   pfam01915,Glyco_hydro_3_C, Glycosyl hydrolase family 3 C
FT                   terminal domain."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0299"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00321"
FT                   /db_xref="GOA:A5CMN5"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMN5"
FT                   /protein_id="CAN00321.1"
FT                   /translation="MTGAETTPAPGAVVLPEVSERVRELHARMTLEEKLAQIVGYWVDQ
FT                   GGEVVAPMQGEMATTGRYEEATEHGLGHLTRVYGTRPVDPVERASWLWAEQRRLRTETR
FT                   LGIPALVHEECLTGLAAWQAATFPTPLAWGASFDPGLVEEMAALIGGSMRELGVHQGLA
FT                   PVLDVIRDARWGRVDECIAEDPYVVGTIGTAYVRGLQSAGIHATLKHFVGYSVSQSGRN
FT                   HAPAHVGPRFVEDVLLPPFEMAVLDGGVRSVMNSYAEIDGAPVGATPEYLSDVLRGRWG
FT                   FDGVVVSDYFSVAFLQVMHAVAGDRGEAAELALAAGIDVELPTGDAYLAPLAERIRAGL
FT                   ADESLVDRAVLRVLDEKEELGLLDATFEAPPTSIDLDTPAHRDVARRLAEESVVLLAND
FT                   GTLPLASADRPAPRRIALIGPNADSAEALMGCYSFANHVLAHHPGTPLGFAIPTVAEAL
FT                   RVELPDSELVLVAGAEVEGDDRSGFDAAVDEACRADLAVVVVGDRAGLFGRGTVGEGND
FT                   VESLDLPGVQRELVEAIQATGTPVVMVLLTGRPYAVAWAIEGESAPAAVLQAFFPGEEG
FT                   GSAIAGVLSGRVSPSGRLPVSLPRSAGAQPFSYLHPILGGPSEVTSADPTPVLPFGHGL
FT                   SYTSFARTGLAVAASEVRAGESFTATVEVRNTGDRDGTDVVQLYARDVQGSVTRPVAQL
FT                   LGYLRLDLTAGESARVRFEVPTTRLAFTDPRYRRIVEPGAVELWVGPSSAVRETEAAIE
FT                   IAGPVHHVTIADERYVRTSVEPVGASAGAPAVPERVLEPS"
FT   CDS_pept        complement(361717..362565)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0300"
FT                   /product="putative nucleoside-diphosphate-sugar epimerase"
FT                   /function="Predicted nucleoside-diphosphate-sugar
FT                   epimerases"
FT                   /note="putative nucleoside-diphosphate-sugar epimerase
FT                   (ZP_00227284.1| COG0702: Predicted
FT                   nucleoside-diphosphate-sugar epimerases [Kineococcus
FT                   radiotolerans SRS30216];; NP_822058.1| hypothetical protein
FT                   [Streptomyces avermitilis MA-4680])."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0300"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00322"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMN6"
FT                   /protein_id="CAN00322.1"
FT                   /translation="MIVITGATGALNGATAEHLLRTVPAAGIAVVARDPASARSFADRG
FT                   VEVRRGDYADAASLPTAFAGADRLLLVSASDPGADAVALHRAAVEAATEAGVGRILYTS
FT                   HQGAAPDSPFAPARDHAATEGILAASGIPWTALRNGFYLHSIDLLLGAWRETGVIRVPA
FT                   DGPVSWTSRADAAEGAARILLQDAPADGPVTLTASAAPTMAEVAELASDVAGRPVRLEV
FT                   VDAEDWIAGLVAVGTPAPVARFLLGLPLAAAGGFLAGTDPLLAELLGREPEGVRDHLAR
FT                   G"
FT   CDS_pept        362661..363410
FT                   /transl_table=11
FT                   /locus_tag="CMM_0301"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /function="Transcriptional regulator"
FT                   /note="putative transcriptional regulator, TetR family
FT                   (NP_822057.1| putative TetR-family transcriptional
FT                   regulator [Streptomyces avermitilis MA-4680];; CAE53340.1|
FT                   putative TetR-family transcitpional regulator [Actinoplanes
FT                   teichomyceticus]). pfam00440, TetR_N,Bacterial regulatory
FT                   proteins, tetR family."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0301"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00323"
FT                   /db_xref="GOA:A5CMN7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMN7"
FT                   /protein_id="CAN00323.1"
FT                   /translation="MTTDAPAPDEAAADPRAGTRDRIVDVAADLLRASGRAAVTTRAVS
FT                   EAAGVQAPTIYRLFGDKEGLLDAVAEREMTRFSAAKAEAVRAAAAGAADAVDDLRAGWD
FT                   ATIAFGLANPDLYALMSDPARGPGSPAVRAGVALLEERVHRVALAGRLRVAEPVAVDLL
FT                   HAAATGALLSTIRRPAADRDRVLVDVMREAVLERILTPPPGGRARREPGLVERAVALRA
FT                   HVADADRLSTGERTLLAEWLDRIAAAR"
FT   CDS_pept        complement(363450..364307)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0302"
FT                   /product="putative transcriptional regulator, Cro/CI
FT                   family"
FT                   /function="Predicted transcriptional regulators"
FT                   /note="putative transcriptional regulator, Cro/CI family
FT                   (NP_625190.1| putative DNA-binding protein [Streptomyces
FT                   coelicolor A3(2)];; NP_821830.1| putative DNA-binding
FT                   protein [Streptomyces avermitilis MA-4680]).
FT                   pfam01381,HTH_3, Helix-turn-helix. This large family of DNA
FT                   binding helix-turn helix proteins includes Cro and CI."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0302"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00324"
FT                   /db_xref="GOA:A5CMN8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMN8"
FT                   /protein_id="CAN00324.1"
FT                   /translation="MTEFASVLRSWRERVQPADVGLPAGSHRRTAGLRREELAALAGVS
FT                   VDYVVRLEQGRSVKPSPQMLGALARALRLTEDERDHLHRVAGVAPPGRGEVPRHITPGV
FT                   HRIVDRLGDVPIAVFTATHDMLLWNPLWAALNGDPSTRTGWDRNLVWTYFTQGHAGTDF
FT                   DAVHEEEFARDLAADLRTAVGRYPADRALARLVARLRAEVPEFERRWSEARVAEHRSSR
FT                   KTVTRTAVGPITIDCDTLSVPGSDLRIVVYTAEPGSTDEARLDLLRVTGLQALTTAPVE
FT                   AAGA"
FT   CDS_pept        364409..365089
FT                   /transl_table=11
FT                   /locus_tag="CMM_0303"
FT                   /product="short chain oxidoreductase"
FT                   /function="Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /note="putative short chain dehydrogenase/oxidoreductase
FT                   (ZP_00227716.1| COG1028: Dehydrogenases with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenases) [Kineococcus radiotolerans SRS30216];;
FT                   NP_625189.1| putative short chain oxidoreductase.
FT                   [Streptomyces coelicolor A3(2)]). pfam00106,
FT                   adh_short,short chain dehydrogenase. This family contains a
FT                   wide variety of dehydrogenases."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0303"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00325"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMN9"
FT                   /protein_id="CAN00325.1"
FT                   /translation="MTTTLITGSNRGLGLETARRLVEAGHTVHAGMRDTADGDAARAVG
FT                   AHPVQLDVDDQASVERAIASLPELDVLVNNAGILGTAQGVDDLTPEAMLAVLQTNVVAV
FT                   VRVTQAALPLLRASDAPVIVNVASGVGWPRALRGEDTDERHVLTIPYATSKAALITATV
FT                   QYAKNLPAFRINATDPGYTATDFNGNSGHQTVTEGTDATVAMALVGPDGPTGEFHSRHG
FT                   RIEY"
FT   CDS_pept        365157..365555
FT                   /transl_table=11
FT                   /locus_tag="CMM_0304"
FT                   /product="conserved hypothetical protein"
FT                   /function="unknown"
FT                   /note="conserved hypothetical protein (NP_386041.1|
FT                   CONSERVED HYPOTHETICAL PROTEIN [Sinorhizobium meliloti
FT                   1021];; NP_739257.1| conserved hypothetical protein
FT                   [Corynebacterium efficiens YS-314]). pfam05146, DUF704,Aha1
FT                   domain. The function of this presumed domain is unknown."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0304"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00326"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMP0"
FT                   /protein_id="CAN00326.1"
FT                   /translation="MTWPALHITRSVDADVASVVAVAGDPARLPEWAAGVSSGIRLEGG
FT                   RWLSDSPMGAIEIAFTGPRELGILDHDVTLPDGTVVRNPLRVLPNGGGSEVVFTLFRRP
FT                   GATDVSFAEDAALVAEDLDRLAALVARG"
FT   CDS_pept        365594..366160
FT                   /transl_table=11
FT                   /locus_tag="CMM_0305"
FT                   /function="putative acetyltransferase"
FT                   /note="putative acetyltransferase (ZP_00227803.1| COG1670:
FT                   Acetyltransferases, including N-acetylases of ribosomal
FT                   proteins [Kineococcus radiotolerans SRS30216];;
FT                   NP_600641.1| acetyltransferase [Corynebacterium glutamicum
FT                   ATCC 13032])."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0305"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00327"
FT                   /db_xref="GOA:A5CMP1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMP1"
FT                   /protein_id="CAN00327.1"
FT                   /translation="MPTARLAAPEDRTARLDLHRPSPDDAAEVHAILSDPAVWTHYPSL
FT                   RVTDPAQTDRFLRARTEAWERDGLGTWIVRERHADAVVGFGGCGIAHDAFWNLGYRFSP
FT                   TVHGRGFATEMASRALARARILRPELPIVAYLVAHNRASAAVAEKAGLTLVHRAPDPGN
FT                   PDPGVLRLVYADRALTDAERDATMR"
FT   CDS_pept        366519..367412
FT                   /transl_table=11
FT                   /locus_tag="CMM_0306"
FT                   /product="conserved hypothetical protein"
FT                   /note="Region start changed from 366300 to 366519 (-219
FT                   bases)"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0306"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00328"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMP2"
FT                   /protein_id="CAN00328.1"
FT                   /translation="MSTAADALARLVEGIDRERLGAYGAVVRIGDDDAAHRWRSDDPEN
FT                   LYSVSKGVCALAVGIAVDEGILHLGTRVPELLPGLDLGPGVDEVTVEHLLTMTSGVDFA
FT                   WFGDEPVPGPDLAQAMLGRPSRGRVFQYSDASPYVAMRMLAAAVGDVRDWLLPRLFEPL
FT                   GIDDPQWHRCPLGLIVGGSGLELRTGELARIGRLLRDRGAWDGRQLVSAEWIDRMHGSW
FT                   VGTGADPTTPFARYGLATWDGPGDAWRLDGRYGQYVLVDGSRDAVVTITAHEEERDHRL
FT                   AELAVAAVAEAAPVGG"
FT   CDS_pept        complement(367435..367848)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0307"
FT                   /product="putative sulfurtransferase"
FT                   /function="Rhodanese-related sulfurtransferase"
FT                   /note="putative thiosulfate sulfurtransferase
FT                   (ZP_00227801.1| COG0607: Rhodanese-related
FT                   sulfurtransferase [Kineococcus radiotolerans
FT                   SRS30216];;NP_625584.1| conserved hypothetical protein
FT                   [Streptomyces coelicolor A3(2)]). Catalyzes although with
FT                   low efficiency the sulfur transfer reaction from
FT                   thiosulfate to cyanide (By similarity).
FT                   pfam00581,Rhodanese, Rhodanese-like domain. InterPro:
FT                   Rhodanese/cdc25 fold"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0307"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00329"
FT                   /db_xref="GOA:A5CMP3"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMP3"
FT                   /protein_id="CAN00329.1"
FT                   /translation="MSLSATDFFAAELTYETDPADLAADRANGAAPLVVDVRSDASWAQ
FT                   GRIPGAVHILGVELAARAAAELPDRDARVVVYCWGPGCNGSTRAALTLATLGYTRVQEL
FT                   IGGFEYWAREGFAVVSDAGRTRREPDPLTAPVD"
FT   CDS_pept        368106..369347
FT                   /transl_table=11
FT                   /locus_tag="CMM_0308"
FT                   /product="conserved hypothetical protein"
FT                   /note="conserved hypothetical protein (BAB98631.1|
FT                   Hypothetical protein [Corynebacterium glutamicum ATCC
FT                   13032];; NP_695848.1| hypothetical protein BL0662
FT                   [Bifidobacterium longum NCC2705])."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0308"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00330"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMP4"
FT                   /protein_id="CAN00330.1"
FT                   /translation="MRDSTDNPFSPGSDTVPEVWAGRTEQLGDWRDVVRPRISRGLPER
FT                   GRTILGEPGLGKSSLVRRIAQTAARAGDWVTPQLRIPLGADPLKAVATAVLELADTAGL
FT                   AAARERRIKDAISRVETVAVHGISLTLGGSAAGSGPEPYAALTELVVEVGRAAMRHDHV
FT                   ALIHVDEVQNITDESTLSQLLIALGDANTHEEAVALPGGAKVARSLPIAVYLTGLPDFE
FT                   DRAGAHKGATFARRFRTTVLAAIDDDDIRAALQDFVVPGWEVPDGRGGTRRIRMEADAA
FT                   SAIVDVCRGEPFLFQLAGERAWYAGAGAVITREHVLSGWRGAEREATAHVERILDRLPD
FT                   RERAFVEAMAGLPAEDRTLTRIAAEAGHAKATEAGTTARRLDTVRGIIHRGTAYGFRHR
FT                   AIEAYLTSGWPRIG"
FT   CDS_pept        complement(369387..369920)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0309"
FT                   /product="conserved hypothetical protein"
FT                   /note="conserved hypothetical protein (NP_627216.1|
FT                   hypothetical protein SCE50.21 [Streptomyces coelicolor
FT                   A3(2)];; ZP_00191774.2| COG0529: Adenylylsulfate kinase and
FT                   related kinases [Kineococcus radiotolerans SRS30216]). weak
FT                   similarity to: smart00382, AAA, ATPases associated with a
FT                   variety of cellular activities"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0309"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00331"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMP5"
FT                   /protein_id="CAN00331.1"
FT                   /translation="MDSGSPTQALFLGGRSGVGKTTVAAEVSRILAAADVAHALIEGDA
FT                   LDQAHPEPWRQGIPLAERNLAAIWRNYREAGWTRVIFTNTVSVLELPALTAALGGEVEA
FT                   VGVLLTADDATAAARLAGREIGSGLAEAIGRSAAAAPRLEAGSADAVHRVATDGRTVAE
FT                   IAAEVVALSGWIPD"
FT   CDS_pept        370093..371634
FT                   /transl_table=11
FT                   /gene="abfA1"
FT                   /locus_tag="CMM_0310"
FT                   /function="Alpha-L-arabinofuranosidase"
FT                   /EC_number="3.2.1.55"
FT                   /note="alpha-L-arabinofuranosidase (Arabinosidase)
FT                   (ZP_00121523.2| COG3534: Alpha-L-arabinofuranosidase
FT                   [Bifidobacterium longum DJO10A];; NP_626674.1|
FT                   alpha-L-arabinofuranosidase [Streptomyces coelicolor
FT                   A3(2)]). ,pfam03662, Glyco_hydro_79n, Glycosyl hydrolase
FT                   family 79,N-terminal domain. , pfam06964, Alpha-L-AF_C,
FT                   Alpha-L-arabinofuranosidase C-terminus.This catalyses the
FT                   hydrolysis of nonreducing terminal
FT                   alpha-L-arabinofuranosidic linkages in
FT                   L-arabinose-containing polysaccharides."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0310"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00332"
FT                   /db_xref="GOA:A5CMP6"
FT                   /db_xref="InterPro:IPR010720"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMP6"
FT                   /protein_id="CAN00332.1"
FT                   /translation="MTDAPSTTDAFPSADARIAIDRTAVVAPVNRRTFGSFVEHLGRCV
FT                   YDGIYEPGHPTANADGFRLDVVDLVKELGSSTIRYPGGNFVSGYRWEDGVGPRAERPKR
FT                   LDLAWHSLETNEVGLDEFARWCELTGSELMMAVNLGTRGVLEALDILEYSNHPGGTALS
FT                   DQRIANGSPEPHNVKMWCLGNEMDGPWQVGHMTADDYGKLANRTAGAMKMVDPTLELVA
FT                   CGSSGSGMPTFGEWERTVLEHAYDNVDFISAHAYYQERRGDLGSFLASSLDMEYFIRTV
FT                   VASADQVKYRRKSDKTINISFDEWNVWYLDEHQESGVITEGWPYAPHLLEDVYSVADAV
FT                   VLGNLMITLLKHSDRVTSASLAQLVNVIAPIMTETGGGAWRQTTFFPFSVTSRLAQGEV
FT                   LRPRIDVGTYETEVHGTAPLVDSVATFDEATGRAAVFLVNRSLSDALTIEVDVAGLAVS
FT                   EVLEAVGIHDADVYAKNTFEDRERVGLTPNASATLVDGTLTITLPPVSWTAVSLG"
FT   CDS_pept        complement(371722..371940)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0311"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein (NP_626168.1| hypothetical
FT                   hydrophilic protein [Streptomyces coelicolor A3(2)];;
FT                   NP_845828.1| conserved hypothetical protein [Bacillus
FT                   anthracis str. Ames])."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0311"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00333"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMP7"
FT                   /protein_id="CAN00333.1"
FT                   /translation="MGTPPDGFEYVVRGDDVVIRHHGRVASTLRGSAARRFLAQVEAGD
FT                   AQQIMARATGDYKRGNERTARQRSRRA"
FT   CDS_pept        complement(372277..372867)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0312"
FT                   /product="putative acetyltransferase"
FT                   /function="Acetyltransferases"
FT                   /note="putative acetyltransferase (ZP_00184424.1| COG1670:
FT                   Acetyltransferases, including N-acetylases of ribosomal
FT                   proteins [Exiguobacterium sp. 255-15];; NP_626962.1|
FT                   putative acetyltransferase [Streptomyces coelicolor
FT                   A3(2)]). pfam00583, Acetyltransf_1, Acetyltransferase
FT                   (GNAT) family. This family contains proteins with
FT                   N-acetyltransferase functions."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0312"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00334"
FT                   /db_xref="GOA:A5CMP8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMP8"
FT                   /protein_id="CAN00334.1"
FT                   /translation="MSAEPRLFPAVPRLEGERVILRPFSPADVDAMGPVLADPDVIRLT
FT                   GSAHTTAEVAEIAARTTLDDRTRTWYATRADQPDRLDLALVDRATDACVGEAVINEWSP
FT                   EDRSANLRILIGPAGRDRGLGSEAVRMLVDHAFAATDLERISLEVMDFNPRARRVYERA
FT                   GFVEEGRLRGSFRFDGEPVDVIVMALLRSDPRP"
FT   CDS_pept        complement(372914..373255)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0313"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein (NP_825872.1| putative
FT                   Lsr2-like protein [Streptomyces avermitilis MA-4680];;
FT                   ZP_00293146.1| hypothetical protein Tfus02001333
FT                   [Thermobifida fusca])."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0313"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00335"
FT                   /db_xref="InterPro:IPR024412"
FT                   /db_xref="InterPro:IPR042261"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMP9"
FT                   /protein_id="CAN00335.1"
FT                   /translation="MTDDVDPRDDTTDSATEAVCFGLDGIVHEINLDPAGARALRAALA
FT                   PYVAAGRRTTVTITPIRDEPARASGAGAAPTGERAAARAWLEANGHKLGPGGRISATLM
FT                   TLYRGRDGR"
FT   CDS_pept        373355..374428
FT                   /transl_table=11
FT                   /locus_tag="CMM_0314"
FT                   /product="conserved hypothetical protein"
FT                   /function="Putative GTPases (G3E family)"
FT                   /note="conserved hypothetical protein, putative GTPase
FT                   (NP_962706.1| hypothetical protein MAP3772c [Mycobacterium
FT                   avium subsp. paratuberculosis str. k10];; ZP_00173773.1|
FT                   COG0523: Putative GTPases (G3E family) [Methylobacillus
FT                   flagellatus KT]). pfam02492, cobW, Cobalamin synthesis
FT                   protein/P47K."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0314"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00336"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMQ0"
FT                   /protein_id="CAN00336.1"
FT                   /translation="MDPHANARPSVVRGGLAVTLVSASDLGAASRVAAAAVGAPASAAP
FT                   AVVEAPGGDSGDLGADLADGLIADVDDGRRGLAVVALEPAADPLEVALVLEHVVEARHP
FT                   GSTPIGILDVVAVSSVAEIRELLLEPGDTDTTPFDAAERLAGRLECASVVVLDDLDPDR
FT                   PTPDARRAVALLAHLAPDARVVATADRASLAPAPLRIGRGRARGLAAGMGWQVALAGEA
FT                   APTSTDGMGVHVFRDPRPFHPGRLHAAVAHDLVPGPVGRIVRSRGLVRLATRPATVGAW
FT                   ATAGDVLSLDPTAMRSWDADSPAGQEIAFVGEHLDGELLDRILGACLLAPAELVAGPDA
FT                   WHGYADPFPVWDTEHRH"
FT   CDS_pept        374511..375521
FT                   /transl_table=11
FT                   /locus_tag="CMM_0315"
FT                   /product="putative thioredoxin reductase"
FT                   /function="Thioredoxin reductase"
FT                   /note="putative thioredoxin reductase (ZP_00217649.1|
FT                   COG0492: Thioredoxin reductase [Burkholderia cepacia
FT                   R18194];; NP_639620.1| putative oxidoreductase
FT                   [Streptomyces coelicolor A3(2)]). pfam00070,
FT                   Pyr_redox,Pyridine nucleotide-disulphide oxidoreductase.
FT                   This family includes both class I and class II
FT                   oxidoreductases and also NADH oxidases and peroxidases.
FT                   InterPro: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0315"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00337"
FT                   /db_xref="GOA:A5CMQ1"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMQ1"
FT                   /protein_id="CAN00337.1"
FT                   /translation="MEITQGIDGRHEWDAVVIGGGAAGSSAALMLVRARRSVLMVDAGQ
FT                   PRNAVAAHMHGVLGHDGKPPRQLVAEGRREIEGYGGVVVDGRVERVAALDDPDGPRFRL
FT                   TLDGGAAVTARRVILATGLADVLPEVPGLAAHWGAGVVVCPYCDGYEVRDRRIGVLATG
FT                   PGSLHHVQMLRQWSADVTFLVAGGTADGAPLEIDAATRAGLDARGIRVEESAVVRALGE
FT                   RGALEGVELADGRTLPLDALFAIPGVAPRDGIARALGAATEDTPWGPFVAADPMGQTSV
FT                   PGLLIAGNASSGSANVPVAMAAGTMAGAMANAGMVTEDVAMAVALADAPTPAVGR"
FT   CDS_pept        375588..377780
FT                   /transl_table=11
FT                   /gene="clpY"
FT                   /locus_tag="CMM_0316"
FT                   /product="ATPase with chaperone activity, ATP-binding
FT                   subunit"
FT                   /function="ATPases with chaperone activity ATP-binding
FT                   subunit"
FT                   /note="putative ATP-dependant protease, ATPase subunit
FT                   (ZP_00225929.1| COG0542: ATPases with chaperone
FT                   activity,ATP-binding subunit [Kineococcus radiotolerans
FT                   SRS30216];; YP_056693.1| ATP-dependent protease (Clp
FT                   chaperone) [Propionibacterium acnes KPA171202]). pfam00004,
FT                   AAA,ATPase family associated with various cellular
FT                   activities (AAA) (twice). clpX: ATP-dependent Clp protease
FT                   ATP"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0316"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00338"
FT                   /db_xref="GOA:A5CMQ2"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMQ2"
FT                   /protein_id="CAN00338.1"
FT                   /translation="MANMQGAPATDENAKTALEQYGVNLTEIAKSGKLDPVIGRDAEIR
FT                   RISQVLTRRTKNNPVLIGEPGVGKTAVVEGLAQRIVAGDVADSLKGKQLVSLDLAALVA
FT                   GAKYRGEFEERLKAVLKEIDDADGEVITFVDELHTLMGAGGGEGSVAASNMLKPMLARG
FT                   ELRLIGATTLDEYRQYIEKDAALERRFQQVYVGEPSVEDTVAILRGLKGRYEAHHQVPI
FT                   TDAALVAAASLSNRYIPARQLPDKAIDLIDEAASRLRMEIDSSPVEIDELRRAVDRMRL
FT                   EELALKREKDEASKARLAKLREDVAAREQTLGELQRRWEAERASVNRVGKLKDELNELR
FT                   IRAERAQREGNLEKASRLLYGEIPVIEREVAQAEAAESVPSAEDRMVNEQVTAEDVAAV
FT                   VAAWTGIPVGRLLQGETEKLLHLEQELGKRLIGQKQAVRAVADAVRRTRAGISDPDRPT
FT                   GSFLFLGPTGVGKTELAKALAEFLFDDEKAMVRIDMSEYGEKFAVSRLVGAPPGYVGYE
FT                   QGGQLTEAVRRRPYSVVLLDEVEKAHPEVFDVLLQVLDDGRLTDGQGRTVDFRNVILVL
FT                   TSNLGSQFISDATLPLDQREQAVQQLVRQTFKPEFVNRLDDIVVFQTLSMDDLAQIVEL
FT                   YIDRLGVRLSDRRLSLGVTPDARRWLAERGHDPLYGARPLRRLMQREIDDRLARELLAG
FT                   DIRDGDAVRVDLAPDGDGLTVSRAWSDEPEDQAPGA"
FT   CDS_pept        complement(377847..380030)
FT                   /transl_table=11
FT                   /gene="agaA"
FT                   /locus_tag="CMM_0317"
FT                   /function="Alpha-galactosidase"
FT                   /EC_number="3.2.1.22"
FT                   /note="alpha-galactosidase (Melibiase)(ZP_00226650.1|
FT                   COG3345: Alpha-galactosidase [Kineococcus radiotolerans
FT                   SRS30216];; AAD30994.2| alpha-galactosidase
FT                   [Bifidobacterium adolescentis]). pfam02065,
FT                   Melibiase,Melibiase."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0317"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00339"
FT                   /db_xref="GOA:A5CMQ3"
FT                   /db_xref="InterPro:IPR000111"
FT                   /db_xref="InterPro:IPR002252"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031704"
FT                   /db_xref="InterPro:IPR038417"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMQ3"
FT                   /protein_id="CAN00339.1"
FT                   /translation="MPDTAVPSALLHLRASGVSLVLDLTEGRLPAVVHWGADLGDTTAA
FT                   DLATLALAAVEPIAGSVADDPIRLAILPEAHTSWTGKPGLEGHRDGADWSPLFRVASAT
FT                   VDGDPLPAGADGRPGSASTGPALVHVDAVDEVAGLGLALDVELLASGLVRTRAEVTNTG
FT                   EGTYSVGGVTLALPLPAEAREILDFAGRWGLERTPQRRELVVGIHEREGRKGRTGPDAA
FT                   TLLSVGTPGFGFRQGEVRGVHVAFSGNHRHYAERLSTGRQVIGGGELLLPGEVRLARGE
FT                   SYASPWVYAAYGDGLDDQASRFHRHLRARDTHPRRDRPMTINVWEAVYFDHDLARLTDL
FT                   ADRAAALGVERYVLDDGWFRHRRDDHAGLGDWYVDEGVWPDGLGPIIDHVTGLGMEFGI
FT                   WFEPEMVNEDSDLARAHPEWIMATGGRLPVRARDQQVLDLAIPEAYAHVLERMTAILSE
FT                   NDIAYIKWDHNRDLVDAGISPRGEAGVHLQTIAAYRLMDELKARFPGLEIESCSSGGSR
FT                   VDLGVLERTDLVWVSDCIDPLDRQTMMRWTMQLLPPELMGSHIASGVSHTTGRAHRLAF
FT                   RAGSALYGHLGIEWDLAQATDEENADLAAWIALYKEERALMHTGTVVRADESDPTLLVY
FT                   GAVASDAASALFFLASIGRSEVSPRGRFLLPGLDPARRYRVEPVRIGTPEPGFAAPAWW
FT                   DGVELTGRALAASGLHAPLMLPESIAILRVTAV"
FT   CDS_pept        380141..380620
FT                   /transl_table=11
FT                   /locus_tag="CMM_0318"
FT                   /product="putative transcriptional regulator"
FT                   /function="Transcriptional regulator"
FT                   /note="putative transcriptional regulator (only weak
FT                   similarity, ZP_00199538.1| COG1309: Transcriptional
FT                   regulator [Kineococcus radiotolerans SRS30216];;
FT                   NP_624573.1| putative transcriptional regulator
FT                   [Streptomyces coelicolor A3(2)])."
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0318"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00340"
FT                   /db_xref="InterPro:IPR041483"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMQ4"
FT                   /protein_id="CAN00340.1"
FT                   /translation="MELLDVFLGDWLTALSAELDAGVDARRGSEVRARQLADVLAGSLA
FT                   GRGVLCDLFGAQGGVLEHDVSVEVVTRHKRASLARLTTATDLVRRHVPELGDGAQSFCL
FT                   MSLVTARALASYVPPPASLIAAYAEDPALGVLHFDFRHALRDAFTASLLGALPRA"
FT   CDS_pept        complement(380682..381347)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0319"
FT                   /product="conserved hypothetical protein"
FT                   /note="conserved hypothetical protein (ZP_00199464.2|
FT                   hypothetical protein Krad06000208 [Kineococcus
FT                   radiotolerans SRS30216];; NP_216552.1| hypothetical protein
FT                   Rv2036 [Mycobacterium tuberculosis H37Rv];; NP_630338.1|
FT                   conserved hypothetical protein SCAH10.03 [Streptomyces
FT                   coelicolor A3(2)])."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0319"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00341"
FT                   /db_xref="GOA:A5CMQ5"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMQ5"
FT                   /protein_id="CAN00341.1"
FT                   /translation="MVVWPMSSRERAAIWTAVHDERRSLSADLSTIPAEGWAVGSLCAG
FT                   WDVHDVVAHLIDSAATTRWGFARRMVAARFDFDRDNAVGVERERRMSPAKTLAEFDRVA
FT                   PWTRTPPAALASRLVEAVVHAEDVRRPLGVRRDYPLGHVLPALTHQLRTSGAMGGGRDR
FT                   AAGLRLIADDADLSWGGGPEVHGSALALLMAVSGRPVAPGELSGPGARDLAQRVSPTG"
FT   CDS_pept        complement(381414..381764)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0320"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00342"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMQ6"
FT                   /protein_id="CAN00342.1"
FT                   /translation="MHTIRYADGRYLTGDDIARAVVECARALAREGTAAESVTVPVWLP
FT                   EGGVGSVAILIGPASQIVVEPAGPAEDELRDPEAVDRIRALTVRPRQSQSSTSVSADRQ
FT                   DGMAVPGLEDLD"
FT   CDS_pept        381880..382884
FT                   /transl_table=11
FT                   /locus_tag="CMM_0321"
FT                   /product="putative oxidoreductase"
FT                   /function="Predicted oxidoreductases (related to
FT                   aryl-alcohol dehydrogenases)"
FT                   /note="putative oxidoreductase (ZP_00225711.1| COG0667:
FT                   Predicted oxidoreductases (related to aryl-alcohol
FT                   dehydrogenases) [Kineococcus radiotolerans SRS30216];;
FT                   ZP_00292358.1| COG0667: Predicted oxidoreductases (related
FT                   to aryl-alcohol dehydrogenases) [Thermobifida fusca]).
FT                   pfam00248, Aldo_ket_red, Aldo/keto reductase family. This
FT                   family includes a number of K+ ion channel beta chain
FT                   regulatory domains - these are reported to have
FT                   oxidoreductase activity."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0321"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00343"
FT                   /db_xref="InterPro:IPR005399"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMQ7"
FT                   /protein_id="CAN00343.1"
FT                   /translation="MTYVAHPDRYSSMPYRRSGRSGLKLPELSLGLWHNFGTARPIDTQ
FT                   RAIVRRAFDLGITHFDLANNYGPPPGSAETAFGRILAEDLRPYRDEIVISSKAGYLMWD
FT                   GPYGEWGSRKSMLASLDQSLGRMGLEYVDVFYSHRPDPETPIEETMGALATAVHQGKAL
FT                   YAGISNYSPEQTERAVAALAEHKVPLTIHQPSYSMFNRHVEGGLLPVLEEAGSGCIVFS
FT                   PLAQGLLTDRYLSGSIPADSRAATSGFLDESAVSSVYLERARGLQAVAEGRGQTLAQLA
FT                   LSWVLRHPGITSALIGASSVEQLEQNVAAAGAAPLTDDELAAIEPFAVDGTGR"
FT   CDS_pept        382892..384100
FT                   /transl_table=11
FT                   /locus_tag="CMM_0322"
FT                   /product="putative dipeptidase"
FT                   /function="Zn-dependent dipeptidase microsomal dipeptidase
FT                   homolog"
FT                   /note="putative dipeptidase (NP_826200.1| putative
FT                   dipeptidase [Streptomyces avermitilis MA-4680];;
FT                   ZP_00191103.2| COG2355: Zn-dependent dipeptidase,microsomal
FT                   dipeptidase homolog [Kineococcus radiotolerans SRS30216]).
FT                   pfam01244, Renal_dipeptase, Renal dipeptidase."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0322"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00344"
FT                   /db_xref="GOA:A5CMQ8"
FT                   /db_xref="InterPro:IPR008257"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMQ8"
FT                   /protein_id="CAN00344.1"
FT                   /translation="MTDSPAPSPALADRVARLLDVQGIVDGHDDLAWALRERAVREGGP
FT                   SASVGDDVIARLAIEDAVPGLHTDLPRLARGRVAAQFWSVWVPDLPGVDPVRSTIEQID
FT                   VVRRLVAAHPDRLALAVTADDVERVVASGRIASLMGMEGGHSIGGSLGALRTMRALGVR
FT                   YMTLTHNANVAWADSATDAPVHHGLSAAGERVVAEMERIGMLVDLSHVSADVMRHALRI
FT                   ARRPVLFSHSGARAECDVPRNVPDDVLATLPANGGVCMATFVPQFVSPAVAAWHDETLA
FT                   LAVAEGVHPRDHEGVQAVAARRPGERPRATLADVVRHVERIREVAGPRHVGLGGDYDGV
FT                   DRTPDGLEDVSRYPALIAALAGRGWSDDDLRALAGGNALRVLRAADADDDVSRGAADAW
FT                   ALA"
FT   CDS_pept        384097..384960
FT                   /transl_table=11
FT                   /locus_tag="CMM_0323"
FT                   /product="putative acetyltransferase, GnaT family"
FT                   /function="Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /note="putative acetyltransferase, GnaT family
FT                   (NP_629283.1| hypothetical protein [Streptomyces coelicolor
FT                   A3(2)];; AAB84468.1| putative acetyl transferase [Bacillus
FT                   subtilis]). pfam00583,Acetyltransf_1, Acetyltransferase
FT                   (GNAT) family. This family contains proteins with
FT                   N-acetyltransferase functions. InterPro: GCN5-related
FT                   N-acetyltransferase pfam00583, Acetyltransf_1,
FT                   Acetyltransferase (GNAT) family. This family contains
FT                   proteins with N-acetyltransferase functions."
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0323"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00345"
FT                   /db_xref="GOA:A5CMQ9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMQ9"
FT                   /protein_id="CAN00345.1"
FT                   /translation="MSGGSDAGSEAAAVRAMDPRAAAALLDDLADRGWPAETRELHGRW
FT                   ILRAAGGVTKRANSALPAGPVADPDAALDAAEAFARHHGIDPCVQVSPASEPADLASRL
FT                   AARGYVAEARTLVEVADAAAVAERLAGARPADPALVVTVADAPDDAWLDAWWSVDGRGG
FT                   SAELAVARRILERGPSVYAAVRDGDGDRVLATARLALVGSWGGLFAVATRPEARRRGLS
FT                   RAAMAAAVDAGLDRGITALWLQVVAENDGARALYGGLGFATASRYEYWARTRQPSAATT
FT                   SARNPA"
FT   CDS_pept        complement(384894..386636)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0324"
FT                   /product="putative ABC transporter (fused permease/ATPase)"
FT                   /function="ABC-type multidrug transport system ATPase and
FT                   permease components"
FT                   /note="putative ABC transporter (fused permease/ATPase)
FT                   (NP_631729.1| putative ABC transporter ATP-binding protein
FT                   [Streptomyces coelicolor A3(2)];; AAN77618.1| putative ABC
FT                   transporter [Mycobacterium avium subsp. paratuberculosis]).
FT                   putative exporter of siderophore/antibiotic."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0324"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00346"
FT                   /db_xref="GOA:A5CMR0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMR0"
FT                   /protein_id="CAN00346.1"
FT                   /translation="MRAIDDARRTLGPEGERELRPVVARMAAASVLHGAAVVALVPVLE
FT                   RLFGPDPASAWPWIALFLLLAAAHLAVQARAQSAAFGAGVRAANALHHRIGDHVVRLPL
FT                   AWFDATHRAELTAAAGGSVLASMGVPAYLLRPLITATVVPAVIAASLLVLDPPLGVALL
FT                   LLAPVLVLALRVGGRIAARADAERAAADTGIGERVVEFAQAQHVLRAHGRTGRDAGLVD
FT                   AILVRHRAASRALIGRTVAGLVAFGAVMRVVLVAALAIAATRVLGGPVDPGRTVATLVL
FT                   VFHAADIVGQAAELGVGVRAARRDLGAVARILDAAPIPEPQPGATRVPDGADVELDGVS
FT                   FSYPGSATEAVSGLDAALPVGRMTALVGPSGSGKTTVARLIARAADVTGGAVRIGGVDV
FT                   RDMAQADVAAHVSTVFQDVHLLAGTLGDNVRIADPDADDAAVADALRRAGLPLGDGLDL
FT                   DTPVGEGGRQLSGGQRQRVSIARVLLKDAPVVVLDEATAALDAESAAAVAEAIRLLRGH
FT                   RTLLVIAHRLDTVRSADEILVLDGGRLVQRGTHDELAGQPGVYAGFLADVVAADGWRVR
FT                   AQYS"
FT   CDS_pept        complement(386636..388456)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0325"
FT                   /product="putative ABC transporter (fused permease/ATPase)"
FT                   /function="ABC-type multidrug transport system ATPase and
FT                   permease components"
FT                   /note="putative ABC transporter (fused permease/ATPase)
FT                   (NP_631728.1| putative ABC transporter ATP-binding protein
FT                   [Streptomyces coelicolor A3(2)];; ZP_00267801.1| COG1132:
FT                   ABC-type multidrug transport system, ATPase and permease
FT                   components [Rhodospirillum rubrum]). putative exporter of
FT                   siderophore/antibiotic."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0325"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00347"
FT                   /db_xref="GOA:A5CMR1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMR1"
FT                   /protein_id="CAN00347.1"
FT                   /translation="MTDAADATDAADATDPPATVAGAVRAVRGRLAAAVLLQAAASASG
FT                   LVAVVAVAEIGRAAVADPGGPPAWGGVMLAVVAGIAGLLLAASADTLTHLADADLQLDL
FT                   RRLVVARLGLVPLAWFDDHDAGEVRQAVQQDVAALHALVAHTLLDVTRLVVVTVASLVY
FT                   LLALDVPLALVCLLPLVAGVVLFARAMAGAMSSMAEYGRASAEIAGSVVEFADGIQVVR
FT                   SFGRPGRAHSRYLRAVDAFAAFFGAWVARTTAATTASWLTVSPIGVLALVVPVGGAMVA
FT                   SGALPAADLAPFLLLAPAMAAPVGVIGPRAQAIRGAVDAARAVDEVLRAPVEPDVAEPR
FT                   EPDARHVAGLVLRGVCFSYDGERDALRDVDLELSPGSVTAVVGPSGSGKSTLAALVARL
FT                   RLPTRGTLELGGVDVRDATPSAWHAQVGCVLQDTVLLRDTALENLRLGRPDASLDEVRA
FT                   AARIAQVDDVIDGLPDGYGTVLDPRGGLSGGEAQRVALARALVADCPVLVLDEPMAHAD
FT                   PSTAARMQRALASATRGRTVLVVAHRLETVEHADRIVVMEAGRVAEQGTHAELLARDGL
FT                   YARLLRAGATATGPAPAPAPAPGETHEEVR"
FT   CDS_pept        complement(388453..389223)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0326"
FT                   /function="putative methyltransferase"
FT                   /note="putative methyltransferase (NP_631727.1| conserved
FT                   hypothetical protein [Streptomyces coelicolor A3(2)];;
FT                   NP_962672.1| hypothetical protein MAP3738c [Mycobacterium
FT                   avium subsp. paratuberculosis str. k10]). PUTATIVELY
FT                   INVOLVED IN METHYLATION OF SIDEROPHORE/ANTIBIOTIC."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0326"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00348"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMR2"
FT                   /protein_id="CAN00348.1"
FT                   /translation="MTLDLQDYSPGAEFYDLVARRHTEALAGVLAEALAVVPAGAAAGP
FT                   AADDAADPGTVVELGAGTGRVTRLLAHLVPRSPILAAEPSPVMRAVLRSRVHEDPDLRR
FT                   RVTIRPETAQELALPERIRAVVLIGVAGHLGSDARADLWRRCLERLVPGGVIVVDLMGT
FT                   SARSLPATRLLRERIGTQAYEWWTTAEPGRDGATRFTTRWLVLDGARTVREVRGGYEWH
FT                   SLDQATLAREAGRSWTVLRGGAEEAATEVAVLGR"
FT   CDS_pept        complement(389220..390032)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0327"
FT                   /product="putative thioesterase"
FT                   /function="Predicted thioesterase involved in non-ribosomal
FT                   peptide biosynthesis"
FT                   /EC_number="3.1.2.-"
FT                   /note="putative thioesterase (NP_821582.1| putative
FT                   thioesterase [Streptomyces avermitilis MA-4680];; S49055
FT                   thioesterase - Streptomyces fradiae (strain T59235)).
FT                   pfam00975, Thioesterase, Thioesterase domain. Peptide
FT                   synthetases are involved in the non-ribosomal synthesis of
FT                   peptide antibiotics. Next to the operons encoding these
FT                   enzymes, in almost all cases, are genes that encode
FT                   proteins that have similarity to the type II fatty acid
FT                   thioesterases of vertebrates."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0327"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00349"
FT                   /db_xref="GOA:A5CMR3"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR012223"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMR3"
FT                   /protein_id="CAN00349.1"
FT                   /translation="MIETPRDEGGWLRRIAAAPDARIRLVCLPHAGGAASAYRGWAPFA
FT                   PRGVEVLAVQYPGRGDRYGDPLSPDLDTLAADVAAAVDALPERLPVVLFGHSMGALVAY
FT                   ETARVLAARGRPAARLVVSGRRAPTVRWGGTLHRQDDAALLADLERHSGTAPEILADDD
FT                   MRRTVLACLRDDYRLVETHRTAPGPGTGCPVSVFSGDADPELRPAEAEAWHRLGDGDGD
FT                   GDAGGTGLRVFRGGHFYLAERPAEVVEAIASLLDPALAFPAPAEAMFP"
FT   CDS_pept        complement(390130..392058)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0328"
FT                   /product="putative oxidoreductase/methylase"
FT                   /function="Oxidoreductase (NAD-binding) involved in
FT                   siderophore biosynthesis"
FT                   /note="putative oxidoreductase/methylase (NP_631724.1|
FT                   conserved hypothetical protein [Streptomyces coelicolor
FT                   A3(2)];; NP_404400.1| conserved hypothetical protein
FT                   [Yersinia pestis];; NP_631727.1| conserved hypothetical
FT                   protein [Streptomyces coelicolor A3(2)]). two domains:
FT                   N-terminal (COG4693, PchG, Oxidoreductase
FT                   (NAD-binding),involved in siderophore biosynthesis;
FT                   pfam07414, YbtU,Yersiniabactin synthetase thiazolinyl
FT                   reductase component YbtU. This family represents the
FT                   thiazolinyl reductase component YbtU (approximately 350
FT                   residues long) of the bacterial four-protein yersiniabactin
FT                   synthetase complex.). C-terminal putative
FT                   methylase(COG2242, CobL,Precorrin-6B methylase 2,COG2226,
FT                   UbiE, Methylase involved in ubiquinone/menaquinone
FT                   biosynthesis; pfam00891,Methyltransf_2,
FT                   O-methyltransferase. This family includes a range of
FT                   O-methyltransferases. These enzymes utilise S-adenosyl
FT                   methionine.). putatively involved in the modification of a
FT                   siderophore/antibiotic."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0328"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00350"
FT                   /db_xref="GOA:A5CMR4"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR010091"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMR4"
FT                   /protein_id="CAN00350.1"
FT                   /translation="MTGDAADRPLRVVVCGTGFGRIHLRAVGLVPGLRLAGVLARGGDA
FT                   SRALAAEHGVPLWTDVAELPADVDVASVAVGSAVQGGPGSELVLALLARGIHVLQEHPA
FT                   HPDEITAAARAARTAGVRYRLSTHYRHVRATRGFLASAERLRARSPIVHVDAAGPVHLL
FT                   QPLVDILGLAVGGLRPWAFTDPVERPRELTALEARPSPLTAIEGVVGGIALSLRVHDEL
FT                   HPADRDNHALLWPRIALASEAGVLTLADVHGPVTWSPALHTRRDAAGRLDLDGDPARRA
FT                   LPRLSSWPDAPAPTAGDLFDDVWPDAVAHALTQLVAEIRSGDGDALRAAQADITMARAW
FT                   VDLIRRLGPPRSIRPGEPPRVTAAAILPAAEAAPAGGHGASGPAADPGPGDPAPADPYG
FT                   PAAELFDLAAAEHAELTAAAVCRLLDGRDLSAAPVLDIGAGTGVIARAVARAHPEALVV
FT                   AAEPSEPLRAVLTARILDAPGLQERVTVTAGSAPDLDLPDRISAVLLCGVLGHLDAGQR
FT                   ARLWERIAERLLPGGLVVVETMGLEPGARVPESRLARTRVGDDEVEWWFRADPAPGGML
FT                   DLRTRWRSREPGGREREVHDAYSWDPVGLEELAREAGMDLVRLPAAAGASLPLGALVPR
FT                   PADPPAG"
FT   CDS_pept        complement(392055..393200)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0329"
FT                   /product="putative dehydrogenase, iron-regulated protein"
FT                   /note="putative dehydrogenase, iron-regulated protein
FT                   (NP_631723.1| conserved hypothetical protein [Streptomyces
FT                   coelicolor A3(2)];; NP_962677.1| hypothetical protein
FT                   MAP3743 [Mycobacterium avium subsp. paratuberculosis str.
FT                   k10]). putatively involved in the modification of a
FT                   siderophore/antibiotic. weak similarity to: COG1748,
FT                   LYS9,Saccharopine dehydrogenase and related proteins [Amino
FT                   acid transport and metabolism];; pfam03435,
FT                   Saccharop_dh,Saccharopine dehydrogenase."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0329"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00351"
FT                   /db_xref="GOA:A5CMR5"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMR5"
FT                   /protein_id="CAN00351.1"
FT                   /translation="MIAVIGASGAVGRPAVLALRAASDEPLRLGGRREAPLRELADEVG
FT                   GRVETVTVDLMDDDALARFCRGADVVVHCAAPAFAFGDRITAAALAAGADYVDVCGEEP
FT                   VRAGLVARGLAADAVRDGRRAVVSTGVVPGLSGLLPRLAAEGLRGPLRLRGWVGGVEAC
FT                   SPGVALDVPLSLAAGGPGSTAYGTPLAAWTGGRRVERALRAEEDATAPFFAGRVALQPY
FT                   LSAETERIARGRGFADARWWNVHPGPAVRDALNRLPALLAGEDGAAAAADALIRAGDLD
FT                   LLGNRPFHVLAVSVDGTDDEGAPVERAIVLHSDDSYVLAGRLAAITVREIRAGAVPPGV
FT                   GFAHDVLDPQRVLDLVVASGASTVTRIDDAGDAGEMVEEDL"
FT   CDS_pept        complement(393197..398776)
FT                   /transl_table=11
FT                   /gene="npsB"
FT                   /locus_tag="CMM_0330"
FT                   /product="non-ribosomal peptide synthetase"
FT                   /function="Non-ribosomal peptide synthetase modules and
FT                   related proteins"
FT                   /note="non-ribosomal peptide syntethase (NP_631722.1|
FT                   putative non-ribosomal peptide synthase [Streptomyces
FT                   coelicolor A3(2)];; NP_252915.1| pyochelin synthetase
FT                   [Pseudomonas aeruginosa PA01]). putatively involved in the
FT                   biosynthesis of a catecholate siderophore/antibiotic.
FT                   pfam00668, Condensation, Condensation domain.
FT                   pfam00501,AMP-binding, AMP-binding enzyme.
FT                   pfam01209,Ubie_methyltran, ubiE/COQ5 methyltransferase
FT                   family. pfam00550, PP-binding, Phosphopantetheine
FT                   attachment site. pfam00975, Thioesterase, Thioesterase
FT                   domain."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0330"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00352"
FT                   /db_xref="GOA:A5CMR6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR041464"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMR6"
FT                   /protein_id="CAN00352.1"
FT                   /translation="MNAEQLIDDLDARGVRLWAEDGRIRFRGPRGVIDDDRRELIRRHR
FT                   DEVLAILGRRDASGTDAADPAAADHAAAHDPFPLTPVQTAYLLGRTDAYPYGGVACSAD
FT                   LDLSWPASTDPARIVDAWIRLVAHHGMLRAEVHPDGSQRVLADPGPVEVPVDDLRGLGP
FT                   ASIGHRIDAVRADLAQGTGRDPGWPRVRAVVTRADDAVRLHLAVDLLVLDHASLQLVLD
FT                   QLRALVEDPAAALPGSPDGPGFRDRVLARRALTASAAYERDRSYWWRRLDDLPPAPELP
FT                   LADHDPMAAPVRFRRLSAVLDPASAARLDRAAADAGVTPTSALLAAYAETVGRWSRSPR
FT                   FVLNVPVSDRRGLPEAAEQVMGDFTSVELLEVDLTEDVPAVERMRALSARLLEDLAHPL
FT                   CGGTELLAELTRRRGGDARDVALAPVVFTSALAGDAASAPAGDGGRITAAVTRTPQVWI
FT                   DCQALRVPDGLQLSWDVREGILADGVADAAFGAYIGAVRALADDPAAWQLPCAVDLPAD
FT                   QRERRIRVGETGDPVAPALVHEPLLAAAEAAPDAPAVIAPDRTLTHDELVRRAAAVAAR
FT                   LRSTGMRRGDRVAIVAARGWEQVVAVVGVLLAGGAYVPVDVAQPRIRRDTVLADAGIRQ
FT                   VLTQEALVGAPADWPTGVERIAVDALEPAASRPTPDADRDGVDPADPAYVIYTSGSTGT
FT                   PKGAILSHHAAHNTLVDIRERFGVGPDDRVLALAGLGFDLSVFDVLGVLGAGGAMVLPD
FT                   PRRRDDPSHWAALIARHRVTLWNSVPAQARMLQDYRDAVAATGGPTDGSAAGDDAPSTL
FT                   RLALLSGDWIPVTLPDAMRAGHPELTVVSLGGATEAAIWSVHHVIGEVDRLLPSIPYGT
FT                   PLRGQRLAVVDHLGRDRPEGVPGEILIRGAGVALGYIGDAERTRERFGVDPATGDREYR
FT                   TGDIGRYLPDGSIELLGREDAQVKIRGYRIELAEIQAAVLAHPGVADCAVQVAEGTAGR
FT                   HLVGIVQPERSAPVEAPDDRAPGDAARAALQVAAADVDTDALGAFLAQFDEHALRVIER
FT                   TLAAAGALVDQASPVTADEVADLLRASDAHRVVVRRWLRALERRGRIARDADGRYRGAL
FT                   SADPERVARAWARVEEAEREIRWSAELLRHVQASSSALADLVSGDLDIAELLYPGAPSD
FT                   AIGAAYRDNLGVRLLTAALTAAVVALADLHDARGLGADEPLRILEVRGGVGGAADQLIP
FT                   ALAGRAVEYAFTDPSMFHVGEARERHPDRHGVRFQAFDPAADPLPQGQRPSSYDVVICS
FT                   NGLHGVPDVPAALRRLQGLLAPHGHLAVIESTREDNPPLMIATDFMEVRAGGPADARLA
FT                   DDALLFAADEWRAMLGDLGARGIQQVPADEDPLSGLGQHLLLAQVKADRVPLRAASLRR
FT                   HTADRLPDYMVPRRWQVLDALPVTANGKVDRAALARLAEDRAPAAAVAAGSDAPRDDVE
FT                   RRLQELWAELLGRPGIGRDDDFFALGGDSLLVARLVGRMREQLPEVVDLEWDVVLRHML
FT                   RRPTIAGLAGYVRQAGQGGAGDRDAPATPAVSLLSGSGRGPATVLVHAGIGTIMPYRAL
FT                   MTEIRRRSRGTGSLYGVEVPDLDAFLDADPHGLIDRIAAEYARELLATGIRTFHVVGYC
FT                   LGGLVATEVARALTEAGADVASFTAISSHSPAFRLDDEMVSEYSFAMMIGIDPVDLGFP
FT                   ADPWRIAAAGARILERTPGVMPADGYASLDGEFADIGRAFLDLSRIPRRARIARMCEVV
FT                   PPASGSYTPEQMTRFFRTFRQSVFAITRYRPDPYAGDITFLRHSGAYPFPGSREAVTDY
FT                   WEELALGELDIVDIPGDHYDCLSVEHAPRVLSILTNVTGGAVIA"
FT   CDS_pept        complement(398773..405660)
FT                   /transl_table=11
FT                   /gene="npsA"
FT                   /locus_tag="CMM_0331"
FT                   /product="non-ribosomal peptide synthetase"
FT                   /function="Non-ribosomal peptide synthetase modules and
FT                   related proteins"
FT                   /note="non ribosomal peptide synthethase (NP_631721.1|
FT                   putative non-ribosomal peptide synthase [Streptomyces
FT                   coelicolor A3(2)];; NP_534178.1| non-ribosomal peptide
FT                   synthetase [Agrobacterium tumefaciens str. C58]).
FT                   putatively involved in the biosynthesis of a catecholate
FT                   siderophore/antibiotic. two activation/conjugation domains.
FT                   pfam00501, AMP-binding, AMP-binding enzyme (twice: Aa
FT                   609-1014, 1682-2079). pfam00668, Condensation,Condensation
FT                   domain (twice: Aa 112-409, 1185-1475). pfam00550,
FT                   PP-binding, Phosphopantetheine attachment site (thrice: Aa
FT                   13-76, 1099-1162, 2188-2246)."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0331"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00353"
FT                   /db_xref="GOA:A5CMR7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMR7"
FT                   /protein_id="CAN00353.1"
FT                   /translation="MTERIPSVPAPASLRAQVARALRLDPADVGLDDDLVDLGLESTAL
FT                   IRLAGRWRRDGLAADFSRLAADPTIRVWARMLGEAAADGYGDGAGVGGGADPVPRPAAP
FT                   ALDPASPSPLTPLQHAYWLGRQPGQPSGSVAAHFYVELDGADLDPERLRAALAALVARH
FT                   ASLRMRFRDDGTQQPLPADEEPPAARLRVHDLRTEDADAVDARLERMRHDGTHRRMAVE
FT                   RGEVLRVDLTLLPFGRSRLHVDLDMLAGDAISLRVLLADLRDLVEEPGRQLPAIHRDVR
FT                   AELAARAARADASRTSADARWWRERVPDLPAGPALPVRDDAGRADADPRSRRLHHRIGR
FT                   EELRLLEAAARARGLTVAAVLATAFAEVVAAWSAEGRFLLNLPVLERGDEEGLELVVGE
FT                   FSTSILLDVDLREERSFQDDARRIQRGVREAVAHAGYGGVDVLRDLARRDGGSPVLAPV
FT                   VYTSAIGLGELYDASIRRALGEPVWIISQGPQVWLDAQVTELDGGLLLNWDVRVDILEE
FT                   RAMEAAFAAYRQVVDGLAHERPGAWETPALAVPAPEDARARRELERPAPGTGPLVHEAP
FT                   DTDGGLLHSAFLARAAADPGRTAVIGSDGHVVAYGELAENARRVAGLLRARGVGPGATV
FT                   AITAPAGPDRVAAVLGVLLAGACYAPVGPDQPPARRAMVLGRGIDCVLADDGLVDAIAA
FT                   GLSPGGPPVVALGAARDAAPLADPVAVAPDDPAYLLFTSGSTGRPKGVEVAHRAAVATI
FT                   RSLARVAPLGPDDRGIALSALDFDLSVYDLFALLSVGGAVVVPAEHERRDADRWRDLVR
FT                   AHGVTVWNTVPALLDMLLTATGDGPLPLRLVLLGGDVVGPDLPARLAACAPAARLLALG
FT                   GMTEATIHSTVHEARVGAPVDPASPARGLPWGEPLPGVRVRVVDERDRDRPDGVPGELL
FT                   VGGHALARGYRGEPELTAQRFPVLDGARWYRSGDRARYRRDDAGRPVLESLGRADHQLK
FT                   IRGHRVEPGEVEAALASAPGVQRAVVVAVAGALAAMVVPEPGAIVAPDDVAAHAGALLP
FT                   PSMACARVVVRAGLPLTANGKVDRARIMAELAERPAPALRPDDDAPRTPEERLVERVWS
FT                   ELLGVPCGRGRSFFAAGGDSLQATRSVAALRAAGTADASVAALFRHPVLADFAATLHLM
FT                   APEPADARARIVPDPAHRHDPFPLTDVQRAYAVGRDPRIPLGGVGTYHHTEFDGEGQDL
FT                   DLLAAAFDELVRRHPTLRTVIRPDGTQRVLEEVPRVRVDVRDVPADADPDAVDAALAGF
FT                   RERTSHRRHDLAVWPLFDVDALRYPDGRGGIRTRIAIGIDYAVVDALSIMILYTELDLL
FT                   VRGLPLAPAPAELTFRDCVLQTRPDPERLRADEEHWRRRLAGMPDAPRLPLATADPAPR
FT                   FTRRAHRFDAGWWTAFRDRCRAAGLTPTSMLATAYGHVLSRWTGQRDLTMTLTLFDRRD
FT                   AHPDMPRLVGDFTALTLLDHRAAGSAAAAARGLQERLAGDLDHRETPASWILRERARLA
FT                   GTAVAPVPVVFTSAIGVGDEAGVGDGDGDGDGVSADVSGAFGERIHGVSQSPQVLIDVQ
FT                   VLEDHGGLRVDADARDDAFPPGLVDALFAAYVTTLEHLATADWDAPLPVDPPADQARAR
FT                   AAATAAPTAPRPGRLLHDAVHEAARRAPDAPALITGTGAATRVVTHGQLADRAMRIAGA
FT                   LRRRGIGPGDLVGVTLPRGADQAAAVVGVLSAGAAYAPIGIGQPPVRRRAIHRAAGIRL
FT                   VIADDPPAAGGDEPGAPALLRPADAAAEEPLADPARPPVEALAYVIHTSGSTGEPKGVE
FT                   ITHDAAWSTVDAVSRMLEIGPGDRVLALSALDFDLSVFDVLGVLGAGGALVLPEEGEER
FT                   DAPRWLDLVHEHGVTLWDTVPMLLDMLLVAADDRPGRLGSLRAALVSGDRVGTDLHGRL
FT                   IRAAGPGTRLVALGGATEAAIWSNAWEVDGPLDGWQSAPYGRPLPDQAFRVLDASGRDC
FT                   PDWVPGELVIGGRGLARGYRGDPARTAAAFVELGGGRWYRTGDTGRYRPGGILEFLGRA
FT                   DRQVKLGGHRMELGEIEAAHAASPGVRRAMALVVDGPGGRRRVHVAVEPHDGHDGAAVL
FT                   AAATATAADRLPAYAMPHRADLVDAWPLTANGKVDVAALGRALADAEPDPAATAADLAS
FT                   ASAPGTAPDTAPATGTATEAALAELWAGILGAPPAPGTGFFAAGGDSLAMLRLVTAAQR
FT                   RFGVDAGVRRFLEEPTVRAYGACIDRLVATNATTTAATTTPASAPTADAPARPPATTGA
FT                   DLFESGDL"
FT   CDS_pept        405761..407479
FT                   /transl_table=11
FT                   /locus_tag="CMM_0332"
FT                   /function="putative organic acid CoA ligase"
FT                   /note="putative organic acid CoA ligase (NP_631720.1|
FT                   putative AMP-binding ligase [Streptomyces coelicolor
FT                   A3(2)];; ZP_00059514.1| COG1021: Peptide arylation enzymes
FT                   [Thermobifida fusca]). putatively involved in the
FT                   biosynthesis of a catecholate siderophore/antibiotic.
FT                   pfam00501, AMP-binding, AMP-binding enzyme."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0332"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00354"
FT                   /db_xref="GOA:A5CMR9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMR9"
FT                   /protein_id="CAN00354.1"
FT                   /translation="MHEREHAERPGPGPGRGCVDWVDAMADDARAAGQEPDARLDGILR
FT                   RSAARVPDRTALVGVGGRWTHAELDAEVDLVARGLAASGVLPGDRILLQLADGAAFLIA
FT                   WCALVRAGAVPVHAMPGHRLMELAHLAAGSGARGLVLAERVGRDDGRDLAAGVRAACPG
FT                   LDLVILHGSRRVDGALTWEEVRDRGRTPEGAVAAPGSRLDPIAPDGAPRLGLLLHSGGT
FT                   TGLPKLIPRHHAEYSYNAWAAARASGVGPDAVLLAVLPVAFNFTLACPGALGVLDAGGT
FT                   VVIAPDPDPATAFALVARERVTHVALTPTLARAWIDEAAHATADLSSLRVVQVGGARLD
FT                   DVTARALEPALGATLQQVYGMAEGLVCMTGLDDPPELRWSTQGRPISPDDLIRLRAADG
FT                   SLAADGEAGELETRGPCTLRGYHAAPDADATAFTPDGFYRTGDVVRRLPSGHLVVTGRA
FT                   KDQVNRGGEKYAAAEVERYLLALPSVRAAAVVPVPDPDLGERAVAVIACAGPAPDRRAV
FT                   VAHLRSLGVAAYKHPDRVVVLPELPLTAVGKIDKGEVAALLAAGAHHEADGDTRA"
FT   CDS_pept        407472..408191
FT                   /transl_table=11
FT                   /locus_tag="CMM_0333"
FT                   /product="4-phosphopantetheinyl transferase"
FT                   /function="Phosphopantetheinyl transferase component of
FT                   siderophore synthetase"
FT                   /EC_number="2.7.8.-"
FT                   /note="putative 4-phosphopantetheinyl transferase
FT                   (NP_337369.1| EntD-related protein [Mycobacterium
FT                   tuberculosis CDC1551];; AAR92400.1| Sfp-type
FT                   phosphopantetheinyl transferase [Saccharopolyspora
FT                   erythraea]). pfam01648, ACPS, 4'-phosphopantetheinyl
FT                   transferase superfamily."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0333"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00355"
FT                   /db_xref="GOA:A5CMS0"
FT                   /db_xref="InterPro:IPR003542"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="InterPro:IPR041354"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMS0"
FT                   /protein_id="CAN00355.1"
FT                   /translation="MLDAILPAGAVLAEERGPAGEHAMHPAEAGAVARAVPSRRREFAA
FT                   TRACARTALAALVAEAARGGGASRAAADAPGSSPVAIPKGRGGDPVWPRGVVGSLTHCA
FT                   GYRAAVVAGIDALRTIGIDAEPHAPLPREARDIVGLAGELHPHPPLGAGVHADCVLFSA
FT                   KESVGKAHFARYREWLGFADLHVTLHPDGAFTARRSAPGPIPFPAYRGGWCVTEGIVLT
FT                   CAWLAVPRIPSAVARPA"
FT   CDS_pept        408202..409668
FT                   /transl_table=11
FT                   /locus_tag="CMM_0334"
FT                   /product="putative organic acid synthase"
FT                   /function="organic acid synthases component I"
FT                   /note="putative anthranilate synthase (CAG20074.1|
FT                   hypotetical anthranilate synthase [Photobacterium
FT                   profundum];; NP_405477.1| putative salicylate synthetase
FT                   [Yersinia pestis]). putatively involved in the synthesis of
FT                   an aromatic acid (salicylate, isochorismate) for a
FT                   catecholate siderophore/antibiotic.
FT                   pfam00425,Chorismate_bind, chorismate binding enzyme. This
FT                   family includes the catalytic regions of the chorismate
FT                   binding enzymes anthranilate synthase, isochorismate
FT                   synthase,aminodeoxychorismate synthase and
FT                   para-aminobenzoate synthase."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0334"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00356"
FT                   /db_xref="GOA:A5CMR8"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019996"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMR8"
FT                   /protein_id="CAN00356.1"
FT                   /translation="MPAAPVTRVAELRITRDPLGAVADLARAFRDEPHVILEEAGRFSC
FT                   AIGAWAEVVVDRRVVRLRVRGEAEVVVPWRDRPLRVVDRLLAGLGPDRGRAYGTACFEL
FT                   ARAHAGMPVAAEAGELLHVILPRTEVVIADGLATVRSGDAREAAEVARILGAAEPAPSP
FT                   SPSPEPHPCPAPDRPGVVDPEEGRERYLAAVASGVAAIHAGELQKVVVSRRVPVTGEVD
FT                   LPATFVRGRRANTPARSYLLGLGGIEAVGFSPEIVVAVDARGTVRTQPLAGTRALVADP
FT                   IESRRLREELLSDAKEIHEHAISVKLAVEEMAPVCRPGSVRVEEFMVVEERGTVQHLGS
FT                   RVAGELADGLTCWDALAALFPAVTASGVPKRAAFDLIRRLEGHDRGLYAGAVLQIEPDG
FT                   ALDAALVLRTLFRRGDATWLQAGAGVVGASSPARELEETREKLASIADHVVRAREPGRA
FT                   AHASASVDAGASAGEPGVSARAPRGAAAGR"
FT   CDS_pept        complement(409681..411495)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0335"
FT                   /product="conserved membrane protein"
FT                   /note="conserved membrane protein (NP_531343.1| conserved
FT                   hypothetical protein [Agrobacterium tumefaciens str. C58];;
FT                   NP_384960.1| HYPOTHETICAL TRANSMEMBRANE SIGNAL PEPTIDE
FT                   PROTEIN [Sinorhizobium meliloti 1021])."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0335"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00357"
FT                   /db_xref="GOA:A5CMS1"
FT                   /db_xref="InterPro:IPR018702"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMS1"
FT                   /protein_id="CAN00357.1"
FT                   /translation="MRERAGIRAGRAARIRLAVVAALLTALAIPLGLAAPAHADVDDFS
FT                   FRSFDAVYRLSADADGRSVLRTTETLVAEFPDRDQNRGIRRELVRDYDGHPTGIRVLSV
FT                   TDGEGVLRGFDSDSDDGALVLTIADDDAYVRGEQTYVIEYEQHDVTRAYADTAADEFYW
FT                   DVNGLGWAQPFGRVTATVEIAPGLLPRLTGGADAAAGPAGADGPADMQRTDAGFTATAE
FT                   GLGPRENLSFSIGFEPGTFTPRDSSFLAAPWPGLSLAGALLALAAAAGALVLRRRRLSD
FT                   APGRGTIVAQYDPPEGVGVLVSSVISGNAARATTALLLDLAVRGAVRILERDGGRGKPT
FT                   YSLELVDPSRVTDPDERRFVAAVFGDGAGTGAVKDLARTDAKATARIHKLMAAVTKRTV
FT                   ADGLRKPLPTGTIALLLVAASLGMVAAVVFAVLSLVDAYGGPVVIAFLVAGVLATAVTI
FT                   LALVKHPLTERGVALRDHLAGLREFIRLAEADRIRMLQSPEGAERRDLPRDDRDALRLT
FT                   EELLPYAAMSGQEEEWADELGRRYEHARDRPGWYAGQTPFSPAVFAASLGSVSSSMHGT
FT                   YSGSSSSGGSTGGTTSGGGGGGGGGGGV"
FT   CDS_pept        complement(411488..411898)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0336"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00358"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMS2"
FT                   /protein_id="CAN00358.1"
FT                   /translation="MTSADASGTGDEGGRDEGGRDEAAAAEILEALLDAGPRRPVRRAV
FT                   RAISTVALTAVGLGGDLGGLGREAQLVVRRIDTGREVMRTDAGDLDEADRLLQRVRLDL
FT                   ETRSVRDFVAEWRLVDAGHGSAPGTSTGATGA"
FT   CDS_pept        complement(411935..413278)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0337"
FT                   /product="conserved hypothetical protein"
FT                   /function="Beta-lactamase class A"
FT                   /note="conserved hypothetical protein, putative peptidase
FT                   (AAP13501.1| Orf12 [Streptomyces clavuligerus];;
FT                   NP_959400.1| LpqF [Mycobacterium avium subsp.
FT                   paratuberculosis str. k10]). , weak similarities to:
FT                   pfam00768, Peptidase_S11, D-alanyl-D-alanine
FT                   carboxypeptidase."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0337"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00359"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR040846"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMS3"
FT                   /protein_id="CAN00359.1"
FT                   /translation="MTALTTACAASPADPATSAPVAEPVILPGSAVGQQAQWLLDTVNA
FT                   EEPVPVQGTGERLAQVMLDAASAEDLAAVLEQVRAGRPWTATAHEEQGGQSVTTIASEA
FT                   GGTFDMTVAVDDAGLIEGLFFGEPEGDREPATSWAELEEQAAALGGDVSLTVTRASGGE
FT                   LGERILEVLPDGVAATDARPIGSIVKLYVLGALVQAVEEGRIGWDDPLTVTDDVRSLPS
FT                   GELQDAPTGTVVSVRDTAEKMIAISDNTATDMLIQAVGREAVEAALVDLGHSDPPRNVP
FT                   LMTTRDLFRIGWQHDGALRARWADGDAAERRALLEALPGGVVDVPVTAVTDVVWTEGAD
FT                   WFATPDDIARAHLRLAELAATPAGEPVRGILGANPGLPEPARFDHVAFKGGSSVGTLAL
FT                   SYLVDRGDDTWTVVVQAAAREASGLERQSAYAGLAADAAALLAAGSRG"
FT   CDS_pept        complement(413447..414691)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0338"
FT                   /product="conserved hypothetical protein"
FT                   /function="Putative peptidoglycan-binding domain-containing
FT                   protein"
FT                   /note="conserved hypothetical protein (maybe involved in
FT                   cell wall metabolism; putative N-acetylmuramoyl-l-alanine
FT                   amidase) (ZP_00235910.1| putative peptidoglycan binding
FT                   domain protein [Bacillus cereus G9241];; NP_733648.1|
FT                   hypothetical protein [Streptomyces coelicolor A3(2)]).
FT                   pfam01471, PG_binding_1, Putative peptidoglycan binding
FT                   domain."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0338"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00360"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015020"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMS5"
FT                   /protein_id="CAN00360.1"
FT                   /translation="MNQARRSVLSRRSVLGGALAAVPVALVAAGPAHADEATTPATPIP
FT                   EVPLASNGRPVVRDIQEQLVARYGARTGFPAVTTDGVWTGDSHKALIHALQLEMGIDEA
FT                   TANGVMGPLTRTTLQKQATLTVGSADTTGYLVHLLQASLVVMSTWDGPVDGTFSAEQGV
FT                   RISQFQRTVALPETGLGDYRTWAALLASNGDPTRPGNAADGITVITAERAKTLKDAGYT
FT                   IVGRYLTNSDIPDPLEKRIQDGELDAIFAGGLKVFPIFQEGGTDTTYFSYDLGVRAAGR
FT                   ADDAARRLGFLPGTPIYYAVDFDATGDEVETYLEPYFRGIHAELKRRGSAYRVGVYAGR
FT                   RICRTLAAAHLTELSYVADMSTGWGANLGVKIPENWAFDQILEHTIGTGDGAIGIDTNV
FT                   VSGRDAGQSRVEPRG"
FT   CDS_pept        complement(414897..415358)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0339"
FT                   /product="conserved membrane protein"
FT                   /note="conserved membrane protein (NP_827521.1| putative
FT                   integral membrane protein [Streptomyces avermitilis
FT                   MA-4680];; NP_938697.1| Putative membrane protein
FT                   [Corynebacterium diphtheriae NCTC 13129]).
FT                   pfam07332,DUF1469, Protein of unknown function (DUF1469).
FT                   This family consists of several hypothetical bacterial
FT                   proteins of around 140 residues in length. Members of the
FT                   family seem to be found exclusively in Actinomycetes. The
FT                   function of this family is unknown."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0339"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00361"
FT                   /db_xref="GOA:A5CMS4"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMS4"
FT                   /protein_id="CAN00361.1"
FT                   /translation="MTDDDSSSRGGWLGGSFAQKAIDPLLRAVRAEIDSAKREIGERAR
FT                   SARSGAIMLGAGVALALVSLGLLAAVIVALLLLALPLWAATLITLALFGIATAVVVRVG
FT                   IARLSRGVPPVPSDTLHHARDRMRPGDRGTGDGGSDGPTGPAASAPSDG"
FT   CDS_pept        complement(415448..416053)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0340"
FT                   /product="putative membrane protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0340"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00362"
FT                   /db_xref="GOA:A5CMS6"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMS6"
FT                   /protein_id="CAN00362.1"
FT                   /translation="MTSTNRALNRLLVIVVGLVLIAAGVALGAGSLLPDVQSTVSGAAS
FT                   DAKQPVGDALSGGQPWILWVVALVALVLIVVLAWFALRQGHGRTGTLVRLEGGRDASTP
FT                   TGGSVVIDAKVAEQLLGDALRDDSAIVSVDVTAFEVAHATTLRVTAVARRGVSPVAVRR
FT                   TVDEAVTRLDAVLGTEVPVVIQITGGLRSSMSSETRLA"
FT   CDS_pept        complement(416050..416628)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0341"
FT                   /product="putative membrane protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0341"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00363"
FT                   /db_xref="GOA:A5CMS7"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMS7"
FT                   /protein_id="CAN00363.1"
FT                   /translation="MSTDSTYRRLVRRETHSSRAGIAITLAVLLILVLAWLGTESVLAA
FT                   VGTAPLLLAPADLASATLDAASAPAGALIAIGIVVAIVGLVLVSVGITPGSRGRRGGSV
FT                   GRTAAVVDDRVIARSVALTASYAGEVSPDQVDVSVSKRQVLVRLTPSSGYTPDKATIEQ
FT                   AVRAELDGYDYTPKLTAKVTLAKDGKVGS"
FT   CDS_pept        complement(416625..416999)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0342"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00364"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMS8"
FT                   /protein_id="CAN00364.1"
FT                   /translation="MSSAIAAPGTPGTASQATRGRTTITSRAVRRVVSAVTADALEVPA
FT                   GDVSVTLTDAGGKLTVEARTPIRVPALSDRPVREGSLVERLTAAQTEVRERVLGLTGST
FT                   VGRVDLRITGARIQERRRVS"
FT   CDS_pept        complement(417181..417618)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0343"
FT                   /product="putative alkaline shock protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /note="conserved hypothetical protein, putative alkaline
FT                   shock protein (ZP_00189314.2| COG1302: Uncharacterized
FT                   protein conserved in bacteria [Kineococcus radiotolerans
FT                   SRS30216];; NP_827606.1| hypothetical protein SAV6430
FT                   [Streptomyces avermitilis MA-4680]). pfam03780,
FT                   DUF322,Protein of unknown function (DUF322). This is a
FT                   family of small proteins. It includes a protein identified
FT                   as an alkaline shock protein, so may be involved in stress
FT                   response. flhB_rel: FlhB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0343"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00365"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMS9"
FT                   /protein_id="CAN00365.1"
FT                   /translation="MSSITPTSASTGVTGTGTTGGKNTIADGVIEKVAGIAARQVAGVH
FT                   DLGNGAARAVGAIRNVIGQQDRGQGISVEVGETQVAVDVTLIAEYPVDLQQVADDVRSA
FT                   ITDAIDQVVGMEVTEVNVTITDVNLPSDKSSDDDAAEKRVQ"
FT   CDS_pept        complement(417819..419000)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0344"
FT                   /product="putative transcriptional regulator, AraC family"
FT                   /function="AraC-type DNA-binding domain-containing
FT                   proteins"
FT                   /note="putative transcriptional regulator, AraC family
FT                   (ZP_00024251.1| COG2207: AraC-type DNA-binding
FT                   domain-containing proteins [Ralstonia metallidurans];;
FT                   NP_962164.1| hypothetical protein MAP3230c [Mycobacterium
FT                   avium subsp. paratuberculosis str. k10]).
FT                   pfam00165,HTH_AraC, Bacterial regulatory helix-turn-helix
FT                   proteins,araC family. Members of this family contain two
FT                   structural repeats of this domain."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0344"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00366"
FT                   /db_xref="GOA:A5CMT0"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMT0"
FT                   /protein_id="CAN00366.1"
FT                   /translation="MSTASAPDGRHRESSPLHALPALDPERAGGIGLPGTPRSAPAARA
FT                   HDADATVDTIAPHEGGGRPDERDADLADWAAESPSPALRRGHMAGTDIDEAVARYGALF
FT                   PGTEFRAAKGPGDFSYRYSFVGDENVTLRSSVFPAEHWGRLPVLPDYVVAWWREGSGAV
FT                   DVGSHEVRSSGTRPFLLPSGRSFSFRSEPAVQNLVHIDANFLEETAAELHEGRSRPLVF
FT                   DHTRPPSPEQTTAWRHAVGEASPVLQDATSSPLLRMQAGLLVARATLELFPWHDVPFSA
FT                   EMRAPRMSAVRAAIEYLHHHADRPITPADAARAAGISTRVLQLAVRRHEDTTPSALLRG
FT                   IRLDRVHAELRDASPTTTTVRAVAEQWGFGHLGRFAASYSERFGELPSATLRG"
FT   CDS_pept        complement(419162..420103)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0345"
FT                   /product="conserved exported protein"
FT                   /note="conserved exported protein, putative
FT                   dessication-related protein (ZP_00227307.1| hypothetical
FT                   protein Krad06001366 [Kineococcus radiotolerans SRS30216];;
FT                   ZP_00280800.1| hypothetical protein Bcep02004480
FT                   [Burkholderia fungorum LB400])."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0345"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00367"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMT1"
FT                   /protein_id="CAN00367.1"
FT                   /translation="MFDKKFISQAIDRSAQSPLDRRRFFSAAGVAGLGVGAAALIPATG
FT                   AQAADAQAEADAGAVTDAAVLNFALNLEYLEAEFYLRAVTGNGLVPNDTTGVGTLGAVT
FT                   GGRAVQFQDYAIRQYAYEIAQDEKAHVKFLRAALGSARVARPAIDLDAAFTAAARAAGL
FT                   ISGTQTFDAFANQENFLLASFIFEDVGVTAYKGAAPLITNKTYLEAAAGILAVEAYHAG
FT                   IIRSQLFARGLAAPANAISNARDSLDGRTDLDQGITVSGGANLVPTDANSIAFSRTTGQ
FT                   VLNIVYLNSKAVNRGGFYPAGINGSITTSAAN"
FT   CDS_pept        complement(420329..420871)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0346"
FT                   /product="conserved membrane protein"
FT                   /function="ABC-type anion transport system duplicated
FT                   permease component"
FT                   /note="conserved membrane protein (ZP_00227499.1| COG1121:
FT                   ABC-type Mn/Zn transport systems, ATPase component
FT                   [Kineococcus radiotolerans SRS30216];; NP_821494.1|
FT                   hypothetical protein SAV320 [Streptomyces avermitilis
FT                   MA-4680])."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0346"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00368"
FT                   /db_xref="GOA:A5CMT2"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMT2"
FT                   /protein_id="CAN00368.1"
FT                   /translation="MSERNTVIRSMHDLGLAAWFGGSLMGAVGLNGAAAKAKQPQERVR
FT                   LASIGWARWAPVQLAALGAHAIGGLGLIAANKDRLKFQGEARTNTKAKTVLTLGAAGVT
FT                   LYSALVGARMAKHADEGAAGTTEPGAGTSDELASAQKQQKALQWAIPALTAVLVILAAQ
FT                   QGEQQRPIAGWVDRFRS"
FT   CDS_pept        complement(421093..424278)
FT                   /transl_table=11
FT                   /gene="manX"
FT                   /locus_tag="CMM_0347"
FT                   /product="putative alpha-mannosidase"
FT                   /function="Alpha-mannosidase"
FT                   /EC_number="3.2.1.24"
FT                   /note="putative alpha-mannosidase (NP_822929.1| putative
FT                   alpha-mannosidase [Streptomyces avermitilis MA-4680];;
FT                   YP_054780.1| glycosyl hydrolase [Propionibacterium acnes
FT                   KPA171202]). pfam01074, Glyco_hydro_38, Glycosyl hydrolases
FT                   family 38."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0347"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00369"
FT                   /db_xref="GOA:A5CMT3"
FT                   /db_xref="InterPro:IPR000602"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR011682"
FT                   /db_xref="InterPro:IPR015341"
FT                   /db_xref="InterPro:IPR027291"
FT                   /db_xref="InterPro:IPR028995"
FT                   /db_xref="InterPro:IPR037094"
FT                   /db_xref="InterPro:IPR041147"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMT3"
FT                   /protein_id="CAN00369.1"
FT                   /translation="MHQNQKLVQERILRALDERITPAVYSSKTPVTLRAWMAPDEPVPV
FT                   AEAMRQEYAPFALGEPWGRAWSTWWFEVTGEVPAEWAGRTVELLIDPGFIGDWPGNQAE
FT                   CLVHTMDGVPVKGIHPRNTYVRLADEAAGGEQVRFLVEAAGNPDILVNEFVPTPYGDKA
FT                   TAPAEPIYRFRQAELAVFEPEVWALRFDVEVLYQLLMELPETEPRRHEVLRAIERALDV
FT                   LAMDDIVGTAAAARAELADVLSRPAVPSAHTLSGVGHAHIDSAWLWPIRETKRKTARTF
FT                   SNVLRLAEQYPDFRFACSQAQQYVWVKENYPTVFEGIKQAIADGTWYPVGSMWIEPDGN
FT                   LPGGEAMIRQLTHGMRFFQEELGVETHGVWLPDSFGYTASFPQIAKLAGLDWFLTQKLS
FT                   WNQTNTFPHHTFFWEGIDGSRIFTHFPPIDTYNSTLEAEETHHAVRQFREKGRATMSLA
FT                   PFGYGDGGGGPTRDMMERQRRTADLEGSPKVIVEHPDEFFRKAEAEYPDAPVWVGELYL
FT                   ELHRGTFTSHAREKRGNRQAEHRLREAELWWTIAAVRTGADYPYEALDRLWKQTLLQQF
FT                   HDILPGSSITWVHRENEEDYARSLAELDALVADAIARVTAQAVADGEGDGSGAFAVNST
FT                   GHARTALVEATDGSALALVAVPGSGIAPLVAVEPVAPVVTTRADGGTVLDNGLLRVTLD
FT                   ARGLITSIVDLRHADRELVPAGRAANLLQLHEDIPTAWDAWDVDAHYRASRTDLVEAAS
FT                   VELVEDSALRATVEVVRQFGRSRVVQRVSLHADDARIHATADLDWLEDEKLLKVTFPLT
FT                   IHAQHHSAEIQFGHVRRPTHTNTSWDEARFEVMAHRFVHVEEPGYGVALTNAGSYGHDI
FT                   TRSVGVTGEVETELRISLVRAARSPDPVQDIGHHRFEYALVPGVGIEGAVDAGLEQNLP
FT                   VRVVRPGDATEVAPAAVGSAPASDAVVPSSLPTAAGLVSVHGGTVRIEALKLADDGSGD
FT                   VIVRLYESTGARAATRLEAHLAADRFTEVDVLERPLGAGFPRSIAFEPEADGRGVRLVL
FT                   RAFQVITVRIHRA"
FT   CDS_pept        complement(424342..425685)
FT                   /transl_table=11
FT                   /gene="bglY"
FT                   /locus_tag="CMM_0348"
FT                   /product="putative 6-phospho-beta-glucosidase"
FT                   /function="Alpha-galactosidases/6-phospho-beta-glucosidases
FT                   family 4 of glycosyl hydrolases"
FT                   /EC_number="3.2.1.86"
FT                   /note="putative 6-phospho-beta-glucosidase (NP_822930.1|
FT                   putative 6-phospho-beta-glucosidase [Streptomyces
FT                   avermitilis MA-4680];; YP_054779.1| putative glucosidase
FT                   [Propionibacterium acnes KPA171202]).
FT                   pfam02056,Glyco_hydro_4, Family 4 glycosyl hydrolase."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0348"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00370"
FT                   /db_xref="GOA:A5CMT4"
FT                   /db_xref="InterPro:IPR001088"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR019802"
FT                   /db_xref="InterPro:IPR022616"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMT4"
FT                   /protein_id="CAN00370.1"
FT                   /translation="MRLTILGGGGFRVPLVYSALLRDHEAGRVDHVALYDTDEVRLTAV
FT                   ARVLAEQAAAYADAPVITLHTDLDEALAGAAFVFSAIRVGGMAGRSCDERLGMAHGVIG
FT                   QETVGYGGISYALRTLPVVMDLAERIRVQAPDAWVINFTNPAGVVTEAMSRVLGDRVIG
FT                   ICDSPIGLARRVLGALGVQGDDVVIDYAGLNHLGWLRGLRVDGRDVLPDLMARPDLIGT
FT                   FEEGRLFGAEWVTELGAVPNEYLHYYYFRREVRHADQLAAQTRGAFLVEQQGRFYEQLE
FT                   HRHDVSALALWERTRLDRETTYMATNRQSAGMGDRDEDDLVSGGYEDVAIALMRGIAYD
FT                   QSARLILNVRNRGTLAALDADAVVEVPCVVDASGAHPVAGTELPDFGVGLVTNAKYVER
FT                   QTIEAGLGGSRAAAVRALAHHPLVDSVTVARSLLEDAMHAFPALSYLR"
FT   CDS_pept        complement(425682..426407)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0349"
FT                   /product="putative transcriptional regulator, DeoR family"
FT                   /function="Transcriptional regulators of sugar metabolism"
FT                   /note="putative transcriptional regulator, DeoR family
FT                   (NP_822931.1| putative DeoR-family transcriptional
FT                   regulator [Streptomyces avermitilis MA-4680];; NP_624108.1|
FT                   Transcriptional regulator of sugar metabolism
FT                   [Thermoanaerobacter tengcongensis]). pfam00455,
FT                   DeoR,Bacterial regulatory proteins, deoR family. InterPro:
FT                   Bacterial regulatory protein DeoR family"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0349"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00371"
FT                   /db_xref="GOA:A5CMT5"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMT5"
FT                   /protein_id="CAN00371.1"
FT                   /translation="MILDRLRATRSATVAELAEVAGTSDATIRRDLARLDEQGALRRTH
FT                   GGAVLVEVDAPFAEVEQVNREAKERIARTAASQIQDGQSVVLDIGTTTLHLAEQLRGRA
FT                   VTVITANVAAFDVLRDDRSVRLILLPGDWDPVYRSVSGPLTAESLRMLHADHAFVGVSG
FT                   IADNGDLRDTTMAQVPIKRAMAEMSDRVTVLADSSKFPGTGAGRVAPTASLTQLITEAA
FT                   PHERVSQCLADKGVSVTVA"
FT   CDS_pept        426635..427657
FT                   /transl_table=11
FT                   /locus_tag="CMM_0350"
FT                   /product="putative carbohydrate kinase"
FT                   /function="Sugar kinases ribokinase family"
FT                   /EC_number="2.7.1.-"
FT                   /note="putative carbohydrate kinase (NP_822932.1| putative
FT                   carbohydrate kinase [Streptomyces avermitilis MA-4680];;
FT                   ZP_00226288.1| COG0524: Sugar kinases, ribokinase family
FT                   [Kineococcus radiotolerans SRS30216]). pfam00294, PfkB,pfkB
FT                   family carbohydrate kinase. This family includes a variety
FT                   of carbohydrate and pyrimidine kinases."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0350"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00372"
FT                   /db_xref="GOA:A5CMT6"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMT6"
FT                   /protein_id="CAN00372.1"
FT                   /translation="MPAATRTDQAPADRAPAGLLVVGQLFADVVFGELAGGPRPGHEIW
FT                   TSSFGHGPGGIANFAVAGARLGVPTAIAAAVGTDPFSLLVRAALAAEGVTLDHLVTLDD
FT                   WALPVTASLSYDDDRALVTGGVLCPLDSDELVPGEVPAAAAALVHLDPHRSSWIGRAAA
FT                   AGTDVYADVGWDPSERWDPAILDQLDDCHAFIPNELEAAAYTGAGSAVQAARALAARVP
FT                   LSVVTSGSRGVVAVDAARGEEVVRPPLAVRAIDATGAGDVFGAALAASARPQWTLTQRI
FT                   DFACLVAGITVTRPGGASGAPRLDELVPWLRAHPEAAEPGRYDYLADALDHPDGARLLA
FT                   "
FT   CDS_pept        427733..429019
FT                   /transl_table=11
FT                   /locus_tag="CMM_0351"
FT                   /product="putative sugar ABC transporter, substrate binding
FT                   protein"
FT                   /function="ABC-type sugar transport system periplasmic
FT                   component"
FT                   /note="putative sugar ABC transporter, substrate binding
FT                   protein (NP_822933.1| putative sugar binding secreted
FT                   protein [Streptomyces avermitilis MA-4680];; YP_054776.1|
FT                   sugar-binding protein [Propionibacterium acnes KPA171202]).
FT                   pfam01547, SBP_bac_1, Bacterial extracellular
FT                   solute-binding protein."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0351"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00373"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMT7"
FT                   /protein_id="CAN00373.1"
FT                   /translation="MSLSPTRRSRARRIVVGVATLALLAPVLASCSSSSGSSAGGQLDL
FT                   WIWPDGLSQTVLDKVPAEVPGTTLNVSTIGGDFKQKLVTTFTGRSGLPSITGVKGEDMP
FT                   YFLSEDGLFENLDDLGAKDVTDQYPAWKLKEATTKDGQLIGLPIDIGPTALYYRADVFA
FT                   KAGLPSEPADVAAATATWDDYFAFGKKLKAATGGAIFVDASDVFTKSLGQGTTRFVDED
FT                   GDFTGDSDTVKAAWDRAVLAWKDGLTANVTDGSPDWASAISNGSLPALLGASWYQADLK
FT                   SATADTSGDWRVAPMPGGPANIGGSFLSIPSGTKDPQAAFAVIKDVLSEDNQVTAYADK
FT                   GIFPSATAAYDSPELQKGDDFFGGQSTVGIFADAAAKMPTAYTSPYDNQVQAAFVTELQ
FT                   NVTSLGKDPDQAWTDAVAAGEAALKTAKQ"
FT   CDS_pept        429016..430014
FT                   /transl_table=11
FT                   /locus_tag="CMM_0352"
FT                   /product="putative sugar ABC transporter, permease
FT                   component"
FT                   /function="ABC-type sugar transport systems permease
FT                   components"
FT                   /note="putative sugar ABC transporter, permease component
FT                   (NP_822934.1| putative sugar transport system permease
FT                   [Streptomyces avermitilis MA-4680];; YP_054775.1| transport
FT                   permease [Propionibacterium acnes KPA171202]). pfam00528,
FT                   BPD_transp_1, Binding-protein-dependent transport system
FT                   inner membrane component. InterPro:
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0352"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00374"
FT                   /db_xref="GOA:A5CMT8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMT8"
FT                   /protein_id="CAN00374.1"
FT                   /translation="MIPVAVRPGGRPPAPSRAGAGTRGLRRTWPYYVAIAPFFVLFAIF
FT                   GLFPALYSLVLSFQDWNGLGTAKWVGLANFQALAADGTFWLSIKNTLVIFALSTFPMMA
FT                   IAVVVAAMLNSAKRLSTFYKISYFVPNVTSVVAMAVLFGSIFGDSFGLVNAGLRAIGLD
FT                   GVAWLSTPWAIQVTIAILITYQWTGYNAIIFLAGMQAIGTEVYEAAKLDGAGAIRTFWS
FT                   VTLPLLRPTILFVLVVSTITGLQSFTEAQVLTASSSTTNPNSGGAGQAGLTTVLYFYQQ
FT                   AFNYNRFGYGAAIAWGVFLLVVIFSIISFRLGSEKKEKVVRAPGTRKGHRA"
FT   CDS_pept        430011..430934
FT                   /transl_table=11
FT                   /locus_tag="CMM_0353"
FT                   /product="putative sugar ABC transporter, permease
FT                   component"
FT                   /function="ABC-type sugar transport system permease
FT                   component"
FT                   /note="putative sugar ABC transporter, permease component
FT                   (NP_822935.1| putative ABC-type transport system permease
FT                   protein [Streptomyces avermitilis MA-4680];; YP_054774.1|
FT                   sugar transport permease BglB [Propionibacterium acnes
FT                   KPA171202]). pfam00528, BPD_transp_1,
FT                   Binding-protein-dependent transport system inner membrane
FT                   component. InterPro: Binding-protein-dependent transport
FT                   systems inner membrane component"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0353"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00375"
FT                   /db_xref="GOA:A5CMU0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMU0"
FT                   /protein_id="CAN00375.1"
FT                   /translation="MSATVHAAGSAAARVADQASGRPRVERTGRPAGRRQLPPGRVILH
FT                   GILFAGSIVSLFPLYWLVVMASNTTSDIYKSPPVLVPGPYLWDNIQAVFRTIDFGGSLM
FT                   NTVIVAVSVTVLVLFFDSIAAFTFAKYEFPGRRALFALLLVTFMLPAQLSVIPQFVTMI
FT                   NLGWVGQLQALIVPAAANAFGIFWLRQFIISSVPDELIDAARIDGAGFFRQYITVCLPL
FT                   IRPGLGFLGIFTFIAAWNDYLWPLIVLNDPGTLTLQVAMSQLNSAHGKDYGMVMAGALL
FT                   AVIPLIVVFLIGAKQFIGDIAKGALK"
FT   CDS_pept        430931..431695
FT                   /transl_table=11
FT                   /gene="nagB"
FT                   /locus_tag="CMM_0354"
FT                   /product="putative glucosamine-6-phosphate isomerase"
FT                   /function="6-phosphogluconolactonase/Glucosamine-6-phosphate
FT                   isomerase/deaminase"
FT                   /EC_number="3.5.99.6"
FT                   /note="putative glucosamine-6-phosphate deaminase
FT                   (Glucosamine-6- phosphate isomerase) (Q9K487|NAGB_STRCO
FT                   Glucosamine-6-phosphate deaminase (Glucosamine-6-phosphate
FT                   isomerase) (GNPDA) (GlcN6P deaminase);; ZP_00120662.1|
FT                   COG0363: 6-phosphogluconolactonase/Glucosamine-6-phosphate
FT                   isomerase/deaminase [Bifidobacterium longum DJO10A]).
FT                   Catalyzes the reversible isomerization-deamination of
FT                   glucosamine 6-phosphate (GlcN6P) to form fructose
FT                   6-phosphate (Fru6P) and ammonium ion (By similarity).
FT                   pfam01182, Glucosamine_iso, Glucosamine-6-phosphate
FT                   isomerases/6-phosphogluconolactonase. nagB:
FT                   glucosamine-6-phosphate isomerase"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0354"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00376"
FT                   /db_xref="GOA:A5CMT9"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMT9"
FT                   /protein_id="CAN00376.1"
FT                   /translation="MTAASTRPPRIVGVDDAAALGVAAADAVQAFLGGDPAGVLGVATG
FT                   SSPEPLYAELARRHRERGLVTDGLSLVALDEYVGLPVGHPQSYLAFVLARIAEPLGVPS
FT                   ARVIVPDGTGADPREAAHEHERRIRRLGGAGLQIVGIGANGHLGFNEPGSPFDGVSRVV
FT                   RLAEGTRRDNARYFGGDPRRVPTHAITQGIATIMSAGRILLVASGARKADALAAALAGP
FT                   VTEDVPASILQRHPRVTVVADRAALAGLVALA"
FT   CDS_pept        431769..434759
FT                   /transl_table=11
FT                   /gene="bgaA"
FT                   /locus_tag="CMM_0355"
FT                   /product="beta-galactosidase"
FT                   /function="Beta-galactosidase/beta-glucuronidase"
FT                   /EC_number="3.2.1.23"
FT                   /note="beta-galactosidase (Lactase) (AAQ19029.1|
FT                   beta-galactosidase [Arthrobacter sp. SB];; ZP_00226654.1|
FT                   COG3250: Beta-galactosidase/ beta-glucuronidase
FT                   [Kineococcus radiotolerans SRS30216]).
FT                   pfam02837,Glyco_hydro_2_N, Glycosyl hydrolases family 2,
FT                   sugar binding domain. pfam02836, Glyco_hydro_2_C, Glycosyl
FT                   hydrolases family 2, TIM barrel domain.
FT                   pfam02929,Bgal_small_N, Beta galactosidase small chain, N
FT                   terminal domain. sipfam02930, Bgal_small_C, Beta
FT                   galactosidase small chain, C terminal domain. This domain
FT                   is found in the carboxy-terminal portion of the small chain
FT                   of dimeric beta-galactosidases EC:3.2.1.23. This domain is
FT                   also found in single chain beta-galactosidase."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0355"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00377"
FT                   /db_xref="GOA:A5CMU1"
FT                   /db_xref="InterPro:IPR004199"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR023230"
FT                   /db_xref="InterPro:IPR023232"
FT                   /db_xref="InterPro:IPR023933"
FT                   /db_xref="InterPro:IPR032312"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMU1"
FT                   /protein_id="CAN00377.1"
FT                   /translation="MSHLDDVAPGSASRLEPRARFATDAPVHSLDGDWRFRLLPEAPVD
FT                   AAGRAPAVADPALDDAALDAAGWTTLPVPSHWVLHGHGSPAYTNLQYPFPIDPPHVPDA
FT                   NPTGEHRRTFELPASFADAERVLLRTDGIEGLATFWVNGVEAGWTTGSRLTTELDVTEL
FT                   LVPGENVLGIRVHQWSAASYLEDQDQWWLPGIFRPVELLARPAGALDDVRVRADRDPAD
FT                   GSGRLDVQVDGAFPVVVRVPELGIHATWETAADVAPVAIPAVDAWSAERPRLYDATVSS
FT                   PGETASLRIGFRTVRIDGDALLVDGRRLTFRGVNRHESHPERGRVFDEAEARADLELMK
FT                   RSGVNAIRTSHYPPHPRLIDIADELGLWVVLECDLETHGFWDVEWRDNPSDDPRWRDAY
FT                   LDRIARTVGRDRNHPSIVMWSLGNESGTGRNIAAMSAWVRRADPTRPVHYEGDLTGEHT
FT                   DVYSRMYPTLEEIDSVCGTPVASIHETTGATGAKQRAKPFILCEYGHAMGNGPGSLADY
FT                   EDAIDRWPRLHGGFVWEWRDHGLLARTADGRHFHAYGGDFDEPVHDGPFVMDGLLLSDG
FT                   TPTPGLEELAAVIAPVRVRVAADGSGVRVENRRHSASTDDVDLVWILAHDGRPVARGIL
FT                   EHTPLAAGDAATIPLPVEARAAGHAEEAHVTVQVVTRHDAPWAEAGHVVSSHQALVRDR
FT                   PAPRPRPAGRWRGDSLGAGTFDAHGDLVAWAGVPVRGPRLELWRAPTENDRGAGQGSYE
FT                   LAEPEPTRGRGAEETPPSADRWRERGLHRLTHRLLGTSRTDSGLETRMRVQAAHSGAGV
FT                   DVAFRWTATDRGLLLATEVVPFGAWDCTWPRVGVRIDLPGALAEHPVAWHGTGPGESYA
FT                   DSRTAARVGRFASSVDGLAVAYARPQETGHRPELRSLVVGDGCTTPLTLTTVPDGSGHR
FT                   PGFQLSRWTPQQMTDVGHPHELPAPDGLHLFIDDAQHGLGSRACGPDVLPRHALWPSLR
FT                   TCEVLLG"
FT   CDS_pept        complement(434829..435344)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0356"
FT                   /product="putative acyl-CoA thioesterase"
FT                   /function="Predicted thioesterase"
FT                   /note="putative acyl-CoA thioesterase (NP_967633.1|
FT                   conserved hypothetical protein [Bdellovibrio bacteriovorus
FT                   HD100];; ZP_00269440.1| hypothetical protein Rrub02001636
FT                   [Rhodospirillum rubrum]). pfam03061, 4HBT, Thioesterase
FT                   superfamily. This family contains a wide variety of
FT                   enzymes, principally thioesterases. InterPro:
FT                   4-hydroxybenzoyl-CoA thioesterase family active site"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0356"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00378"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMU2"
FT                   /protein_id="CAN00378.1"
FT                   /translation="MNLYLRLLLMRLTARRRGRLGIWDTARTAFRVLPHDLDLFGHVNN
FT                   GRYLTIMDVARLDLLVRSGLWSRIRARGWYPVVAGQTITYRRSLTLGQRFVVESRVLGT
FT                   YDRWSYVEQTFLVGDQVAARAVVRNRFLHEGGGTVSAAELDELVGPAPDGTRMPDWVAG
FT                   WTSSTRTI"
FT   CDS_pept        435599..436171
FT                   /transl_table=11
FT                   /locus_tag="CMM_0357"
FT                   /product="conserved hypothetical protein"
FT                   /function="Predicted flavoprotein"
FT                   /note="putative NADPH-dependent FMN reductase (NP_102215.1|
FT                   hypothetical protein mlr0414 [Mesorhizobium loti
FT                   MAFF303099];; CAD47912.1| putative NADPH:quinone
FT                   oxidoreductase [Arthrobacter nicotinovorans]).
FT                   pfam03358,FMN_red, NADPH-dependent FMN reductase."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0357"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00379"
FT                   /db_xref="GOA:A5CMU3"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMU3"
FT                   /protein_id="CAN00379.1"
FT                   /translation="MSTTYRVGYLVGSLSSTSINRALSLALKRLGAQAGLELAEIPIQP
FT                   LPFYSADMDGEYPEVANAFKAAIADADAVLIVTPEYNRSVPGVLKNALDFASRPYGENA
FT                   FQGKPSAVIGTSIGAVGTAVAQQHLRSILSFLASPELSQPEAYIQTTEGLISPEGEISN
FT                   AGTEEFLVGWLQAFHAHIEKNLQAVSA"
FT   CDS_pept        436334..437383
FT                   /transl_table=11
FT                   /locus_tag="CMM_0358"
FT                   /product="putative transcriptional regulator, LacI family"
FT                   /function="Transcriptional regulators"
FT                   /note="putative transcriptional regulator, LacI family
FT                   (NP_629820.1| putative transcriptional regulator
FT                   [Streptomyces coelicolor A3(2)];; ZP_00227762.1| COG1609:
FT                   Transcriptional regulators [Kineococcus radiotolerans
FT                   SRS30216]). pfam00356, LacI, Bacterial regulatory proteins,
FT                   lacI family. pfam00532, Peripla_BP_1,Periplasmic binding
FT                   proteins and sugar binding domain of the LacI family. This
FT                   family includes the periplasmic binding proteins, and the
FT                   LacI family transcriptional regulators."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0358"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00380"
FT                   /db_xref="GOA:A5CMU4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMU4"
FT                   /protein_id="CAN00380.1"
FT                   /translation="MVTIRDVAADAGVARSTVSYVLSGKKKLPDATRERVLASVSKLGY
FT                   RPDPAARALALRRTNILGFLASIDPASRESDIEVFMRFVRAGMYEANTRGFDLLIMGKG
FT                   EDELRGDVLADALVVMDIRDDDPRIPVLQAIGLPTVLVGHPGRSSAFSAVDLDFEEAGR
FT                   VAVDHLVALGHREIALLGSGAPAARTEMGFAVRFRRGFTERCAHHGVQGAVVPSAGGGD
FT                   DAAERWLDAAREALPAASAIVAHTPGELEPIAAALRARGIRIPEDCSLITVAPEVVMRT
FT                   AALPLTVIDLPGDEMVRRATGLAVDELAGAAEPGVLELLPAVLVELGSTGRHVPGESGS
FT                   AFRSVSASA"
FT   CDS_pept        437577..438791
FT                   /transl_table=11
FT                   /locus_tag="CMM_0359"
FT                   /product="putative sugar ABC transporter, substrate-binding
FT                   protein"
FT                   /function="ABC-type sugar transport system periplasmic
FT                   component"
FT                   /note="putative sugar ABC transporter, substrate-binding
FT                   protein (ZP_00192200.3| COG1653: ABC-type sugar transport
FT                   system, periplasmic component [Kineococcus radiotolerans
FT                   SRS30216];; NP_625350.1| putative sugar transport sugar
FT                   binding protein [Streptomyces coelicolor A3(2)]).
FT                   pfam01547, SBP_bac_1, Bacterial extracellular
FT                   solute-binding protein. InterPro: Bacterial extracellular
FT                   solute-binding protein family 1"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0359"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00381"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMU5"
FT                   /protein_id="CAN00381.1"
FT                   /translation="MINTRTRAALAATVVVTAGLALTGCSTGGGGSSDPDSLTLWDSFT
FT                   QYDASSPYGKLISGCETSTGITIDRTQNPDNETKFLQAASSKTTPNLIVLDNPAIARFA
FT                   DTGLLVANDESGLDTSKVLPNVLAAGQLDGKTYGSSIGANTLALFYDKAKLAAAGVQPP
FT                   TDWASLEDAAAKTTQGDVQGLGFSAIGTEEGTFQFLPFFWGAGADLSDISSPAAVRALT
FT                   LWTDMVKDGQASSANVNANQQDIRDQFLAGKLAMMVNGTWQLSALDEAGIDYGVVPLPA
FT                   EDGGAAPSPLGGEFVEVVVSDEAKQDAAARFAQCMIDPANLADWTAGQSYISPYADAAA
FT                   QQVSADPELVPWVDAVSVAQGRTADLGIAYPDTSKALYQAIQEALTGSKTPQAALDDAA
FT                   ATLKK"
FT   CDS_pept        438788..439747
FT                   /transl_table=11
FT                   /locus_tag="CMM_0360"
FT                   /product="putative sugar ABC transporter, permease
FT                   component"
FT                   /function="ABC-type sugar transport systems permease
FT                   components"
FT                   /note="putative sugar ABC trasnporter, permease component
FT                   (NP_625351.1| putative sugar transport integral membrane
FT                   protein [Streptomyces coelicolor A3(2)];; ZP_00226127.1|
FT                   COG1175: ABC-type sugar transport systems, permease
FT                   components [Kineococcus radiotolerans SRS30216]).
FT                   pfam00528, BPD_transp_1, Binding-protein-dependent
FT                   transport system inner membrane component."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0360"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00382"
FT                   /db_xref="GOA:A5CMU6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMU6"
FT                   /protein_id="CAN00382.1"
FT                   /translation="MSGRVIDRPLAPSRGAGTAGPAEGRPPRRRPYRTVSVVAAIGFMA
FT                   PVVAFLAIFFVYPIIRGFLLSLQEYGPRAFVTGEAPYVGFQNYVTILGDSLFATIAWHT
FT                   VVFTVVSLAGQFAIGLALAVFFTRRFPLSTTFRSLILLPWLLPLIVSATAWRWMFDQQF
FT                   GIINSVLGTPIGWLSDPSVSLWSVIIANIWLGIPFNMILLYGGLQGIPENLYEAAALDG
FT                   AGRWRTFRSITWPLLRPVTAVTLLLGLVYTIKVFDVIWILTKGGPANSSHTLSTWAYEK
FT                   SFTDLDFGVGAAAGEILVVVALVFGLIYVRAQRKEAQS"
FT   CDS_pept        439744..440574
FT                   /transl_table=11
FT                   /locus_tag="CMM_0361"
FT                   /product="putative sugar ABC transporter, permease
FT                   component"
FT                   /function="ABC-type sugar transport system permease
FT                   component"
FT                   /note="putative sugar ABC transporter, permease component
FT                   (NP_625352.1| putative sugar transport integral membrane
FT                   protein [Streptomyces coelicolor A3(2)];; ZP_00226128.1|
FT                   COG0395: ABC-type sugar transport system, permease
FT                   component [Kineococcus radiotolerans SRS30216]). pfam00528,
FT                   BPD_transp_1, Binding-protein-dependent transport system
FT                   inner membrane component."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0361"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00383"
FT                   /db_xref="GOA:A5CMU7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMU7"
FT                   /protein_id="CAN00383.1"
FT                   /translation="MNTIDTPVRRWTNAVIGLVICAVLLFPLYWMLNVSLTKPQDLISS
FT                   TPSLFPADPTLDGYAQAISTQLPNLVTSLVISIGCVILTLLISLPAAYATAKFRVRGTG
FT                   AVMFVFLLAQMIPGIVLVTALFAIYDALGLLNTYPGLILAGATASVPFAVIVLRAFMLG
FT                   IPDELLEAARIDGASSWRAFVSIVVPLSRNAIVTAALFSFLFAWADFLNANSLTSGNSI
FT                   VPFTLGLYRYIGSTTTNWNGIMATAVIASIPAAVLLVVAQRFVAAGVTAGAVKD"
FT   CDS_pept        440654..442702
FT                   /transl_table=11
FT                   /locus_tag="CMM_0362"
FT                   /product="putative alpha glucosidase"
FT                   /function="Alpha-glucosidases family 31 of glycosyl
FT                   hydrolases"
FT                   /EC_number="3.2.1.-"
FT                   /note="putative alpha glucosidase (NP_459046.1| putative
FT                   glycosyl hydrolase [Salmonella typhimurium LT2];;
FT                   XP_388973.1| hypothetical protein FG08797.1 [Gibberella
FT                   zeae PH-1])., pfam01055, Glyco_hydro_31, Glycosyl
FT                   hydrolases family 31., InterPro: Glycoside hydrolase family
FT                   31"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0362"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00384"
FT                   /db_xref="GOA:A5CMU8"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMU8"
FT                   /protein_id="CAN00384.1"
FT                   /translation="MIDDDQHFTSDGTRLVWRGDGETLVVEPWGPDSLRVRSRIMAPVA
FT                   DADWALLPQPEERPRIEVDGATARITNGGITAVLVSESSYGYQTGYEENRCHVTYLDRH
FT                   GEVLLEEIGTGGALHLRAREQRPHLGGDFRITASFATGPDERLYGMGLYQQDILDLAGS
FT                   TFELAHRNSQASVPFVMSSRGYGFLWHDPAIGRATFAANRVEWTAETSEQLDYWITAGD
FT                   TPADISRAYARATGSAPMMPEHGLGFWQCKLRYWNQEQLLEVAREHTRRGLPMDVIVAD
FT                   FFHWPKMGDLRFEEEFWPDPTAMVEELRSMGIELMVSIWPQVSLESENYARMKKENLLV
FT                   RSERGIDVQMQFEGPSAFVDVTNPDARRHLWETAQRGYGAHGIRLFWLDEAEPEYGVYD
FT                   YDNYRYHAGPNVRVGNVYPQMFSRAMHEGRIQAGQEPGVDLVRAAWAGSQRYGALVWSG
FT                   DIHSTFEALARQVTAGIHMGVAGIPWFTTDIGGFAGARTDDPAFHELLVRWFQFGAFSP
FT                   VMRLHGDRGPSVEVRAADGSRRAPSGSGNELWSFGEEVYGILAGYVHLRERLRPYLRDV
FT                   MREAHEDGQPVMRGMFHVFPDDAASWTLGDQYMLGADVLVAPVLEAGARSRSVHLPAGT
FT                   SWIEASTGARHEGGQRVVADAPLHVIPIFVRAGAAVEVRLPEGDPVA"
FT   CDS_pept        442816..443871
FT                   /transl_table=11
FT                   /locus_tag="CMM_0363"
FT                   /product="putative Fe3+-hydroxamate ABC
FT                   transporter,substrate binding protein"
FT                   /function="ABC-type Fe3+-hydroxamate transport system
FT                   periplasmic component"
FT                   /note="putative Fe3+-hydroxamate ABC transporter,substrate
FT                   binding protein (ZP_00226720.1| COG0614: ABC-type
FT                   Fe3+-hydroxamate transport system, periplasmic component
FT                   [Kineococcus radiotolerans SRS30216];; NP_699933.1| iron
FT                   compound ABC transporter, periplasmic iron compound-binding
FT                   protein [Brucella suis 1330]). pfam01497, Peripla_BP_2,
FT                   Periplasmic binding protein. This family includes bacterial
FT                   periplasmic binding proteins. Several of which are involved
FT                   in iron transport."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0363"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00385"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMU9"
FT                   /protein_id="CAN00385.1"
FT                   /translation="MPRARALARLTATAVTGLVLVALTGCGASEEVPAASVAEAGEGST
FT                   TYPLTLSNCGHDVTVDQAPSRVVSLDQDSTEILLSLGLQDRMVGTASWTDPVLDSLADA
FT                   NAQVPRLADNAPTYEVLLGADPDFVTASFGRHYATGGVATRERLAETGIPSYLSPTDCD
FT                   SDISINGGGQRTTALTVDALYQEIREMAEVFDVQDRGEALVSSLQQRAAAATDGMDMGG
FT                   AKVMYWFADTKTPYMGGGFGATALLSRQTGLTDAFPEVRDDFVATGWETVVDRDPDILV
FT                   LGDLQRDRFPGDRLQDKIDFLKSDPLTRDLTAVKEDRMVALHGAELNPSIRFVDGLEKI
FT                   RAWWDARGAEL"
FT   CDS_pept        443868..444944
FT                   /transl_table=11
FT                   /locus_tag="CMM_0364"
FT                   /product="putative Fe3+-siderophore ABC
FT                   transporter,permease component"
FT                   /function="ABC-type Fe3+-siderophore transport system
FT                   permease component"
FT                   /note="putative Fe3+-siderophore ABC transporter, permease
FT                   component (ZP_00226721.1| COG0609: ABC-type
FT                   Fe3+-siderophore transport system, permease component
FT                   [Kineococcus radiotolerans SRS30216];; NP_793040.1| iron
FT                   ABC transporter, permease protein, putative [Pseudomonas
FT                   syringae pv. tomato str. DC3000]). pfam01032, FecCD, FecCD
FT                   transport family. This is a sub-family of bacterial binding
FT                   protein-dependent transport systems family."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0364"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00386"
FT                   /db_xref="GOA:A5CMV0"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMV0"
FT                   /protein_id="CAN00386.1"
FT                   /translation="MSAAAPRAPFATAAARVRALPHALRVALLVVLGIVALALSVGVAV
FT                   TLGPADVSLVNVRDILLNHAGLARIPVRVSEDAIVWQERLPRALVAAACGAGLGLCGVV
FT                   LQSLLRNPLADPFVLGVSSGASTGAVLIGVLGLGGGAIGMSGGAFIGALVAFGFVLLLA
FT                   RFSSAGTAGVILAGVASTQLFSALTSLVVFAFADSDETRGITFWLLGSLEGMRWDEVGL
FT                   SVSVVAVGAVVCLAYARSLDAFAFGEEVASSLGIHVGRTRMILLVVTALLTATLVSIAG
FT                   AIGFVGLVLPHAARLLFGQRHARVVPATLVLGAVFMVWVDAFSRLAFAPTPLPVGVGTA
FT                   LVGVPVFMLLLMRDRGRA"
FT   CDS_pept        444941..445711
FT                   /transl_table=11
FT                   /locus_tag="CMM_0365"
FT                   /product="putative Fe3+-siderophore ABC transporter,ATPase
FT                   component"
FT                   /function="ABC-type cobalamin/Fe3+-siderophores transport
FT                   systems ATPase components"
FT                   /note="putative Fe3+-siderophore ABC transporter, ATPase
FT                   component (ZP_00226722.1| COG1120: ABC-type
FT                   cobalamin/Fe3+-siderophores transport systems, ATPase
FT                   components [Kineococcus radiotolerans SRS30216];;
FT                   CAB92552.1| FecE protein [Serratia sp. ATCC 39006]).
FT                   pfam00005, ABC_tran,ABC transporter."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0365"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00387"
FT                   /db_xref="GOA:A5CMV1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMV1"
FT                   /protein_id="CAN00387.1"
FT                   /translation="MTLEARGVSWSRGGRIVVDDVTLEPAPGSTVGLLGPNGSGKSSLL
FT                   KLLQGAASPDSGRVTLDGADLAGLRRRDVARRVATVTQHGETEVDIAVRDVVRLGRTPY
FT                   RTLLGGDTAEDAAAIDRAIAHVGLEAKADRAWRTLSGGERQRAHIARALAQEPRELLLD
FT                   EPTNHLDIRHQLELLALVRDLPVTTVVALHDLNLAAMFCDSVLVLREGRVVAGGHPREV
FT                   LTPELIADVYGVRAVVTHDAAVGCSRVLFDAAPL"
FT   CDS_pept        445786..446586
FT                   /transl_table=11
FT                   /locus_tag="CMM_0366"
FT                   /product="putative nucleoside-diphosphate-sugar epimerase"
FT                   /function="Nucleoside-diphosphate-sugar epimerases"
FT                   /note="putative nucleoside-diphosphate-sugar epimerase
FT                   (ZP_00291479.1| COG0451: Nucleoside-diphosphate-sugar
FT                   epimerases [Thermobifida fusca];; AAL17942.1| putative UDP
FT                   glucose epimerase [Mycobacterium smegmatis]).
FT                   pfam01370,Epimerase, NAD dependent epimerase/dehydratase
FT                   family. This family of proteins utilise NAD as a cofactor."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0366"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00388"
FT                   /db_xref="GOA:A5CMV2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMV2"
FT                   /protein_id="CAN00388.1"
FT                   /translation="MATITITGGSGRIATSIRPLLLAAGHELRLLDVVAPPTPLAPGET
FT                   SAIVDTTDVDACTEAFRGSDLVVHLAAHAAERPWEAIQAVNNDGAHAVHEAVVRAGVPR
FT                   ILAASSIHAVGFLPATEAAREDVPAPRPDTFYGLSKVLLEGLGSLYADRHGHVVVSVRI
FT                   MTAEPEPSQARSVSTWLSAGDAARLVEAVLRWDEPGHRIVWGVSRNTRRWVSLAAGEAI
FT                   GYHPEDDAEVFAHRFPELGEDTSPPRGVLLGSIFTEVELGSDMG"
FT   CDS_pept        446742..447713
FT                   /transl_table=11
FT                   /gene="phnD"
FT                   /locus_tag="CMM_0367"
FT                   /product="putative phosphonate ABC transporter,
FT                   substrate-binding protein"
FT                   /function="ABC-type phosphate/phosphonate transport system
FT                   periplasmic component"
FT                   /note="putative phosphonate ABC transporter,
FT                   substrate-binding protein (ZP_00110175.1| COG3221: ABC-type
FT                   phosphate/phosphonate transport system, periplasmic
FT                   component [Nostoc punctiforme];; NP_946052.1| putative PhnD
FT                   protein, phosphonate ABC transporter, periplasmic binding
FT                   protein precursor [Rhodopseudomonas palustris CGA009]).
FT                   PART OF THE BINDING-PROTEIN-DEPENDENT TRANSPORT SYSTEM FOR
FT                   ALKYLPHOSPHONATES. InterPro: Bacterial extracellular
FT                   solute-binding proteins family 3"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0367"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00389"
FT                   /db_xref="GOA:A5CMV3"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR005770"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMV3"
FT                   /protein_id="CAN00389.1"
FT                   /translation="MSLSPRTRIGALAASALVAALALTGCSAGGSDASAASADSSGTWA
FT                   KSEGTLVFGATPDQAGSDSNNKPLEDYIAKETGLKVEYYPTADYTALIAAAVAGKIDLM
FT                   SSGALQYVMASNKGAEIEPVAAMLTSKDVTDPGYYSEAIVPKGSTITDLAGAKGKTVCF
FT                   VDPNSTSGFLFGLYQLQKAGIDVTSTGSDANGNPQFADFTPYFAGAHDKSAQAVASGQC
FT                   DVGFAEDSIVEPAVAAGQLTSIGKEYVPGGPLSISSALPADVKAKLTTTLQGASLDAIT
FT                   ASGVPLTDGFTKGYFGAQPEDTTYYKGIADLCDSIAAAKCAK"
FT   CDS_pept        447735..448634
FT                   /transl_table=11
FT                   /gene="phnC"
FT                   /locus_tag="CMM_0368"
FT                   /product="putative phosphate/phosphonate ABC
FT                   transporter,ATPase component"
FT                   /function="ABC-type phosphate/phosphonate ABC
FT                   transporter,ATPase component"
FT                   /note="putative phosphate/phosphonate ABC
FT                   transporter,ATPase component (NP_243840.1| alkylphosphonate
FT                   ABC tranporter (ATP-binding protein) [Bacillus
FT                   halodurans];; NP_486270.1| ABC tranporter, ATP-binding
FT                   component [Nostoc sp. PCC 7120]). pfam00005, ABC_tran, ABC
FT                   transporter."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0368"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00390"
FT                   /db_xref="GOA:A5CMV4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012693"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMV4"
FT                   /protein_id="CAN00390.1"
FT                   /translation="MTGTTTSPLVSVSGVTKDFGGTRALHDVDLTVERGEVVVLLGLSG
FT                   SGKSTLLRHLDGLELPTAGSVRVFDQDVASLGQQDLRALRGRVAMIFQQFELVPSLTVL
FT                   ENVLTGALGRLRGPRLGIWTYPRAARTEALGHLDRVGLLEKAYERADRLSGGQQQRVAI
FT                   ARALMQRPEILLADEPVASLDPESSEQVMRLIREIAADDGLTVVCSLHQVDLALGWGDR
FT                   IVGLRHGEVVLDTPTRGIGKAEVMEIYGRVASTTSALAAIATELGDVLPLDEPVGVRSA
FT                   GALGDQGLARGRRADGTR"
FT   CDS_pept        448631..450379
FT                   /transl_table=11
FT                   /gene="phnE"
FT                   /locus_tag="CMM_0369"
FT                   /product="putative phosphate/phosphonate ABC
FT                   transporter,permease component"
FT                   /function="ABC-type phosphate/phosphonate transport system
FT                   permease component"
FT                   /note="putative phosphate/phosphonate ABC
FT                   transporter,permease component (ZP_00203666.1| COG3639:
FT                   ABC-type phosphate/phosphonate transport system, permease
FT                   component [Dechloromonas aromatica RCB];; AAP27494.1|
FT                   phosphonate ABC transporter, permease protein [Bacillus
FT                   anthracis str. Ames]). pfam00528, BPD_transp_1,
FT                   Binding-protein-dependent transport system inner membrane
FT                   component (twice). InterPro: Binding-protein-dependent
FT                   transport systems inner membrane component"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0369"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00391"
FT                   /db_xref="GOA:A5CMV5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMV5"
FT                   /protein_id="CAN00391.1"
FT                   /translation="MTAVAERPGEAPPGVRPDVDERAPRRRPDRQKALALVVVLAMVAF
FT                   AVHALTTLDFTWSNVLRSVGNAAKVFSRMDPISFPAPGDLAYLIGLTLGIVVLGTLAAA
FT                   LVSVPVAYASARNTTPAPWLRGLGRTIGVVTRAVPDVVLALAFALAFALGSPLPGILAI
FT                   GIHSIGMISKLFADAIEQVDEGPQRAIRTTGGTRAQEFWAGVFPQVLPSWIATVLHRFD
FT                   INLRGSAILGYAGVGGLGYAMKVAFGQFPEGYGRGIGIAIVIFALCVLLEVVSSSIRRS
FT                   ALGVRPAGRGLGDRIVRRLTRGRALPERAGSAGTARAVTVESMQRRPWTPDRVRTVAWS
FT                   ALAVVVVVGGYLMADIDLGQITWEYVGPTFQSFWPPSTGSHTFGEFAEALLVTIQVAFA
FT                   AALLSVVLAFVVGSLAARNVAPSPAVRNAARTVLVVFRGVPELVLAILLIMITGLGNQA
FT                   GVVALAFGGVGLLGKLIADSFEEVGAGPERALTAVGATRGQRFLAATWPQGLPSLVGNS
FT                   LYLVDTNIRAATILGIVGGSGIGFHLTNASSVMTLHGQVTTLVAMVFVSVLAVEALAAW
FT                   LRRVFR"
FT   CDS_pept        450376..451269
FT                   /transl_table=11
FT                   /gene="panE"
FT                   /locus_tag="CMM_0370"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /function="Ketopantoate reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="putative 2-dehydropantoate 2-reductase (NP_337148.1|
FT                   oxidoreductase, ketopantoate reductase family
FT                   [Mycobacterium tuberculosis CDC1551];; Q9ABG6|PANE_CAUCR
FT                   Putative 2-dehydropantoate 2-reductase (Ketopantoate
FT                   reductase)). Catalyzes the NADPH-dependent reduction of
FT                   ketopantoate into pantoic acid. InterPro: Ketopantoate
FT                   reductase ApbA/PanE. pfam02558, ApbA,Ketopantoate reductase
FT                   PanE/ApbA. apbA_panE: 2-dehydropantoate 2-reductas"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0370"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00392"
FT                   /db_xref="GOA:A5CMV6"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMV6"
FT                   /protein_id="CAN00392.1"
FT                   /translation="MTPALPAVAVVGPGAIGTSVAAALHEAGVPVLLCGRTARDRLVLV
FT                   ADDATVVVPGPVRTDPAGISAPVDLVLLAVKATQVEAAAPWLRALCHAGTVVVVLQNGI
FT                   EQVGDVAPHVPGCPVVPAVVWFPAEARADGSVLLRGDPRITLPDMPTSRVAVDALAGGR
FT                   CRVELAADFRTVAWRKLVQNAVAGIMAATGRRAGVFRRDDVAGLARGYARECLAVARAE
FT                   GAHLDDGVADRIVDDFRAAPADQGTSILADREAGRPLEWEARNGVILRRARAHGLPTPI
FT                   GDVLVPLLAAASDGPG"
FT   CDS_pept        complement(451286..451903)
FT                   /transl_table=11
FT                   /gene="phnX"
FT                   /locus_tag="CMM_0371"
FT                   /product="putative acetyltransferase"
FT                   /function="Acetyltransferase (isoleucine patch
FT                   superfamily)"
FT                   /EC_number="2.3.1.-"
FT                   /note="putative acetyltransferase (NP_530883.1|
FT                   acetyltransferase [Agrobacterium tumefaciens str. C58];;
FT                   NP_437997.1| putative acetyltransferase protein
FT                   [Sinorhizobium meliloti 1021])."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0371"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00393"
FT                   /db_xref="GOA:A5CMV7"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR017694"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMV7"
FT                   /protein_id="CAN00393.1"
FT                   /translation="MTTKLTEEPLIAPDVVMSGSDLGRWTQIGASTRLLDTVIGDYSYC
FT                   DRLCDFAHTDVGRFSNIASAVRVGATDHPLDRATLHHFMYRSTMYWDDVEDDAEFFEHR
FT                   RSRRTSIGHDTWIGHGAMIKPGVRVGDGAVVASGAVVTRDVPDYAIVAGVPATVIRFRQ
FT                   PPEIAERLRRLAWWDWDHATLRARLDDFRALPTEAFLERYEG"
FT   CDS_pept        complement(451900..452610)
FT                   /transl_table=11
FT                   /gene="phnN"
FT                   /locus_tag="CMM_0372"
FT                   /product="conserved hypothetical protein involved in
FT                   phosphonate metabolism"
FT                   /function="Uncharacterized component of phosphonate
FT                   metabolism"
FT                   /note="conserved hypothetical protein involved in
FT                   phosphonate metabolism (NP_085695.1| ATP-binding component
FT                   of phosphonate transport [Mesorhizobium loti MAFF303099];;
FT                   AAL52063.1| PHOSPHONATES TRANSPORT ATP-BINDING PROTEIN PHNN
FT                   [Brucella melitensis 16M])."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0372"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00394"
FT                   /db_xref="GOA:A5CMV8"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR012699"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMV8"
FT                   /protein_id="CAN00394.1"
FT                   /translation="MSDAVSAGTSPAAASPAAPAPVPLGPGPFVAVVGASGVGKDALLG
FT                   AARARSGPDAHFPRRAITRPPGPGEDFDALGDEEFAAAAARGDYAVTWRAHGLSYGIPA
FT                   TADAAVRAGAAVVANVSRSMLDVLQARYARLVVVRITVSEDVRAARLRERGREAADDIA
FT                   RRLARQDPAPDRVADHEVRNHGTVAEGGEALLRAIRAARASALAGSAPAGSLPAASPLP
FT                   HPIDPAPRGRTETP"
FT   CDS_pept        complement(452607..453788)
FT                   /transl_table=11
FT                   /gene="phnM"
FT                   /locus_tag="CMM_0373"
FT                   /product="putative metal-dependent hydrolase involved in
FT                   phosphonate metabolism"
FT                   /function="Metal-dependent hydrolase involved in
FT                   phosphonate metabolism"
FT                   /note="putative metal-dependent hydrolase involved in
FT                   phosphonate metabolism (ZP_00195547.1| COG3454:
FT                   Metal-dependent hydrolase involved in phosphonate
FT                   metabolism [Mesorhizobium sp. BNC1];; ZP_00124006.1|
FT                   COG3454: Metal-dependent hydrolase involved in phosphonate
FT                   metabolism [Pseudomonas syringae pv. syringae B728a]).
FT                   BELONGS TO AN OPERON INVOLVED IN ALKYLPHOSPHONATE UPTAKE
FT                   AND C-P LYASE. EXACT FUNCTION NOT KNOWN."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0373"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00395"
FT                   /db_xref="GOA:A5CMV9"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR012696"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMV9"
FT                   /protein_id="CAN00395.1"
FT                   /translation="MSRETVLRNARIVLDDEVLHGSVLIRDGLVADISPGTAGEVGGTG
FT                   DDLDGDLLIPGLVELHTDHLESHAQPRPGTRWDPIPAVLAHDAQLSGAGVTTVFDAIRI
FT                   GTLEGRDDATTLSLSLAEAIEHAVAAGLLRAEHLIHLRCEVAAPGTVAEFREFDRIASV
FT                   RLASLMDHTPGQRQYADVEAFSRYMVGRGRVSQAGIGALMEELQDVAAEHSTPNRIAIA
FT                   ELATARGVTLAAHDDATVAHVEESAALGVRISEFPTTEVAARAAREHGQLIVMGAPNIV
FT                   RGGSQSGNVAAAELLALGLLDVLSSDYVPASPLQAIVQLDADGILPITRGVRLVSGDPA
FT                   RAVGLDDRGSIRVGARADLVRVHRHVVPASERHPGGRTVPVVRGVHLRGARVS"
FT   CDS_pept        complement(453785..454531)
FT                   /transl_table=11
FT                   /gene="phnV"
FT                   /locus_tag="CMM_0374"
FT                   /product="Conserved hypothetical protein possibly involved
FT                   in phosphonate metabolism"
FT                   /note="Conserved hypothetical protein possibly involved in
FT                   phosphonate metabolism (ZP_00195546.1| hypothetical protein
FT                   MBNC02000901 [Mesorhizobium sp. BNC1];; NP_697873.1|
FT                   conserved hypothetical protein [Brucella suis 1330]).
FT                   pfam06299, DUF1045, Protein of unknown function (DUF1045).
FT                   This family consists of several hypothetical proteins from
FT                   Agrobacterium, Rhizobium and Brucella species. The function
FT                   of this family is unknown."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0374"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00396"
FT                   /db_xref="InterPro:IPR009389"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMW0"
FT                   /protein_id="CAN00396.1"
FT                   /translation="MTRVAVYAIPGVGSDGPVAILLRERAEAWLGRSVVGGSAAPAPGA
FT                   PAGWTRAEVDAVTVDARRYGFHGTLKAPFRLADGHDLDGLEAAVADLAGSRDPVALPGL
FT                   RVASLGGFLALVPTGPVPALDALAADVVMRLDGFRAPPTDAETARRDPASLSPRQRELL
FT                   ATWGYPHVLDRFRFHLTLTDRIPAAARPRAEAALVAWFADATDRPVAVDALALVVEDAP
FT                   GAPFRLRSVHPLHPRATPAPDPEGPR"
FT   CDS_pept        complement(454528..455286)
FT                   /transl_table=11
FT                   /gene="phnL"
FT                   /locus_tag="CMM_0375"
FT                   /product="putative phosphonate ABC transporter, ATPase"
FT                   /function="ABC-type polar amino acid transport system
FT                   ATPase component"
FT                   /note="putative phosphonate ABC transporter, ATPase
FT                   (NP_104472.1| ATP-binding component of phosphonate
FT                   transport, HisP-like nucleotide binding protein
FT                   [Mesorhizobium loti MAFF303099];; NP_767866.1| phosphonate
FT                   uptake transporter ATP-binding protein [Bradyrhizobium
FT                   japonicum USDA 110]). PART OF THE BINDING-PROTEIN-DEPENDENT
FT                   TRANSPORT SYSTEM FOR ALKYLPHOSPHONATES. PROBABLY
FT                   RESPONSIBLE FOR ENERGY COUPLING TO THE TRANSPORT SYSTEM.
FT                   pfam00005, ABC_tran, ABC transporter."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0375"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00397"
FT                   /db_xref="GOA:A5CMW1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012701"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMW1"
FT                   /protein_id="CAN00397.1"
FT                   /translation="MIRPMTGSTPGPVPATAPILTVDDVAKTFTMHLQGGQRLAVLDGL
FT                   SFVVGRAEAVVLGGASGAGKSTVLKLVYGNYLADRGRIVVHAPGGDVDMATAPPRAVLA
FT                   ARRDAVGYVSQFLRCVPRVGTLDVVAEPLVERGVDAEDARDRAARILTRLSIPERLWSL
FT                   PPATFSGGEQQRVNVARGFLPELPLLLLDEPTASLDARNRDVVVELIAEKRAAGVGMLG
FT                   IFHDAEVRAAVADRAVDVEAFVPAVAVAAR"
FT   CDS_pept        complement(455283..456062)
FT                   /transl_table=11
FT                   /gene="phnK"
FT                   /locus_tag="CMM_0376"
FT                   /product="putative phosphonate ABC transporter, ATPase"
FT                   /function="ABC-type phosphonate transport system ATPase
FT                   component"
FT                   /note="putative phosphonate ABC transporter, ATPase
FT                   (NP_530885.1| ABC transporter, nucleotide binding/ATPase
FT                   protein [phosphonate] [Agrobacterium tumefaciens str.
FT                   C58];; NP_437995.1| putative phosphonate uptake ABC
FT                   transporter ATP-binding protein [Sinorhizobium meliloti
FT                   1021]). pfam00005, ABC_tran, ABC transporter. InterPro: AAA
FT                   ATPase superfamily."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0376"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00398"
FT                   /db_xref="GOA:A5CMW2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012700"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMW2"
FT                   /protein_id="CAN00398.1"
FT                   /translation="MSDDRPLLEVRGAAHRYGDRYGCRDVDLDLHPGEVLAVVGESGSG
FT                   KSTLLGTLSQRLALSEGSIRYRLADGEVVELADLSESAVRRLWRSEWGFVHQDPADGLR
FT                   MHVSAGGNVGEPLMTNGWRHYRRIRETAAEWLRHVEIPVDRIDDHPTTFSGGMRQRLQI
FT                   ARNLVVSPRLVFMDEPTSGLDVSVQARLLDLIRGLVAELGLAVVIVTHDLAVARLISHR
FT                   TLVMKDGRVIESGLTDRVLDDPQAAYTQLLVSSILQG"
FT   CDS_pept        complement(456059..456928)
FT                   /transl_table=11
FT                   /gene="phnJ"
FT                   /locus_tag="CMM_0377"
FT                   /product="putative C-P (carbon-phosphorus) lyase"
FT                   /function="Uncharacterized enzyme of phosphonate
FT                   metabolism"
FT                   /note="putative C-P (carbon-phosphorus) lyase (NP_418522.1|
FT                   phosphonate metabolism; conserved protein in phn operon
FT                   [Escherichia coli K12];; NP_437994.1| putative C-P
FT                   (carbon-phosphorus) lyase component protein [Sinorhizobium
FT                   meliloti 1021]). pfam06007, PhnJ,Phosphonate metabolism
FT                   protein PhnJ."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0377"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00399"
FT                   /db_xref="GOA:A5CMW3"
FT                   /db_xref="InterPro:IPR010306"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMW3"
FT                   /protein_id="CAN00399.1"
FT                   /translation="MSASLIGYNLGYLDEQTKRMIRRALLKAVAIPGFQVPFASREVPM
FT                   PRGWGTGGVQVTAAVIGEDDVLKVIDQGADDTTNAVSIRQFFASVAGVATTTRTDEATV
FT                   IQTRHRIPETPLAEGQVIVYQVPMPEPLRFLEPRETETRRLHALEEYGLMYVKLYEDIA
FT                   RFGHVAKTYDYPVMVAGRYLMAPSPVPSFDNPKMHMSPALQLFGAGREKRIYAVPPYTS
FT                   VESLGFEDHPFEPQSFEDPCAICGSTGVYLDEVITDDRGASMHVCSDTDHCERTVEAAR
FT                   AHDEEARA"
FT   CDS_pept        complement(456925..458040)
FT                   /transl_table=11
FT                   /gene="phnI"
FT                   /locus_tag="CMM_0378"
FT                   /product="conserved hypothetical protein involved in
FT                   phosphonate metabolism"
FT                   /function="Uncharacterized enzyme of phosphonate
FT                   metabolism"
FT                   /note="conserved hypothetical protein involved in
FT                   phosphonate metabolism (NP_104468.1| hypothetical protein,;
FT                   ZP_00205860.1| COG3626: Uncharacterized enzyme of
FT                   phosphonate metabolism [Pseudomonas syringae pv. syringae
FT                   B728a]). pfam05861, PhnI, Bacterial phosphonate metabolism
FT                   protein . Bacteria that use phosphonates as a phosphorus
FT                   source must be able to break the stable carbon-phosphorus
FT                   bond. In Escherichia coli phosphonates are broken down by a
FT                   C-P lyase that has a broad substrate specificity. The genes
FT                   for phosphonate uptake and degradation in E. coli are
FT                   organised in an operon of 14 genes, named phnC to phnP.
FT                   Three gene products (PhnC, PhnD and PhnE) comprise a
FT                   binding protein-dependent phosphonate transporter, which
FT                   also transports phosphate, phosphite, and certain phosphate
FT                   esters such as phosphoserine; two gene products (PhnF and
FT                   PhnO) may have a role in gene regulation; and nine gene
FT                   products (PhnG, PhnH, PhnI, PhnJ, PhnK, PhnL,PhnM, PhnN,
FT                   and PhnP) probably comprise a membrane-associated C-P lyase
FT                   enzyme complex."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0378"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00400"
FT                   /db_xref="GOA:A5CMW4"
FT                   /db_xref="InterPro:IPR008773"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMW4"
FT                   /protein_id="CAN00400.1"
FT                   /translation="MYVAVKGGEKAIAAAHALLAAEGRGAPGSARIEAGQVAGQLGVLV
FT                   SRVMTEGSLHDPELAARALIQAQGDVLEAVTLLRSYRTTLPRFGCTLPVDTAGLPPQRR
FT                   VSATFKDLPGGQQLGATFDYTHRLFTDAEPAAVTSRAADAGATMPRVADLLGQSALIEP
FT                   DSHPGQDDEEPADITREPTVHPMTRAERLQALARGDEGFLLGLGYSTQRGFGTTHPFAG
FT                   EIRVGEVEVELDAPELGFAVPLGRIEVTECQMVNQFTGSADRPAQFTRGYGLAFGRSER
FT                   KAMSMALVDRALRADELGERVTAPAQDEEFVISHCDNVQATGFVEHLKLPHYVDFQAEL
FT                   VLVRRLAREWRERQEAPEASSDAPAGAGARA"
FT   CDS_pept        complement(458040..458687)
FT                   /transl_table=11
FT                   /gene="phnH"
FT                   /locus_tag="CMM_0379"
FT                   /product="putative C-P (carbon-phosphorus) lyase component"
FT                   /function="Uncharacterized enzyme of phosphonate
FT                   metabolism"
FT                   /note="putative C-P (carbon-phosphorus) lyase component
FT                   (NP_104467.1| hypothetical protein, ; NP_946047.1| putative
FT                   PhnH protein, phosphonate metabolism, function unknown
FT                   [Rhodopseudomonas palustris CGA009]). pfam05845,PhnH,
FT                   Bacterial phosphonate metabolism protein ."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0379"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00401"
FT                   /db_xref="GOA:A5CMW5"
FT                   /db_xref="InterPro:IPR008772"
FT                   /db_xref="InterPro:IPR038058"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMW5"
FT                   /protein_id="CAN00401.1"
FT                   /translation="MTAATGRAPGIPAPGIPAPGFGDATRGAQAAFRALLDALAHPTRI
FT                   QPLTGPAEAPAGLGPGLGAVALTVLDEESALWLDPRRAADDEVTSWLTFHTGVRLVTAA
FT                   SDADFVLADPASLPPLAALAAGTDEEPHRSATALLDVRDAAGTMRIRAEGPGIDGHAIA
FT                   DAPWADEGFLDAWRANGERFPRGVDLLLVDAGSVAALPRTTRLRAADPRSEA"
FT   CDS_pept        complement(458684..459175)
FT                   /transl_table=11
FT                   /gene="phnG"
FT                   /locus_tag="CMM_0380"
FT                   /product="putative C-P (carbon-phosphorus lyase component"
FT                   /function="Uncharacterized enzyme of phosphonate
FT                   metabolism"
FT                   /note="putative C-P (carbon-phosphorus lyase component
FT                   (NP_530889.1| conserved hypothetical protein [Agrobacterium
FT                   tumefaciens str. C58];; NP_437991.1| putative C-P
FT                   (carbon-phosphorus lyase component protein [Sinorhizobium
FT                   meliloti 1021]). pfam06754, PhnG,Phosphonate metabolism
FT                   protein PhnG. The exact function of PhnG is unknown,
FT                   however it is thought likely that along with six other
FT                   proteins PhnG makes up the the C-P (carbon-phosphorus)
FT                   lyase."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0380"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00402"
FT                   /db_xref="GOA:A5CMW6"
FT                   /db_xref="InterPro:IPR009609"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMW6"
FT                   /protein_id="CAN00402.1"
FT                   /translation="MTTTTTSSAGREDVAARQRWMRVLSAADAGALDAAWTAWEPKPCV
FT                   QHIRGPEAGLVMVRGRVDAGGARFNVGEATVTRATLRLHGPVMAADALGSSYVLGSDLE
FT                   HARLAALFDGMLLDAGLHDRVLAEVVAPLERARAEADDVRAAEARSTLVDFFTVARENG
FT                   "
FT   CDS_pept        459383..460120
FT                   /transl_table=11
FT                   /gene="phnF"
FT                   /locus_tag="CMM_0381"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /function="Transcriptional regulators"
FT                   /note="putative transcriptional regulator, GntR family
FT                   (NP_530890.1| transcriptional regulator, GntR family
FT                   [Agrobacterium tumefaciens str. C58 (U. Washington)];;
FT                   NP_698105.1| transcriptional regulator, GntR family
FT                   [Brucella suis 1330]). putative regulator of the phn
FT                   operon. pfam00392, GntR, Bacterial regulatory proteins,gntR
FT                   family. This domain comprises the N-terminal HTH-containing
FT                   region of GntR-like bacterial transcription factors. At the
FT                   C terminus there is usually an
FT                   effector-binding/oligomerisation domain. InterPro:
FT                   Bacterial regulatory proteins GntR family."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0381"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00403"
FT                   /db_xref="GOA:A5CMW7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR012702"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMW7"
FT                   /protein_id="CAN00403.1"
FT                   /translation="MATQSRSTSGYSAWRLIAEELRAEILQGTVPAGAKLSSESELAER
FT                   FQVHRHTVRQAVAALATDGLVVSRRGSGTFVTAHDVIVHRIGLRTRLSDSLAGRGSAST
FT                   GELLEWAVEDPPADVAERLALAGRPALRLETLRLVDGRPVVRGTSWLVEELVPGIVDRY
FT                   GPDGSMTNALRAVGVDDYLRSATTVTGRLATAAESAELQLSSGAVVLVVRALNTLPDGT
FT                   PLLINVTRFAADRVELDVEHSRA"
FT   CDS_pept        460220..461437
FT                   /transl_table=11
FT                   /locus_tag="CMM_0382"
FT                   /product="putative multidrug efflux MFS permease"
FT                   /note="putative multidrug efflux MFS permease (NP_737817.1|
FT                   putative multidrug resistance protein [Corynebacterium
FT                   efficiens YS-314];; NP_962079.1| hypothetical protein
FT                   MAP3145c [Mycobacterium avium subsp. paratuberculosis str.
FT                   k10]). pfam00083, Sugar_tr, Sugar (and other) transporter."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0382"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00404"
FT                   /db_xref="GOA:A5CMW8"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMW8"
FT                   /protein_id="CAN00404.1"
FT                   /translation="MPDTRGPAKAPRAKLPRDVLVLGVIALFVMVGFGVVVPVLPVYAE
FT                   SFGVGSFEVGAVISAFALMRFVMSPFVARLIDWSGERTVLAVGIGIVAVSSGLAGLAQD
FT                   YVQLLLLRGAGGIGSAMFSVAAMTLLLGSTDPTRRARAIGFYQGGFLIGGMAGPALGAV
FT                   LATISLTAPFFFYAATLAVASVIGLLLLRPRTRDVAATGADEVVIPFGRVLRDPRYRAA
FT                   LLANLGNGWASMGVRSALIPLLVVAVIGADPSATGIAFACAAVVQALALAPAARFVDTR
FT                   GRRPAIVGAYGVAGLLMIAIPFAPDMVVLTVLLCVYGAAASFMGTAPAAAVGDAAGARS
FT                   GRPVAVFSMVSDLGAIVGPLVAGFLADAFSYPVAFATGAVLLLAASAYALLRMPRDERA
FT                   AAPAAS"
FT   CDS_pept        461542..464274
FT                   /transl_table=11
FT                   /gene="ppcA"
FT                   /locus_tag="CMM_0383"
FT                   /function="Phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /note="phosphoenolpyruvate carboxylase (ZP_00293827.1|
FT                   COG2352: Phosphoenolpyruvate carboxylase [Thermobifida
FT                   fusca];; NP_695792.1| phosphoenolpyruvate carboxylase
FT                   [Bifidobacterium longum NCC2705]). pfam00311,
FT                   PEPcase,Phosphoenolpyruvate carboxylase."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0383"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00405"
FT                   /db_xref="GOA:A5CMW9"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMW9"
FT                   /protein_id="CAN00405.1"
FT                   /translation="MTTPPKKPLPLEHDSTRDGTRDAVEPALRSDVSHLGGLLGQVLRE
FT                   SGGDDLLRDVERLRELVIDAYESARDASIDDAERLVATFTPERAEQVARAFTCYFHLAN
FT                   LAEEHHRVRVLREREAAAGFVPDSIPDAVGKLTEELGREEAMRRLGEMRFHPVLTAHPT
FT                   EARRRAVATGIRRIGDLLTERDGAMAGTLTGADVDRRLLEEIDGLWRTTPLRTTRPTPL
FT                   DEVRTAMGVFDQTLFEVVPRVYRLLDDWLLGDEAGVRDAVAPAFFRLGNWIAADRDGNP
FT                   YVTAAVTEEAAGIASEHILLGLERVALRVGRSLTLGDADTPPSAELRELAAAQDALAPH
FT                   LTARIGTRAPAELHRRVLLVIAGRLSATRERHDDPIAYPSAAELLADLRVLQASLRSAG
FT                   AHRIAGGELQGLVWQAETFGFHLAEMEVRQHSQVHREALREVLAVAAADASGDQAPELA
FT                   PMTVEVLDVFRTLARLQERHGVAPFSRFIVSFTQSADDIRTVHELAALALGSAEAAPVL
FT                   DVIPLFETFADLNASTEILDGMIRLPQVAARLAQTGRKLEVMLGYSDSSKDVGPVSATF
FT                   ALFDAQARIAAWARENDIELTLFHGRGGALGRGGGPADRAVRAQPPGSVDGRFKLTEQG
FT                   EVIFAHYGDKRIAARHIEQMAAATLLASAPSNEERNAVAAEGSAEMVRTMDEASRARFF
FT                   ELVKAPGFAPWFAQVTPMEEIGLLALGSRPARRGLSVESLEDLRAIPWVFAWTQARINL
FT                   TGWFGLGSALAAVGDEAVLRKAYEEWPLFTSMIDNVEMSLAKTDGRLAERYLALGDRPD
FT                   LAALVTEEMERTREWVRKATGRGEILEGRPVLRRAVRLRSPYVDALSLLQLRALRALRT
FT                   SASEAAGQGAPGQADPTDPDHRLLLLTVNGIAAGLQNTG"
FT   CDS_pept        complement(464495..464998)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0384"
FT                   /product="putative transcriptional regulator, Cro/CI
FT                   family"
FT                   /function="Predicted transcriptional regulators"
FT                   /note="putative transcriptional regulator, Cro/CI family
FT                   (NP_863201.1| hypothetical protein [Staphylococcus
FT                   epidermidis ATCC 12228];; NP_900580.1| hypothetical protein
FT                   CV0910 [Chromobacterium violaceum ATCC 12472]). pfam01381,
FT                   HTH_3, Helix-turn-helix. This large family of DNA binding
FT                   helix-turn helix proteins includes Cro and CI."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0384"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00406"
FT                   /db_xref="GOA:A5CMX0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMX0"
FT                   /protein_id="CAN00406.1"
FT                   /translation="MNGTRIVDLRTQRGWTQERLAEASGITVRTVQRLEAGNDASLDTL
FT                   TRVATALAVQVGDLTTAPDESVLGRDVPALDTRAARQQERRDTITDGLEALYYGVGALL
FT                   TIGVIVGIKTDAFANHAIYLIPAYWIAGWLLSLFLFLVVLSPRLDRRFPLSRDRREPTP
FT                   DGRT"
FT   CDS_pept        complement(465146..466255)
FT                   /transl_table=11
FT                   /gene="ltaE"
FT                   /locus_tag="CMM_0385"
FT                   /product="putative L-threonine aldolase"
FT                   /function="Threonine aldolase"
FT                   /EC_number="4.1.2.5"
FT                   /note="High confidence in function and specificity"
FT                   /note="putative L-threonine aldolase (NP_822663.1| putative
FT                   L-threonine aldolase [Streptomyces avermitilis MA-4680];;
FT                   YP_011095.1| threonine aldolase, low-specificity
FT                   [Desulfovibrio vulgaris subsp. vulgaris str.
FT                   Hildenborough]). Catalyzes the cleavage of L-allo-threonine
FT                   and L- threonine to glycine and acetaldehyde. Can also act
FT                   on L-erythro- phenylserine L-threo-phenylserine
FT                   L-beta-34-methylenedioxyphenylserine and
FT                   L-beta-34-dihydroxyphenylserine."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0385"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00407"
FT                   /db_xref="GOA:A5CMX1"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMX1"
FT                   /protein_id="CAN00407.1"
FT                   /translation="MDPVTDATAASPVSPLRLHDTAARGFASDNYSGIHPEVLEAIAAA
FT                   NGGHQVAYGGDAYTARLQEVVGEHFGRGAEAFPVFNGTGANVTGLLSMLPRWGAVVCAT
FT                   TAHINTDEGGAPERVAGIKLLQVPTDDGKLTPELIDREAWGWGDEHRAQPLAVSITQTT
FT                   ELGTVYTPAEVRAIADHAHERGMRLHMDGARLSNAAATLDAPFRAFTSDAGVDVVSFGG
FT                   TKNGLLYGEAIVVLDPEASEGLTYLRKLNMQLASKMRFVSAQLLALLGSEVDGVPLYLR
FT                   SARHANGMAARLRSALDGVDGVEFTQETQANGLFAILPEGVADRLRGEFRFYDWDPARR
FT                   EVRWMCSFDTTEDDIDRFAAAIRREVGAG"
FT   CDS_pept        complement(466292..466948)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0386"
FT                   /product="putative NTP pyrophosphohydrolase"
FT                   /function="NTP pyrophosphohydrolases including oxidative
FT                   damage repair enzymes"
FT                   /note="putative NTP pyrophosphohydrolase (NP_624609.1|
FT                   conserved hypothetical protein SCF85.08c [Streptomyces
FT                   coelicolor A3(2)];; ZP_00229098.1| COG0494: NTP
FT                   pyrophosphohydrolases including oxidative damage repair
FT                   enzymes [Kineococcus radiotolerans SRS30216]).
FT                   pfam00293,NUDIX, NUDIX domain."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0386"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00408"
FT                   /db_xref="GOA:A5CMX2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR004385"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMX2"
FT                   /protein_id="CAN00408.1"
FT                   /translation="MTRPGETVPDSRGRSGLHLRGTDLDRNPDVVVKRVEVTSDGWHVL
FT                   RRTTLDLRLRDGSWQEQQRETYDRGDGATVLLYAADTHRILLTRQFRYPAYVNGHPDGM
FT                   LVEAAAGLLDEDSPEDAIRREAREELGVEIVALTHLFDLFMSPGSVTERVHHYLASYTP
FT                   ADVVGAGGGVAEEGEDIERIEVTLDEALAMVADGRIADGKTVILLQHVALHGFPA"
FT   CDS_pept        complement(467019..468287)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0387"
FT                   /product="putative NAD(FAD)-dependent dehydrogenase"
FT                   /function="putative NAD(FAD)-dependent dehydrogenases"
FT                   /note="putative sulfide:quinone oxidoreductase
FT                   (NP_440916.1| hypothetical protein [Synechocystis sp. PCC
FT                   6803];; ZP_00084090.1| COG0446: Uncharacterized
FT                   NAD(FAD)-dependent dehydrogenases [Pseudomonas fluorescens
FT                   PfO-1]). , pfam00070, Pyr_redox, Pyridine
FT                   nucleotide-disulphide oxidoreductase. This family includes
FT                   both class I and class II oxidoreductases and also NADH
FT                   oxidases and peroxidases."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0387"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00409"
FT                   /db_xref="GOA:A5CMX3"
FT                   /db_xref="InterPro:IPR015904"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMX3"
FT                   /protein_id="CAN00409.1"
FT                   /translation="MTDAPGTTPHHDVLVIGGGNAGLSVAGRLRRYGVDDVAVIEPRDT
FT                   HYYQPMFSHVAGGTARASQATRPQGSVTPKGVTWIRDRVAGIDPVAKTVTLESGARLSY
FT                   GDLIVCPGIQKDWDRVPGLAEAMDSPVGISNYEHHYARKASRVLRDVRSGTVVFTQPDG
FT                   PGTCSGAAQKPVYLACDHWRTIGVLDDIRVVLVVPTPTMFGMPLVDAELERKVAEYGIE
FT                   VRYGRELVGVDPAARTVEIAGVDRARALLGPDHAAQQGLADADRETLRYDVLHAVPPQS
FT                   APDWLAGTGLTAPGDAGGFVEVDPLTLRHPRFPDVWALGDAAATTNSKSGGALRQQTTT
FT                   VAKNLVAALKGKPLPQTYDGYSVCPFVVSRSTVVFAEFDDRYRPKPTIPGWTGLAKERR
FT                   LTFLADRYVLPWVYWNLILQGRA"
FT   CDS_pept        468608..469054
FT                   /transl_table=11
FT                   /locus_tag="CMM_0388"
FT                   /product="putative alkaline shock protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /note="putative stress-like protein (; NP_626104.1|
FT                   putative stress-like protein [Streptomyces coelicolor
FT                   A3(2)]). pfam03780, DUF322, Protein of unknown function
FT                   (DUF322). This is a family of small proteins. It includes a
FT                   protein identified as an alkaline shock protein, so may be
FT                   involved in stress response."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0388"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00410"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMX4"
FT                   /protein_id="CAN00410.1"
FT                   /translation="MTDVTPATASSRAAAKHTPADSAAGKNTIADGVVEKVAGIAARQV
FT                   PGVHDLGNGAARAVGAIRNVIGQQDRGQGISVEVGEKQVAADIVVVAEYPVALQDLADR
FT                   IRESVTDAISQVVGMDVTEVNVTVSDVHIPSDDKDDDDSKSRVQ"
FT   CDS_pept        469277..470095
FT                   /transl_table=11
FT                   /gene="aqpZ"
FT                   /locus_tag="CMM_0389"
FT                   /function="putative aquaporin"
FT                   /note="putative Aquaporin (ZP_00032143.1| COG0580: Glycerol
FT                   uptake facilitator and related permeases (Major Intrinsic
FT                   Protein Family) [Burkholderia fungorum];; NP_884218.1|
FT                   aquaporin Z [Bordetella parapertussis 12822]). Transport of
FT                   water across the membrane. Possibly involved in the
FT                   adaptation to variation in intravacuolar pH or osmolarity.
FT                   MIP: MIP family channel proteins pfam00230, MIP, Major
FT                   intrinsic protein. MIP (Major Intrinsic Protein) family
FT                   proteins exhibit essentially two distinct types of channel
FT                   properties: (1) specific water transport by the aquaporins,
FT                   and (2) small neutral solutes transport, such as glycerol
FT                   by the glycerol facilitators."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0389"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00411"
FT                   /db_xref="GOA:A5CMX5"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR034294"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMX5"
FT                   /protein_id="CAN00411.1"
FT                   /translation="MSKSTATTKAPRDTPAQGRGRKAASAGDRPSTAARWGAEAFGTFL
FT                   LVFGGVGTALYASAFPDDGNATGVGFLGVALAFGLTVMAGVAAVGGISGGHFNPAVSVG
FT                   LAFAGRIGWREVPGYVVAQLVGGILGSSALALIAADGPAGYLASAQDAGFASNGFGDAS
FT                   PGGFGLGAVLLVEVILTAVFVTVILAVNGQKAYAAVAPIVIGLTLTLIHLISIPVSNTS
FT                   VNPARSISAAIYGGPVALGQVWAFIVAPLVGAAIAGLAHLALTRAADVPA"
FT   CDS_pept        470190..471176
FT                   /transl_table=11
FT                   /locus_tag="CMM_0390"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein (similarities of the N-terminal
FT                   part to: ZP_00189314.2| COG1302: Uncharacterized protein
FT                   conserved in bacteria [Kineococcus radiotolerans
FT                   SRS30216];; NP_626104.1| putative stress-like protein
FT                   [Streptomyces coelicolor A3(2)])."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0390"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00412"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMX6"
FT                   /protein_id="CAN00412.1"
FT                   /translation="MNDAAPAIRPIDLTGIDAAHPEGETTAHRVGVAAAETAAGVTGVH
FT                   HLGGTAARALDAASRAIRGTSTGPGVTVSEEAGDTVIDIDLVVEYPTPVQDVVDETREQ
FT                   VARAARQIAAGSVRVNIRVTDVHGPFDDEQSPAGAALERAKDAGSDALEKAEDAGSDAL
FT                   EKTKAAGPEGLEKAKAAGSEAADRAREAGDRIQDASADAAARAQDAGSRAADAAKEIGA
FT                   EAADRAKAAGAVLADSAKADVEETRDAAEERDERAAADSADDAADFDTYATHAGPAPEV
FT                   TVVVDGHGDGTTRVEVDGPATVEVQGDRVEVDGAAVPRDDAEAADRS"
FT   CDS_pept        complement(471212..471784)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0391"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein (ZP_00057389.1| hypothetical
FT                   protein [Thermobifida fusca];; CAF19543.1| secreted protein
FT                   [Corynebacterium glutamicum ATCC 13032])."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0391"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00413"
FT                   /db_xref="InterPro:IPR026004"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMX7"
FT                   /protein_id="CAN00413.1"
FT                   /translation="MAVAARRILPSAFAAVLLAAALSGCSLQQLADLVPHAETRDDDGS
FT                   ITAGGTTDVFTLRAGDCLDDAASAAVVEQDAADAHPASDDDSAHSHEVGDVSTVPCSEP
FT                   HDFEVYAVPTLTSDDYPGDDAVDAQADDLCGSAFGPFVGFDYQDSIYDYLGYKPTSESW
FT                   STGDRVVDCVIGDPAGKTVGSLAGIGR"
FT   CDS_pept        complement(471875..472327)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0392"
FT                   /product="conserved hypothetical protein"
FT                   /function="Predicted membrane protein"
FT                   /note="conserved hypothetical protein (ZP_00223109.1|
FT                   COG3152: Predicted membrane protein [Burkholderia cepacia
FT                   R1808];; NP_708910.1| putative cytochrome [Shigella
FT                   flexneri 2a str. 301]). pfam05656, DUF805, Protein of
FT                   unknown function (DUF805)."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0392"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00414"
FT                   /db_xref="GOA:A5CMX8"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMX8"
FT                   /protein_id="CAN00414.1"
FT                   /translation="MTDATPPGSRTHLELPLYGASWQEAMRRFFLKYATFRGRASRGEF
FT                   WWWILTSVVGTSALQTLSSVNADRREPLGGLGFLDELTIVDSWSAVLAVLQLAVSVPSL
FT                   AVSWRRLHDVDRSGTWTFITFIPILGLIVYVVMTAGRSRPGGARFD"
FT   CDS_pept        complement(472374..473138)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0393"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /note="conserved hypothetical protein (NP_854517.1|
FT                   HYPOTHETICAL PROTEIN [Mycobacterium bovis subsp. bovis
FT                   AF2122/97];; BAC00185.1| Hypothetical protein
FT                   [Corynebacterium glutamicum ATCC 13032])."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0393"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00415"
FT                   /db_xref="InterPro:IPR014513"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMX9"
FT                   /protein_id="CAN00415.1"
FT                   /translation="MTGADPGAILLIGAEARDVLHAAQGRTTALRGTTDVDIGIALSGW
FT                   SAYEGVRQAFVPVGHTGIRFRIADMAVDVVPFGGVEDPRGLARPRGREDDAIVVFGFVE
FT                   VMRRAWILPLPSGVGIRVPRVEGYAALKMRAWIDRSPDHEEKDADDLALALHWYLVDPD
FT                   VLTRAWEEGERLDEADGDVTLVIASLLGSDVAAALSASDCEDLLPRWLAMDLDALARAF
FT                   SRENGRPWTGDPARARLLLDALTRGVVFGPSA"
FT   CDS_pept        complement(473188..474225)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0394"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /note="conserved hypothetical protein (NP_215352.1|
FT                   hypothetical protein Rv0837c [Mycobacterium tuberculosis
FT                   H37Rv];; NP_601982.1| hypothetical protein NCgl2692
FT                   [Corynebacterium glutamicum ATCC 13032]))."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0394"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00416"
FT                   /db_xref="InterPro:IPR019238"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMY0"
FT                   /protein_id="CAN00416.1"
FT                   /translation="MHPSNTSVLLRDVIAIEAWLQEHALHLVTPGPHRTALDLTSLEPQ
FT                   RPADAVLEHADGTPVAELVVLPLLEMTHSAAVLHAPSAATDGRLLLLGPHTSSRGSAVL
FT                   RNAGIHHIDGAGNAWLRLPGVVVDIRGRPSPRPASPRGSSQAHLFSPSRASVVCALISW
FT                   PELVEAPVRTIAASARVSVGLAQDTLKMLEADGHLTTWPTRGLERIPQLIDRWAAAFPA
FT                   GLGSPARTRGYHAESLDVEAADAGVVRLSGEATAPGIRGLSAVVYTDESSMRLALRNRW
FT                   RTDREPNIFVRSLFWREPDEADASSLMGVAPPLVVYADLLASGEGRQRETARAMREADG
FT                   GLRAR"
FT   CDS_pept        complement(474322..474789)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0395"
FT                   /product="putative membrane protein"
FT                   /note="putative membrane protein (H83813 hypothetical
FT                   protein BH1312 [imported] - Bacillus halodurans (strain
FT                   C-125))."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0395"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00417"
FT                   /db_xref="GOA:A5CMY1"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMY1"
FT                   /protein_id="CAN00417.1"
FT                   /translation="MIDALQDFTNGLPEVLRWFGVMVTAMIPFLEVEFAAVLGVISGQH
FT                   VAIAVLAAVVGNVAVVALIVLVASRTRSRLTRDSAKEETPRRAKIRRTFDRYGVPGVSL
FT                   LGPLLVPTHFTSAAMVSFGARPRAVLIWETIAIAVWGVAFGALAVLGLTVV"
FT   CDS_pept        complement(474786..475919)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0396"
FT                   /product="putative Na+ efflux ABC transporter, permease
FT                   component"
FT                   /function="ABC-type Na+ efflux pump permease component"
FT                   /note="putative Na+ efflux ABC transporter, permease
FT                   component (ZP_00227879.1| COG1668: ABC-type Na+ efflux
FT                   pump, permease component [Kineococcus radiotolerans
FT                   SRS30216];; AAF04136.1| hypothetical ABC transporter
FT                   [Mycobacterium smegmatis])."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0396"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00418"
FT                   /db_xref="GOA:A5CMY2"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMY2"
FT                   /protein_id="CAN00418.1"
FT                   /translation="MSTTSSTRPGTAPTFAQSTMLVTGREVRMRLRSKSFLISTGILLV
FT                   GILASIIVSGFLTANGGLGGSGDPTRVAVVGSAQQAVSGAESLEGVPADSVEDAQAMVR
FT                   DGDVEAAVVPDTQADSDGAVLVIGDTSAPDGVVSALTDTPRVELLEEPTTNPAIAYIVA
FT                   IAFGLVFFISALTFGQIIAQSVVEEKQTRVVELLMSTIPVRALLAGKVLGNSILAFTQI
FT                   ALIALMTGVGLLVTEQTALLAVVGPAVIWFVVFFLFGFVLLASLFAAAASLVSRQEDVG
FT                   AVTAPVTYLVMIPYFAVIFFNDNPVVMTIMSYVPFSAPVGMPMRLFLGEAQWWEPLVSL
FT                   AVLIATTAVVVALGSRIYSNSLLRTGSRVKLREALRA"
FT   CDS_pept        complement(475916..476797)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0397"
FT                   /product="putative ABC transporter, ATP-binding protein"
FT                   /function="ABC-type uncharacterized transport system ATPase
FT                   component"
FT                   /note="putative ABC-Transporter, ATP binding protein
FT                   (ZP_00227878.1| COG4152: ABC-type uncharacterized transport
FT                   system, ATPase component [Kineococcus radiotolerans
FT                   SRS30216];; AAF04137.1| hypothetical ABC transporter
FT                   [Mycobacterium smegmatis]). InterPro: AAA ATPase
FT                   superfamily pfam00005, ABC_tran, ABC transporter."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0397"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00419"
FT                   /db_xref="GOA:A5CMY3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMY3"
FT                   /protein_id="CAN00419.1"
FT                   /translation="MLEVQNVTRSFGDRKVLDDVSFTVRPGRLTGFVGGNGAGKTTTMR
FT                   IMLGVLTADSGTVSLNGSDLGTSSRRTFGYMPEERGLYPKMKLQEQIVYLGRLHGMTAA
FT                   DATASTERLLDRLSLGERRNDPIESLSLGNQQRAQIAASLVHDPEVLVLDEPFSGLDPI
FT                   AVETVLGVLTERAAQGVPVLFSSHQLDIVERLCDDVVVIAEGRIRASGDREELREQHSR
FT                   PLTELQIDGDGGWVRDVPGVEVVEFDGGYVLFEAEEEARQRVLAEAVSRGSVTSFTRRR
FT                   PTLSEIFQEVVQ"
FT   CDS_pept        476999..477448
FT                   /transl_table=11
FT                   /locus_tag="CMM_0398"
FT                   /product="putative membrane protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0398"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00420"
FT                   /db_xref="GOA:A5CMY4"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMY4"
FT                   /protein_id="CAN00420.1"
FT                   /translation="MRFPTLVQAVADGASAAGCVLFALIATGIGTAPLAIGGLALLGLS
FT                   AIVRVVAIVWARRRLALLDRGRGARGAWRRWIHALWIVQCLAFVAGLVLAHSSVGAVAT
FT                   AAIVGVVVGVTSLALAGGAARRAGRGSGVDSRTGFVDSATVTAYA"
FT   CDS_pept        complement(477439..478344)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0399"
FT                   /product="conserved hypothetical protein"
FT                   /function="Gluconolactonase"
FT                   /note="conserved hypothetical protein, eventually
FT                   Ca2+-binding (NP_978918.1| regucalcin family protein
FT                   [Bacillus cereus ATCC 10987];; NP_626682.1| putative
FT                   calcium-binding protein [Streptomyces coelicolor A3(2)])."
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0399"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00421"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMY5"
FT                   /protein_id="CAN00421.1"
FT                   /translation="MTVRTWEAQPLDTVRSEHAEAPLWDEARGTLLWADQYVGIVREAT
FT                   LDPVTLAVGPVTETHVGGPVGAVVRHADGGHVLAARDGFVRLTAEGELIPMVDVLPADG
FT                   IRRRMNDGEVDPRGRLWAGSMAFDKTHGAGALYLLDGGAATTLLEGVTISNGTAFSADG
FT                   AEMLYIDTTTQQVRRFRVTDDDGSGRPGLADPEVVVEIDPADGHPDGMCLDDAGFLWVA
FT                   LWGGSEVRRYSPTGEHVGSVRVDAPQVSSCAFVGPDRDVLVITTSQEGYTPEDSARHPR
FT                   AGMLFAVRPGVTGPAASAYA"
FT   CDS_pept        complement(478341..479135)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0400"
FT                   /product="putative short chain dehydrogenase"
FT                   /function="Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /note="putative short chain dehydrogenase (ZP_00226079.1|
FT                   COG1028: Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)
FT                   [Kineococcus radiotolerans SRS30216];; CAF21988.1| Subunit
FT                   of 2-[hydroxy(phenyl)methyl]-succinyl-CoA DH; bbsD
FT                   [Azoarcus sp. EbN1]). pfam00106, adh_short, short chain
FT                   dehydrogenase. This family contains a wide variety of
FT                   dehydrogenases."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0400"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00422"
FT                   /db_xref="GOA:A5CMY6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMY6"
FT                   /protein_id="CAN00422.1"
FT                   /translation="MLIDLRDRVVVVSGAAQGIGRAIAERFLEEGCRVFGLDLRFRDAL
FT                   PEGVTAIVADVTDQASVRAAIAQVVEAAGRVDVLVNNAGINVEGSVETIDPARFQAAFD
FT                   VNVGGVFLLSQAVIPAMKAAGGGRIINAASFAAVIPSVGAAAYGASKAAVVQFTRVLAS
FT                   ELGPWGITVNAYAPGMIPTAMNGFAEMPEPAQDRLLDTLSIRRWERPDDVADLLVFLAS
FT                   DRAGYITGTLVDVSGGKLATQMPQRAYEGEGAPERGPRDGAR"
FT   CDS_pept        479188..479970
FT                   /transl_table=11
FT                   /locus_tag="CMM_0401"
FT                   /product="putative short-chain alcohol dehydrogenase"
FT                   /function="short-chain alcohol dehydrogenase"
FT                   /note="putative short-chain alcohol dehydrogenase
FT                   (ZP_00226078.1| COG1028: dehydrogenases with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenases) [Kineococcus radiotolerans SRS30216];;
FT                   NP_767148.1| hypothetical oxidoreductase [Bradyrhizobium
FT                   japonicum]). pfam00106, adh_short, short chain
FT                   dehydrogenase. This family contains a wide variety of
FT                   dehydrogenases."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0401"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00423"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMY7"
FT                   /protein_id="CAN00423.1"
FT                   /translation="MSGARTHDQHDDHDLDARGEGSASPRTLWISGAGSGVGRATAVAA
FT                   ARDGWRLVLSGRRREALEETRALVDDLGSTAVVAPLDVTDDAALAAVVADLDRLDGVVV
FT                   AAGLNAPRRSWAEQDVADFDRIVATNLTGPAHQVAAALPLLRASGGTVVLVSSYAAWTH
FT                   SPGAGVAYSASKTALGTLVRDLNAQEAGAGIRATHLCPGTIDSDFLALRPTVPDAAERA
FT                   AMLTPDDVARAAMFVLASPPHVRIDELVLSPMSQRGGF"
FT   CDS_pept        complement(479989..480438)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0402"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0402"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00424"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMY8"
FT                   /protein_id="CAN00424.1"
FT                   /translation="MLPGLVSWAVFTEPSASTAEDVEDWTQEFRIRVGRPPLGDLCDLG
FT                   HQEEGRYLLVAEDMTWTVCCYDGGIDVSMLDAAVESALVDAHERWLPPDSWVVEHAWMR
FT                   AATRGDLRRKALVARRNDIRNARWHRKHDPDGTLGRGYGEDDDED"
FT   CDS_pept        480919..482340
FT                   /transl_table=11
FT                   /gene="glpT"
FT                   /locus_tag="CMM_0403"
FT                   /product="putative glycerol-3-phosphate MFS permease"
FT                   /function="Sugar phosphate permease"
FT                   /note="putative glycerol-3-phosphate MFS permease
FT                   (NP_938673.1| Putative glycerol-3-phosphate transporter
FT                   [Corynebacterium diphtheriae];; AAL21184.1| MFS family,
FT                   sn-glycerol-3-phosphate transport protein [Salmonella
FT                   typhimurium LT2]). Responsible for glycerol-3-phosphate
FT                   uptake. pfam00083, Sugar_tr, Sugar (and other) transporter.
FT                   2A0104: phosphoglycerate transporter pr"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0403"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00425"
FT                   /db_xref="GOA:A5CMY9"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR005267"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR021159"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMY9"
FT                   /protein_id="CAN00425.1"
FT                   /translation="MTTDQRTRSDGSAVRRGLLTFMAAPPPAPRLDDATVARRYPRLRL
FT                   QVFMGIFIGYAAYYLIRNNVPLVATILRDENGFSALGLGILTNGVLLAYGFSKFLSAIV
FT                   SDRSSARWFLPIGLLLSALANLVVAFVPAVGASVALFAVVMIVNGFFQGMGWPPSGRTL
FT                   VHWFSTSERGGKTAIWNVAHNVGGAGAGGLAGLAIATFGTWQSAFWFPAIVCIVIALIA
FT                   FVLLRDTPESEGLPPIEEHRNDPAPVETDAADEGASTWTTIRRYVIGNRTMVNLALANV
FT                   FVYTLRYGVLVWAPIYLADVRGASLGEGIAGFSLFELAGIPGTLLCGYISDKVFRGRRS
FT                   PTGILFMAAVGVAVAIYWLSPADGPLWVSLAALVLIGGLIYGPVMLIGLQALDLSPRKV
FT                   AGTAAGFTGLFGYVLGATLASTGIGASVHAFGWDVTFVLILVCVALAIVLLAIVGKDES
FT                   ALRRRREERGDIAAR"
FT   CDS_pept        complement(482363..483100)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0404"
FT                   /product="putative two-component system response regulator"
FT                   /function="Response regulator containing a CheY-like
FT                   receiver domain and an HTH DNA-binding domain"
FT                   /note="putative two-component system response regulator
FT                   (NP_625929.1| putative two-component response regulator
FT                   [Streptomyces coelicolor A3(2)];; ZP_00227053.1| COG2197:
FT                   Response regulator containing a CheY-like receiver domain
FT                   and an HTH DNA-binding domain [Kineococcus radiotolerans
FT                   SRS30216]). InterPro: Response regulator receiver domain
FT                   pfam00072, Response_reg, Response regulator receiver
FT                   domain. pfam00196, GerE, Bacterial regulatory proteins,luxR
FT                   family."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0404"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00426"
FT                   /db_xref="GOA:A5CMZ0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMZ0"
FT                   /protein_id="CAN00426.1"
FT                   /translation="MSTEPTDPTAPAPAAPASVRVLLVDDQALVRAGIRVILESEDGIE
FT                   VVGEAADGEEGVRLAAALAPDVICMDVQMPRVDGLEATRRIVADPTIGAAVLMLTTFDR
FT                   EDYLFTALDAGASGFVLKSASPESLVEAVHVIARGDALLSPDVTRRVIERFGRGPADAA
FT                   STAPIPTIPTDPRVATLTDRELEVLRLLAEGLANAEIAERLYLGEATVKTHVSRLLLKL
FT                   GVRDRVQAVVFAYERGIVVPGAS"
FT   CDS_pept        complement(483097..484506)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0405"
FT                   /product="putative two-component system, sensor kinase"
FT                   /function="Signal transduction histidine kinase"
FT                   /note="putative two-component system, sensor kinase
FT                   (NP_825857.1| putative two-component system sensor kinase
FT                   [Streptomyces avermitilis MA-4680];; NP_627597.1| putative
FT                   two component sensor kinase [Streptomyces coelicolor
FT                   A3(2)]). pfam02518, HATPase_c, Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase. This family represents
FT                   the structurally related ATPase domains of histidine
FT                   kinase, DNA gyrase B and HSP90."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0405"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00427"
FT                   /db_xref="GOA:A5CMZ1"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMZ1"
FT                   /protein_id="CAN00427.1"
FT                   /translation="MSAASAPDSVDRFWVRPRPDRAGLRFDVLLALVMLVLTTGSCILY
FT                   YAIGMYPTRPPLWVIAAWILLMTAPLALRRLQPEAVTLVIGATFIVGAYQFVPEVLFSN
FT                   IAMFIAMYSLGAWGRNRLRANVVRGIVVVGMFAWLFSALLQASGYFSLAGSTIERAPDD
FT                   AWVPAPVAAGLISIITNLLYFGGAWYFGDRAWASARDRCALETRTAELATERERVAEQA
FT                   VTLERVRIARELHDVVAHHVSVMGVHAGAARRVLARDADKAAASLGIVEDNARSAIEEL
FT                   HRMLVALRQDEDDVASDGRADADPTRTASTRGVDQLSELVADACGAGLQVAFDVIGTPR
FT                   PLTPTVDLIVYRVAQESLTNVRKHAGTGARVDLRMRYLADRVEVEVSDGGPAGAAAAAA
FT                   QGSVRNGPGGLGQRGMRERVAAVGGSIEIGPKARGGYLVRASVPTGRAPVVPPVPLDAS
FT                   IPAPAPEETRA"
FT   CDS_pept        484813..486405
FT                   /transl_table=11
FT                   /locus_tag="CMM_0406"
FT                   /product="putative drug efflux MFS permease"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /note="putative drug efflux MFS permease (NP_472303.1| ;
FT                   NP_627413.1| putative transmembrane efflux protein
FT                   [Streptomyces coelicolor A3(2)]). pfam00083, Sugar_tr,Sugar
FT                   (and other) transporter. InterPro: General substrate
FT                   transporters 2_A_01_02: Multidrug resistance protein"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0406"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00428"
FT                   /db_xref="GOA:A5CMZ2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMZ2"
FT                   /protein_id="CAN00428.1"
FT                   /translation="MSDTTASARPAAGASGAPGASGSSSAPVVSRRAWQALIVLLAGMF
FT                   IALLDTTIVNVALPTIRTSLDASESTLSWIISGYALAFGLALIPAGRLGDRYGHKWVFV
FT                   TGIALFTLASLACGVAQDDLQLVIARVVQGLAGGLFVPAVTAFIQLLFPPQARGKAFAI
FT                   MGAVIGVSSALGPIVGGLIIQAAGEESGWRLVFFVNLPVGLATVIAAIFLLPSRQVAEQ
FT                   VAGDVRAQSGQRAGTKQGAAAPAKAPAASGVDLVGILLVSAGLVALLVPLIDGQDQGWP
FT                   LWTYLSLAGGVVLLALFGAWEVMQTKRSKGVLVPPHLFTHPAFTGGVILAMVYFAAFTS
FT                   IFFTISILWQSGLGNSALESGLVSIPFAIGSIVGSSQSNRLTKRLGRTVLVIGTALVSV
FT                   GLIWLWLVLLNTQAADLTSWMLLVPLLLAGIGNGLFIAPNAQFIVATVDPAEAGAASGV
FT                   IGTVQRVGSAVGIAVIGSVLFAGVAGAGIRGPQMVPQAFTDASASAMGVSAIFAVVAFA
FT                   LVFALPRRVSRGH"
FT   CDS_pept        complement(486491..487339)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0407"
FT                   /product="hydrolase, alpha/beta hydrolase fold family"
FT                   /function="Predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily)"
FT                   /note="putative hydrolase (ZP_00226479.1| COG0596:
FT                   Predicted hydrolases or acyltransferases (alpha/beta
FT                   hydrolase superfamily) [Kineococcus radiotolerans
FT                   SRS30216];; NP_826888.1| putative alpha/beta hydrolase fold
FT                   family protein [Streptomyces avermitilis MA-4680]).
FT                   pfam00561, Abhydrolase_1, alpha/beta hydrolase fold. This
FT                   catalytic domain is found in a very wide range of enzymes."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0407"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00429"
FT                   /db_xref="GOA:A5CMZ3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMZ3"
FT                   /protein_id="CAN00429.1"
FT                   /translation="MLTETDLRLPDGRTLHCYDTGPGDGADLVVVYHHGTPNVGPPPAP
FT                   LVEAPAGRGIRWISYDRPGYGGSARDPGRTVATTAADDAAVADALGIDRFAVLGHSSGA
FT                   VLALAAAAALPGRVLGALCGAALAPIRAEGLDWFAGMHAGGERELRAAVAGREALEEEL
FT                   SASTFDPAMFTDGDLRALETEWAWLNEVAGRGLDAGIGGMVDDDLALVADWGVGLAAVR
FT                   APVILLHGDADRIAPVAHARWLADRVPGAELVIRPGDGHISVLHGAADALARLRGRIAA
FT                   A"
FT   CDS_pept        487427..488134
FT                   /transl_table=11
FT                   /locus_tag="CMM_0408"
FT                   /product="hypothetical protein"
FT                   /function="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0408"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00430"
FT                   /db_xref="GOA:A5CMZ4"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMZ4"
FT                   /protein_id="CAN00430.1"
FT                   /translation="MDEAQGSELRELRRRAYGPAPDLDDAELDRLRELEARQGGAAGAA
FT                   SDPHSAGAVPPVAPSTAHPGGPAPADPAIDERDADDDDAPASRAPAPRRRTAILWAASV
FT                   LVAVGATVALTSGLASMTGRDVGTVALDPDRPVPDRWDDWYQDVATGVGEFHGLTVIGL
FT                   ENPEDDAACVTVVAPRFARGTNPVGGCAAGSFPARGVLTVTGDMPAELRDEFPEGTALE
FT                   FVLEGGSVRVTAG"
FT   CDS_pept        complement(488148..488861)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0409"
FT                   /product="putative oxidoreductase"
FT                   /function="Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /note="oxidoreductase (ZP_00227286.1| COG1028:
FT                   Dehydrogenases with different specificities (related to
FT                   short-chain alcohol dehydrogenases) [Kineococcus
FT                   radiotolerans SRS30216];; AAD46515.1| oxidoreductase
FT                   homolog [Streptomyces albus]). InterPro: Short-chain
FT                   dehydrogenase/reductase (SDR) superfamily
FT                   pfam00106,adh_short, short chain dehydrogenase. This family
FT                   contains a wide variety of dehydrogenases."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0409"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00431"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMZ5"
FT                   /protein_id="CAN00431.1"
FT                   /translation="MDIQDQVALVTGANRGIGRTFVEELLARGARKVYATARRPEAIDV
FT                   PGVEVLRLDLADPASVDAAAAAAQDVTLVVNNAGISTGAALITGDMAEIRREMDTHFYG
FT                   TLGVIRAFAPVLAANGGGGIVNILSALSWFSTSGAGGYAAAKAAEWNMTNAVRLELAEQ
FT                   GTLVQGVHLGAADTDIMAGYDGPMIAPRDVARASLDGVAAGSVEVVVDDWSRMVKDSLS
FT                   GDPAPFYEKLRAILR"
FT   CDS_pept        488994..489413
FT                   /transl_table=11
FT                   /locus_tag="CMM_0410"
FT                   /product="putative transcriptional regulator, MerR-family"
FT                   /function="Predicted transcriptional regulators"
FT                   /note="putative transcriptional regulator, MerR-family
FT                   (ZP_00191407.2| COG0789: Predicted transcriptional
FT                   regulators [Kineococcus radiotolerans SRS30216];;
FT                   CAE53385.1| putative transcriptional regulator, MerR family
FT                   [Actinoplanes teichomyceticus]). pfam00376, MerR,MerR
FT                   family regulatory protein."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0410"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00432"
FT                   /db_xref="GOA:A5CMZ6"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMZ6"
FT                   /protein_id="CAN00432.1"
FT                   /translation="MLRIGDVAGRAGVSTRALRYYEEQGLLPAERTTSGQRVYPEAAVE
FT                   RVQLIQRLFAAGLPSRTIRQLLPSVDSGVAAPESLALLRSERDRITAAIAELERAREEL
FT                   TRVIDICLHPTPEHCPALREGGAAHAGAREESVAA"
FT   CDS_pept        489604..490074
FT                   /transl_table=11
FT                   /locus_tag="CMM_0411"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0411"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00433"
FT                   /db_xref="GOA:A5CMZ7"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMZ7"
FT                   /protein_id="CAN00433.1"
FT                   /translation="MIMRLGAIASVAGACGALAAVVVWLFARGIVDEEFVRDFWTGPPA
FT                   AGIFTLVGAGLAYGAATVAARVSRRSAERQEWWDRAKWALDLVMSSDEADREVGLAAIE
FT                   VLVAEATTTEAEMIDAVTSSSRLDGERRSIAACGLGVRPPEVDTVPTRAENG"
FT   CDS_pept        490088..490267
FT                   /transl_table=11
FT                   /locus_tag="CMM_0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0412"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00434"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMZ8"
FT                   /protein_id="CAN00434.1"
FT                   /translation="MTMDQRNPSPSALEKRIQAGKADPISDAERASAARIRIVVDKKRG
FT                   RKTEDWIKKLAQSA"
FT   CDS_pept        complement(490374..490736)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0413"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0413"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00435"
FT                   /db_xref="UniProtKB/TrEMBL:A5CMZ9"
FT                   /protein_id="CAN00435.1"
FT                   /translation="MITRREAALRLGIPLEMATRHGIPGRVPESEIAAMDQDPPPWLAQ
FT                   SRANTTGKRPVWVQLTCEVCGFTEAVRPKKWWPEFSYLSCERHSPDELPEPALGLARRE
FT                   VDGIGSRFVGVVDERP"
FT   CDS_pept        490826..491362
FT                   /transl_table=11
FT                   /locus_tag="CMM_0414"
FT                   /product="transcriptional regulator, MarR family"
FT                   /function="Transcriptional regulators"
FT                   /note="putative transcriptional regulator, MarR family
FT                   (NP_899880.1| probable transcriptional regulator, MarR
FT                   family [Chromobacterium violaceum ATCC 12472];;
FT                   NP_348196.1| Transcriptional regulators, MarR/EmrR family
FT                   [Clostridium acetobutylicum]). InterPro: Bacterial
FT                   regulatory protein MarR family. pfam01047, MarR, MarR
FT                   family. The Mar proteins are involved in the multiple
FT                   antibiotic resistance, a non-specific resistance system."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0414"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00436"
FT                   /db_xref="GOA:A5CN00"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN00"
FT                   /protein_id="CAN00436.1"
FT                   /translation="MTGTESCPPADETAPPARIADELVCFSLYTASRSTTQAYRALLAP
FT                   WGLTYPQYLVLVLLWSGDDRTVTELGQQLDLDSGTLSPLLARMEEAGFIARRRISADQR
FT                   VVTVSLAERGRTVRAELAHVPAAIIRGMGLDLDRARQLLATLHLLTAGMQEATADALAH
FT                   PATRPAEASARTRTP"
FT   CDS_pept        491439..491861
FT                   /transl_table=11
FT                   /gene="osmC"
FT                   /locus_tag="CMM_0415"
FT                   /product="Organic hydroperoxide resistance protein"
FT                   /function="Predicted redox protein regulator of disulfide
FT                   bond formation"
FT                   /note="putative organic hydroperoxide resistance protein
FT                   (NP_599276.2| stress-induced protein [Corynebacterium
FT                   glutamicum ATCC 13032];; NP_834187.1| Osmotically inducible
FT                   protein C [Bacillus cereus ATCC 14579]). pfam02566, OsmC,
FT                   OsmC-like protein. Osmotically inducible protein C is a
FT                   stress -induced protein found in E. Coli. This family also
FT                   contains a organic hydroperoxide detoxification protein
FT                   that has a novel pattern of oxidative stress regulation."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0415"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00437"
FT                   /db_xref="GOA:A5CN01"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN01"
FT                   /protein_id="CAN00437.1"
FT                   /translation="MDALYTAEALATGAGRDGRVAVSDSDLALDLSIPKAMGGSGEGAN
FT                   PEQLFAAGYAACFHSALQGVARARKVKIADSSVGSRVSIGSNGQGGYQLAVHLEVVIPG
FT                   VEHDLAQELADQAHQVCPYSNATRGNIEVVVTVSDD"
FT   CDS_pept        491861..492268
FT                   /transl_table=11
FT                   /locus_tag="CMM_0416"
FT                   /product="putative membrane protein"
FT                   /note="putative membrane protein (NP_295648.1| hypothetical
FT                   protein [Deinococcus radiodurans R1];; ZP_00209412.1|
FT                   hypothetical protein Magn023696 [Magnetospirillum
FT                   magnetotacticum])."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0416"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00438"
FT                   /db_xref="GOA:A5CN02"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN02"
FT                   /protein_id="CAN00438.1"
FT                   /translation="MAGLARTSFPRTAARVVLGSFLAFAGVSHLTVAREEFRAQVPKSL
FT                   PVPEDVTVVGSGIVEITLGSALLFARSRRGLAGWATAAFFTAIFPGNIAQYVHKRDGFG
FT                   LDTDGKRLGRLFFQPVLIALALWSTGALRKR"
FT   CDS_pept        492406..492837
FT                   /transl_table=11
FT                   /locus_tag="CMM_0417"
FT                   /product="conserved hypothetical protein"
FT                   /function="Predicted lactoylglutathione lyase"
FT                   /note="conserved hypothetical protein (NP_883401.1|
FT                   conserved hypothetical protein [Bordetella parapertussis
FT                   12822];; ZP_00032237.1| COG3607: Predicted
FT                   lactoylglutathione lyase [Burkholderia fungorum]).
FT                   InterPro: Glyoxalase/Bleomycin resistance
FT                   protein/Dioxygenase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0417"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00439"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN03"
FT                   /protein_id="CAN00439.1"
FT                   /translation="MPMIFVNLPVTDLPRAIAFYEAVGCAVNPDFTDEKAACLVVEADR
FT                   SAFMLLTRDFFQSFLDVPVGDPSSSAAAITAVMLDSRADVDARATAGLDAGGSEPRRAV
FT                   DLGFMYQRQLRDPDGNVLELGHMDPIPAGGVPHVETAAG"
FT   CDS_pept        complement(492847..493980)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0418"
FT                   /product="putative epoxide hydrolase"
FT                   /function="Predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily)"
FT                   /EC_number="3.3.2.-"
FT                   /note="putative epoxide hydrolase (ZP_00229095.1| COG0596:
FT                   Predicted hydrolases or acyltransferases (alpha/beta
FT                   hydrolase superfamily) [Kineococcus radiotolerans
FT                   SRS30216];; NP_347356.1| Epoxide hydrolase,"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0418"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00440"
FT                   /db_xref="GOA:A5CN04"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR010497"
FT                   /db_xref="InterPro:IPR016292"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN04"
FT                   /protein_id="CAN00440.1"
FT                   /translation="MTHSLPLHVTDADLDDLRDRIRRTRWAPAWPVEPWEAGTDQATLR
FT                   RLAAVWADVFDWRAREREIRALPWAVADLDGTPVSYLRFEAEQSDHAGGLPIVLTNGWP
FT                   SSALEMVPLAERLSQPSRFGGDPGDAVTVIVPALPGFPFSPQRPRIDERTHELWHRLMT
FT                   EELGFARYAAHGGDLGAGITSRLAESHPEAVAGIHLMAVAAPHDLDEATLTDEERAHLE
FT                   RSRAWDAAEGGYQHQQQTRPLTLAPALQDSPVGLLSWILEKHRAWSDCGGDVSRAFSDD
FT                   HLLTLASLYWFTGSIGTSLRPYFEYGSGRTARVGRVPVPTAVALFPHDLSHPPRSWAER
FT                   TYDVVRYTTMPRGGHFAPHEEPGLLADDITAFLRTLR"
FT   CDS_pept        complement(493997..495226)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0419"
FT                   /product="conserved hypothetical protein"
FT                   /note="conserved hypothetical protein, putative HTH-type
FT                   transcriptional regulator (NP_737943.1| hypothetical
FT                   protein [Corynebacterium efficiens YS-314];; NP_695848.1|
FT                   hypothetical protein BL0662 [Bifidobacterium longum
FT                   NCC2705])."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0419"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00441"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN05"
FT                   /protein_id="CAN00441.1"
FT                   /translation="MDALSNPYTPNAGAQPEILIGRDEQTTAFHNLLGRLRRGRTDQSM
FT                   IITGLRGVGKTVLLNSFRTIALQEHWEVIEFEAVKHGESRFRQTIASQLKAALLRISPR
FT                   ARWSDKGARAASVLSSFAVSVNAEGTWSIGWDVPAAEGLADHGDLAMDLTDVLIAVGEA
FT                   ASEKGDGIVLLIDEVQFLDSRQLEALIQAIHKTVQRSLPVTFVGAGLPQIAELVGDAKS
FT                   YSERLFKFPRIDSLDEDDARAALVEPAAAEGASFDADAVALAVEITSGYPYFIQELGSQ
FT                   VWTIASNARITRDDVVLAQDAYEAKLDSSFFRVRLDRATPLQTAYMRAMAELGAAPQKA
FT                   GDVAALMDRSSTQLGPTRAELIEMGLLFTPEHGYAAFTVPDFDRFMKRAVPVLDVPPVG
FT                   ARRPRRPLNP"
FT   CDS_pept        complement(495310..496368)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0420"
FT                   /product="putative sugar ABC transporter, membrane spanning
FT                   protein"
FT                   /function="Ribose/xylose/arabinose/galactoside ABC-type
FT                   transport systems permease components"
FT                   /note="putative sugar ABC transporter, permease component
FT                   (NP_695267.1| probable ABC transporter permease protein for
FT                   sugars [Bifidobacterium longum NCC2705];; ZP_00182437.2|
FT                   COG1172:ribose/xylose/arabinose/ galactoside ABC-type
FT                   transport systems, permease components Exiguobacterium sp.
FT                   255-15]). pfam02653,BPD_transp_2, Branched-chain amino acid
FT                   transport system / permease component.Also found with in
FT                   this family are proteins from the galactose transport
FT                   system permease, and a ribose transport system."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0420"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00442"
FT                   /db_xref="GOA:A5CN06"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN06"
FT                   /protein_id="CAN00442.1"
FT                   /translation="MSATTIQPPVTPTPAPGQGAAPRPPRRSMRLRLDSLPTVAALVIL
FT                   LAMLAYGEIAYGRILQAATLSNLLINNAHVIVLAVGLTFVILTGGIDLSVGAIVAVSSV
FT                   AGVILANAGWDPWVVMVLMILIGTASGVVSGVLIQFFDVQPFIATLAMMFLGRGLASIL
FT                   STVPERLDDESPLRSLATNMKVVDGPKVNDVVTTPGVLIALVVVAVAFFVLHRTRLGRT
FT                   VYATGGSEQSAALMGLPVRRTKLAVYVISGTLAGLASVIYTARLGSAQNITGIGWELDA
FT                   IAATVIGGTLLTGGVGFVLGSVVGALVLGLMNVLITRDGGIPPEATTIITGGILLVFVL
FT                   LQRAVMARRRRT"
FT   CDS_pept        complement(496365..497447)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0421"
FT                   /product="putative sugar ABC transporter, permease
FT                   component"
FT                   /function="Ribose/xylose/arabinose/galactoside ABC-type
FT                   transport systems permease components"
FT                   /note="putative sugar ABC transporter, permease component
FT                   (NP_695266.1| probable ABC transport system permease
FT                   protein for sugars [Bifidobacterium longum NCC2705];;
FT                   ZP_00066972.1| COG1172: Ribose/xylose/arabinose/galactoside
FT                   ABC-type transport systems, permease components
FT                   [Microbulbifer degradans 2-40]). InterPro: Binding-system
FT                   dependent bacterial transporters (araH livH/limM families)
FT                   pfam02653,BPD_transp_2, Branched-chain amino acid transport
FT                   system / permease component."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0421"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00443"
FT                   /db_xref="GOA:A5CN07"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN07"
FT                   /protein_id="CAN00443.1"
FT                   /translation="MSDTTTAKRSARGRGDVLHRPWFWGTVAILLLLAINVAKDPGYLA
FT                   LSVNPDTGNLVGNLVDILRAAAPVLMIAVGMCLVVATGGIDLSVGSIMVVAGAVSMEFL
FT                   KAAGSDSLGVALGAMGLALLIAGILGAVNGMLVSVVGLQPFISTLVIMLAGRGLAKVIT
FT                   AGQNTAASNEPFRWVANGYLVGLPVVFLLAVLITIGVAVLVRRSALGLMIEAIGMDPQA
FT                   ARLAGLDRRALLFTAYIASGLLAGVAGIFATASVMTVDVSRTGYQLELDAILAVVIGGT
FT                   SLAGGKFHLLGAAVGALLIATLDKTVVFLGISSSATPAFKAIVIVAIVLLQSRRVRALF
FT                   TRCRPPAPTPVPTEKEAVPA"
FT   CDS_pept        complement(497444..499018)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0422"
FT                   /product="putative sugar ABC transporter, ATPase component"
FT                   /function="ABC-type sugar transport system ATPase
FT                   component"
FT                   /note="putative sugar ABC transporter, ATPase component
FT                   (NP_695265.1| ATP binding protein of ABC transporter
FT                   [Bifidobacterium longum NCC2705];; NP_437568.1| putative
FT                   sugar uptake ABC transporter ATP-binding protein
FT                   [Sinorhizobium meliloti 1021]). pfam00005, ABC_tran, ABC
FT                   transporter (2 times)."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0422"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00444"
FT                   /db_xref="GOA:A5CN08"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN08"
FT                   /protein_id="CAN00444.1"
FT                   /translation="MQASSPIVEMRGITISFPGVKALDGVDLRLFPGEVHTLMGENGAG
FT                   KSTLIKALTGVYGIDSGRVVVDGTERRLSGTADAQAAGISTVYQEVNLCGNLTIGENVM
FT                   LGHERRGRFGIDWKGTHAAASEVLARVGLGHLDPRTPLSTISLALQQLVAISRATVLDA
FT                   KVLILDEPTSSLDADEVEGLFRVMRRLRDEGVAILFVSHFLDQVFAISDRLTVLRNGRL
FT                   VGEHLTRDIDRAGLIAEMIGKDLQTLRSLDRERASRQVATGEPVYRATGIGRKGSLDAT
FT                   DVELRRGEVVGLAGLLGSGRTELARLLYGVDRPDTGSVTMDGAPVAISSPAKALKHRIA
FT                   FSSENRRDEGIIRDLSVRENLVLAVQAKRGWARPLPRKEKDRIVAKYLTELNVRPADPD
FT                   RPIRNLSGGNQQKVLLGRWLATEPELLILDEPTRGIDVGAKAEIQEQVAALADTGVAVV
FT                   FISSELEEVVRLSDRIVVLKDHRKIAELEAGPDVTAQSIVAAIAEEGVSDIALETVPDT
FT                   APEEAAR"
FT   CDS_pept        complement(499112..500116)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0423"
FT                   /product="putative sugar ABC transporter, binding protein"
FT                   /function="ABC-type sugar transport system periplasmic
FT                   component"
FT                   /note="putative sugar ABC transporter, binding protein
FT                   (ZP_00121662.1| COG1879: ABC-type sugar transport
FT                   system,periplasmic component [Bifidobacterium longum
FT                   DJO10A];; ZP_00223066.1| COG1879: ABC-type sugar transport
FT                   system,periplasmic component [Burkholderia cepacia
FT                   R1808])."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0423"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00445"
FT                   /db_xref="GOA:A5CN09"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR033893"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN09"
FT                   /protein_id="CAN00445.1"
FT                   /translation="MSTKRRIATIAAAGAIALSLAACNSNSGTGSTAGGAADSGGETAT
FT                   VGFVAVGPEGAWRQANEKDIQDTFTKEAGFDLKYAPATNNDQKSQIDAFTSFVDEGVDV
FT                   ILLSATEGSGWEDSLERAKEAEIPVVLIDRGIEPDDDSLYATRIAPDNIAVSSSVADWA
FT                   KTALPDGGKYFTLEGPAGVSVVNERNEGWDEVIGAESSFTKVGAQTANWSTEEAKSVFE
FT                   TVLKSNANDVQMVFAQNDEMGLGAVQAVEEAGLTPGQDVKIATIDGTKNALQALADGKL
FT                   SFVAEYNPLFGGTALEAVQALLDGESVESSIVVPSDVFDSAEKAATALPDRKF"
FT   CDS_pept        complement(500283..501956)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0424"
FT                   /product="putative sugar uptake ABC transporter, ATPase
FT                   component"
FT                   /function="ABC-type sugar transport system ATPase
FT                   component"
FT                   /note="putative sugar uptake ABC transporter, ATPase
FT                   component (NP_695265.1| ATP binding protein of ABC
FT                   transporter [Bifidobacterium longum NCC2705];;
FT                   ZP_00223067.1| COG1129: ABC-type sugar transport
FT                   system,ATPase component [Burkholderia cepacia R1808]).
FT                   pfam00005,ABC_tran, ABC transporter (duplicated domain)."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0424"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00446"
FT                   /db_xref="GOA:A5CN10"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN10"
FT                   /protein_id="CAN00446.1"
FT                   /translation="MRHARGSTTIRPTGPTAVPAPGSAQTARPHAPARPTVRMRGITVA
FT                   FPNGVALDGVDLDLHPGEVHALLGENGAGKSTLIKALLGVHRIDAGEILVDGEPVRLGG
FT                   PADARALGIQAAFQESHLVENLSVGENVMLGHEARGRLGISWRATHARAAAMLAELGLA
FT                   DLDPRDRLADLSPASRQLVSIARAMVDRPRVLVLDEPTSSLDADDVARLFQVIRRLRDQ
FT                   GVAILFVSHFLEQVLALSDRMTILRGGVKEGDHLPHELDRAELVARMIGKDVAHLKRIG
FT                   SERRAHRVDPVGPPLYRAAGVGRRGMLRPVDLELHPGEVVGIAGLRGSGRTELARLLAG
FT                   ADRADGGVVTLGGRDVVIDRPADALRNRVALSAEDRGAEGLIGELSVRENIVLALQALR
FT                   GWAHPLAKAEREDLVERHIEHFGITPADPATPAGQLSGGNQQKVLLARWLAIRPRVLIL
FT                   DEPTRGVDIRAKVDIQAHIAQLAIEGVAVVFISSAFDELVRVSDRIVVLKDREKIGELA
FT                   NGPGVTVDTLVELIAAPADEDDEADFPLPELPERPDPPRR"
FT   CDS_pept        complement(502082..503104)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0425"
FT                   /product="transcriptional regulator, LacI family"
FT                   /function="Transcriptional regulators"
FT                   /note="putative transcriptional regulator, LacI family
FT                   (NP_630441.1| putative transcriptional regulator
FT                   [Streptomyces coelicolor A3(2)];; NP_822206.1| putative
FT                   LacI-family transcriptional regulator [Streptomyces
FT                   avermitilis MA-4680]). pfam00356, LacI, Bacterial
FT                   regulatory proteins, lacI family. pfam00532,
FT                   Peripla_BP_1,Periplasmic binding proteins and sugar binding
FT                   domain of the LacI family. This family includes the
FT                   periplasmic binding proteins, and the LacI family
FT                   transcriptional regulators. The LacI family of proteins
FT                   consist of transcriptional regulators related to the lac
FT                   repressor. In this case, generally the sugar binding domain
FT                   binds a sugar which changes the DNA binding activity of the
FT                   repressor domain (pfam00356)."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0425"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00447"
FT                   /db_xref="GOA:A5CN11"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN11"
FT                   /protein_id="CAN00447.1"
FT                   /translation="MSVRSGGERLGLREVAERAGVSHMTVSRVLNGHPQVKESTRQRVL
FT                   EVVAELDFRPNSAARQLVTQQALRIGVLIESAVEFGPSSILRAIERSARDGGYSVASFA
FT                   LRDDEDATPEEAVRHLTGQGIDALCVVAPRSSSVAVLRTITTGLPTLVVKAEKDPAFLT
FT                   VSVDQSAGTRLVVDHLASLGHRDVLHVSGPLDWLDARARERAFHARTRAWGMRERPIVI
FT                   GDWSSDFGYDFARGLTAVPEYTAVFVANDEMALGVIHGLHDRGIRVPEDLSVVGFDDLP
FT                   VSRHFLPPLTTVKQDFPALGTLVVDVLIAAIEGREIPQASRIPAELVVRDSSAAARRVD
FT                   "
FT   CDS_pept        503366..504322
FT                   /transl_table=11
FT                   /locus_tag="CMM_0426"
FT                   /product="manganese-containing catalase"
FT                   /function="Mn-containing catalase"
FT                   /note="putative manganese-containing catalase
FT                   (ZP_00235296.1| manganese catalase [Bacillus cereus
FT                   G9241];; CAE09059.1| mn catalase [Thermus thermophilus]).
FT                   pfam05067, Mn_catalase, Manganese containing catalase.
FT                   Catalases are important antioxidant metalloenzymes that
FT                   catalyse disproportionation of hydrogen peroxide, forming
FT                   dioxygen and water. Two families of catalases are known,one
FT                   having a heme cofactor, and this family that is a
FT                   structurally distinct family containing non-heme
FT                   manganese."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0426"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00448"
FT                   /db_xref="InterPro:IPR007760"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR039377"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN12"
FT                   /protein_id="CAN00448.1"
FT                   /translation="MYFHAQTWINEIADGEPDPAAANALQEGLGGQFGEMRTMMQYLFQ
FT                   AMNFRGAAAKPYRDLIQGVGTEEISHVELIGTTISRLLDGSPEYTGRLTDPLDTPGKGG
FT                   ATPLSIALDHGNIHHHLVGAQGALPVDAAGNPWSGSYVYNSGNLPLDLLYNVMLESTGR
FT                   LQKCRIYEMTDNPVARATVAYLIVRDQAHENAYAKALETLGVDWGKLLPIPKTNAEQFP
FT                   EVKKLVDLGLQSKQYSFDLDGKSEAGRIFQGTSPSKDGTDLTATEQAPVGVPSTIAPER
FT                   LEEFAPGLDKDLLALIQETAERELAEVEAFYGPTKTA"
FT   CDS_pept        506213..506389
FT                   /transl_table=11
FT                   /locus_tag="CMM_0427"
FT                   /product="hypothetical protein"
FT                   /function="unknown"
FT                   /note="hypothetical protein , weak similarity to:
FT                   pfam01476, LysM, LysM domain. The LysM (lysin motif) domain
FT                   is about 40 residues long. It is found in a variety of
FT                   enzymes involved in bacterial cell wall degradation. This
FT                   domain may have a general peptidoglycan binding function."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0427"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00449"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN13"
FT                   /protein_id="CAN00449.1"
FT                   /translation="MTYYVPAAGDTMTGIASRFGVCIADLAAANSGHEVLEGVEILVAR
FT                   TTAMPLDDRACLG"
FT   CDS_pept        506602..509040
FT                   /transl_table=11
FT                   /locus_tag="CMM_0428"
FT                   /product="putative phosphoketolase"
FT                   /function="Phosphoketolase"
FT                   /EC_number="4.1.2.-"
FT                   /note="putative phosphoketolase (Q8YTZ6|PHK2_ANASP Probable
FT                   phosphoketolase 2;; NP_960507.1| hypothetical protein
FT                   MAP1573c [Mycobacterium avium subsp. paratuberculosis str.
FT                   k10]). pfam03894, XFP, D-xylulose 5-phosphate/D-fructose
FT                   6-phosphate phosphoketolase. Bacterial enzyme splits
FT                   fructose-6-P and/or xylulose-5-P with the aid of inorganic
FT                   phosphate into either acetyl-P and erythrose-4-P and/or
FT                   acetyl-P and glyeraldehyde-3-P EC:4.1.2.9, EC:4.1.2.22."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0428"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00450"
FT                   /db_xref="GOA:A5CN14"
FT                   /db_xref="InterPro:IPR005593"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR018969"
FT                   /db_xref="InterPro:IPR018970"
FT                   /db_xref="InterPro:IPR019789"
FT                   /db_xref="InterPro:IPR019790"
FT                   /db_xref="InterPro:IPR023962"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN14"
FT                   /protein_id="CAN00450.1"
FT                   /translation="MASDPAPRDPAAPLYLDVVDGWWRAANYLSVGQIYLLDDPLLERP
FT                   LTRDDIKPRLLGHWGTTPLLNFVYAHLNRAIIERDLDMIYIAGPGHGGPGMVANAYLDG
FT                   TYSELFSAATPDRAGMRHLFRQFSFPGGVPSHAAPETPGSINEGGELGYSLVHAFGAAL
FT                   DNPDLVVACVIGDGEAETATLASSWHLDKFLDPETDGAVLPILNLNGWKIANPTILARI
FT                   PEEELLALFTGYGYSPRIVSGGFDGEDHAAVHERFALALGEALDDISRIQLAARTGGSE
FT                   ERPAWPMLILRTPKGWTGPKEVDGKQVEGTWRAHQVPLSGVRDDPDHLRQLQEWLESYR
FT                   PHELFDRDGRLTPALQPNRPEGDRRMSANPHANGGLLRRDLRLPPLEVNAIDLSDGRGV
FT                   IAEPTRVLGGWLRDVIARNPLDFRIFGPDETASNRLDDVYEVTAKAWQGEVLPVDEHLA
FT                   HEGRVIEILNENITQGLLEAYLLTGRHGLFTSYEAFIHVVDSMFNQYAKWLESSSKVEW
FT                   RRPVASFTYLLSSHVWRQDHNGFSHQDPGFLDHVVNKRAEIVRVYLPFDANSLLVTMDH
FT                   CLRGTDLINVVIAGKQPTASLLSLEEARAHGARGVGVWEWAGTEVPGLEPDVVVACAGD
FT                   IPTVEAMAAVQILKREIPQLRVRFVNVVDLMRLQDSTQHPHGLDDGSFDALFTRDKPVV
FT                   FAFHGYPSLIHRLTYKRHNHENMHVRGFVEQGGTTTPFDMLMLNDLDRFRLVMDVIRRV
FT                   PHLETTYAGLSQRMDDERIAHRVFTREHGEDMADVSGAEGLPFADPTRQTAIDTGDDNA
FT                   "
FT   CDS_pept        complement(509091..509840)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0429"
FT                   /function="putative secreted protein"
FT                   /note="putative secreted protein (ZP_00413710.1| S-layer
FT                   homology region [Arthrobacter sp. FB24])."
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0429"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00451"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN15"
FT                   /protein_id="CAN00451.1"
FT                   /translation="MPSVRRRGLVGLIALALITAAQAGPASPASADPVPPTAGATGSAT
FT                   TATVVGRVYLDRVDPRNLVRTGEVSLELSDIPFGDSVDIVDGAFRFEGMRATRYTLRAW
FT                   VALGGTPASQYLGQVNEWRDARFFTAPAGRETRVDIVIRTPAGIGGTVTLPGGAPASAA
FT                   PVDVLRATGDGRLEASGFTDASGRYALGNLEPGFYVVRFGTPSSDPRAYLPEWSGDRTQ
FT                   RALATRIAVSRWGQVVTGVDATLAPAP"
FT   CDS_pept        complement(509932..511758)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0430"
FT                   /product="hypothetical secreted protein, putative
FT                   cell-surface protein"
FT                   /function="putative secreted protein"
FT                   /note="hypothetical secreted protein, putative cell-surface
FT                   protein (only weak similarities, putative N-terminal RTX
FT                   toxin and C-terminal fibrinogen-binding domain;
FT                   ZP_00413710.1| S-layer homology region [Arthrobacter sp.
FT                   FB24])."
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0430"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00452"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN16"
FT                   /protein_id="CAN00452.1"
FT                   /translation="MHAPRRRALIGLLSLSLVLSAQAGIAGSATAADARPSASNTAATT
FT                   RAIPTFTASPKPTITGTPRVGSTLTAVTGDWTPKPTTFGYRWWRDGVAIAGATGSTLKL
FT                   TAADAGARIDLTVTARRGGYASLARSSGSTAAVAPAATTPTPPAPTPAPTAPTPDPTPA
FT                   PTPTPTPDPTPTPDPTPPVATAPFTEAADPVITGDVQVGRPLRAVAGVWTPRPTAFAYA
FT                   WQVDGVAVAGATSISYTPVDADAGKRITATVTGTAPGITPTTRTSAATPPVAAAGVDLP
FT                   EQPSTGKVVGNIYLDSVDPANLVSSGEIYLEPAPYEFSDGLVSGVVGGAFAFSGVRPGE
FT                   YRLHAFFTVGGKYLYQYYGQTNDVKRAQTFAVQADGTVRVDVVLKRYATIQGTVTTTGG
FT                   VPAKGLSVAAYRTYDGQLLDSTTTDAQGGYTLSSAEPGDYLIKVGTPVGDSRGIIGEWY
FT                   SDAYDRESATPVTVAQWGTPVTGIDVELNRGASAKGQIYRSDGVGTPAASVRFVPVSAA
FT                   VEGAAPTTGLVAFVDQYGRFSLNGITPGEYVVYVAAAGETPRQLPRWAGGTGTLATATR
FT                   YTATLDTQLPAIYVQLAPDPTARRSRAAPTAR"
FT   CDS_pept        complement(511928..514192)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0431"
FT                   /product="putative hemagglutinin/hemolysin-related protein"
FT                   /function="putative secreted protein"
FT                   /note="putative secreted hemagglutinin/hemolysin-related
FT                   protein (NP_868824.1| probable fibrinogen-binding protein
FT                   homolog-putative involved in cell-cell interaction
FT                   [Pirellula sp. 1];; also similarities to membrane proteins
FT                   of unknown function: NP_628213.1| putative integral
FT                   membrane transport protein [Streptomyces coelicolor
FT                   A3(2)])."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0431"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00453"
FT                   /db_xref="GOA:A5CN17"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN17"
FT                   /protein_id="CAN00453.1"
FT                   /translation="MSSARRRAVVGLLSLALVASAQVGIASGASAAEAPTPAASAAPDA
FT                   SRGSAPAAAQAAAFTASPRPTITGTAQVGSPLTAVTGTWTPAPDSFSYRWWRDGVTISG
FT                   ATDARYVPVAADQGKRITVTVTAAKSGYTSLARSSGPTAAVTAAPAALPFTAAPAPTIT
FT                   GTAAIGSPLTAVPGTWTPSPRFAYQWFVGDKPIFGATASTYTPTYSDLGRALSVSVAGY
FT                   RDGYATTVRMSAPTPATVGRGTLTTAVPTITGSAVVGSALRAVPNAWSPDPTFEFRWFA
FT                   DDEAISNATGEYYTPVAADIGKRITVTVTGSAVGYNPAARTSARTAAVVAATTPPPVPA
FT                   TGTIVGRVYLDSVAPGNLISSGEVIPFRAGAAQATSAPIVDGAFRAEGLLPGDYRLFAS
FT                   VTVGGRELRQYYGEADGVTDGRTFTVQADGTVRLDVVLKRYATISGTATLSDGSPAVGS
FT                   QVEVFRVRGGQVSSATTDAAGRFLADGLTPGQYEVHFTAPFTNPDGVIGEWYSDTDDRN
FT                   AATRFTVGWGQAVTGVDPTLDAGTRLSGLVRGPDGTPYAGAGVYVVPEATALLGADPRT
FT                   ASRAAGTDAAGRFRVTGILPGRYYVFVTADRSEAPSYASQWLGGSGSLASATVYTAERG
FT                   ADLPAVDTRLVVSSSVTATISGTPAAGWSDHAQVTLFQGGTAKRTTFVFPGSDAFLDSV
FT                   PAGTYRVQVTYFRDYVPSSRWWDGGTGADRSELVVPAGKDVSLAIRSAPAVAATGALQV
FT                   R"
FT   CDS_pept        514407..515069
FT                   /transl_table=11
FT                   /locus_tag="CMM_0432"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized low-complexity proteins"
FT                   /note="conserved hypothetical protein (NP_600647.1|
FT                   uncharacterized low-complexity protein [Corynebacterium
FT                   glutamicum ATCC 13032];; NP_628440.1| hypothetical protein
FT                   [Streptomyces coelicolor A3(2)])., ,
FT                   pfam00805,Pentapeptide, Pentapeptide repeats (8 copies)."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0432"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00454"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN18"
FT                   /protein_id="CAN00454.1"
FT                   /translation="MAASTRILPPRISDPRLEGLADGDPSDLDAHASFERLRFADADLT
FT                   DADLVDIGFEECALERIRLHEADLTAASLVDVLASRLDAPVLKAPRIRMRDVRLEGSRV
FT                   GSAELYDASLSSVHITDCRLGFVNLRGSKITDLLITDCAIEELDLRGTAGMRVAFARTT
FT                   IGTLDLADSSLTHLDLRGAEIMDLDTPDGLRGAVLDSTQLMALGPVFARHFRVRVED"
FT   CDS_pept        complement(515083..516114)
FT                   /transl_table=11
FT                   /gene="fepG"
FT                   /locus_tag="CMM_0433"
FT                   /product="putative iron-siderophore ABC
FT                   transporter,permease component"
FT                   /function="ABC-type enterobactin transport system permease
FT                   component"
FT                   /note="putative iron-siderophore ABC transporter, permease
FT                   component (BAB97894.1| ABC-type transporter, permease
FT                   components [Corynebacterium glutamicum ATCC 13032];;
FT                   AAD29086.1| FepG [Yersinia enterocolitica];; NP_626057.1|
FT                   putative iron-siderophore uptake system transmembrane
FT                   component [Streptomyces coelicolor A3(2)]).
FT                   pfam01032,FecCD, FecCD transport family. This is a
FT                   sub-family of bacterial binding protein-dependent transport
FT                   systems family. This Pfam entry contains the inner
FT                   components of this multicomponent transport system."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0433"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00455"
FT                   /db_xref="GOA:A5CN19"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN19"
FT                   /protein_id="CAN00455.1"
FT                   /translation="MRPRIPRRDRVVLGILVLAVLGAAAVGLGTGAYPLSPAQALDALL
FT                   GGGDAQARFIVADQRLPRVVCAVAIGAALGLSGMVFQSVSRNPLGSPDVIGFSTGAATG
FT                   GLVAILVTGSTAAAPSSAGSIALGTVVGGFATAFAVHLMSSRTATTGERLVLVGIAVGA
FT                   MLASVNDFLITRSDLELAQAAATWRFGTLNGISWPQVAPAVLVLAVIVPLAFLGEPPLR
FT                   MLEMGDDTARALGLDVGRWRTVLLAAGVALAAVGVAAVGPVGFVALAAPHLARRMMPGS
FT                   RGRMLPALVVGALLLSVADLVAGRLLSPFQIPVGLATSAIGGLYLLWLLASPDTSRRAA
FT                   SSG"
FT   CDS_pept        complement(516111..517118)
FT                   /transl_table=11
FT                   /gene="fepD"
FT                   /locus_tag="CMM_0434"
FT                   /product="putative iron-siderophore ABC
FT                   transporter,permease component"
FT                   /function="ABC-type Fe3+-siderophore transport system
FT                   permease component"
FT                   /note="putative iron-siderophore ABC transporter, permease
FT                   component (BAB97895.1| ABC-type transporter, permease
FT                   components [Corynebacterium glutamicum ATCC 13032];;
FT                   NP_626058.1| putative iron-siderophore uptake system
FT                   transmembrane component [Streptomyces coelicolor A3(2)];;
FT                   AAD29085.1| FepD [Yersinia enterocolitica]). InterPro:
FT                   FecCD transport family pfam01032, FecCD, FecCD transport
FT                   family. This is a sub-family of bacterial binding
FT                   protein-dependent transport systems family. This Pfam entry
FT                   contains the inner components of this multicomponent
FT                   transport system."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0434"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00456"
FT                   /db_xref="GOA:A5CN20"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN20"
FT                   /protein_id="CAN00456.1"
FT                   /translation="MPPTRPAPVAAAAVVALAALVALCAVSLATGSRDIALDSVWHAIQ
FT                   HPDDGSRDAIIVWQLRAPRTLLAVAVGVLLAVAGVVMQAMTRNPLAEPGLLGVNAGASL
FT                   AVVLSVAVLGVGSAAGYAWPAFAGAAIAAVVVVLVGMRAGPRADPTRLLLAGTALTASL
FT                   ASVTGVVTLSDSRTFGDYRSWVVGSVASRDPADLVWLLPLTAVVVVGALLLVRPLAVLA
FT                   LGDDTATALGSSVGRVRLAGFALVTVACGAATAVAGPISFVGLVVPHAVRLVVGRRERP
FT                   VLLGSVAAGPMLVLGADVLGRIVARPGELEAGIVTAFIGAPVLLALVLRRTGAR"
FT   CDS_pept        517149..518225
FT                   /transl_table=11
FT                   /gene="fepB"
FT                   /locus_tag="CMM_0435"
FT                   /product="putative iron-siderophore ABC transporter,binding
FT                   protein"
FT                   /function="ABC-type Fe3+-hydroxamate transport system
FT                   periplasmic component"
FT                   /note="putative iron-siderophore ABC transporter, binding
FT                   protein (BAC00469.1| ABC-type Fe3+-siderophores transport
FT                   systems, periplasmic components [Corynebacterium glutamicum
FT                   ATCC 13032];; pfam01497, Peripla_BP_2,Periplasmic binding
FT                   protein. This family includes bacterial periplasmic binding
FT                   proteins. Several of which are involved in iron transport."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0435"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00457"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN21"
FT                   /protein_id="CAN00457.1"
FT                   /translation="MIIASPPRPDRRPTRRRLAGVALAATVLVALAGCAAPAASTGTGS
FT                   ASGTAGADADAAATGYTTPRTMPDGKGSGQPDGVFPRTVVHFAGTTTIPAAPQRVAVIS
FT                   TGQADSLLTLGIVPVASTAADGAAVVPDYLTRAFPEDADALAAVAPLGDRISPDIESVA
FT                   AAKPDLILMNVTGKDAASLYASLSAIAPTVATQGTGLYWKQDLLLLADAVGRTQQAASW
FT                   LDSYQSDAAAFGAGLADRPTVSFLRSSADRIRVFGVASFAGSVAEDAGLPRPTAQDFTD
FT                   ETSRDISEEQIDLAEGGHVFAGVQGGDDTALTGLPLWPTLQAVEDDAVTFVDDDVFYLN
FT                   TGPTAARSVLEAMRSALG"
FT   CDS_pept        complement(518235..518756)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0436"
FT                   /product="putative acetyltransferase"
FT                   /function="Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /note="putative acetyltransferase (NP_103315.1| probable
FT                   transcriptional regulator [Mesorhizobium loti MAFF303099];;
FT                   BAA06228.1| regulatory protein for C-P lyase [Streptomyces
FT                   griseus]). pfam00583, Acetyltransf_1,Acetyltransferase
FT                   (GNAT) family. This family contains proteins with
FT                   N-acetyltransferase functions."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0436"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00458"
FT                   /db_xref="GOA:A5CN22"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN22"
FT                   /protein_id="CAN00458.1"
FT                   /translation="MLADLAIPVPLAARVDGVILRRATVADLAELMRLLADDPVSAGRG
FT                   DRADPGDADLYRDALARILADPANDLLVAADAGGAVVGTLQLTRIPGMARRGASRLQVE
FT                   AVRVRSDLRSAGIGGAMMRWVADAAAPALGTPLVQLTSDAARVDAHRFYERLGYARSHV
FT                   GFKLRIPGGA"
FT   CDS_pept        518809..519558
FT                   /transl_table=11
FT                   /locus_tag="CMM_0437"
FT                   /product="putative SAM-dependant methyltransferase"
FT                   /function="SAM-dependent methyltransferases"
FT                   /note="putative SAM-dependant methyltransferase
FT                   (NP_631493.1| hypothetical protein SC5C11.02. [Streptomyces
FT                   coelicolor A3(2)];; NP_418726.1| putative methyltransferase
FT                   [Escherichia coli K12]). pfam02390,Methyltransf_4, Putative
FT                   methyltransferase."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0437"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00459"
FT                   /db_xref="GOA:A5CN23"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN23"
FT                   /protein_id="CAN00459.1"
FT                   /translation="MDRNRISDLAHADHPIASPLSDHRVDRLLAAAVAGQGTVLDLGCG
FT                   DGSWLLRALRRDPALIAVGVDHSDAGFDRVREQAEREGLADRLELVRADARSWSSNDRF
FT                   DVVLSVGATHAFGGLERTLAAIDGHLRPGGRALVGECFWEQAPTPRVLDLLGSQQDDYG
FT                   DLAATVEVAAANGWVPLQGHVSTLEEWDDYEWSWTGALAAWASGHPDDADRDQVMAASV
FT                   EHRRAWLGGYRGTLGFLTLILGRAAAS"
FT   CDS_pept        complement(519626..520414)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0438"
FT                   /product="putative hydrolase"
FT                   /function="Hydrolases of the alpha/beta superfamily"
FT                   /note="putative hydrolase (NP_350247.1| Alpha/beta
FT                   superfamily hydrolase [Clostridium acetobutylicum];;
FT                   NP_623397.1| Hydrolases of the alpha/beta superfamily
FT                   [Thermoanaerobacter tengcongensis]).
FT                   pfam00561,Abhydrolase_1, alpha/beta hydrolase fold. This
FT                   catalytic domain is found in a very wide range of enzymes."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0438"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00460"
FT                   /db_xref="GOA:A5CN24"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN24"
FT                   /protein_id="CAN00460.1"
FT                   /translation="MARAAGRVAPLELDHGGLTLRGWEHGTVRPGAPAALLVHGFGDSG
FT                   TGGHGLWVPVARALAASGTAARAYDRIGHGVSDGDSADVRLLDEVDQVTAMIRALARDA
FT                   GGPVHVVAHSLGGVESALAAARAPELVASLTLWSPAGVVVDDITVHGRVMSVPLAPSRE
FT                   RGVVDVAGMGLGLGFPDEVLAGVDVYGPVEGYPGPVDVLHGTADEVVPVSYGARYGELM
FT                   PGAAFTAVEGADHGWSSVELRRMLVERLLAHVARAAGAAA"
FT   CDS_pept        complement(520414..520944)
FT                   /transl_table=11
FT                   /gene="padA"
FT                   /locus_tag="CMM_0439"
FT                   /product="putative phenolic acid decarboxylase"
FT                   /function="Phenolic acid decarboxylase"
FT                   /EC_number="4.1.1.-"
FT                   /note="putative phenolic acid decarboxylase (NP_959619.1|
FT                   hypothetical protein MAP0685 [Mycobacterium avium subsp.
FT                   paratuberculosis str. k10];; NP_391320.1| ferulate
FT                   decarboxylase [Bacillus subtilis]). pfam05870,PA_decarbox,
FT                   Phenolic acid decarboxylase (PAD). This family consists of
FT                   several bacterial phenolic acid decarboxylase proteins.
FT                   Phenolic acids, also called substituted cinnamic acids, are
FT                   important lignin-related aromatic acids and natural
FT                   constituents of plant cell walls. These acids (particularly
FT                   ferulic, p-coumaric, and caffeic acids) bind the complex
FT                   lignin polymer to the hemicellulose and cellulose in
FT                   plants. The Phenolic acid decarboxylase (PAD) gene (pad) is
FT                   transcriptionally regulated by p-coumaric, ferulic, or
FT                   caffeic acid; these three acids are the three substrates of
FT                   PAD."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0439"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00461"
FT                   /db_xref="GOA:A5CN25"
FT                   /db_xref="InterPro:IPR008729"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN25"
FT                   /protein_id="CAN00461.1"
FT                   /translation="MENITTSVEHPVPAQDLSPLVGHRLIYTYANGWQYEMYVKNATTI
FT                   DYRIHSGMVGGRWVKDQTVDLVALADGVFKVSWNEPTGTSVVVNIIPAARVLHGTIFFP
FT                   RWVEEDGSKTVLFQNDHLDQMRAHRDAGPTYPIYVVPEFAHITLDEFVGADDETVVDTA
FT                   PGDLPAGFADRRN"
FT   CDS_pept        521008..521508
FT                   /transl_table=11
FT                   /locus_tag="CMM_0440"
FT                   /function="putative transcriptional regulator, MarR family"
FT                   /note="putative transcriptional regulator, MarR family
FT                   (NP_824165.1| putative MarR-family transcriptional
FT                   regulator [Streptomyces avermitilis MA-4680];;
FT                   ZP_00081183.1| COG1846: Transcriptional regulators
FT                   [Geobacter metallireducens]). pfam01047, MarR, MarR family.
FT                   The Mar proteins are involved in the multiple antibiotic
FT                   resistance, a non-specific resistance system."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0440"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00462"
FT                   /db_xref="GOA:A5CN26"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN26"
FT                   /protein_id="CAN00462.1"
FT                   /translation="MPSEPTDAELAAVARRLGSELGPFRRRLMNASRSAADLPDLPDAQ
FT                   VEVLRRLETTGWATPTALGRGLGLARSTISNLVLAMERDGLVDRRLAKGDGRSTEVGLT
FT                   DHARDLLRTFDRSAEGVLVGALRSLTADERRAIARALPALEALHAAIGGEPRRAGGPAT
FT                   RGD"
FT   CDS_pept        521634..522209
FT                   /transl_table=11
FT                   /locus_tag="CMM_0441"
FT                   /product="hypothetical protein"
FT                   /function="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0441"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00463"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN27"
FT                   /protein_id="CAN00463.1"
FT                   /translation="MESRARLRSAATVVALAAIAASTCVALPAQAASRDETPIAGTYAS
FT                   APMSFRGYDSSVAEAHGYRIVTNSDGRQTSVPVSAEARRQAVLDNVAPGDCGSSFVNAA
FT                   KLSNDTLAVTTGYKVPFTVAEKTWRVNAVSVFSSHTFPWDGPSGGAWSAQAAATLVGPG
FT                   VAVVPLTAHVVVVNGRVCYSAGPTASFG"
FT   CDS_pept        522274..522888
FT                   /transl_table=11
FT                   /locus_tag="CMM_0442"
FT                   /product="hypothetical protein"
FT                   /function="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0442"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00464"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN28"
FT                   /protein_id="CAN00464.1"
FT                   /translation="MLNEEGMRSSPASGPSIVVDDDGLVKLMYIRDVWALPDTGIPPSR
FT                   WPAAPAARLEGVAGVEVGQQVRRHWLEAIAWHAGGTDRLHATRLAAEAGDSAAIREVIP
FT                   PRWDPEVGALLDLDRYTEFFLSLPAASYGLVDADEERSQAATVAAVGRGLGAIIVLPIL
FT                   EPHASQVGDSCLLISRGIYADEVRLVRALDGFARGLAEEEG"
FT   CDS_pept        complement(522987..523577)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0443"
FT                   /product="putative MarR-family transcriptional regulator"
FT                   /function="Transcriptional regulators"
FT                   /note="putative MarR-family transcriptional regulator
FT                   (NP_824140.1| putative MarR-family transcriptional
FT                   regulator [Streptomyces avermitilis MA-4680];; NP_629432.1|
FT                   putative MarR-family transcriptional regulator
FT                   [Streptomyces coelicolor A3(2)]). pfam01047,MarR, MarR
FT                   family. The Mar proteins are involved in the multiple
FT                   antibiotic resistance, a non-specific resistance system.
FT                   The expression of the mar operon is controlled by a
FT                   repressor, MarR."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0443"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00465"
FT                   /db_xref="GOA:A5CN29"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN29"
FT                   /protein_id="CAN00465.1"
FT                   /translation="MSDVDRSPVGDAAGDIPDVADGAAEGIAAGIAEVEEQMTALAARI
FT                   RATTREAAARIHPELPPIGYKMLRVIRRCGAAHASAVADQLGVDRSVVSRQLRQLQELG
FT                   LVEVGADAQDGRVRVLALTPTGRMGIEADDAQGGSRLIRGLGEWTRADLDAFAGYLARL
FT                   NAGASSDAVPGPLACGTDADAAAEAPSASVHAA"
FT   CDS_pept        complement(523574..525331)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0444"
FT                   /product="Putative MFS-type transporter"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /note="putative MFS permease (NP_628213.1| putative
FT                   integral membrane transport protein [Streptomyces
FT                   coelicolor A3(2)];; ZP_00226711.1| COG0477: Permeases of
FT                   the major facilitator superfamily [Kineococcus
FT                   radiotolerans SRS30216]). TIGRFAM (TIGR00711): drug
FT                   resistance transporter, EmrB/QacA subfamily."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0444"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00466"
FT                   /db_xref="GOA:A5CN30"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN30"
FT                   /protein_id="CAN00466.1"
FT                   /translation="MSQHHPATAPSAKAPRRTVSADGSMSKRQVLESLSGLLLGMFVSI
FT                   LAGTVVSTSLPIIISDLKGDQSGYTWVVTATLLATTVSTPLWGKFADLFNRKLLIQLAL
FT                   GTFVLGSALAGFSQNTETLIVFRVLQGLGAGGLAALSQIIMADIISPRDRGRYAGLFGA
FT                   VMAVGTVGGPLLGGVVTDAFGWRWNFFIALPIAIIAIILLQVTLHLPAHPKRKVHVDYL
FT                   GAVFIASGVSLLLIWVSQAGKQFEWASGTSYLMAGGAVVLLIAAVVTELKVAEPIIPLT
FT                   MFRNRTFTLSVLASLAVGISLFGTSVFLAQYMQLSRGATPTQSGLLTIPLMAGLLISST
FT                   VFGNLISRRGKWKAIMITGAVLIVAGTSLLSTLRYDTDFVLVGIYMFVLGAGLGMLMQN
FT                   LVLVVQNAIEVKNLGVATSAVTFFRSLGGTVGVSVLGSILGTIIASEITAGITKLAPAD
FT                   QAAAAQALGSGVIPQISQLSPAVRVVVESAYGVGIGDVFLYSVPLAIVSLIAVIFLPNA
FT                   QLGSKNAVQLKSDKAASSDAREVHRTDAEDALIGASAGAVALTPAGEANPTGSIRLPEA
FT                   EDAGVDARR"
FT   CDS_pept        525500..525856
FT                   /transl_table=11
FT                   /locus_tag="CMM_0445"
FT                   /product="conserved hypothetical protein"
FT                   /note="conserved hypothetical protein (ZP_00071215.1|
FT                   hypothetical protein [Trichodesmium erythraeum IMS101];;
FT                   NP_968301.1| putative glyoxalase [Bdellovibrio
FT                   bacteriovorus HD100]). InterPro: Glyoxalase/Bleomycin
FT                   resistance protein/Dioxygenase superfamily
FT                   pfam00903,Glyoxalase, Glyoxalase/Bleomycin resistance
FT                   protein/Dioxygenase superfamily."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0445"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00467"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN31"
FT                   /protein_id="CAN00467.1"
FT                   /translation="MVDSVATVWLPVKDMTRAVAFYRDTLGLTITSEDADWSEIDADGL
FT                   MIGLNAREEAGGSSSGGAVISFTPEGSIEDELAKIKARGAEITGEISDHEWGRILPFQD
FT                   SEGNDLQLYTPPAS"
FT   CDS_pept        complement(525870..527021)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0446"
FT                   /product="putative peptidase"
FT                   /function="Imidazolonepropionase and related
FT                   amidohydrolases"
FT                   /note="putative Xaa-Pro dipeptidase (NP_343867.1| Prolidase
FT                   (Xaa-Pro dipeptidase) (pepQ-like3) [Sulfolobus solfataricus
FT                   P2];; NP_635937.1| Xaa-Pro dipeptidase [Xanthomonas
FT                   campestris pv. campestris str. ATCC 33913])."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0446"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00468"
FT                   /db_xref="GOA:A5CN32"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN32"
FT                   /protein_id="CAN00468.1"
FT                   /translation="MPDLILRRARVWTSPDETISGPQDVLILAGRVAAIGAVASSPGIA
FT                   ELDLGGRVVTSGFWNCHVHLTGRVWSRASRAPAEVQDSLDDMLLRRGFVGAVDLGSLPR
FT                   TTNSLIRRIERGALRGPRIVTAGVGIRPVRGMPFYMRPMVPSFLRGMLPMPATRRGARR
FT                   AVARQIRGGAGVVKLFTGSYVTPERVKPMRRAVARAAVEEAHRRGARVLAHPSDRRGTA
FT                   VAIDAGVDALAHVPDDTEGTEALLAQAAARDMCVVPTLHMFAATVRPNEDYVGPIRTAL
FT                   GGFIAAGGHVLFGTDVGYMPERDTEPELLAMERAGMSAADVLRSLTVEPSAFLGEDVAG
FT                   TGRVEVGGRADLTVLDVESAQRPADLARIRAVIRDGSLTWSAG"
FT   CDS_pept        complement(527021..527329)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0447"
FT                   /product="conserved hypothetical protein"
FT                   /function="unknown"
FT                   /note="conserved hypothetical protein (NP_821812.1|
FT                   hypothetical protein SAV637 [Streptomyces avermitilis
FT                   MA-4680];; NP_714492.1| conserved hypothetical protein
FT                   [Leptospira interrogans serovar lai str. 56601])."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0447"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00469"
FT                   /db_xref="InterPro:IPR015018"
FT                   /db_xref="InterPro:IPR037079"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN33"
FT                   /protein_id="CAN00469.1"
FT                   /translation="MMTDDLPLDFTAPLWAWEARRALWTFVSLPTDLSPMLRELGEAGR
FT                   RGWGSVPVRVRVGTTTWRTSVFPQGDGTWILPIKRAIRDAHGLEVGDDVHVDLEPLP"
FT   CDS_pept        complement(527347..527865)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0448"
FT                   /product="conserved hypothetical protein"
FT                   /function="Adenylylsulfate kinase and related kinases"
FT                   /note="conserved hypothetical protein (ZP_00229168.1|
FT                   hypothetical protein Krad06000331 [Kineococcus
FT                   radiotolerans SRS30216];; ZP_00191774.2| COG0529:
FT                   Adenylylsulfate kinase and related kinases [Kineococcus
FT                   radiotolerans SRS30216];; NP_627216.1| hypothetical protein
FT                   SCE50.21 [Streptomyces coelicolor A3(2)]). Distant
FT                   similarity to the N-terminal part of APS kinase:
FT                   Bifunctional 3-phosphoadenosine 5-phosphosulfate
FT                   synthethase 1 (PAPS synthethase 1) (PAPSS 1) (Sulfurylase
FT                   kinase 1) (SK1) (SK 1) [Includes: Sulfate
FT                   adenylyltransferase (EC 2.7.7.4) (Sulfate adenylate
FT                   transferase) (SAT) (ATP-sulfurylase); Adenylylsulfate
FT                   kinase (EC 2.7.1.25) (Adenylylsulfate 3-phosphotransferase)
FT                   (APS kinase) (Adenosine-5-phosphosulfate
FT                   3-phosphotransferase) (3- phosphoadenosine-5-phosphosulfate
FT                   synthetase)]. BIFUNCTIONAL ENZYME WITH BOTH ATP SULFURYLASE
FT                   AND APS KINASE ACTIVITY WHICH MEDIATES TWO STEPS IN THE
FT                   SULFATE ACTIVATION PATHWAY. THE FIRST STEP IS THE TRANSFER
FT                   OF A SULFATE GROUP TO ATP TO YIELD ADENOSINE
FT                   5-PHOSPHOSULFATE (APS) AND THE SECOND STEP IS THE TRANSFER
FT                   OF A PHOSPHATE GROUP FROM ATP TO APS YIELDING
FT                   3-PHOSPHOADENYLYLSULFATE (PAPS: ACTIVATED SULFATE DONOR
FT                   USED BY SULFOTRANSFERASE). IN MAMMALS PAPS IS THE SOLE
FT                   SOURCE OF SULFATE; APS APPEARS TO BE ONLY AN INTERMEDIATE
FT                   IN THE SULFATE- ACTIVATION PATHWAY. ALSO INVOLVED IN THE
FT                   BIOSYNTHESIS OF SULFATED L-SELECTIN LIGANDS IN ENDOTHELIAL
FT                   CELLS (BY SIMILARITY). apsK: adenylylsulfate kinase"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0448"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00470"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN34"
FT                   /protein_id="CAN00470.1"
FT                   /translation="MTDAVILTGTVGAGKTTTMHALGALLAERGIPHALVDMDAVRLLR
FT                   PAPRTDPFQQELALRNLGDLSRNYHEAGASVVIVAAVVERAEDLASYAAALGSRDPLLV
FT                   RLTVDAGEVQARIEERHLDDAHALAWHSARAPELAAIIDRAGLGGLAIDTTSRTPAEVA
FT                   AVIADRAGW"
FT   CDS_pept        complement(527872..528774)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0449"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00471"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN35"
FT                   /protein_id="CAN00471.1"
FT                   /translation="MTPAARTAEHDAFGPWIDTVRTLDEVPRLYRPHGVDPFAVRLVLK
FT                   VPRDIPRRDTDPTMDLYDHLLVVGDRELEVLSRDGSAYTARRIPFADIVAVRDRVDLLD
FT                   GLLTVHAVDGQALRVPFNGASADVVVELTELLMTLAGESAGVPHARPSETRGATPRIDV
FT                   GQDEAGVAAAYWDLAARDPQLRYLSSRPRTPLVPTADGLMGALQRLRPMSLAGAVAACS
FT                   PRELLILTRRDQVLRRRTATLSIDRLRILRHAISSTTAEPHPRWVGMSTVTIRAGAASF
FT                   EVVAASADELECDLVTGGC"
FT   CDS_pept        complement(528865..529494)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0450"
FT                   /function="putative oxidoreductase"
FT                   /note="putative oxidoreductase (NP_822664.1| putative
FT                   oxidoreductase [Streptomyces avermitilis MA-4680];;
FT                   NP_902034.1| acetoacetyl-CoA reductase [Chromobacterium
FT                   violaceum ATCC 12472]). pfam00106, adh_short, short chain
FT                   dehydrogenase. This family contains a wide variety of
FT                   dehydrogenases."
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0450"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00473"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN36"
FT                   /protein_id="CAN00473.1"
FT                   /translation="MSVDGRVVVVAGASSAAGRAVCAELTAAGARVVAVGTDAGRLAEV
FT                   DSERREVCDLADHAAVVELTGRIRADLGGVDGLIHLVGGWRGGNGLEGQTDDDWDFLHE
FT                   RLVTTLRNTTRAFDADLQASDAGRLAIVSSTAVQRPYPGGANYSTAKIAAETWVRAVDR
FT                   GFSKAGSPARTTIFVVKALGGLERALGRRVVKLWTAVPPERDLIEG"
FT   CDS_pept        complement(529491..530912)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0451"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein (NP_625383.1| hypothetical
FT                   protein 2SCG4.05c [Streptomyces coelicolor A3(2)];;
FT                   NP_625383.1| hypothetical protein 2SCG4.05c [Streptomyces
FT                   coelicolor A3(2)])."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0451"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00474"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN37"
FT                   /protein_id="CAN00474.1"
FT                   /translation="MSSAAPTAAVIGEPEVVEDVATVASSPAWLALKDAAVALQPMQVK
FT                   DGSIPDAAHHAEAARLIQTIRDAVRTLAPLFPHDAAYLAALDVDFARWVDAGLGVPDFL
FT                   DSLNEFQPQRDRVDGIRHLVVFPMTTQNGSASRLVEAVLIEVVWPEFVAELEAGDYGNA
FT                   LFVPIRFVDFTPGYDTNSAVLFPETVAMREIPTFTWGAIFADREAARFRRVVRHAAEVT
FT                   KLELPDDARRLLDDQRLAEETFVMWDLIHDRTHMRGDLPFDPFMIKQRMPFFLYSIEEL
FT                   RCDLTAFREAVAIQRRLAAVDPAERTAADDALLERAGMVQHAVIFDRIFRFAITGSRVR
FT                   NYDGLGGQLLFAWLHQHHVLHWTDTRLTIDWDDVADVVVALADRVNDLYWRSIDRPKTA
FT                   HWLAAYAMVTETVTPHPASTWAKGPGALPLDGPPKGLTDLVLDDEFPLSMFFEALEKKM
FT                   RDVIGSTAGITGQAA"
FT   CDS_pept        complement(531050..531616)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0452"
FT                   /product="putative acetyltransferase"
FT                   /function="Acetyltransferase"
FT                   /note="putative acetyltransferase (NP_253367.1| peptide
FT                   n-acetyltransferase RimI [Pseudomonas aeruginosa PA01];;
FT                   ZP_00088630.1| COG0456: Acetyltransferases [Azotobacter
FT                   vinelandii]). , pfam00583, Acetyltransf_1,Acetyltransferase
FT                   (GNAT) family. This family contains proteins with
FT                   N-acetyltransferase functions."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0452"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00475"
FT                   /db_xref="GOA:A5CN38"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN38"
FT                   /protein_id="CAN00475.1"
FT                   /translation="MPDTPPASPAVALIPVDVERDRDALRVFLTSNAFPFHVRPRPTAA
FT                   DVEARISDGDFDGPEHAALWVEVAGSGRVGLVALDDLEDPGVLFDLRLAEAARGRGLGV
FT                   LVVRALTDHVFGSYPHVTRVEAQTRDDNRAMRRVLVRAGFVKEAHYRDGWPVVGGEPRA
FT                   SVGYAVLRRDHESGTTTPVPTDDEA"
FT   CDS_pept        531745..532962
FT                   /transl_table=11
FT                   /gene="pitA"
FT                   /locus_tag="CMM_0453"
FT                   /product="Low affinity phosphate permease"
FT                   /function="Phosphate/sulphate permeases"
FT                   /note="puative low-affinity inorganic phosphate permease
FT                   (ZP_00227554.1| COG0306: Phosphate/sulphate permeases
FT                   [Kineococcus radiotolerans SRS30216];; NP_737084.1|
FT                   putative phosphate transport protein PitA [Corynebacterium
FT                   efficiens YS-314]). pfam01384, PHO4, Phosphate transporter
FT                   family."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0453"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00476"
FT                   /db_xref="GOA:A5CN39"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN39"
FT                   /protein_id="CAN00476.1"
FT                   /translation="MDPFILLVLVVITALAFDFTNGFHDTANAMATSIATGALKPKVAV
FT                   TLSAVLNLVGAFLSIEVALTVTNAVVKIQDKSGAPDPALLQGGGSALLLIVLAGLIGGI
FT                   VWNLLTWLLGLPSSSSHALFGGLIGSTLAGLGLNGVNWAGDGSKLDGVVGKVILPALMS
FT                   PILAGAVAAVGTWLVFRIIGNLAGRGLDRTFRIGQIGSASLVSLAHGTNDAQKTMGVIT
FT                   LALIAAGGWTDTESVPFWVKISCALAISLGTYIGGWRIIRTVGKGLVEIDTHQGMAAES
FT                   SSAAVILASSHLGFALSTTHVATGSILGSGVGRPGAQVRWRVALRMVVAWIITLPAAAL
FT                   VGAVMWWLGHLIGGAAGGIAMTLVLVAVSITVYVRSRKDDVGAHNVNDEWSDEKTARPA
FT                   AQPADV"
FT   CDS_pept        532974..533285
FT                   /transl_table=11
FT                   /locus_tag="CMM_0454"
FT                   /product="putative membrane protein"
FT                   /function="unknown"
FT                   /note="putative membrane protein (NP_737083.1| hypothetical
FT                   protein [Corynebacterium efficiens YS-314];; ZP_00227553.1|
FT                   hypothetical protein Krad06004394 [Kineococcus
FT                   radiotolerans SRS30216])."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0454"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00477"
FT                   /db_xref="GOA:A5CN40"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN40"
FT                   /protein_id="CAN00477.1"
FT                   /translation="MLPLFLSAVGQVALVALLLGAGLPALFALGVRSFALASPDTSGRV
FT                   AGSDSARRMPPVVLQAVGALCYAVVVLAVVAGLTLIIATGLGQSVSFEHVIPTFTSKG"
FT   CDS_pept        533288..533998
FT                   /transl_table=11
FT                   /locus_tag="CMM_0455"
FT                   /product="conserved hypothetical protein"
FT                   /note="conserved hypothetical protein, putative fusion
FT                   protein containing duplicated domain (NP_962973.1|
FT                   hypothetical protein MAP4039c [Mycobacterium avium subsp.
FT                   paratuberculosis str. k10];; ZP_00198152.1| hypothetical
FT                   protein Krad06004393 [Kineococcus radiotolerans
FT                   SRS30216])."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0455"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00478"
FT                   /db_xref="InterPro:IPR021784"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN41"
FT                   /protein_id="CAN00478.1"
FT                   /translation="MADSASEAGGPVDGTTGVAVPDRHDRGIVQRVVGWLRAGYPSGVP
FT                   DQDYVPLLGILRRSLTAEELEQVVDQLVDDAVQADAAGEEIGRSRLRERVEAMLLGPAM
FT                   PEDLVRVSARLAAAGWPLGSPEDLHEPDAADARATERTGLVSRVVAWLRAGYPAGLPEQ
FT                   DFVPLLALLRRRLSDEEVQEVSARLASEGGLPASRLDVASAIAGVTSEMPSDADVERVR
FT                   AYLESHGWPEGFRI"
FT   CDS_pept        complement(534030..534233)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0456"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0456"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00479"
FT                   /db_xref="GOA:A5CN42"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN42"
FT                   /protein_id="CAN00479.1"
FT                   /translation="MRRSTARFVAAFVVMIASGAGLIAVIPSALGAGVPLDGWIPIALC
FT                   ALFAASALAAFRVRPAGGARYD"
FT   CDS_pept        534450..535112
FT                   /transl_table=11
FT                   /locus_tag="CMM_0457"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /function="Transcriptional regulator"
FT                   /note="putative transcriptional regulator, TetR family
FT                   (NP_599627.1| transcriptional regulator [Corynebacterium
FT                   glutamicum ATCC 13032];; AAM94766.1| CalR1 [Micromonospora
FT                   echinospora]). pfam00440, TetR_N, Bacterial regulatory
FT                   proteins, tetR family."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0457"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00480"
FT                   /db_xref="GOA:A5CN43"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN43"
FT                   /protein_id="CAN00480.1"
FT                   /translation="MTTSATGTGLRERRRVETSAKLTTLARRLTAQHGLAGFTVEEVCE
FT                   QAGVSRRTFFNYFASKEDALFGRSARVDTADLEEAFVAAGDPEDPALSPTLLDDLADLC
FT                   LERWARLDTDGTSMQDMHAAFRREPGLLVRALEAAVEDEAKDVLLVERREGLPAGDLRA
FT                   SVVVQIMGALGRASAREFLAPGNADPIQLILRRRLDALREIAHPTTTATTRQHERTP"
FT   CDS_pept        535109..536812
FT                   /transl_table=11
FT                   /locus_tag="CMM_0458"
FT                   /product="MFS-type efflux permease"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /note="putative MFS permease (ZP_00229023.1| COG0477:
FT                   Permeases of the major facilitator superfamily [Kineococcus
FT                   radiotolerans SRS30216];; NP_599629.1| permease of the
FT                   major facilitator superfamily [Corynebacterium glutamicum
FT                   ATCC 13032]). InterPro: Drug resistance transporter
FT                   EmrB/QacA subfamily pfam00083,Sugar_tr, Sugar (and other)
FT                   transporter. TIGRFAM (TIGR00711): drug resistance transport
FT                   protein"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0458"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00481"
FT                   /db_xref="GOA:A5CN44"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN44"
FT                   /protein_id="CAN00481.1"
FT                   /translation="MTATAPAPLLLTQRRIWIIFSALIAGMLLSSLDQTIVSTAMPTIV
FT                   GELGGVDHQVWITTAYLLATTIVMPIYGKFGDVLGRRNLFLAAIAIFTLASVGCAFAGD
FT                   FWSFVVFRAAQGLGGGGLMILSQSIIADIVPANQRGKYLGPLGGIFGLSAVGGPLLGGF
FT                   FVDHLTWQWAFYINIPIGIAAFVVAFITLTLPSKRATKRIDVAGVVLLSLATTCLIFFT
FT                   DFGGDKAYGWGSLATWAWGLGLVVAASLFVFTESRADDPVIPLSLFRNPVFVNATAIGL
FT                   ALGIGMFAAIGFVPTFLQMSTGTSAAVSGLLLLPMMVGLIGMSITSGILISRTGRYRIF
FT                   PIVGTLLTMLALVLMTSLTAQTPVWLICVFLFIFGLGLGLIMQVVVLVVQNAVPAAQIG
FT                   TATSTNNYFREVGAALGTAVFGTLFTTRLTENLTTVFAGAGAAPGDAAASASSIDPQTL
FT                   NGLPDAVRDGIVDAYADALAPVFWYLVPFIAIAFVLSLVLKQIPLSDVAGLVARGEAVG
FT                   GEEAERLEAEQRAGVRAGTSPAQATGPDAADDASRIAVPSSDVRDGRPER"
FT   CDS_pept        536932..537375
FT                   /transl_table=11
FT                   /locus_tag="CMM_0459"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /note="conserved hypothetical protein (NP_627085.1|
FT                   hypothetical protein SCE20.30. [Streptomyces coelicolor
FT                   A3(2)];; NP_438059.1| CONSERVED HYPOTHETICAL PROTEIN
FT                   [Sinorhizobium meliloti 1021]). pfam05146, DUF704, Aha1
FT                   domain. The function of this presumed domain is unknown."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0459"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00482"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN45"
FT                   /protein_id="CAN00482.1"
FT                   /translation="MSEPIVITRTFAAPRERVFDAWITPADFSAWFGTAAVDVPLDTLR
FT                   MDVRVGGAWSAVMRLPDGGSIDWAGEYVELDRPSRLAMTMTDRPDQPAGAPLTVDLEEV
FT                   AGGATRMTMTQRAGEFTPEQRAMTIQGGGGFLDVMEGLVAPTA"
FT   CDS_pept        complement(537372..539066)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0460"
FT                   /product="conserved hypothetical protein"
FT                   /function="unknown"
FT                   /note="conserved hypothetical protein (ZP_00120870.2|
FT                   hypothetical protein Blon020749 [Bifidobacterium longum
FT                   DJO10A];; ZP_00218065.1| hypothetical protein Bcepa02000673
FT                   [Burkholderia cepacia R18194])."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0460"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00483"
FT                   /db_xref="GOA:A5CN47"
FT                   /db_xref="InterPro:IPR000560"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN47"
FT                   /protein_id="CAN00483.1"
FT                   /translation="MRLRTRRRLSASVALALALGIAAGGSALPALAATGDGSGTGAATG
FT                   SGSADRTHYSSKTPYAPQGTPADLAPAPAGFAPVYTESVARHGSRALSSFKYDSLTTQV
FT                   WEQARSEGALTTLGETLGPEVQKLTAANQKLGYGNLTGQGADQHRGIGARVVQRLPTLF
FT                   AGIDAGSDTVALESSGEARATASGKAFAEGLKRADPLLASHLPKDIAKDPDTLYFHKSA
FT                   ANADYQAYEDGPAVTAAVDAIYAQPRSHEAARRLLERIYTPAFVDRLAAGQYHFVDGGD
FT                   GGTHVDDELDAAMMLYNLYIIAPDMTEEVSVDFDRYFTSAGAGDDADTEWFAYLLDAED
FT                   FYSKGPAFQGSDITYRMATPLLDDFLDSMDARLAGSSTAATFRFAHAETIIPFAALLGL
FT                   PGSTQPVTPEAPYTYATNAWRGETVTPMAANVQWDVYRDATGRAIVRMLYDEKAIPFRA
FT                   GCAPIAPGSLFYDAGEVRRCLTAVAVVDPGTTAPGASDPGALPGSPAAIAAADASAARG
FT                   DTLAATGMSADELPFLAVLAFALGAAGITAVGVVRRPRRERPADDPR"
FT   CDS_pept        539259..540188
FT                   /transl_table=11
FT                   /locus_tag="CMM_0461"
FT                   /product="putative permease, AEC family"
FT                   /function="Predicted permeases"
FT                   /note="putative permease, AEC family (NP_696444.1|
FT                   hypothetical protein with unknown or transport function
FT                   [Bifidobacterium longum NCC2705];; ZP_00189944.2| COG0679:
FT                   Predicted permeases [Kineococcus radiotolerans SRS30216]
FT                   2a69: Auxin Efflux Carrier pfam03547, Auxin_eff, Auxin
FT                   Efflux Carrier. This family of transporters are found in
FT                   all domains of life."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0461"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00484"
FT                   /db_xref="GOA:A5CN48"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN48"
FT                   /protein_id="CAN00484.1"
FT                   /translation="MIGVLTGFAIIGFIIAVGYGVGRSGIAGPGAQHSLNRVAFFVATP
FT                   ALLFTVLAKADLHVVFSAFLLTSASAVAVAAILYLVVARILFRRPVAETTIGAASASYV
FT                   NANNIGLPVAIYVLGDAQLVAPVLLLQLLVLAPTTLTVLDISSRGSASVVGILTQPLRN
FT                   PMIIASMLGILIAITGLQVPDAIYEPFRLIGGAAIPIVLMAFGMSLVGRKPLAPGSGRG
FT                   EIVVASVIKTVVMPLAAFLLARFAFHLDAPQTFAATVIAGLPTAQNIFNFASRYERGVV
FT                   LARDTVLITTVASIPVLLVIAALLAPGT"
FT   CDS_pept        complement(540201..540359)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0462"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00485"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN49"
FT                   /protein_id="CAN00485.1"
FT                   /translation="MPLIRFLFVAVPVIRRFLRSRQGKAAMAKGKAQMAKRSQKRAAQR
FT                   TAATRRR"
FT   CDS_pept        complement(540498..540974)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0463"
FT                   /product="putative acetyltransferase"
FT                   /function="Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /note="putative acetyltransferase (ZP_00184384.1|
FT                   hypothetical protein Exigu007901 [Exiguobacterium sp.
FT                   255-15];; ZP_00062966.1| COG0454: Histone acetyltransferase
FT                   HPA2 and related acetyltransferases [Leuconostoc
FT                   mesenteroides subsp. mesenteroides ATCC 8293]
FT                   pfam00583,Acetyltransf_1, Acetyltransferase (GNAT) family.
FT                   This family contains proteins with N-acetyltransferase
FT                   functions."
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0463"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00486"
FT                   /db_xref="GOA:A5CN46"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN46"
FT                   /protein_id="CAN00486.1"
FT                   /translation="MPSVTVRPMTPSEFARMMAAADEDYAARQVEAGLWPPEGALARAT
FT                   AETAKWLPDGIRTPRTLLLRGLDEHGVGVGSAWVALDDPNGRPDTAFLFELLVDPSRRG
FT                   CGYGRALLAAVEEATRAAGAPALALNVFGANRVAIALYASAGYGVTAQQMRKAL"
FT   CDS_pept        complement(541062..542021)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0464"
FT                   /product="conserved hypothetical protein"
FT                   /function="UDP-glucose 4-epimerase"
FT                   /note="putative sugar reductase (NP_625517.1| putative
FT                   reductase [Streptomyces coelicolor A3(2)];; CAF21980.1|
FT                   Sugar dehydratase [Azoarcus sp. EbN1])."
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0464"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00487"
FT                   /db_xref="GOA:A5CN50"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN50"
FT                   /protein_id="CAN00487.1"
FT                   /translation="MPSSTSRRALVLGGTGAIGGATAERLARDGWSVDVTGRDPLAMPA
FT                   RLTDLGVRFHALDRADACGIERLTGDGVDLLVDLVAFTAADVQALLPVMRASGSVVVAS
FT                   SRAVHVDDAGRHVNGDEPPRFPVPIPEDNPTLPPAAPGTDPFTREGYAPSKVAVERAAL
FT                   DSGLPVTVIRPSKVHGRWARNARTRAVVERMLAGADTIELADRGASVDHLTAAANAAAL
FT                   VARVADVPGARILHSADPDPLTAAEIVAVIAEELGWRGRIVPLEPGVAGGAHPWAAAHP
FT                   IVLDTRASLALGYAPVGPGAVLLRAEVAWIRDGERPRG"
FT   CDS_pept        542088..542327
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="CMM_PS_12"
FT                   /function="putative deaminase"
FT                   /note="putative deaminase, COG0295: Cytidine deaminase"
FT                   /note="Hypothetical protein"
FT                   /db_xref="PSEUDO:CAN00488.1"
FT   CDS_pept        complement(542537..543241)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0465"
FT                   /product="hypothetical protein"
FT                   /function="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0465"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00489"
FT                   /db_xref="GOA:A5CN52"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN52"
FT                   /protein_id="CAN00489.1"
FT                   /translation="MDDDDRRTEIAELRRRVFGPDRDPRDAAALARLRELEGRGAVPSA
FT                   DPQRGEPYGAREADLRDVDPDAVPPRREGRRPRLHPRLAAVWTASIVIAVVASAGATAW
FT                   WLGDERGTVAMLALEPPPVPDNATYLSVDTGSIAPGSLFAAFHGISVARIPVPDPATGV
FT                   EETCLVAGPAEQDGAVSGVPGCATGAVPARTALVVTADQPQELRDAFPLGTTLTFELDG
FT                   DGETVRVRTVGG"
FT   CDS_pept        complement(543275..544162)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0466"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /note="conserved hypothetical protein (NP_828650.1|
FT                   hypothetical protein SAV7474 [Streptomyces avermitilis
FT                   MA-4680];; NP_293888.1| endo alpha-1,4
FT                   polygalactosaminidase,putative [Deinococcus radiodurans
FT                   R1])."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0466"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00490"
FT                   /db_xref="InterPro:IPR004352"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN53"
FT                   /protein_id="CAN00490.1"
FT                   /translation="MRPLLFAALATAALVALSGCATADPGPASAPTVASADAATTGLLA
FT                   ADTTAAATATVTLPPVGTGFDYQLGGASPVPAGVGIVVRDSTDEPAAGAYGVCYVNGFQ
FT                   TQPGETWPDDLLVQGDDGPLVDPNWDDEHILDTSTAAKRTAIAARQATAVDRCADAGFQ
FT                   AVEFDNLDSWHRSAGALDADDALALATLLVDHAHSRGLAVAQKNTTDIGSRGRDEAGFD
FT                   FAIAEECDRWKECADYTAVYGPHVLDVEYTDDLRGTADEVCARILALDPAPRAIVRDRD
FT                   LVPSSEDGYAYAAC"
FT   CDS_pept        complement(544172..544609)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0467"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /note="conserved hypothetical protein (NP_695944.1|
FT                   narrowly conserved hypothetical protein [Bifidobacterium
FT                   longum NCC2705];; NP_358299.1| Conserved hypothetical
FT                   protein [Streptococcus pneumoniae R6]). pfam06171,
FT                   DUF984,Protein of unknown function (DUF984)."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0467"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00491"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR009326"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN54"
FT                   /protein_id="CAN00491.1"
FT                   /translation="MTTTPDADLPPVEFAFPGPLRDQLVAAIVSGEKTSTSSLLAQYAA
FT                   DDEELPVVGSLGAVIDSAGRPVLVIETTAVEIARLADVPLAHALDEGEGFTTVAEWRAG
FT                   HEGFWGSAEVLAELPDGFRLDDDTEIVMERFRVVGAADRPA"
FT   CDS_pept        complement(544648..544995)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0468"
FT                   /product="putative membrane protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0468"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00492"
FT                   /db_xref="GOA:A5CN55"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN55"
FT                   /protein_id="CAN00492.1"
FT                   /translation="MTLFGLQQPPAPGTRPSSGWMVALTLTGAGLAVIGLIASTASRTA
FT                   EDESFYPDYSTSLFFAGVASIGLMLLIAAFIIKAATSVPRPVYLVQAPPSEQQPLLLAD
FT                   MEVPRPTDENV"
FT   CDS_pept        545154..546062
FT                   /transl_table=11
FT                   /locus_tag="CMM_0469"
FT                   /product="putative oxidoreductase"
FT                   /function="Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /note="putative oxidoreductase (NP_636454.1| oxidoreductase
FT                   [Xanthomonas campestris pv. campestris str. ATCC 33913];;
FT                   NP_535107.1| oxidoreductase [Agrobacterium tumefaciens str.
FT                   C58]). pfam00106, adh_short, short chain dehydrogenase"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0469"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00493"
FT                   /db_xref="GOA:A5CN56"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN56"
FT                   /protein_id="CAN00493.1"
FT                   /translation="MSEIRNSGNQYEIQDPIAQYPSPPFPQQEQTGPGDEKRFEPTPDH
FT                   GQDSYVGFGRLTGRKVLITGADSGIGKAVAIAFAREGADIALNFLDEELEDARDTASTI
FT                   EADGRTAALVPGDISDETACQDIVQASVAALGGVDCLVMVAGYQRNEDDILDLDSEQLD
FT                   RTMKTNVYSLFWLSKAVIPHLPKGGSIITTSSSQAYQPSPDKIDYAVSKGAIRNFTQGL
FT                   AQQLAPKGIRVNSVAPGPFWTVLQPVGQSASDVEEFGSQSVYGRPGQPAEIAATYVFLA
FT                   SQESSFTSGETIAVTGGTPVH"
FT   CDS_pept        complement(546093..546659)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0470"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /note="conserved hypothetical protein (NP_862390.1| MC12
FT                   [Micrococcus sp. 28];; ZP_00225867.1| hypothetical protein
FT                   Krad06004329 [Kineococcus radiotolerans SRS30216]).
FT                   pfam03473, MOSC, MOSC domain. The MOSC (MOCO sulfurase
FT                   C-terminal) domain is a superfamily of beta-strand-rich
FT                   domains identified in the molybdenum cofactor sulfurase and
FT                   several other proteins from both prokaryotes and
FT                   eukaryotes."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0470"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00494"
FT                   /db_xref="GOA:A5CN57"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN57"
FT                   /protein_id="CAN00494.1"
FT                   /translation="MVDLPHEHRVEIAFLVASPVHRLEGRPSDGPRDEPGEPPSRVSVR
FT                   VRAGLGIVGDRYFGQRAHRTAAVTVMAVESVERVARELGVEAGLDPVDTRRNVLLRGAD
FT                   VDRLRGMRFSIDSGHGPVEFQGHRPANPCAWMDVMLAPGAFRALRGRGGVRCEPLGDGI
FT                   LTVGPAVLRTERPLGDEDGDGARLF"
FT   CDS_pept        546768..548468
FT                   /transl_table=11
FT                   /locus_tag="CMM_0471"
FT                   /product="putative two-component sensor histidine kinase"
FT                   /function="Signal transduction histidine kinase"
FT                   /note="putative two-component sensor histidine kinase
FT                   (NP_834294.1| Phosphate regulon sensor protein phoR
FT                   [Bacillus cereus ATCC 14579];; ZP_00061962.1| COG5002:
FT                   Signal transduction histidine kinase [Clostridium
FT                   thermocellum ATCC 27405]). pfam00512, HisKA, His Kinase A
FT                   (phosphoacceptor) domain. Dimerisation and phosphoacceptor
FT                   domain of histidine kinases. pfam02518, HATPase_c,Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0471"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00495"
FT                   /db_xref="GOA:A5CN58"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN58"
FT                   /protein_id="CAN00495.1"
FT                   /translation="MGELAPSDVRRDPVSRAQARLRSMTLSKPLHAQLPFILSLAVVGV
FT                   VAGTGDLDSVAHPGFVAGTVVAAIVTIVAAVIPWERIDADWVAVLPMLDFVALALCHDA
FT                   IGDQVPSTAFLIVFPVIWLAYAFALHVLWLGALGTASVLALPYFRTGTVPEGTTGWSHL
FT                   VVLPVVMLLVAVAVNLLAQQLIRQHARLEEMQRELTGTLVDLQERNSIIDGVLDAIDDT
FT                   VIVLDATGRIMLRNRAARELMALAGPADPDDPMLGRLVYEEDRVTVVPPERQLVARARA
FT                   GEIVGREVYWIGDGGAQKAVLSSLSPLVDASGRIFGTVVVSTDVTALALAVTEREDFVA
FT                   SVSHELKTPLTSILGYVELIADDLEEDDLDDRITAARLAIVERNAQRLLGLIGDLLTAA
FT                   QHKLAVNRNLVDVGEIVENALDVIRPHAQASGVTLVEPDYEELVAEVDAVRIGQVLDNL
FT                   LSNAVKYTPEGGTVITEVGVDGDHFRLCVTDDGVGMSAEDTSQLFTRFFRTNSARASTV
FT                   AGVGLGLSITRSIVEAHDGSIEVESAVGTGTTMRVRLPLRIGPATSRPT"
FT   CDS_pept        548510..549385
FT                   /transl_table=11
FT                   /locus_tag="CMM_0472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0472"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00496"
FT                   /db_xref="GOA:A5CN59"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN59"
FT                   /protein_id="CAN00496.1"
FT                   /translation="MSGSSNDGATRPTRAIEGPDDPPRPPRERHPSRAHRVPGRIHGCA
FT                   AGARRRPPRSFRSSRRRPGVSARTARVPQLPPLLDVRVLEQLLVELSDEPGPARLSVVP
FT                   TTGTPAPPPGVPAPGGVTPPRGHPEPRRGTPSSGSPRPDDRLATRGAPAPGRGQAPAGS
FT                   PRPVGALTSFPAPAEPTCPGALTDGQHACVDFLRFFVDLWPSRWERLDAAVRAADRPAA
FT                   LDACLSVKSSAAMVGALLLSDVAAHLERAIRAADHARAAAMLPELGEVGERSMDAMRSW
FT                   IRAEAGHPPD"
FT   CDS_pept        complement(549618..550475)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0473"
FT                   /product="putative two-component system response regulator"
FT                   /function="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /note="putative two-component system response regulator
FT                   (ZP_00019357.1| hypothetical protein [Chloroflexus
FT                   aurantiacus];; NP_602156.1| two-component system, response
FT                   regulator [Corynebacterium glutamicum ATCC 13032]).
FT                   InterPro: Response regulator receiver domain
FT                   pfam00072,Response_reg, Response regulator receiver domain.
FT                   This domain receives the signal from the sensor partner in
FT                   bacterial two-component systems. It is usually found
FT                   N-terminal to a DNA binding effector domain.
FT                   pfam00486,Trans_reg_C, Transcriptional regulatory protein,
FT                   C terminal."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0473"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00497"
FT                   /db_xref="GOA:A5CN60"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN60"
FT                   /protein_id="CAN00497.1"
FT                   /translation="MDSGRVALVIEDDGDIRQLLEVVLRQGGFEVHSAGTATEGVRLAE
FT                   EVSPDVITLDVGLPDFDGFEAARRIRLVSDAYIVMLTAQGEEVDTLLGLEAGADDYIVK
FT                   PFRPRELRARISAMMRRPRGGGDATATPAAGIPAAADASGTAADADEPVQAAAVATTAV
FT                   VSPAMPTEAAPDDADVLRHNGLELDEGTRHVTVDGAPVDLTRTEFDLLASILASGGRVR
FT                   TKGDLVRDIRSGSYAVASSTEPEERAVEVHLGNLRRKLHDDPREARWIQTVRGVGYRLA
FT                   PPRG"
FT   CDS_pept        complement(550605..551192)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0474"
FT                   /product="putative membrane protein"
FT                   /note="putative membrane protein (only very weak
FT                   similarities to histidine kinases, two-component
FT                   regulators)"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0474"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00498"
FT                   /db_xref="GOA:A5CN61"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN61"
FT                   /protein_id="CAN00498.1"
FT                   /translation="MTPDDDATPERGRRASRGRRSATPPARRRRLPEVPRIALPTLPRG
FT                   RGRADDRSETRAAARSAARDDDPAGPDWVPRWILRIDRRILVTTLVSMLVAAVVGGSIA
FT                   AMGLGLIFVTDACDVDAYVCRDSLFTIGYGIAVAGPLFLTGIAVIVALVGMIRGRTRPW
FT                   LVLLIGVGASLAAYVLGAVLVLVAVPGSSPIT"
FT   CDS_pept        complement(551281..552117)
FT                   /transl_table=11
FT                   /gene="xthB"
FT                   /locus_tag="CMM_0475"
FT                   /product="putative exonuclease III"
FT                   /function="Exonuclease III"
FT                   /EC_number="3.1.11.2"
FT                   /note="Exodeoxyribonuclease III (ZP_00227856.1| COG0708:
FT                   Exonuclease III [Kineococcus radiotolerans SRS30216];;
FT                   CAB06567.1| PROBABLE EXODEOXYRIBONUCLEASE III PROTEIN XTHA
FT                   (EXONUCLEASE III) (EXO III) (AP ENDONUCLEASE VI)
FT                   [Mycobacterium tuberculosis H37Rv]). ,
FT                   pfam03372,Exo_endo_phos,
FT                   Endonuclease/Exonuclease/phosphatase family."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0475"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00499"
FT                   /db_xref="GOA:A5CN62"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN62"
FT                   /protein_id="CAN00499.1"
FT                   /translation="MRVATWNVNSIRTRVGRVVDWLVREDVDVLAMQEIKCKPEQFPMQ
FT                   AFEEAGYEVAVHGLSQWNGVAIASRLPLEDVVTTFEGMPRFGKPDASGQPPLEARAMGA
FT                   TVAGVRLWSLYVPNGRALDDPHYSYKLEWLGALAADTRAWLASDPETPLALMGDWNVAP
FT                   LDTDVWDPALFEGKTHTSEPERAAFAAFLDAGLTDVVRPSIPEGYTYWDYQQLRFPRNE
FT                   GMRIDFILGNDRFQELVGSPRIHRDERKGDGPSDHVPVAVDLDVETELDDDRPMIF"
FT   CDS_pept        complement(556093..556488)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0476"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00500"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN63"
FT                   /protein_id="CAN00500.1"
FT                   /translation="MTLDDDASPAPAPVPIPLPDPADLSRDLTAVLRGVPGVADVFAPR
FT                   SPVLLVAQQVVEGVVAGSSTAAEQLVTVETGEGTVLVQASIAVDAAGRASDTARAAVDA
FT                   IRARLAESVGPEAAALATVTVRVGSIG"
FT   CDS_pept        complement(556485..557234)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0477"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein , , pfam03780, DUF322, Protein
FT                   of unknown function (DUF322). This is a family of small
FT                   proteins. It includes a protein identified as an alkaline
FT                   shock protein, so may be involved in stress response."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0477"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00501"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN64"
FT                   /protein_id="CAN00501.1"
FT                   /translation="MSGTGPGDPGERLPVGPAEPVQPGVPAGPRQPVQPGVPADPATPV
FT                   VPPADAAPAPAPDADGDPVDMAALADYLDRGRTPRIAAYEDDPDTRNALRALEHMRDLG
FT                   RELVEAEAEEADAPGDDFFRGVLAHISRESRAGRDIPLSHPDPGVRLALTEGAVRTLVR
FT                   QAGDEVPGVLIGRCTLDGEVTRAGEPVRVALTMSVVWGDPLPELAQRVRERVHAALLRH
FT                   TELRVEAIDVTVVDVQARPAPEEEAGR"
FT   CDS_pept        complement(557231..557785)
FT                   /transl_table=11
FT                   /gene="sigZ"
FT                   /locus_tag="CMM_0478"
FT                   /product="putative ECF sigma factor"
FT                   /function="DNA-directed RNA polymerase specialized sigma
FT                   subunit, sigma24 homolog"
FT                   /note="ECF sigma factor (ZP_00198063.1| COG1595:
FT                   DNA-directed RNA polymerase specialized sigma subunit,
FT                   sigma24 homolog [Kineococcus radiotolerans SRS30216];;
FT                   ZP_00179997.2| COG1595: DNA-directed RNA polymerase
FT                   specialized sigma subunit, sigma24 homolog [Moorella
FT                   thermoacetica ATCC 39073]). pfam04542, Sigma70_r2, Sigma-70
FT                   region 2. Region 2 of sigma-70 is the most conserved region
FT                   of the entire protein. All members of this class of
FT                   sigma-factor contain region 2. The high conservation is due
FT                   to region 2 containing both the -10 promoter recognition
FT                   helix and the primary core RNA polymerase binding
FT                   determinant. pfam04545, Sigma70_r4, Sigma-70,region 4.
FT                   Region 4 of sigma-70 like sigma-factors are involved in
FT                   binding to the -35 promoter element via a helix-turn-helix
FT                   motif."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0478"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00502"
FT                   /db_xref="GOA:A5CN65"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN65"
FT                   /protein_id="CAN00502.1"
FT                   /translation="MALSSSLQDAGDGILAERAADGDARAFEVLVRRHAPYMRAFAIRL
FT                   TGSRADADDAVQEALITAWDRLPTLEKPDRVKSWLLQIVSRKSIDRIRARRPADDIDDH
FT                   EIADRLTSPERDAETSSQMRALAAVLDALPREQREVWMLREVGGFSYEEIAEKLGSTPS
FT                   TVRGRLSRARTTVMTSMEAWR"
FT   CDS_pept        557918..558391
FT                   /transl_table=11
FT                   /locus_tag="CMM_0479"
FT                   /product="conserved hypothetical protein"
FT                   /note="conserved hypothetical protein (ZP_00189314.2|
FT                   COG1302: Uncharacterized protein conserved in bacteria
FT                   [Kineococcus radiotolerans SRS30216];; NP_626104.1|
FT                   putative stress-like protein [Streptomyces coelicolor
FT                   A3(2)]). pfam03780, DUF322, Protein of unknown function
FT                   (DUF322). This is a family of small proteins. It includes a
FT                   protein identified as an alkaline shock protein, so may be
FT                   involved in stress response."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0479"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00503"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN66"
FT                   /protein_id="CAN00503.1"
FT                   /translation="MSDQNTSTPADVARVSPASTGASTGATGSVLAEGDTTVTDAVIAK
FT                   VAGLAVRDIPGVHALGGGAARVIGQLRDRIGQTDLTQGIAVDAQEAGVAFEVTLVAEYG
FT                   VPLQDVAAGVRAAISDAVTELVGRRVTRVDVTIADIVLPGEGSDDDASAAPAV"
FT   CDS_pept        558564..559439
FT                   /transl_table=11
FT                   /locus_tag="CMM_0480"
FT                   /product="putative beta-hydroxyacid dehydrogenase"
FT                   /function="3-hydroxyisobutyrate dehydrogenase and related
FT                   beta-hydroxyacid dehydrogenases"
FT                   /note="putative beta-hydroxyacid dehydrogenase
FT                   (NP_822718.1| putative dehydrogenase [Streptomyces
FT                   avermitilis MA-4680];; ZP_00187394.1| COG2084:
FT                   3-hydroxyisobutyrate dehydrogenase and related
FT                   beta-hydroxyacid dehydrogenases [Rubrobacter xylanophilus
FT                   DSM 9941])."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0480"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00504"
FT                   /db_xref="GOA:A5CN67"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN67"
FT                   /protein_id="CAN00504.1"
FT                   /translation="MTLLGTGVMGSGMSRSILRAGLPLTVWNRSAEKAAPLADAGATVA
FT                   ESAADAVRDADVVVVMLFDADAVLEVLAEVAPALRPGAVVLQSSTVGVEGTRRIAALAA
FT                   EHAVRFVDAPVLGTRGPAEQGLLVHLVSGSEDDLAVARPVLEATGSRTVVAGSDAGPGS
FT                   ALKLACNAWIASITAATGQSLGLARLLGVEPRLFLDAIAGGAADTPYAHLKGGAMLAGE
FT                   LAPSFALDGLLKDVTLMLAALDGADAHDFDTAMLEALRETYAEASSAGHGGDDVAAVGT
FT                   VFGLPTGPDA"
FT   CDS_pept        559506..560060
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="CMM_0481"
FT                   /function="Orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="putative orotate phosphoribosyltransferase
FT                   (Q9X8R7|PYRE_STRCO Orotate phosphoribosyltransferase (OPRT)
FT                   (OPRTase);; NP_940413.1| Phosphoribosyltransferase
FT                   [Corynebacterium diphtheriae NCTC 13129]). InterPro:
FT                   Orotate phosphoribosyltransferase pyrE: orotate
FT                   phosphoribosyltransferase pfam00156,
FT                   Pribosyltran,Phosphoribosyl transferase domain."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0481"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00505"
FT                   /db_xref="GOA:A5CN68"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN68"
FT                   /protein_id="CAN00505.1"
FT                   /translation="MTTSDARQQLIDHIKRDAVFHGDFTLTSGKKASYYVDLRRVSLDH
FT                   RVAPLIGQVMLDLIADVPDVAAVGGLTMGADPIAAAILHQGAAVGRGYDAFVVRKEPKD
FT                   HGRGRQVEGPDLKGKRVIVVEDTSTTGGSPLKAIEALEKVGAEIAAVAVVVDRSTDARE
FT                   VIEAAGHRYLYAIGLEDLGLA"
FT   CDS_pept        560060..562135
FT                   /transl_table=11
FT                   /locus_tag="CMM_0482"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein (weak similarity to:
FT                   Q06852|SLP1_CLOTM CELL SURFACE GLYCOPROTEIN 1 PRECURSOR
FT                   (OUTER LAYER PROTEIN B)(S-LAYER PROTEIN 1))."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0482"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00506"
FT                   /db_xref="GOA:A5CN69"
FT                   /db_xref="InterPro:IPR026004"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN69"
FT                   /protein_id="CAN00506.1"
FT                   /translation="MSGAPGGGSGHGHDDDPFAVRPATDADRERPAQPLAPIGWGRPAG
FT                   REPVPAEQDDAEQDAAGSTDAGVDPAPADAPQPPDADILAGIVPLDPTEDDARVAPLDQ
FT                   VDPDQDAHDHDADLDAPAPEPGIADAPIDAGDVEFPGEPDPGYVPDPAADGTGEAMSGE
FT                   VEADPAPGDDAPAEMVLEPVDDAQDGAALPVVPADAPVVDAELVEDPAAPADPDDDDAV
FT                   QLTPLRDDMTDEDAEVVHDPADEVEPEPLGELDVDAEAAPAPLAPAAAAARAAAMAWAS
FT                   GSAPAAAPAAAAPAAPPATPADAAPIADRPDAAPEPEPEPEPAPAPEPETAVLSSPVVA
FT                   PSDAERAPDHDAEPRDEVAPTDPTPAPSSFAPPDATDADHDAEPVDAISLLFGDVAVDP
FT                   ESDRADADADDRRTAPEGADDRTRILPAAAPAAAPRPDRDAPTAAVPAASPRPDPTPRP
FT                   APVPPPYAAPPAPRAPAPRAPVLDTVRMPAPPAAAPPRGPRGPRRTGLWVGGAILLVLL
FT                   LVGLFYLGQRLGSAAAPDAAPVATATPEATPTPSPTPTDPVQGPAAAGVQAWDALLGGE
FT                   CIDPYTTPWEEEFTVVDCGSEHHAQMVARVALPQTGDTFPGEEAVRDSADELCIADTVI
FT                   DYAAARGYSDVQYQSAYPISQDEWTAGDRDAYCFVSRAGGGTFTNSIGKPQPPVVP"
FT   CDS_pept        562242..563510
FT                   /transl_table=11
FT                   /locus_tag="CMM_0483"
FT                   /product="putative MFS permease"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /note="putative efflux MFS permease (ZP_00098466.1|
FT                   COG0477: Permeases of the major facilitator superfamily
FT                   [Desulfitobacterium hafniense];; NP_486255.1|"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0483"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00507"
FT                   /db_xref="GOA:A5CN70"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN70"
FT                   /protein_id="CAN00507.1"
FT                   /translation="MTSRVRPDDRAFLLLWGAQAVSSLGASAASFALTLQVFGETGSAL
FT                   ALSALTVVSTVASIYLAPFTGWAADRLGHRRAALASNAVLALVSGGMAVVSAVGPGRLL
FT                   AVVYPLTLVSALAASTLALTLTASVRRMRREADLTRINGVTSLLQDGPTLLAPVLGAAL
FT                   SAVVAPAAVFVVDGVTSLGCVAALLVVRWDAPPDRRIANPFRGARDGIAWIIRHPGLRR
FT                   LQLGFGALNLANGIAASATTAYVLLLGAGGIGSGASLAAFSIAGSAGLLAGAAFVAARG
FT                   DRTPRLVAIAGSAVVLGLVGRVALGASALLAVWILAAVIRNVALQVQGAPLTAVWQERI
FT                   PPARQGAVLGAKRLLGQGFYPPAVLLGGALTVALHPLGQETALRVVIIAGGLGEALVGV
FT                   AMLRSRGIRALLAPAATADRTAA"
FT   CDS_pept        complement(563511..564308)
FT                   /transl_table=11
FT                   /gene="nagD"
FT                   /locus_tag="CMM_0484"
FT                   /product="putative N-acetylglucosamine-6-phosphate
FT                   deacetylase"
FT                   /function="Predicted sugar phosphatases of the HAD
FT                   superfamily"
FT                   /EC_number="3.5.1.25"
FT                   /note="putative N-acetylglucosamine-6-phosphate deacetylase
FT                   (ZP_00228023.1| COG0647: Predicted sugar phosphatases of
FT                   the HAD superfamily [Kineococcus radiotolerans SRS30216];;
FT                   NP_627072.1| putative N-acetylglucosamine-6-phosphate
FT                   deacetylase [Streptomyces coelicolor A3(2)]). pfam00702,
FT                   Hydrolase, haloacid dehalogenase-like hydrolase. This
FT                   family includes L-2-haloacid dehalogenase, epoxide
FT                   hydrolases and phosphatases."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0484"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00508"
FT                   /db_xref="GOA:A5CN71"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN71"
FT                   /protein_id="CAN00508.1"
FT                   /translation="MATRDEMDCWLTDMDGVLVHENQALPGAAALIQQWQDQGKPFLVL
FT                   TNNSIFTPRDLSARLRASGLHVPEESIWTSALATAAFLEQQMPGGSAFVIGEAGLTTAL
FT                   HEAGFIMTDTKPDFVVIGETRNYSFEAITRAIRLINGGARYIATNPDATGPSAEGVLPA
FT                   TGAVLALISKATGKEPYIVGKPNPMMFRSALNKIGAHSESTGMIGDRMDTDIIAGIEAG
FT                   LHTVLVLTGISDRAEIERYPFRPDEVLSGVTELLDPEPVESEL"
FT   CDS_pept        564438..565343
FT                   /transl_table=11
FT                   /gene="cpdA"
FT                   /locus_tag="CMM_0485"
FT                   /product="putative 3',5'-cyclic-nucleotide
FT                   phosphodiesterase"
FT                   /function="Predicted phosphohydrolases"
FT                   /EC_number="3.1.4.17"
FT                   /note="putative 3',5'-cyclic-nucleotide phosphodiesterase
FT                   (ZP_00227924.1| COG1409: Predicted phosphohydrolases
FT                   [Kineococcus radiotolerans SRS30216];; F70536
FT                   3',5'-cyclic-nucleotide phosphodiesterase (EC 3.1.4.17)
FT                   cpdA homolog -Mycobacterium tuberculosis (strain H37RV)).
FT                   pfam00149,Metallophos, Calcineurin-like phosphoesterase.
FT                   This family includes a diverse range of phosphoesterases."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0485"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00509"
FT                   /db_xref="GOA:A5CN72"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN72"
FT                   /protein_id="CAN00509.1"
FT                   /translation="MHALPPGSLRLVHLSDTHLLRDGGLHQGVVDTGAALERVLVEADR
FT                   VPEVRLLVGSGDLSEDGTAESYALLRERLVPWTSSRGAALVLTPGNHDVRSAFRLVLGD
FT                   GHGAPGTDDGRDPAAVPPVDGVTIVDGWRIATLDTSVPGKGYGALREQQLDGLRELLAT
FT                   PAEHGTVLVLHHPPVPAPTTLHESLALQGPERLAEIVRGSDVRVILSGHYHHHIVGSLA
FT                   GVPVLVAPGVANETDVAAEPGTERIVRGSGFLVVDVRPDGRVTSVVVRAHAEDDGDEVA
FT                   LLDAGLVQRIIADSGAPAAP"
FT   CDS_pept        complement(565417..565587)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0486"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein (ZP_00197844.1| hypothetical
FT                   protein Krad06004950 [Kineococcus radiotolerans SRS30216];;
FT                   ZP_00052607.1| COG3237: Uncharacterized protein conserved
FT                   in bacteria [Magnetospirillum magnetotacticum])."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0486"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00510"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN73"
FT                   /protein_id="CAN00510.1"
FT                   /translation="MGLDDKIKNAAQDIAGKAKEALGDHKGDENLKAEGQKDQAAASAK
FT                   KAGEDVKDVFK"
FT   CDS_pept        565772..566191
FT                   /transl_table=11
FT                   /locus_tag="CMM_0487"
FT                   /product="putative membrane protein"
FT                   /note="putative membrane protein (NP_954813.1| putative
FT                   membrane protein [Gordonia westfalica];; NP_628654.1|
FT                   putative membrane protein [Streptomyces coelicolor
FT                   A3(2)])."
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0487"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00511"
FT                   /db_xref="GOA:A5CN74"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN74"
FT                   /protein_id="CAN00511.1"
FT                   /translation="MIVFGLLPLLVAVCALVDVITRPDDQVKHLPKLVWILLIVFLPLI
FT                   GSIVWFCVGHDWDARREPVGPPDRSAAYERAAAAVDLRVRSTEQQLADLEEEERHYARI
FT                   ARMRQLQAEQAVQAARAAGPARAPRAIEPGSTPEP"
FT   CDS_pept        566280..568454
FT                   /transl_table=11
FT                   /gene="recQ2"
FT                   /locus_tag="CMM_0488"
FT                   /product="putative ATP-dependent DNA helicase"
FT                   /function="Superfamily II DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="putative ATP-dependent DNA helicase (NP_823626.1|
FT                   putative ATP-dependent DNA helicase [Streptomyces
FT                   avermitilis MA-4680];; ZP_00226231.1| COG0514: Superfamily
FT                   II DNA helicase [Kineococcus radiotolerans SRS30216]).
FT                   pfam00270, DEAD, DEAD/DEAH box helicase.
FT                   pfam00271,Helicase_C, Helicase conserved C-terminal
FT                   domain."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0488"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00512"
FT                   /db_xref="GOA:A5CN75"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN75"
FT                   /protein_id="CAN00512.1"
FT                   /translation="MPDTATPPSSAAPSDLRSAAREHLSRLVGVAGADFHDGQFEAIEA
FT                   LVQDRSRALVVQRTGWGKSAVYFVATLLLRQQGLGPTLLVSPLLALMRDQVAAARRAGV
FT                   RAVAMNSSNAHEWDDLLRALDADEVDLLLVSPERLNNPRFRDEQLPALRARLGLLVVDE
FT                   AHCISDWGHDFRPDYRRLRDLISSVDERVPVLATTATANSRVVADVEEQLSVGSAGAGV
FT                   VETDRVPVVTIRGPLARRSLRLGVLRLENSRDRLGWLLSHLDELPGSGIIYALTVSAAQ
FT                   DTARLLRDAGHAVKAYTGRDDPADREQAEGELQRNEVKALVATSALGMGFDKPDLGFVV
FT                   HLGAPSSPVSYYQQVGRAGRGSADADVLLLPGREDPDIWQYFATASMPDEQQAAAVIQA
FT                   LGESDRPLSVPALESRVSLSRSRLDLLLKVLDVDGAVRRDTPGWSATGVPWVYDRARYE
FT                   QVAAARVREQQAMLDYETTLGCRMEFLQRQLDDDTAAPCGRCDRCAGAWYPSSLDQQAS
FT                   ATASQALDRVGLPIEPRLRWPTGASTVGVPLSGAIAAGEQVDEGRALARLTDLGWGGRL
FT                   RTVFTAGAEDAPVDDALVAACVRVLAEWGWAERPRAVIHVPSASRPQLVGSLAQRIAEV
FT                   GRLPFLGSLDLVDPGAPGAARGNSVYRLGRVHPRFQVPAHLADDLAADPRPVLLVDDLV
FT                   DTRWTLTVAGRLLRKAGATRVLPFALAQQG"
FT   CDS_pept        complement(568474..569520)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0489"
FT                   /product="putative adenine-specific DNA-modification
FT                   methylase"
FT                   /function="Adenine specific DNA methylase Mod"
FT                   /EC_number="2.1.1.-"
FT                   /note="putative adenine-specific DNA-modification methylase
FT                   (NP_787899.1| DNA modification methyltransferase
FT                   [Tropheryma whipplei str. Twist];; NP_085633.1| DNA
FT                   methyltransferase [Mesorhizobium loti MAFF303099]).
FT                   pfam01555, N6_N4_Mtase, DNA methylase. Members of this
FT                   family are DNA methylases. The family contains both N-4
FT                   cytosine-specific DNA methylases and N-6 Adenine-specific
FT                   DNA methylases."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0489"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00513"
FT                   /db_xref="GOA:A5CN76"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN76"
FT                   /protein_id="CAN00513.1"
FT                   /translation="MPQPAWTPDGPDLVIHAENLEAVRALPDGAFQLIYLDPPFNTGRT
FT                   QERQNLTVTRTPDPAAGPDADAESVADPATALDAAAAPAPGTAAERATPVALAPASTAT
FT                   PEPVRPPGARLGFHGRSYDSVKGMLYGFDDSFADYWDFLEPRLIEAWRLLDPTGTLYLH
FT                   LDYREVHYAKVVLDALFGRRSFLNEIVWAYDYGAKSRRRWPAKHDTILVYVKDPVRYRF
FT                   DSEGVDREPYMAPGLVTPEKRERGKLPTDVWWHTIVSPTGREKTGYATQKPLGVLRRIV
FT                   QASSRPGDWVLDFFAGSGTTGAAARELGRRFVLVDENPQAVEVMRARLAGGGTVFVEPE
FT                   TEPDPVGG"
FT   CDS_pept        569873..570955
FT                   /transl_table=11
FT                   /locus_tag="CMM_0490"
FT                   /product="putative membrane protein"
FT                   /function="unknown"
FT                   /note="putative membrane protein,"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0490"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00514"
FT                   /db_xref="GOA:A5CN77"
FT                   /db_xref="InterPro:IPR025241"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN77"
FT                   /protein_id="CAN00514.1"
FT                   /translation="MGATADPVSPYGPPAVPPAAAPEPAAAPEPADEPAHPAPPQPPAG
FT                   YDAATGSAGSGSGSGIGPGFAPPGPSYAPPVGAAPPAAPAPPYVSGPPPRPRGGKGLAI
FT                   AALVVGIAGVLGAFIPFLNYVTAIPALVAVVLGIVSLARRMDGKPLALTGLILGAVGFV
FT                   LSIVLAFVYTFAFVSTVTDAVESAGTDPGFASPAPTYGSGDDDAAAQPGTSPDDPLPIG
FT                   TPVTGEGVDGPEWRVTLGTPILDATAAVLAADPTNGPPEEGMQYAVVPVTATYLGSSTG
FT                   DPLSELALGFLAPDGTQYSAADSFVQAPAPAFTDASAMLEPQGTASGNVVVEIPIDGAA
FT                   DGLWATAPGMIADAYYFRAG"
FT   CDS_pept        571114..572013
FT                   /transl_table=11
FT                   /locus_tag="CMM_0491"
FT                   /product="putative membrane protein"
FT                   /note="putative membrane protein (ZP_00060954.1|
FT                   hypothetical protein [Clostridium thermocellum ATCC
FT                   27405];; NP_821188.1| putative membrane protein
FT                   [Streptomyces avermitilis MA-4680])."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0491"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00515"
FT                   /db_xref="GOA:A5CN78"
FT                   /db_xref="InterPro:IPR029050"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN78"
FT                   /protein_id="CAN00515.1"
FT                   /translation="MTDARDPNSTPEQHSYPAPPPAPEGGYATPYAPAAPAGPSRGKGL
FT                   AIASLIVAIVAFLGAFVPFLNYVVFIPAIVAIVLAIVALARHKAGKPLALGGLIVGVLA
FT                   LVLSIILAVVYTLGFAAAVSESLPRSEGGSGSSAAPLEETEEEAGPAVGTRENPAPIGT
FT                   VVTGLSGGSPQWEVTLGAPVLDANAAVTSENMFNDPAPAGTQYAMVPVTVKYVGAESAS
FT                   PMFEIGVEYVSAAGTTHTTSDSFAVAPEPQFDSINELFPGASGTGNVVIAIPSADAAAG
FT                   TWAVRPGILADPYYFAAQ"
FT   CDS_pept        572091..573335
FT                   /transl_table=11
FT                   /locus_tag="CMM_0492"
FT                   /product="conserved hypothetical protein"
FT                   /function="Kynureninase"
FT                   /note="conserved hypothetical protein (ZP_00227183.1|
FT                   COG3844: Kynureninase [Kineococcus radiotolerans
FT                   SRS30216];; ZP_00049417.2| COG3844: Kynureninase
FT                   [Magnetospirillum magnetotacticum]). pfam00266,Aminotran_5,
FT                   Aminotransferase class-V."
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0492"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00516"
FT                   /db_xref="GOA:A5CN79"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010111"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN79"
FT                   /protein_id="CAN00516.1"
FT                   /translation="MTPDARGTDAPSRPLPSAAELDARDPLARFRDLFVQSDDVVAYLD
FT                   GNSLGRPTLASVDRVADFVRDGWGGRLIRGWDEDWLAMPTRIGDDLGRVTYGAAPGQTF
FT                   VGDSTTVILYKLVRAAVRARPGRDELVIDTDNFPTDRFVLEGVAEECGMTIRWIDVAPD
FT                   AGVTPELVADAVGERTALVVLSQVAYRSGFLADVPAITRLVHDAGALVLWDTCHSVGVI
FT                   PTELDAWGVDLAVGCSYKYLDGGPGAPAHGYVRSDLQAELRQPIQGWMGAQDVFAMGPE
FT                   YVPADGIRRFLSGTPPIVGMLAMQDMLALIEEAGMPAIRAKSLALTGFALDLVDRDLVP
FT                   LGARVASPREEDRRGSHVSVDHPRFRDIVGALWAEGVIPDFRAPSGLRLGLSPLTTSFR
FT                   EVEVGVEAIRRHLAG"
FT   CDS_pept        complement(573369..574463)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0493"
FT                   /product="putative oxidoreductase"
FT                   /function="Predicted dehydrogenases and related proteins"
FT                   /note="putative NAD(P)H-dependant dehydrogenase
FT                   (ZP_00226640.1| COG0673: Predicted dehydrogenases and
FT                   related proteins [Kineococcus radiotolerans SRS30216];;
FT                   NP_384229.1| PUTATIVE OXIDOREDUCTASE PROTEIN [Sinorhizobium
FT                   meliloti 1021]). pfam01408, GFO_IDH_MocA,Oxidoreductase
FT                   family, NAD-binding Rossmann fold. This family of enzymes
FT                   utilise NADP or NAD."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0493"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00517"
FT                   /db_xref="GOA:A5CN80"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN80"
FT                   /protein_id="CAN00517.1"
FT                   /translation="MPHPAPTAPQIRFGIVGSGWRSAFFLRIARALPERFAVTGLVTRS
FT                   AETGRALEKEWGIRTFRTAAELLAAEAPSFAVVSVPRTAAPDVIADLVDRGVAVLTETP
FT                   PGATVADLERLDALVRQGARIEVAEQYPLSPLLAAQLAIAAGGRLGRISQATVAQCHDY
FT                   HGVRVMRRALGIGFEDATITAARFSSPIVAGPDRDGDPVREEIVTAEQTTARFDFGDRL
FT                   GVYDFSDRQYFSWIRRNRLLVRGERGEIVDEHVSWLLDATTPTWADITRVETGQGGNLE
FT                   GHHLRGLLLGSEWIHENPFAPGRLADDEIAIAQCLVEMHAHAAGGPSTNPLAEASQDHH
FT                   LALLMHEAAATGKPVRSTRRAWAD"
FT   CDS_pept        574662..576896
FT                   /transl_table=11
FT                   /locus_tag="CMM_0494"
FT                   /product="putative sucrose synthase (Sucrose-UDP
FT                   glucosyltransferase)"
FT                   /function="Predicted glycosyltransferases"
FT                   /note="putative sucrose synthase (Sucrose-UDP
FT                   glucosyltransferase)(NP_681372.1| sucrose phosphate
FT                   synthase [Thermosynechococcus elongatus BP-1];;
FT                   NP_926553.1| sucrose phosphate synthase [Gloeobacter
FT                   violaceus PCC 7421];; P31922|SUS1_HORVU Sucrose synthase 1
FT                   (Sucrose-UDP glucosyltransferase 1)). SUCROSE-CLEAVING
FT                   ENZYME THAT PROVIDES UDP-GLUCOSE AND FRUCTOSE FOR VARIOUS
FT                   METABOLIC PATHWAYS. pfam00534, Glycos_transf_1, Glycosyl
FT                   transferases group 1. Members of this family transfer
FT                   activated sugars to a variety of substrates, including
FT                   glycogen, Fructose-6-phosphate and lipopolysaccharides.
FT                   Members of this family transfer UDP, ADP, GDP or CMP linked
FT                   sugars."
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0494"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00518"
FT                   /db_xref="GOA:A5CN81"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN81"
FT                   /protein_id="CAN00518.1"
FT                   /translation="MGIQTSLDQVAEAARILDVMQEADELTVAASRDGGGRAVRLLARA
FT                   AADPADQLTAVAAIHALAQVFDEAADHALVALLDHDTRWIREHAAWAFGTRLPRFDAVS
FT                   GLVAMVVEGGFPGMLAQRTLQQWAGSTPDHVALALENALLGVQGDGPRSRLVETVGLVP
FT                   GRIPERVLLRIAPAAAEGPLTRSAAVAALGDRPAGEAIAALVADIARGDDEVAAVARLA
FT                   VLDIARQHGDHPAPPERPGLTVVQLFLHADIDAGLTHVGAGDNGGIATLLVRLGDALVD
FT                   PAGTVGHAPAARDVATTTVPDRPVDRVITLSRGTPDQALASLARVTAGDDGHVFAHIPM
FT                   LGGPRSLPEAWPHRVEAERGIRRVLRAAGRVDAVHLRMADVGTLAASTVARELGIPVVV
FT                   TVAPDPHGVVDALDRSGALTRDRFGGVDEREHYWFRVRLVQRLAADAAHTVLFPRPELK
FT                   RDMRRLVGIDVDAHPERHSVVAEGIDVAAIERSRDDAMLGADADGAPARAFVELDDLLR
FT                   GLPEERRGLPLVISVGRIARVKGMAQLAHVWAADPALRSRANLLIVGGDLDAPTPEERE
FT                   QLARILDAVPDADGPADAARHGLLLAGHRGNDTVTRWLAAVRYGRPGLTAPGGAYACAS
FT                   IKEEFGVALLEAMSMGLPVVAPASGGPATYVEDGVTGLLVDTTDPGDLATGIARALDIA
FT                   AGPDADAAADRARDMVARTFTIQAMAGTLSRVYRDVAAADDRTLWELSAS"
FT   CDS_pept        576893..578218
FT                   /transl_table=11
FT                   /locus_tag="CMM_0495"
FT                   /product="putative glycosyltransferase"
FT                   /function="Glycosyl transferases related to
FT                   UDP-glucuronosyltransferase"
FT                   /note="putative glucoronosyltransferase (ZP_00240271.1|
FT                   macrolide glycosyltransferase [Bacillus cereus G9241];;
FT                   AAM70336.1| CalG1 [Micromonospora echinospora]). InterPro:
FT                   UDP-glucoronosyl and UDP-glucosyl transferase.
FT                   pfam00201,UDPGT, UDP-glucoronosyl and UDP-glucosyl
FT                   transferase."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0495"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00519"
FT                   /db_xref="GOA:A5CN82"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="InterPro:IPR006326"
FT                   /db_xref="InterPro:IPR035595"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN82"
FT                   /protein_id="CAN00519.1"
FT                   /translation="MTLLVISPDYASHLFPLITLASAWQQAGERVVVATGSATAGIVEA
FT                   SGFERVDLRLGRGSNPGTIKAEDQPTGEDDALRGFFAATRRGMVETLRFQAEARSDDLL
FT                   WEPVETARAVQRILDEVRPDQVIVDHLAFSARLALLASGTRHADVVLGHPSALPVGDEV
FT                   YGFPPAWPAAFEPEEEDLDELRALCERVRDRFTAQWNDALAILAPSMRPSRDAFAEAGD
FT                   VLLLNYPEELHDPDRSELLPPHAFIGSAVRREAPEAEVRDWIDAGGDPIVYVSLGSFLS
FT                   VRGDVLARIAAALRDLDVRVALATGSTDRAELGDIPSDWLVRPFLPQVTLLAHADLAVT
FT                   HGGNNSVTEAATAGVPMLVLPLSTDQFAGAAALEDAGLGIALAPNVATVTELRQAAKLL
FT                   LNPSGAQRAGLDAIAASLTRSPGPQRAYQALAGGIRPEQAAR"
FT   CDS_pept        578576..580291
FT                   /transl_table=11
FT                   /locus_tag="CMM_0496"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /note="conserved hypothetical protein (CAB03747.1|
FT                   CONSERVED HYPOTHETICAL PROTEIN [Mycobacterium tuberculosis
FT                   H37Rv];; NP_925015.1| hypothetical protein gll2069
FT                   [Gloeobacter violaceus PCC 7421]). pfam04169, DUF404,Domain
FT                   of unknown function (DUF404). pfam04174, DUF407,Domain of
FT                   unknown function (DUF407)."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0496"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00520"
FT                   /db_xref="InterPro:IPR016450"
FT                   /db_xref="InterPro:IPR025841"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN83"
FT                   /protein_id="CAN00520.1"
FT                   /translation="MGDLFEGYGTLAAARRASGGAMPFDEMFRDPPVAGEPAVARAAYR
FT                   EIHAALSRMTKEELKDRTDALATSYLAQGVTFDFAGEERPFPLDAVPRVIEQAEWSRLE
FT                   KGVAQRVRALEAFLADVYGPQRAIRDGVIPARLISSSSHFHRQAAGIDPANGVRIQVSG
FT                   IDLVRDEAGEMRVLEDNVRVPSGVSYVISNRRVMAQTLPELFVSMRVRPVGDYPNKLLQ
FT                   ALRASAPDGVEDPNVVVLTPGVYNSAYFEHTLLARLMGVELVEGRDLFCSGGRVWMRTT
FT                   GGPMRVDVIYRRVDDEFLDPLQFRADSMLGSPGLMLAARLGNVTIANAVGNGVADDKLV
FT                   YTYLPDLIRYYLAEDAIIPNVDTWRLEEPDSLEEVLDRLPELVVKPVDGSGGKGLVVGP
FT                   AASAGELAELRARLLKDPRGWIAQPVVQLSTIPTLVEDGMRPRHADLRPFAVNDGRDIW
FT                   VLPGGLTRVALPEGQLVVNSSQGGGSKDTWVVGDSGFPAATRERSVQTLVADQAAVTTS
FT                   IPIIQNGEKAPDQSPHDRPRNRDQHEQQQQAASPAADADARTADARTATAEGDR"
FT   CDS_pept        580291..581226
FT                   /transl_table=11
FT                   /locus_tag="CMM_0497"
FT                   /product="conserved hypothetical protein"
FT                   /note="conserved hypothetical protein (NP_961156.1|
FT                   hypothetical protein MAP2222c [Mycobacterium avium subsp.
FT                   paratuberculosis str. k10];; ZP_00164167.1| COG2307:
FT                   Uncharacterized protein conserved in bacteria
FT                   [Synechococcus elongatus PCC 7942]). pfam04168,
FT                   DUF403,Bacterial domain of unknown function (DUF403)."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0497"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00521"
FT                   /db_xref="InterPro:IPR007296"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN84"
FT                   /protein_id="CAN00521.1"
FT                   /translation="MPMLSRIAESLFWIGRYIERSDGTARILDVHLQLLLEDPWIDEDT
FT                   ACRSLLSVMGSDVPSEDVLGRDDVLALLAVDRTQPASIAYSLGAARENARRAREIVSSE
FT                   LWECLNTTRARMPRKIANDRVHEFFGWVRERSALAVGLVESGTSRDEAWQFFTLGRSIE
FT                   RADMTARLLATRALTEASGPSWTTILRSCGAYEAYLRTYRGVPSARNAAEFLLLDRLFP
FT                   RSITHSIRRAEQCLHDIEPRTDRLGVSDQAQRLLGQIRSELEYRPIQEILDDLPRFMDA
FT                   VQEATSATSEAVRQRYFPTNAAPSWVGENS"
FT   CDS_pept        581223..582068
FT                   /transl_table=11
FT                   /locus_tag="CMM_0498"
FT                   /product="conserved hypothetical protein"
FT                   /function="Transglutaminase-like enzymes putative cysteine
FT                   proteases"
FT                   /note="conserved hypothetical protein (NP_961155.1|
FT                   hypothetical protein MAP2221c [Mycobacterium avium subsp.
FT                   paratuberculosis str. k10];; ZP_00213669.1| COG1305:
FT                   Transglutaminase-like enzymes, putative cysteine proteases
FT                   [Burkholderia cepacia R18194]). , pfam01841,Transglut_core,
FT                   Transglutaminase-like superfamily. This family includes
FT                   animal transglutaminases and other bacterial proteins of
FT                   unknown function."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0498"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00522"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR013589"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN85"
FT                   /protein_id="CAN00522.1"
FT                   /translation="MNRLRITHRTGFHYEGEVTASYNEARMLPVSSENQFVLYSNLDIQ
FT                   PKPGHHTYVDYFGTRVSSFEILSPHRSLELTATSLVEVRPRTHEPHQLGWDDLAVDVER
FT                   ATEHVEQVAQTVRTEPHEEVRALAEEITGGAGTPCEAAAEIARAIGERVEYMAGVTSVQ
FT                   STAREAWEQGRGVCQDITHIVIGALRHVGIPARYVSGYLHPKPNAAVGETVTGESHAWV
FT                   EWFCGEWRGWDPTNLIDIGDRHVLVGRGRDYRDVAPLRGIYAGPFRSKLFVRVEITRES
FT                   "
FT   CDS_pept        582124..583041
FT                   /transl_table=11
FT                   /locus_tag="CMM_0499"
FT                   /product="putative lysophospholipase"
FT                   /function="Lysophospholipase"
FT                   /note="putative lysophospholipase (NP_622099.1|
FT                   Lysophospholipase [Thermoanaerobacter tengcongensis];;
FT                   NP_972747.1| hydrolase, alpha/beta fold family [Treponema
FT                   denticola ATCC 35405]). InterPro:
FT                   Esterase/lipase/thioesterase family active site
FT                   pfam00561,Abhydrolase_1, alpha/beta hydrolase fold. This
FT                   catalytic domain is found in a very wide range of enzymes."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0499"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00523"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN86"
FT                   /protein_id="CAN00523.1"
FT                   /translation="MPDDERSTGGADHRTIVDAEGVTLHYYVWEAERPRAVVHIAHGVG
FT                   EHALRYIRLARELNAAGFTVAADDHRGHGATGLGHLGIGVLGPRRHLAALDGIQLVSEQ
FT                   LRREHPDLPLVLLGHSWGALLAQRIVARAAHLYAGLVLSGASLAMPGVINTGDLNKRWR
FT                   HPAASGFEWLSRDPEAQRAFGADDRNFDVNALKPYRMRDSVQIMGRPPKRLATDLPVLI
FT                   QGGEEDSLGGRRGMQLLARDYSRRSRLSDVLLIVYPGARHEIYNETNRDEVVADLRSWL
FT                   ESRVVPAAPAAPAAPATPGDGGPA"
FT   CDS_pept        583038..583532
FT                   /transl_table=11
FT                   /locus_tag="CMM_0500"
FT                   /product="putative acetyltransferase"
FT                   /function="Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /note="putative acetyltransferase (ZP_00109910.1| COG0454:
FT                   Histone acetyltransferase HPA2 and related
FT                   acetyltransferases [Nostoc punctiforme];; NP_939442.1|
FT                   Putative acetyltransferase [Corynebacterium diphtheriae])."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0500"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00524"
FT                   /db_xref="GOA:A5CN87"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN87"
FT                   /protein_id="CAN00524.1"
FT                   /translation="MTAADATLRPARADDLPFLEDMLLASMDWRDDGSMTRERMLATPE
FT                   LAHYVSGWPRAGDVGVVAEVAGDPAGAAWARLYSDDDRGYGFVAPDIPELGMALVPSAR
FT                   GRGLGRALLVALVAAVRASGAPAVSLSVEDGNDRARALYDSLGFVAVGREGGSDVLLLR
FT                   W"
FT   CDS_pept        complement(583604..586429)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0501"
FT                   /product="conserved hypothetical protein"
FT                   /note="conserved hypothetical protein, putative cell
FT                   wall/surface protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0501"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00525"
FT                   /db_xref="GOA:A5CN88"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN88"
FT                   /protein_id="CAN00525.1"
FT                   /translation="MSRAMRGSTSRASLGLVGATGAVALAALLALGGLAPLAAHAADVV
FT                   LARASGVEIIDIDGDTLTAPTPLAEWSAGAAVTRTAASTGDVLKLNTTRTTGLSSTAGP
FT                   TGASSAIATGELTLRDRPAIVFSGLAVSCTPGGTPAVHVDRLTVGGVDVTADANATPGW
FT                   SRDLPESVYGATRVIVGSTATGDDGSATTVGIDVEAEAGASEIWRVRAGSVTCAAAAAV
FT                   PVPTPSASPTPAPTPVPDPDPTPAPGPTPAPDPSPAPAPGRVATGVTVTAPDGTRVIDG
FT                   QPRVDGLDRSATADSLTASDGSPEHAASVHVETGADGTTTVGVGSFEQLPGSPADPLAE
FT                   YRWTAFRVYGLTATIMPSGAVSTEFADPGSAVFVDGRWIDTTTDLYTGVDEQGAPRVTV
FT                   AFGERETAADGTVTVTAVHYRDLTGAHPDVRLGTVVVPPAAGQVVGAYGVGVTAADGTV
FT                   LVAPQPAATVAAPHASTDAVTGTGTDPDTASTVAVDLGTGDAAGTATVDVGGFRQVPDA
FT                   STDPLADYRWPALRVNGLHAAVSAADAMTVSFADAGNAVFVDGVWIDTTTDLYTGVDEQ
FT                   GTPRVEVRFGERTVAADGTVTLTALHYRDLTGRHPEVRLGVVTVAAGSGTTPAPDPSPT
FT                   PVVIVPDTAPTGWSAYGIRATGPSAVTATPVARPDATATGLAPDALAASDADAPSAGDT
FT                   AADTAGDGAAGQIRASGIRLSSTRGSGSASLDDVDLYPGSRMAVRIRGLRVAVEEGTAR
FT                   VSSDGGLIAGQALAAGDIAPGTRFALPDGGSVLLAEDVTASAARTVTGLHLVDASGLAA
FT                   DVAAGVVTTAAVAVDPSGGSASGAGTGTGTGATGTAAGTPAGGTPAGGTSAGGASVAGT
FT                   GALAPGALSADGSSPAGTSGANARGSLPRTGSSPASALALAALLLVVGSAAALEARRRR
FT                   RAHQGRRPARA"
FT   CDS_pept        complement(586426..588303)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0502"
FT                   /product="putative serine protease, family S53"
FT                   /function="Predicted protease"
FT                   /note="putative serine protease, family S53 (NP_827126.1|
FT                   hypothetical protein [Streptomyces avermitilis MA-4680]).
FT                   pfam00082, Peptidase_S8, Subtilase family. Subtilases are a
FT                   family of serine proteases. They appear to have
FT                   independently and convergently evolved an Asp/Ser/His
FT                   catalytic triad, like that found in the trypsin serine
FT                   proteases (see pfam00089)."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0502"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00526"
FT                   /db_xref="GOA:A5CN89"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015366"
FT                   /db_xref="InterPro:IPR030400"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN89"
FT                   /protein_id="CAN00526.1"
FT                   /translation="MAVAALVASALAGTGSASASADGDPSAARAAAGLRAIAGSAPSWP
FT                   AGTSAVRVGDAPADATVALTVLLDPARPDAAPAVAAWLRDRGLDVGDARDEVSALPVSG
FT                   TLALASRAFDTGFARFRVAGREVVAPERTLAVPATLDAVRGVAGTVQGDVLMPSDAESD
FT                   TAHAGDAQAADDAQSPDAADPVPAPIPGQATGGSPASSADDGTCAAWWGQRLTDAWPAS
FT                   VDVAHRSNSLCGYGPAQLRRVDDVPAEDRGSGATIAIVAAYDDPDTQADTDTYSLAVGE
FT                   PAFTAGQYRDHPSASPRTGICGGPTAWTDEQHLDVQAVHAMAPDATVSYWGADDCTSTS
FT                   LYTRILDAAEDGPDVISLSFGAMEGLDTADDRELLNRVLVEAASRDVSVFASTGNDGDY
FT                   SGVGDHGGNATVASPASSPYVTAVGATSTGLAEDGSIAVEAGWETQTRFARNGALIPPG
FT                   FAFGAGGGHSAEYARPTWQADRLAVAGTGRLLPDVASLGDPDTGFITYGPHKGRTEYAA
FT                   HGGTSLATPMVASMVAISKAVTGRRFGLASPALYALMGTGALRDVQPASAATWSPKGPS
FT                   AGALWPETLFMWDTGRQGLRSAPGWDDVTGAGVPAGRAFIEGLGAEAGR"
FT   CDS_pept        588673..589404
FT                   /transl_table=11
FT                   /locus_tag="CMM_0503"
FT                   /product="transcriptional regulator, TetR family"
FT                   /function="Transcriptional regulator"
FT                   /note="putative transcriptional regulator, TetR family
FT                   (NP_630409.1| transcriptional regulator [Streptomyces
FT                   coelicolor A3(2)];; NP_639852.1| putative lactone-dependent
FT                   transcriptional regulator (TetR-family), MmfR [Streptomyces
FT                   coelicolor A3(2)]). InterPro: Bacterial regulatory proteins
FT                   TetR family pfam00440, TetR_N,Bacterial regulatory
FT                   proteins, tetR family."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0503"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00527"
FT                   /db_xref="GOA:A5CN90"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN90"
FT                   /protein_id="CAN00527.1"
FT                   /translation="MNQRQAAVSRARREIMEAAGAQFAAHGYEGTSFSRVAEAMGKPKS
FT                   AIGYHLFASKESLAGAVVEDQEDRWLRIEAALDRPGALHELIVFLLTGASTVEVCPVAA
FT                   GAIRLLQDMPRLGLAVERRFDVWRFTREHLEAELAVRDIRAGDLDAVVDVLLSATFGVL
FT                   SYRSPRLAEHDSAERLRSLWIPLLVGLGIDDADAVVRAARPLDLELVEVGRPDASEAHT
FT                   GSARGAKAAAAAGEDEDRARA"
FT   CDS_pept        complement(589476..591650)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0504"
FT                   /product="putative phospholipase C"
FT                   /function="Phospholipase C"
FT                   /EC_number="3.1.4.3"
FT                   /note="putative non-hemolytic phospholipase C (NP_900579.1|
FT                   non-hemolytic phospholipase C precursor [Chromobacterium
FT                   violaceum ATCC 12472];; A36143 phospholipase C (EC
FT                   3.1.4.3), nonhemolytic - Pseudomonas aeruginosa).
FT                   pfam04185, Phosphoesterase, Phosphoesterase family. This
FT                   family includes both bacterial phospholipase C enzymes
FT                   EC:3.1.4.3, but also eukaryotic acid phosphatases
FT                   EC:3.1.3.2. pfam05506, DUF756, Domain of unknown function
FT                   (DUF756). This domain is found, normally as a tandem
FT                   repeat, at the C-terminus of bacterial phospholipase C
FT                   proteins."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0504"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00528"
FT                   /db_xref="GOA:A5CN91"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="InterPro:IPR008475"
FT                   /db_xref="InterPro:IPR017767"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN91"
FT                   /protein_id="CAN00528.1"
FT                   /translation="MSTSKPEEHAPDVDLAAGVDAAPPLDPSRPYRTGIRPGVSRRTVL
FT                   LGGAAAIMAGVAAGSAAGAPGAATAATAAARRNLTRSIKDVEHVVILMQENRSFDHYFG
FT                   TLPGVRGFGDKQAVEYPGGGTVFAQPDASRTDGGHMLPFPLDSSRFNAQGAGGLDHSWK
FT                   GGHQAWNKGAWDNWVVAKSEQTMGYFTKDDLPFHHALASAFTIADHYHCSLIGPTTPNR
FT                   LFQWTGTIDPRGKAGGPAIDNPDDYAPVFGWTTYPERLRQAGTTWKTYANDEVGDEGTH
FT                   PYVGDYGDNPLWLFHQYHEALASKDPATRQLALDGGLHDGWKPDSGKGLDVTHLLEEFG
FT                   RDAAAGTLPAVSYVVAPYGWSEHPKASPDYGAHYTNAVIQALMSNPDTWARTVLLINYD
FT                   ENDGYFDHQLPPLAEPGTPDEYVDGLPVGYGTRVPLTVVSPWSRGGWVDSQVFDHTSVI
FT                   RFLETWTGVHEPNISAWRRAISGDLTSCFDFAHPDFSVPSADEVLPMSATQALVAAADA
FT                   DMAKPPVQEPAVGAQRMPEQEAGSMRHRPLPYRQDADVAVDRASGRVTLTMRNQGKQGV
FT                   SHQVFPNIALPFASTPFTVAPRGKAAYTWDSSAHAGAYDFSLYGPDRFLRRFAGTVVAA
FT                   GTADVPVPRVSAETIPGGKPVLRLTLANDGTPSVHYTLTANDFITRERHETVKPGRSTT
FT                   VNWPVDEWGYYDVVVTDGAGFRYRYAGRVE"
FT   CDS_pept        complement(591934..592566)
FT                   /transl_table=11
FT                   /gene="alkB"
FT                   /locus_tag="CMM_0505"
FT                   /product="DNA repair system specific for alkylated DNA"
FT                   /function="Alkylated DNA repair protein"
FT                   /note="putative alkylated DNA repair protein (NP_822306.1|
FT                   putative alkylated DNA repair protein [Streptomyces
FT                   avermitilis MA-4680];; NP_215515.1| Alkylated DNA repair
FT                   protein [Mycobacterium tuberculosis H37Rv]). alkb:
FT                   alkylated DNA repair protein AlkB"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0505"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00529"
FT                   /db_xref="GOA:A5CN92"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR032854"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN92"
FT                   /protein_id="CAN00529.1"
FT                   /translation="MSIAFQASLFDDLQADPGLGALGAEVERLDLGQGAWLDIRPGWVS
FT                   DSDALFERLVEDVEWTADTRLMHGRTVEVPRLLSWFGPRAPLPAPVLVEARDALNEHYG
FT                   RPPGQVLETAGLCFYRTGDDSVAWHGDRVGRAIDRDTMVAIVSVGAARTLSLRPKGGGE
FT                   VRRFPLGHGDLVVMGGSAQRTHEHAILKTQKAVGPRISIQFRPVWPA"
FT   CDS_pept        complement(592631..593311)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0506"
FT                   /product="putative membrane protein"
FT                   /note="conserved membrane protein (NP_832507.1| Integral
FT                   membrane protein [Bacillus cereus ATCC 14579];;
FT                   ZP_00212776.1| hypothetical protein Bcepa02005818
FT                   [Burkholderia cepacia R18194])."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0506"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00530"
FT                   /db_xref="GOA:A5CN93"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN93"
FT                   /protein_id="CAN00530.1"
FT                   /translation="MRIIWAAIRLLTALTVLVAVASQYVVSSSYWRSIGVEGIWGKTVD
FT                   FLMYFTIESNLLAAAVMAVGAVRLLRRAPAPGRGWTTLRLAATTYMVTTGIVYNLLLRG
FT                   LPTIPGGDLPWSNEVLHVAVPLLVLLDWLFAPDRRALDYGAVGRVVVFPLAWVAITLAR
FT                   GPFTGNEVTGAATYYPYPFLDPATGGGGYGTVAVWVLVIAALICGLTLLLTWAGRRASR
FT                   APAA"
FT   CDS_pept        593390..594439
FT                   /transl_table=11
FT                   /gene="lplA"
FT                   /locus_tag="CMM_0507"
FT                   /product="putative lipoate-protein ligase A"
FT                   /function="Lipoate-protein ligase A"
FT                   /EC_number="6.-.-.-"
FT                   /note="putative lipoate-protein ligase A (ZP_00227712.1|
FT                   COG0095: Lipoate-protein ligase A [Kineococcus
FT                   radiotolerans SRS30216];; T46683 probable lipoate protein
FT                   ligase snoP [imported] - Streptomyces nogalater). CREATES
FT                   AN AMIDE LINKAGE THAT JOINS THE FREE CARBOXYL GROUP OF
FT                   LIPOIC ACID TO THE EPSILON-AMINO GROUP OF A SPECIFIC LYSINE
FT                   RESIDUE IN LIPOATE-DEPENDENT ENZYMES. THE ENZYME CATALYZES
FT                   BOTH THE ATP-DEPENDENT ACTIVATION OF LIPOATE TO LIPOYL-AMP
FT                   AND THE TRANSFER OF THE ACTIVATED LIPOYL ON THE APOPROTEINS
FT                   (BY SIMILARITY). InterPro: Biotin/lipoate A/B protein
FT                   ligase family lipoyltrans: lipoyltransferase and lipoate
FT                   protein ligase pfam03099, BPL_LipA_LipB,Biotin/lipoate A/B
FT                   protein ligase family. This family includes biotin protein
FT                   ligase, lipoate-protein ligase A and B. Biotin is
FT                   covalently attached at the active site of certain enzymes
FT                   that transfer carbon dioxide from bicarbonate to organic
FT                   acids to form cellular metabolites."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0507"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00531"
FT                   /db_xref="GOA:A5CN94"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN94"
FT                   /protein_id="CAN00531.1"
FT                   /translation="MHGEYKVPGGKLVVVDLDVTDGRISGFRLAGDFFLEPDDALEAID
FT                   GAVNGLPEDSDANAIAAAIRRALPPQAVLLGFSPEAVAVAIRRSLARATNWGDYEWEVI
FT                   HDRAYRPVEQMALDQVLAEEVGAGRRNPTLRIWEWEQPAVVIGSFQSLRNEVDAEQAAA
FT                   HGFDVVRRVSGGGAMYMEAGAVITYSIYAPVDLVQGMTFADSYAYLDEWVITALRSLGI
FT                   DASYQPLNDITSPTGKIGGAAQKRLGAGAVLHHVTMSYDMDGEKMVQVLRIGREKISDK
FT                   GITSAAKRVDPLRSQTGMSRADIIDRMKDTFTGLYGGKPGRVTPEEWAKTRQLVEEKFS
FT                   TPEWLTRVP"
FT   CDS_pept        complement(594698..594982)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0508"
FT                   /product="putative acetyltransferase"
FT                   /function="Predicted acetyltransferase"
FT                   /note="putative acetyltransferase (NP_631766.1| conserved
FT                   hypothetical protein [Streptomyces coelicolor A3(2)];;
FT                   ZP_00225610.1| COG2388: Predicted acetyltransferase
FT                   [Kineococcus radiotolerans SRS30216])."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0508"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00532"
FT                   /db_xref="GOA:A5CN95"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR031165"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN95"
FT                   /protein_id="CAN00532.1"
FT                   /translation="MSVDVTHDPDGSRYTLWLDGERAGFADYLIQGDRIVFTHTEVDPA
FT                   KRRGGLGGELVRAALDDVRGGSRTVVAACPFVAEWIDEHPDYRELLERG"
FT   CDS_pept        complement(595050..595268)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0509"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00533"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN96"
FT                   /protein_id="CAN00533.1"
FT                   /translation="MDIPASAWPILVAFAGSAATADFCRVPEVGWLLCAIGGAVTAAVV
FT                   EWVKHHPPCPNDGTFRFYTGDRESYCH"
FT   CDS_pept        complement(595269..595616)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0510"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00534"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN97"
FT                   /protein_id="CAN00534.1"
FT                   /translation="MPRFIAAASPRRTDERPRRSARRQLAVLAIAITAALTTVIGHSIP
FT                   AEAAEHPVSAATAVHAGAASAAAPTSAVTAPASAAGGTSTAYTPSGAEAADPHQIGASA
FT                   RSFGWNWHGGF"
FT   CDS_pept        595865..596761
FT                   /transl_table=11
FT                   /locus_tag="CMM_0511"
FT                   /product="conserved hypothetical protein"
FT                   /note="conserved hypothetical protein (N-terminal:
FT                   AAD27613.1| 57 kilodalton cell surface protein precursor
FT                   Msa2 [Renibacterium salmoninarum];; NP_821231.1|
FT                   hypothetical protein SAV57 [Streptomyces avermitilis
FT                   MA-4680]). C-terminal half: NP_241888.1| BH1022~unknown
FT                   conserved protein in bacilli [Bacillus halodurans C-125];;
FT                   NP_828397.1| hypothetical protein SAV7221 [Streptomyces
FT                   avermitilis MA-4680])., pfam01833, TIG, IPT/TIG domain."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0511"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00535"
FT                   /db_xref="InterPro:IPR002909"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR024301"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN98"
FT                   /protein_id="CAN00535.1"
FT                   /translation="MTADIRRRNILAAALAVPVTAVLAACTRQEPAPRATLGAGADGQP
FT                   AASGSSPAVTSVEPATLSVSGGQTVTLTGAGLSGATAVMFAGTAGTDLQVAGDGSVTVV
FT                   APRSTDYEDRSADIQVMAGDAALTTATAAYAAQTPVDKQLQYALAHWDAYNLEEYGNFN
FT                   PSGGDCVNFVSQSLIQRGWQMTNEWHNRGGGSDWTYAWIHVPTFDKWLAANASTLGVKR
FT                   LELADRDQLKVGDIVIFDWNRNSSPDHTQIVSAIEPKDGGNVVKMVGHNLDNDYRDLDA
FT                   TITTEHPGAEVHFWSVA"
FT   CDS_pept        complement(596758..597207)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0512"
FT                   /product="putative membrane protein"
FT                   /note="putative membrane protein (weak similarities to:
FT                   NP_656679.1| hypothetical protein predicted by GeneMark
FT                   [Bacillus anthracis A2012])."
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0512"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00536"
FT                   /db_xref="GOA:A5CN99"
FT                   /db_xref="InterPro:IPR021257"
FT                   /db_xref="UniProtKB/TrEMBL:A5CN99"
FT                   /protein_id="CAN00536.1"
FT                   /translation="MHPADGPRDAAPVVDRDVRLPDGHARRRIVSLGALLAVVVAGMVV
FT                   THSDGRGLWPDVFYAAAIHLALIAVMPRVDPVVHGAAVLVWCTGIELLQITGWPALWAL
FT                   HVPLCRLLIGTGFDPVDLAAYAAGVLLVLLVDRLLRAGRGIGDAG"
FT   CDS_pept        complement(597320..598960)
FT                   /transl_table=11
FT                   /gene="pgmA"
FT                   /locus_tag="CMM_0513"
FT                   /function="Phosphoglucomutase"
FT                   /EC_number="5.4.2.2"
FT                   /note="phosphoglucomutase (ZP_00227289.1| COG0033:
FT                   Phosphoglucomutase [Kineococcus radiotolerans SRS30216];;
FT                   NP_821978.1| putative phosphoglucomutase [Streptomyces
FT                   avermitilis MA-4680]). THIS ENZYME PARTICIPATES IN BOTH THE
FT                   BREAKDOWN AND SYNTHESIS OF GLUCOSE. InterPro:
FT                   Phosphoglucomutase and phosphomannomutase family.
FT                   pfam02878, PGM_PMM_I,Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain I. pfam02879,
FT                   PGM_PMM_II,Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain II. pfam02880,
FT                   PGM_PMM_III,Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain III."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0513"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00537"
FT                   /db_xref="GOA:A5CNA0"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR005852"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A5CNA0"
FT                   /protein_id="CAN00537.1"
FT                   /translation="MHDRAGTAALPSDLIDIDELIRAYHDLHPDVEDPEQKVAFGTSGH
FT                   RGSSLKAAFNEDHILAITQAIVEHRAEQGITGPLFIGRDTHGLSKPAEDTALEVLVANG
FT                   VRVLADSRDSWCPTPALSHAILRWNRDDAHGDDDVADGIVVTPSHNPPADGGFKYNPPH
FT                   GGPADSDATGWIAARANAIIAGGLADVKRVPLEEARRRVEGYDFLGHYVDDLGSIIDME
FT                   AIRKAGVRIGADPLGGASVEYWAAIGERHGLDLEVVNPEVDPAWSFMTLDWDGKIRMDP
FT                   SSSSAMASVLARKDDFDILTGNDADADRHGIVTPDAGLMNPNHYLAVAIDYLYAHRPEW
FT                   RADAAIGKTLVSSSVIDRVAESLGRRLWEVPVGFKWFVPGLIDGSVGFGGEESAGASFL
FT                   RMDGTVWTTDKDGILLALLASEILAVTGKTPSVLYRELTERFGDPVYERVDAAATKAQK
FT                   ATLGKLDGDAIAATEVAGDPITAKLSTAPGNGAAVGGVKVVTDKAWFAARPSGTEDVYK
FT                   IYAESFVGLDHLHAVQAEAKRIVDAALDA"
FT   CDS_pept        599010..599966
FT                   /transl_table=11
FT                   /gene="pheA"
FT                   /locus_tag="CMM_0514"
FT                   /function="Prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="Prephenate dehydratase (|NP_628146.1| prephenate
FT                   dehydratase [Streptomyces coelicolor A3(2)];;
FT                   ZP_00058942.1| COG0077: Prephenate dehydratase
FT                   [Thermobifida fusca]). pfam00800, PDT, Prephenate
FT                   dehydratase. This protein is involved in Phenylalanine
FT                   biosynthesis. This protein catalyses the decarboxylation of
FT                   prephenate to phenylpyruvate. pfam01842, ACT, ACT domain.
FT                   This family of domains generally have a regulatory role.
FT                   ACT domains are linked to a wide range of metabolic enzymes
FT                   that are regulated by amino acid concentration. Pairs of
FT                   ACT domains bind specifically to a particular amino acid
FT                   leading to regulation of the linked enzyme."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0514"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00538"
FT                   /db_xref="GOA:A5CNA1"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="UniProtKB/TrEMBL:A5CNA1"
FT                   /protein_id="CAN00538.1"
FT                   /translation="MAETPRPDETYSYLGPSGTFTEAALKQVEAARGRTWRAVNNASEA
FT                   LADVVSGTSVAAMIAIENSVEGGVTATQDALANIPGLRILSEHLVPVTFDLVVRPGTAL
FT                   ADVRTVAAHPVAYGQCRRFLERELPTHGHVPASSNVAAALSLLDGGIADAAIAPPQITE
FT                   SQPLEAVARGIGDNPNAVTRFVLVGRATTLPQRTGADKTSLIVELPDDRAGSLLDLLEQ
FT                   FATRGVNLTLIQSRPIGDALGRYRFVIDAEGHVRDERVADALLGIRRFSPRVTFLGSYP
FT                   RADGTPSTYRARYEDDVFLEARDWLRGIVSAEPGAGD"
FT   CDS_pept        600028..601308
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="CMM_0515"
FT                   /function="Seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="Seryl-tRNA synthetase (Serine-tRNA ligase)
FT                   (ZP_00226153.1| COG0172: Seryl-tRNA synthetase [Kineococcus
FT                   radiotolerans SRS30216];; CAF20916.1| SERYL-TRNA SYNTHETASE
FT                   [Corynebacterium glutamicum ATCC 13032]). InterPro:
FT                   Seryl-tRNA synthetase serS: seryl-tRNA synthetase
FT                   pfam02403, Seryl_tRNA_N, Seryl-tRNA synthetase N-terminal
FT                   domain. This domain is found associated with the Pfam tRNA
FT                   synthetase class II domain (pfam00587) and represents the
FT                   N-terminal domain of seryl-tRNA synthetase. pfam00587,
FT                   tRNA-synt_2b, tRNA synthetase class II core domain (G, H,
FT                   P, S and T)."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0515"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00539"
FT                   /db_xref="GOA:A5CNA2"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5CNA2"
FT                   /protein_id="CAN00539.1"
FT                   /translation="MIDPQTLRDHPDLVIASQELRGASVEVVDQAVAADSERRRAVTEF
FT                   EGLRAEQNAHGKLVAKADKADKPRLIAEVQELKARVTAAQERAQEAESALDEAMRRIPN
FT                   IVIDGVPAGGEDDWALVREVGAKPSFDFAPRDHLEIGEILDAIDMGRGAKVSGARFHYL
FT                   KGIGARLEIALMNFGLARALEAGLVPLITPTLVKPEIMAGTGFLGAHADEVYHLDDDDL
FT                   YLTGTSEVALAGYHADEILDLAQGPIRYAGWSTCYRKEAGSYGKDTRGIIRVHQFQKLE
FT                   MFSYVDPADAEAEHERLLAMQERMMQDLGLSYRVIDTAAGDLGSSAARKYDVEAWIPTQ
FT                   DAYRELTSTSNCTTFQARRLGTRFRGEDGRTSPVATLNGTLATTRWIVAILETHQQADG
FT                   SVRVPEALRPYLGGLEVLEPAAAKAAR"
FT   CDS_pept        601305..602126
FT                   /transl_table=11
FT                   /locus_tag="CMM_0516"
FT                   /product="putative hydrolase, HAD superfamily"
FT                   /function="Predicted hydrolases of the HAD superfamily"
FT                   /note="putative hydrolase (ZP_00226154.1| COG0561:
FT                   Predicted hydrolases of the HAD superfamily [Kineococcus
FT                   radiotolerans SRS30216];; NP_789662.1| conserved
FT                   hypothetical protein [Tropheryma whipplei TW08/27])."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0516"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00540"
FT                   /db_xref="GOA:A5CNA3"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A5CNA3"
FT                   /protein_id="CAN00540.1"
FT                   /translation="MTPRVPDADRLLIALDIDGTLLGEDGSLDESVIREVRRMEEIGHL
FT                   VMPSTGRSVADTLPIVDRLGIHPRYMVCSNGAIVLERDADAPTGYSRRFVETFDPADVL
FT                   QRIRPHLASGRYAVEDEEGVYLYSGGDFPDGALEANGRHVEFEDLLHVPATRVVVISPG
FT                   HDLEDFQDVVERMGLHRVSYSIGWTAWLDIAPDGVNKATAMERVRELHDVARTHVIAMG
FT                   DGRNDIEMLEWAGEHGRGIAMGQAPAEVIAVATEVTGPITENGAAAVLSRL"
FT   tRNA            602300..602387
FT                   /locus_tag="CMM_tRNA_0004"
FT                   /anticodon="(pos:602334..602336,aa:Ser)"
FT   CDS_pept        602512..603657
FT                   /transl_table=11
FT                   /locus_tag="CMM_0517"
FT                   /product="putative transcriptional regulator, LytR family"
FT                   /function="Transcriptional regulator"
FT                   /note="putative transcriptional regulator/attenuator, LytR
FT                   family(NP_787856.1| transcriptional regulator [Tropheryma
FT                   whipplei str. Twist];; NP_627264.1| putative
FT                   transcriptional regulator [Streptomyces coelicolor A3(2)]).
FT                   , pfam03816, LytR_cpsA_psr, Cell envelope-related
FT                   transcriptional attenuator domain."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0517"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00541"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:A5CNA4"
FT                   /protein_id="CAN00541.1"
FT                   /translation="MGVAVLLVSGLSVGTIALWDLNRSVQANTVDISDGTEQTTVGVGA
FT                   LDGGFNVLLAGSDTRQGQGDGYGKTDGALNDVNMVLHVSADHSQATVVSLPRDMVVPIP
FT                   ACARSDGSGTAPAIAAAPLNTALSDGGLPCVAKTVAQFTGLDIPYAALIEFNGVIEMSN
FT                   AVGGVPVCLASPLKDKRTDLDLPAGVTPLQGKQALQFLRTRHAVGDGSDLARISNQQVF
FT                   LSALVRTMKQSSTLSDPTRVYGLAKAAVDNMQRSTSLDYQTMASMALALKDIPLDQVHF
FT                   LQYPGTTAGTGVYAGKVQPLKTDGDQLMQLLKTDAPFEVKAGNTGLGAVTEQPAASTPA
FT                   PSASAPAAGDGSQPAASSPTVLPEAITGTDAGTVTCSKAFK"
FT   tRNA            604058..604149
FT                   /locus_tag="CMM_tRNA_0005"
FT                   /anticodon="(pos:604094..604096,aa:Ser)"
FT   CDS_pept        604230..604763
FT                   /transl_table=11
FT                   /locus_tag="CMM_0518"
FT                   /product="hypothetical protein"
FT                   /function="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0518"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00542"
FT                   /db_xref="UniProtKB/TrEMBL:A5CNA5"
FT                   /protein_id="CAN00542.1"
FT                   /translation="MLDQLSTGRSRRDVQAIRDALSALSPGDPVSVVIRSPRYGLYAVD
FT                   GSVRVASNGQMVVADTALGAAGEIQALSVRPGDDVPPQGGLPDSVADLHHGTVTRVTFD
FT                   EPAYGAFHVTGPLTAGDDAFLLVGSWIVVDGDAFAPRVVSVEVAGDLDVHPANVPPRRP
FT                   SVDDKVAAVPGLVP"
FT   CDS_pept        604825..605892
FT                   /transl_table=11
FT                   /locus_tag="CMM_0519"
FT                   /function="putative transcriptional regulator, LacI family"
FT                   /note="putative transcriptional regulator, LacI family
FT                   (BAD02385.1| LacI/GalR family transcriptional repressor
FT                   [Streptomyces thermoviolaceus];; NP_628912.1| putative
FT                   transcriptional regulator [Streptomyces coelicolor A3(2)]).
FT                   pfam00532, Peripla_BP_1, Periplasmic binding proteins and
FT                   sugar binding domain of the LacI family."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0519"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00543"
FT                   /db_xref="GOA:A5CNA6"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A5CNA6"
FT                   /protein_id="CAN00543.1"
FT                   /translation="MTDTFPDAPRPPAPEHGSGTTLGLIAREANVSIGTVSKVLNGRKG
FT                   ISPATRARVEELMELHGYSRRGAERPHGALIEIVLEVVDTGFSVDLLRGVSAVAREHAL
FT                   SVIVTEHGRDQELDGDWMAGVMQRRPMGLVLVFSDLAPAQKRQLRSRGIPFVVVDPAGS
FT                   PAADVPAVGSTNWEGGHAAGEHLLGLGHRRIGAISGPPHRLYSRARMSGFRSALEAAGS
FT                   GVSLVEVEGDFGRTAGHRAGGELLDRAERPTAIFAGNDEQALGLYEAARERGIRIPDDL
FT                   SVLGYDDLPFARIVSPALSTVRQPVREMAEAAARMVLRIREGRSEEPTRLDLATALVVR
FT                   ASTAAPATGAVSSPE"
FT   CDS_pept        606062..606760
FT                   /transl_table=11
FT                   /locus_tag="CMM_0520"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /note="conserved hypothetical protein (ZP_00226605.1|
FT                   COG3828: Uncharacterized protein conserved in bacteria
FT                   [Kineococcus radiotolerans SRS30216];; NP_624682.1|
FT                   conserved hypothetical protein [Streptomyces coelicolor
FT                   A3(2)])."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0520"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00544"
FT                   /db_xref="InterPro:IPR029010"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A5CNA7"
FT                   /protein_id="CAN00544.1"
FT                   /translation="MTAARKALVVRGGWDGHMPVETTGLFIPFLEENGFEVRVEEGSAV
FT                   YADADVMAATDLIVQANTMTTIEPEEMAGLYAAVVAGTGMAGWHGGIADSYRNTADYLH
FT                   MIGGQFAHHAGKDPAERTGEQSDNYIPYTVEMTELGRTHEITQGIADFDLVTEQYWVLS
FT                   DEYNDVLATTTQTVRPWDPWHRPVTAPAIWTRQWGEGRIFVSAPGHRIEVVEDPNVRTI
FT                   IERGLLWAAR"
FT   CDS_pept        606778..607854
FT                   /transl_table=11
FT                   /locus_tag="CMM_0521"
FT                   /product="putative oxidoreductase/dehydrogenase"
FT                   /function="Predicted dehydrogenases and related proteins"
FT                   /note="putative oxidoreductase/dehydrogenase
FT                   (ZP_00226604.1| COG0673: Predicted dehydrogenases and
FT                   related proteins [Kineococcus radiotolerans SRS30216];;
FT                   NP_770032.1| dehydrogenase [Bradyrhizobium japonicum USDA
FT                   110]). pfam01408, GFO_IDH_MocA, Oxidoreductase family,
FT                   NAD-binding Rossmann fold. This family of enzymes utilise
FT                   NADP or NAD. InterPro: Oxidoreductase C-terminal."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0521"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00545"
FT                   /db_xref="GOA:A5CNA8"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5CNA8"
FT                   /protein_id="CAN00545.1"
FT                   /translation="MTLGIIGVGKISEQYFAAFETLPGVRLVAVADLDLDRARTVAEAQ
FT                   GVDALSVDDLIADPRIDTVLNLTIPAAHAEVDLRVLEAGKHVYGEKPLALSPAEAEPIL
FT                   RLAEEKGLRVGSAPDTVLGTGIQTARAVLDAGTIGKPVAANAFWGAPGHELWHPAPAFY
FT                   YQPGAGPLFDMGPYYLTALVTLLGPITRVQGASLRSDRVRSAASDPESREIPVTVDTHV
FT                   SAVLTHASGAVSTVTMSFDVWATRIPNIEVYGTAGTLSVPDPNHFSGPVQVATSADREW
FT                   TDVEPSAGFVDAGRGCGLAEMADAIRRGVPHRASGELAFHVLEVMDAILDPGATGEIRS
FT                   TVGRPEAVPLGQPGRSGD"
FT   CDS_pept        607946..608311
FT                   /transl_table=11
FT                   /locus_tag="CMM_0522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0522"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00546"
FT                   /db_xref="UniProtKB/TrEMBL:A5CNA9"
FT                   /protein_id="CAN00546.1"
FT                   /translation="MTRHFSQFLFAPYGDGEGLRAVEPDAADAQLLGADACEADADDDP
FT                   REREADVTDPSVWPPLTAVEWPLTHRPFDDDEPEIADGHFAPADEDPDAEAQEEAAAHA
FT                   ARAALLAEVYGWPHRAI"
FT   CDS_pept        complement(608351..609706)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0523"
FT                   /product="glycosyl hydrolase, family 13"
FT                   /function="Glycosidases"
FT                   /EC_number="3.2.1.-"
FT                   /note="glycosyl hydrolase, family 13 (NP_960521.1|
FT                   hypothetical protein MAP1587c [Mycobacterium avium subsp.
FT                   paratuberculosis str. k10];; NP_737573.1| putative amylase
FT                   [Corynebacterium efficiens YS-314]). InterPro: Glycoside
FT                   hydrolase family 13 pfam00128, Alpha-amylase, Alpha
FT                   amylase, catalytic domain."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0523"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00547"
FT                   /db_xref="GOA:A5CNB0"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A5CNB0"
FT                   /protein_id="CAN00547.1"
FT                   /translation="MASWTDHVVWWHVYPLGFTGAPQTRDDLAGPDGGSPAHPDAPPAH
FT                   RIDRLRAWLPYLVDLGANGLLLGPVFDSETHGYDTRDHLTLDPRLGDDADLDALLADAS
FT                   ARGVRVLLDGVFNHVGRSHPRFAQALADGPGSEAASWFRWDGAGAPVGFEGHGALVTLD
FT                   HDSEAVRAHVAEVMIHWLDRGISGWRLDAAYAVPASFWAAVLPRVRERHPDAWFVGEMI
FT                   HGDYAGYAAESTIDSITAYELWKSIRNSIAEGNLFELDWTLTRHAELLPSFTPQTFIGN
FT                   HDVTRIASAVDPRHLGHAIALLLLLPGIPSIYAGDERGLTGVKEDRAGGDDAVRPEYPA
FT                   SPDDLRDDEHAARIRSLHQELVGLRRRHAWLVDARMETSGLTNTALTITLRPSGTGAAG
FT                   GVAPGSPGALRLVLNIGDEPVEVAGSPGGREAGDVAGDGRVPGHSWAVLAGA"
FT   tRNA            609908..609980
FT                   /locus_tag="CMM_tRNA_0006"
FT                   /anticodon="(pos:609941..609943,aa:Arg)"
FT   CDS_pept        complement(610081..610308)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="CMM_PS_13"
FT                   /function="putative transcriptional regulator"
FT                   /note="putative transcriptional regulator, LuxR family"
FT                   /note="Hypothetical protein"
FT                   /db_xref="PSEUDO:CAN00548.1"
FT   CDS_pept        complement(610366..611445)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0524"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00549"
FT                   /db_xref="GOA:A5CNB2"
FT                   /db_xref="UniProtKB/TrEMBL:A5CNB2"
FT                   /protein_id="CAN00549.1"
FT                   /translation="MNTADPTLDTRIRAFAAAVRDRLADLDPEDVDDLTGGLEADLQEE
FT                   AADHDGALQLGDPVRYADELRSSAGLPERAVAAASTSPLAQLRETVRERLGELHARICA
FT                   NRELSAILDLLIVFRPVWWLLRAWAGYQIAVIVLSIFFGSSSSFVVLPGGPVGWILLIP
FT                   LLVVSVQWGRGEWAARPSLRSFRSAVSVVTALALVVLIPVAIERSSRGDYVDHSSSPSS
FT                   SYVPQELTLDGKRISNVFAYDAEGNLLDRVQLFDQDGEPLSVVPPALAEVDSSTGEQLE
FT                   PSTGAWNAFPLSLRDAGRIGHLSVEEMGSGRPPFAKALPLPALKGSTSTPTPSATATPG
FT                   STQEEEGTPSPTPTPEPTP"
FT   CDS_pept        complement(611442..611858)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0525"
FT                   /product="putative transcriptional regulator, PadR family"
FT                   /function="Predicted transcriptional regulators"
FT                   /note="putative transcriptional regulator, PadR family
FT                   (NP_687299.1| conserved hypothetical protein [Streptococcus
FT                   agalactiae 2603V/R];; NP_422202.1| conserved hypothetical
FT                   protein [Caulobacter crescentus CB15]). pfam03551, PadR,
FT                   Transcriptional regulator PadR-like family. Members of this
FT                   family are transcriptional regulators that appear to be
FT                   related to the pfam01047 family. This family includes PadR,
FT                   a protein that is involved in negative regulation of
FT                   phenolic acid metabolism."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0525"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00550"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5CNB3"
FT                   /protein_id="CAN00550.1"
FT                   /translation="MDTTQLLKGALDTAVLAVVQHDDGYGYDIVRRLRDAGLGDVGDAS
FT                   VYGTLRRLYAAGALSSYVVPSEGGPHRKYYAINPEGRELLAGQRATWAAFATAMSGLLG
FT                   EPAPAPTHRSRKAGATGEGPVPASVNVRTIGEKP"
FT   CDS_pept        612006..612341
FT                   /transl_table=11
FT                   /locus_tag="CMM_0526"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0526"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00551"
FT                   /db_xref="GOA:A5CNB4"
FT                   /db_xref="UniProtKB/TrEMBL:A5CNB4"
FT                   /protein_id="CAN00551.1"
FT                   /translation="MLPSGMPIVLEALGRVLALVGDVVLGGAGVTPAILLAALLGAASV
FT                   AAAIALVRIAAARGLIGSAAPPLGPDEDVDLPVLVSSSDPDADGHERSRAPGRRMQVVV
FT                   PAPLPAA"
FT   CDS_pept        612444..613211
FT                   /transl_table=11
FT                   /locus_tag="CMM_0527"
FT                   /product="putative membrane protein"
FT                   /note="putative membrane protein, possible preprotein
FT                   translocase (NP_627080.1| putative membrane protein.
FT                   [Streptomyces coelicolor A3(2)];; ZP_00057695.1| COG0706:
FT                   Preprotein translocase subunit YidC [Thermobifida fusca]).
FT                   pfam02096, 60KD_IMP, 60Kd inner membrane protein."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0527"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00552"
FT                   /db_xref="GOA:A5CNB5"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/TrEMBL:A5CNB5"
FT                   /protein_id="CAN00552.1"
FT                   /translation="MDPTSIAPVRAVLDGLSQLVVGLADLIHPLAGASATGVAVILLTL
FT                   GVRALLVPVGVAQVRAEIQRRRIAPALAELRRRHAGKPEQLSRATQELYAREGASPLAG
FT                   CLPTLAQAPVLAAVYALFAHARIGGEANALLAAPFAGIPLGSSALSAAAMGVTPLVVSV
FT                   VVLGLLAIVIEVRRRADLRFQGPPAPVDPALPGMAGMTAMMRVLPFVTVVFAGIAPLAA
FT                   ALYLLSSAAWTLLERAALRRVLGRAPSRGTAAA"
FT   CDS_pept        613276..614184
FT                   /transl_table=11
FT                   /locus_tag="CMM_0528"
FT                   /product="putative metal-dependent hydrolase"
FT                   /function="Predicted metal-dependent hydrolases related to
FT                   alanyl-tRNA synthetase HxxxH domain"
FT                   /note="putative metal-dependent hydrolase (NP_796992.1|
FT                   hypothetical protein VP0613 [Vibrio parahaemolyticus RIMD
FT                   2210633];; CAG19181.1| hypothetical metal-dependent
FT                   hydrolase [Photobacterium profundum])."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0528"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00553"
FT                   /db_xref="GOA:A5CNB6"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="UniProtKB/TrEMBL:A5CNB6"
FT                   /protein_id="CAN00553.1"
FT                   /translation="MTSTTAGAVALPPTRVTYPAGSVASEGQVLRVDDLADGTRAVVLD
FT                   ATACHPVDAAWPDQPADRAVLRVRGAGIEVLDCVVGAASTDPAEDATLHVGADVPVKKG
FT                   ADGWSFVAVHVVPGDSDVRVGDAVEVAVDPEHRRALSAGHTGCHLASLALDRALADAWT
FT                   KDVPTDALGAPGFDALAIGTSRIGPWSSVDTYRLGKSLRKKGFVPAALVERLDEVRDAV
FT                   DATLAEWVASGAAARIEREGDLLTSRRSWVCELPGGAARIPCGGTHLAGLDELASITID
FT                   LEVEEADGAVVVRMRTTCVPA"
FT   CDS_pept        614297..614839
FT                   /transl_table=11
FT                   /locus_tag="CMM_0529"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0529"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00554"
FT                   /db_xref="UniProtKB/TrEMBL:A5CNB7"
FT                   /protein_id="CAN00554.1"
FT                   /translation="MVSNVAATPATKCSVCGKANPVGMATGNILDHGRNHERCPGSGKP
FT                   PAVSTKPASAAAKSGTAPSRKPASDAAKREPSRKTTPAKAAGPTRGVTVRRVEVDTERL
FT                   RLREEKLERIRVQREEAARRRLGDYIVPLDADGQEAPEADITLETMDDEAQATVEPGAS
FT                   TESDVATADAAEGRPSA"
FT   CDS_pept        614857..615891
FT                   /transl_table=11
FT                   /locus_tag="CMM_0530"
FT                   /product="putative oxidoreductase"
FT                   /function="Predicted oxidoreductases (related to
FT                   aryl-alcohol dehydrogenases)"
FT                   /note="putative oxidoreductase (ZP_00228825.1| COG0667:
FT                   Predicted oxidoreductases (related to aryl-alcohol
FT                   dehydrogenases) [Kineococcus radiotolerans SRS30216];;
FT                   NP_629103.1| putative aldoketoreductase [Streptomyces
FT                   coelicolor A3(2)]). pfam00248, Aldo_ket_red, Aldo/keto
FT                   reductase family."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0530"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00555"
FT                   /db_xref="GOA:A5CNB8"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A5CNB8"
FT                   /protein_id="CAN00555.1"
FT                   /translation="MTEQSTDQPATYLGRTGVEVSRLCLGTMMFGAWGETDHEKSIRVI
FT                   HRAIDAGITFIDTADIYAYGESEEIVGKAIAQSGRRDDLILATKFFNGMKPEANFRGGS
FT                   RRWIMRAVEDSLRRLGTDYIDLYQMHRPDEHTDIEETLGALTDLVRAGKVRYIGSSTFQ
FT                   PSQVVEAQWVARERGTARFVTEQPPYSMLTRGIEADLLPTTQRHGMGTLVWSPLAGGWL
FT                   SGKYRKGQEIPKTHRNDRDPSRYDPADPKFEAADKLGALADELGVPLVHLALAFVLRHP
FT                   AVSSAIIGPRTMEQLESQLDAANLELDAATLDRIDEIVPPGLNVNPADTGFANYWLDPA
FT                   RRRR"
FT   CDS_pept        615988..616755
FT                   /transl_table=11
FT                   /gene="plsC"
FT                   /locus_tag="CMM_0531"
FT                   /product="putative 1-acylglycerol-3-phosphate
FT                   O-acyltransferase"
FT                   /function="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.51"
FT                   /note="putative 1-acylglycerol-3-phosphate
FT                   O-acyltransferase (NP_822660.1| putative
FT                   1-acylglycerol-3-phosphate O-acyltransferase [Streptomyces
FT                   avermitilis MA-4680];; NP_602082.1|
FT                   1-acyl-sn-glycerol-3-phosphate acyltransferase
FT                   [Corynebacterium glutamicum ATCC 13032]). , pfam01553,
FT                   Acyltransferase, Acyltransferase."
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0531"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00556"
FT                   /db_xref="GOA:A5CNB9"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A5CNB9"
FT                   /protein_id="CAN00556.1"
FT                   /translation="MSRRTREPVYGTAVILGRALFGALRLRLVADGRERIPDTGGAVIA
FT                   MTHFGYLEFALVEWATWLHDRRRIRFMAKKGAFDQPGVGWVLRRMRHIEVDMTAGAAAY
FT                   ADAVAALRAGELIGVFPEAGVSASFRVRKLKTGAARLAAEAGVPIVPVAVWGGHRLLTK
FT                   NHRIRMRDRIGVPVHLRVGERIPVAPDADPREVTEALRVELQELVDGLQSAYPVDGRGA
FT                   WWQPRHLGGTAPTPEEAAAADAERDARRRAEGR"
FT   CDS_pept        complement(617075..617491)
FT                   /transl_table=11
FT                   /gene="panD"
FT                   /locus_tag="CMM_0532"
FT                   /function="Aspartate 1-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /note="aspartate 1-decarboxylase precursor (Aspartate
FT                   alpha- decarboxylase) (PAND_MYCTU Aspartate 1-decarboxylase
FT                   precursor (Aspartate alpha-decarboxylase);; PAND_STRCO
FT                   Aspartate 1-decarboxylase precursor (Aspartate
FT                   alpha-decarboxylase)). panD: aspartate 1-decarboxylase.
FT                   pfam02261, Asp_decarbox, Aspartate decarboxylase."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0532"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00557"
FT                   /db_xref="GOA:A5CNC0"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5CNC0"
FT                   /protein_id="CAN00557.1"
FT                   /translation="MLRTMMTAKIHRATVTHADLHYVGSVTVDRDLLDAADILVGERVS
FT                   IVDVTNGARLDTYTIAGERGSGVLGINGAAAHLVDVGDVVILIAYGQMTTEEARALEPR
FT                   VVHVDVGNRIRAVDADPTAPPAPGLERSPLAEPV"
FT   CDS_pept        617722..618813
FT                   /transl_table=11
FT                   /locus_tag="CMM_0533"
FT                   /product="putative tRNA processing ribonuclease BN"
FT                   /function="Predicted membrane protein"
FT                   /EC_number="3.1.13.-"
FT                   /note="putative tRNA processing ribonuclease BN (RNase
FT                   BN)(NP_822167.1| putative membrane protein [Streptomyces
FT                   avermitilis MA-4680];; BAB98344.1| tRNA-processing
FT                   ribonuclease BN [Corynebacterium glutamicum ATCC 13032]).
FT                   rbn: ribonuclease BN putative pfam03631,
FT                   Ribonuclease_BN,Ribonuclease BN-like family. This family
FT                   contains integral membrane proteins with 5 to 6 predicted
FT                   transmembrane spans. The family include ribonuclease BN
FT                   that is involved in tRNA maturation."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0533"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00558"
FT                   /db_xref="GOA:A5CNC1"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:A5CNC1"
FT                   /protein_id="CAN00558.1"
FT                   /translation="MARRDTAGTIEDRPDEDDARKPDSPTEIEKPSWKYVLRKTVREFG
FT                   SDQCTDIAASLTYYAVLSLFPALIAIISLLGVFGQGQQTVTAVLDLLRGFAPADALALI
FT                   EPILTGFVESPAAGFALVSGIVLAIWSASGYVGAFTRAMNRIYEIPEGRPFLKLKPMQL
FT                   AVTLIGIVILLVCALIIAISGPVTDAIGEALGLGPTVQIVWSIAKWPVLAFAIVLLIAI
FT                   LYYATPNAKQPKFRWMSVGAAIALVVLVVASVGFAFYVTEFSSYAKSYGALAGVVVFLL
FT                   WLWIANLALLFGAEFDAELERGRQLQAGIAAEETLQLPPRDTVVSDKKAAAEREDVKRG
FT                   RGIRERHERAERLGRGDDAGDGA"
FT   CDS_pept        complement(618856..620382)
FT                   /transl_table=11
FT                   /gene="phrB"
FT                   /locus_tag="CMM_0534"
FT                   /product="Deoxyribodipyrimidine photo-lyase"
FT                   /function="Deoxyribodipyrimidine photolyase"
FT                   /EC_number="4.1.99.3"
FT                   /note="putative deoxyribodipyrimidine photolyase
FT                   (NP_108272.1| blue light photoreceptor cryptochrome
FT                   [Mesorhizobium loti MAFF303099];; NP_531913.1| DNA
FT                   photolyase [Agrobacterium tumefaciens str. C58]).
FT                   pfam00875, DNA_photolyase, DNA photolyase. This domain
FT                   binds a light harvesting cofactor. pfam03441,FAD_binding_7,
FT                   FAD binding domain of DNA photolyase."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0534"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00559"
FT                   /db_xref="GOA:A5CNC2"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:A5CNC2"
FT                   /protein_id="CAN00559.1"
FT                   /translation="MSDDDAPDHGSADREGAEEAHGPSIVWLRDDLRVADNPALHAAVE
FT                   RGEPIVVLYVLDEESDGIRPLGGAARWWLHMSLSRLAESLRELGSDLVLRRGKAADVVD
FT                   DLVREIGAGAVLWNRRYGGAEIAVDTAIKKDLGDRGLDVRSFQGSLLVEPWTVTNKQGE
FT                   PFRVYTPFWKAAQEREEPRKPLPAPKELDAPREAPRSDDLDGWGLLPTKPDWAAGLRES
FT                   CDPGEAAGLQRLEDFVHHELEDYAAQRDEPAAMTTSRLSAYLRWGEVSPFQVWHRIQRT
FT                   RGKKVGGDEVNATKFLSELGWREFSYHLLYHQPDLATRNFVPRFDAFPWDEPTDETLGA
FT                   WQRGETGVPLVDAGMRALWKDGHLHNRVRMVVASFLIKNLLIDWRHGEQWFWDTLVDAD
FT                   AANNAASWQWVAGSGADAAPYFRVFNPVLQGQKFDPSGEYIRSYVPELAHAPRDVVHEP
FT                   WKAMGDLVASAEDGADDSDDGGLAAYPAPIVDLKESRQRALAAYDEIKDR"
FT   CDS_pept        620529..621914
FT                   /transl_table=11
FT                   /locus_tag="CMM_0535"
FT                   /product="putative glycosyl transferase"
FT                   /note="putative glycosyl transferase (weak similarities to:
FT                   NP_787164.1| glycosyltransferase [Tropheryma whipplei str.
FT                   Twist];; NP_808963.1| putative glycosyltransferase
FT                   [Bacteroides thetaiotaomicron VPI-5482])
FT                   pfam00535,Glycos_transf_2, Glycosyl transferase. Diverse
FT                   family,transferring sugar from UDP-glucose,
FT                   UDP-N-acetyl-galactosamine, GDP-mannose or CDP-abequose, to
FT                   a range of substrates including cellulose, dolichol
FT                   phosphate and teichoic acids."
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CMM_0535"
FT                   /db_xref="EnsemblGenomes-Tr:CAN00560"
FT                   /db_xref="GOA:A5CNC3"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5CNC3"
FT                   /protein_id="CAN00560.1"
FT                   /translation="MDNQSTPLPPPEHPGRSSRDAVSAVVVAGDAGSTIAATLTSILGQ
FT                   TMPPARVVVVVAGSRDDTFAVARTFNGRHAHALADAGHAATTVTVIDRGPREGSLRSAY
FT                   GFALRLVDDAGRVLLVAPDAELKPDVLQLLAAALERDPGARSVSASLDPRPSGSHGPLA
FT                   GALQVLQRHWAMGAVETGIDLGLTGPVPLAPATLLRLPAADAPSSSAASSEGILTDLLA
FT                   GDDRSALVPGARARVDTAVTWGMMRERRDRWGAHVARLARGGSPADVGDRRRARLASLR
FT                   IGVGPVLRFVAYALVALYLAAAGMQGMLEPAWWWAIPVVVRLPLHIRTLRRIRERTAAD
FT                   VLFGATFLPLEAAEAAYGVSRIRDGLHRMAHRGRRRGPAAAETVPPFSRVDAVAAAAVA
FT                   LVVVGVLAVAEVGGPAAAGLTTMVGWAACVVTAADLVMALLRLLVAHGGPFARPSAAGG
FT                   SEA"
FT   CDS_pept        complement(621911..622354)
FT                   /transl_table=11
FT                   /locus_tag="CMM_0536"
FT                   /product="transcriptional regulator, MarR family"
FT                   /function="Transcriptional regulators"
FT                   /note="transcriptional regulator, MarR family (NP_103003.1|
FT                   probable transcriptional regulator [Mesorhizobium loti
FT