(data stored in ACNUC29543 zone)

EMBL: AM743169

ID   AM743169; SV 1; circular; genomic DNA; STD; PRO; 4851126 BP.
XX
AC   AM743169;
XX
PR   Project:PRJNA30351;
XX
DT   25-APR-2008 (Rel. 95, Created)
DT   06-FEB-2015 (Rel. 123, Last updated, Version 9)
XX
DE   Stenotrophomonas maltophilia K279a complete genome, strain K279a
XX
KW   complete genome.
XX
OS   Stenotrophomonas maltophilia K279a
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales;
OC   Xanthomonadaceae; Stenotrophomonas; Stenotrophomonas maltophilia group.
XX
RN   [1]
RP   1-4851126
RA   Crossman L.C.;
RT   ;
RL   Submitted (24-MAY-2007) to the INSDC.
RL   Crossman L.C., Pathogen Sequencing Unit, The Wellcome Trust Sanger
RL   Institute, Hinxton, Cambridge, Cambridgeshire, CB10 1SA, UNITED KINGDOM.
XX
RN   [2]
RX   DOI; 10.1186/gb-2008-9-4-r74.
RX   PUBMED; 18419807.
RA   Crossman L.C., Gould V.C., Dow J.M., Vernikos G.S., Okazaki A.,
RA   Sebaihia M., Saunders D., Arrowsmith C., Carver T., Peters N., Adlem E.,
RA   Kerhornou A., Lord A., Murphy L., Seeger K., Squares R., Rutter S.,
RA   Quail M.A., Rajandream M.A., Harris D., Churcher C., Bentley S.D.,
RA   Parkhill J., Thomson N.R., Avison M.B.;
RT   "The complete genome, comparative and functional analysis of
RT   Stenotrophomonas maltophilia reveals an organism heavily shielded by drug
RT   resistance determinants";
RL   Genome Biol. 9(4):R74-R74(2008).
XX
DR   MD5; 8f8820bce2e64b026eadb91eb83f4380.
DR   BioSample; SAMEA1705934.
DR   EnsemblGenomes-Gn; EBG00001180252.
DR   EnsemblGenomes-Gn; EBG00001180253.
DR   EnsemblGenomes-Gn; EBG00001180254.
DR   EnsemblGenomes-Gn; EBG00001180255.
DR   EnsemblGenomes-Gn; EBG00001180256.
DR   EnsemblGenomes-Gn; EBG00001180257.
DR   EnsemblGenomes-Gn; EBG00001180258.
DR   EnsemblGenomes-Gn; EBG00001180259.
DR   EnsemblGenomes-Gn; EBG00001180260.
DR   EnsemblGenomes-Gn; EBG00001180261.
DR   EnsemblGenomes-Gn; EBG00001180262.
DR   EnsemblGenomes-Gn; EBG00001180263.
DR   EnsemblGenomes-Gn; EBG00001180264.
DR   EnsemblGenomes-Gn; EBG00001180265.
DR   EnsemblGenomes-Gn; EBG00001180266.
DR   EnsemblGenomes-Gn; EBG00001180267.
DR   EnsemblGenomes-Gn; EBG00001180268.
DR   EnsemblGenomes-Gn; EBG00001180269.
DR   EnsemblGenomes-Gn; EBG00001180270.
DR   EnsemblGenomes-Gn; EBG00001180271.
DR   EnsemblGenomes-Gn; EBG00001180272.
DR   EnsemblGenomes-Gn; EBG00001180273.
DR   EnsemblGenomes-Gn; EBG00001180274.
DR   EnsemblGenomes-Gn; EBG00001180275.
DR   EnsemblGenomes-Gn; EBG00001180276.
DR   EnsemblGenomes-Gn; EBG00001180277.
DR   EnsemblGenomes-Gn; EBG00001180278.
DR   EnsemblGenomes-Gn; EBG00001180279.
DR   EnsemblGenomes-Gn; EBG00001180280.
DR   EnsemblGenomes-Gn; EBG00001180281.
DR   EnsemblGenomes-Gn; EBG00001180282.
DR   EnsemblGenomes-Gn; EBG00001180283.
DR   EnsemblGenomes-Gn; EBG00001180284.
DR   EnsemblGenomes-Gn; EBG00001180285.
DR   EnsemblGenomes-Gn; EBG00001180286.
DR   EnsemblGenomes-Gn; EBG00001180287.
DR   EnsemblGenomes-Gn; EBG00001180288.
DR   EnsemblGenomes-Gn; EBG00001180289.
DR   EnsemblGenomes-Gn; EBG00001180290.
DR   EnsemblGenomes-Gn; EBG00001180291.
DR   EnsemblGenomes-Gn; EBG00001180292.
DR   EnsemblGenomes-Gn; EBG00001180293.
DR   EnsemblGenomes-Gn; EBG00001180294.
DR   EnsemblGenomes-Gn; EBG00001180295.
DR   EnsemblGenomes-Gn; EBG00001180296.
DR   EnsemblGenomes-Gn; EBG00001180297.
DR   EnsemblGenomes-Gn; EBG00001180298.
DR   EnsemblGenomes-Gn; EBG00001180299.
DR   EnsemblGenomes-Gn; EBG00001180300.
DR   EnsemblGenomes-Gn; EBG00001180301.
DR   EnsemblGenomes-Gn; EBG00001180302.
DR   EnsemblGenomes-Gn; EBG00001180303.
DR   EnsemblGenomes-Gn; EBG00001180304.
DR   EnsemblGenomes-Gn; EBG00001180305.
DR   EnsemblGenomes-Gn; EBG00001180306.
DR   EnsemblGenomes-Gn; EBG00001180307.
DR   EnsemblGenomes-Gn; EBG00001180308.
DR   EnsemblGenomes-Gn; EBG00001180309.
DR   EnsemblGenomes-Gn; EBG00001180310.
DR   EnsemblGenomes-Gn; EBG00001180311.
DR   EnsemblGenomes-Gn; EBG00001180312.
DR   EnsemblGenomes-Gn; EBG00001180313.
DR   EnsemblGenomes-Gn; EBG00001180314.
DR   EnsemblGenomes-Gn; EBG00001180315.
DR   EnsemblGenomes-Gn; EBG00001180316.
DR   EnsemblGenomes-Gn; EBG00001180317.
DR   EnsemblGenomes-Gn; EBG00001180318.
DR   EnsemblGenomes-Gn; EBG00001180319.
DR   EnsemblGenomes-Gn; EBG00001180320.
DR   EnsemblGenomes-Gn; EBG00001180321.
DR   EnsemblGenomes-Gn; EBG00001180322.
DR   EnsemblGenomes-Gn; EBG00001180323.
DR   EnsemblGenomes-Gn; EBG00001180324.
DR   EnsemblGenomes-Gn; EBG00001180325.
DR   EnsemblGenomes-Gn; EBG00001180326.
DR   EnsemblGenomes-Gn; EBG00001180327.
DR   EnsemblGenomes-Gn; EBG00001180328.
DR   EnsemblGenomes-Gn; EBG00001180329.
DR   EnsemblGenomes-Gn; EBG00001180330.
DR   EnsemblGenomes-Gn; EBG00001180331.
DR   EnsemblGenomes-Gn; EBG00001180332.
DR   EnsemblGenomes-Gn; EBG00001180333.
DR   EnsemblGenomes-Gn; EBG00001180334.
DR   EnsemblGenomes-Gn; EBG00001180335.
DR   EnsemblGenomes-Gn; EBG00001180336.
DR   EnsemblGenomes-Gn; EBG00001180337.
DR   EnsemblGenomes-Gn; EBG00001180338.
DR   EnsemblGenomes-Gn; EBG00001180339.
DR   EnsemblGenomes-Gn; EBG00001180340.
DR   EnsemblGenomes-Gn; EBG00001180341.
DR   EnsemblGenomes-Gn; EBG00001180342.
DR   EnsemblGenomes-Gn; EBG00001180343.
DR   EnsemblGenomes-Gn; EBG00001180344.
DR   EnsemblGenomes-Gn; EBG00001180345.
DR   EnsemblGenomes-Gn; EBG00001180346.
DR   EnsemblGenomes-Gn; EBG00001180347.
DR   EnsemblGenomes-Gn; EBG00001180348.
DR   EnsemblGenomes-Gn; EBG00001180349.
DR   EnsemblGenomes-Gn; EBG00001180350.
DR   EnsemblGenomes-Gn; EBG00001180351.
DR   EnsemblGenomes-Gn; EBG00001180352.
DR   EnsemblGenomes-Gn; EBG00001180353.
DR   EnsemblGenomes-Gn; EBG00001180354.
DR   EnsemblGenomes-Gn; EBG00001180355.
DR   EnsemblGenomes-Gn; EBG00001180356.
DR   EnsemblGenomes-Gn; EBG00001180357.
DR   EnsemblGenomes-Gn; EBG00001180358.
DR   EnsemblGenomes-Gn; EBG00001180359.
DR   EnsemblGenomes-Gn; EBG00001180360.
DR   EnsemblGenomes-Gn; EBG00001180361.
DR   EnsemblGenomes-Gn; EBG00001180362.
DR   EnsemblGenomes-Gn; EBG00001180363.
DR   EnsemblGenomes-Gn; EBG00001180364.
DR   EnsemblGenomes-Gn; EBG00001180365.
DR   EnsemblGenomes-Gn; EBG00001180366.
DR   EnsemblGenomes-Gn; EBG00001180367.
DR   EnsemblGenomes-Gn; EBG00001180368.
DR   EnsemblGenomes-Gn; EBG00001180369.
DR   EnsemblGenomes-Gn; EBG00001180370.
DR   EnsemblGenomes-Gn; EBG00001180371.
DR   EnsemblGenomes-Gn; EBG00001180372.
DR   EnsemblGenomes-Gn; EBG00001180373.
DR   EnsemblGenomes-Gn; EBG00001180374.
DR   EnsemblGenomes-Gn; EBG00001180375.
DR   EnsemblGenomes-Gn; EBG00001180376.
DR   EnsemblGenomes-Gn; EBG00001180377.
DR   EnsemblGenomes-Gn; EBG00001180378.
DR   EnsemblGenomes-Gn; EBG00001180379.
DR   EnsemblGenomes-Gn; EBG00001180380.
DR   EnsemblGenomes-Gn; Smlt0016.
DR   EnsemblGenomes-Gn; Smlt0041.
DR   EnsemblGenomes-Gn; Smlt0055.
DR   EnsemblGenomes-Gn; Smlt0490A.
DR   EnsemblGenomes-Gn; Smlt1240.
DR   EnsemblGenomes-Gn; Smlt1296.
DR   EnsemblGenomes-Gn; Smlt1297.
DR   EnsemblGenomes-Gn; Smlt1332.
DR   EnsemblGenomes-Gn; Smlt1391.
DR   EnsemblGenomes-Gn; Smlt1395.
DR   EnsemblGenomes-Gn; Smlt1479.
DR   EnsemblGenomes-Gn; Smlt1480.
DR   EnsemblGenomes-Gn; Smlt1481.
DR   EnsemblGenomes-Gn; Smlt1632.
DR   EnsemblGenomes-Gn; Smlt1828.
DR   EnsemblGenomes-Gn; Smlt1977.
DR   EnsemblGenomes-Gn; Smlt2065.
DR   EnsemblGenomes-Gn; Smlt2227.
DR   EnsemblGenomes-Gn; Smlt2407A.
DR   EnsemblGenomes-Gn; Smlt2436.
DR   EnsemblGenomes-Gn; Smlt2437.
DR   EnsemblGenomes-Gn; Smlt2456.
DR   EnsemblGenomes-Gn; Smlt2476.
DR   EnsemblGenomes-Gn; Smlt2878.
DR   EnsemblGenomes-Gn; Smlt3044.
DR   EnsemblGenomes-Gn; Smlt3083A.
DR   EnsemblGenomes-Gn; Smlt3087.
DR   EnsemblGenomes-Gn; Smlt3368.
DR   EnsemblGenomes-Gn; Smlt3421.
DR   EnsemblGenomes-Gn; Smlt3626.
DR   EnsemblGenomes-Gn; Smlt4013.
DR   EnsemblGenomes-Gn; Smlt4033.
DR   EnsemblGenomes-Gn; Smlt4061.
DR   EnsemblGenomes-Gn; Smlt4134.
DR   EnsemblGenomes-Gn; Smlt4136.
DR   EnsemblGenomes-Gn; Smlt4443.
DR   EnsemblGenomes-Gn; Smlt4447A.
DR   EnsemblGenomes-Gn; Smlt4447C.
DR   EnsemblGenomes-Gn; Smlt4450.
DR   EnsemblGenomes-Gn; Smlt4451.
DR   EnsemblGenomes-Gn; Smlt4545.
DR   EnsemblGenomes-Gn; Smlt4547.
DR   EnsemblGenomes-Gn; Smlt4549.
DR   EnsemblGenomes-Gn; Smlt4665.
DR   EnsemblGenomes-Tr; EBT00001758679.
DR   EnsemblGenomes-Tr; EBT00001758682.
DR   EnsemblGenomes-Tr; EBT00001758684.
DR   EnsemblGenomes-Tr; EBT00001758686.
DR   EnsemblGenomes-Tr; EBT00001758687.
DR   EnsemblGenomes-Tr; EBT00001758689.
DR   EnsemblGenomes-Tr; EBT00001758690.
DR   EnsemblGenomes-Tr; EBT00001758692.
DR   EnsemblGenomes-Tr; EBT00001758694.
DR   EnsemblGenomes-Tr; EBT00001758695.
DR   EnsemblGenomes-Tr; EBT00001758697.
DR   EnsemblGenomes-Tr; EBT00001758698.
DR   EnsemblGenomes-Tr; EBT00001758700.
DR   EnsemblGenomes-Tr; EBT00001758701.
DR   EnsemblGenomes-Tr; EBT00001758703.
DR   EnsemblGenomes-Tr; EBT00001758705.
DR   EnsemblGenomes-Tr; EBT00001758706.
DR   EnsemblGenomes-Tr; EBT00001758708.
DR   EnsemblGenomes-Tr; EBT00001758711.
DR   EnsemblGenomes-Tr; EBT00001758713.
DR   EnsemblGenomes-Tr; EBT00001758715.
DR   EnsemblGenomes-Tr; EBT00001758717.
DR   EnsemblGenomes-Tr; EBT00001758719.
DR   EnsemblGenomes-Tr; EBT00001758722.
DR   EnsemblGenomes-Tr; EBT00001758724.
DR   EnsemblGenomes-Tr; EBT00001758726.
DR   EnsemblGenomes-Tr; EBT00001758728.
DR   EnsemblGenomes-Tr; EBT00001758730.
DR   EnsemblGenomes-Tr; EBT00001758732.
DR   EnsemblGenomes-Tr; EBT00001758734.
DR   EnsemblGenomes-Tr; EBT00001758736.
DR   EnsemblGenomes-Tr; EBT00001758738.
DR   EnsemblGenomes-Tr; EBT00001758740.
DR   EnsemblGenomes-Tr; EBT00001758742.
DR   EnsemblGenomes-Tr; EBT00001758744.
DR   EnsemblGenomes-Tr; EBT00001758746.
DR   EnsemblGenomes-Tr; EBT00001758747.
DR   EnsemblGenomes-Tr; EBT00001758749.
DR   EnsemblGenomes-Tr; EBT00001758750.
DR   EnsemblGenomes-Tr; EBT00001758753.
DR   EnsemblGenomes-Tr; EBT00001758758.
DR   EnsemblGenomes-Tr; EBT00001758760.
DR   EnsemblGenomes-Tr; EBT00001758761.
DR   EnsemblGenomes-Tr; EBT00001758763.
DR   EnsemblGenomes-Tr; EBT00001758766.
DR   EnsemblGenomes-Tr; EBT00001758767.
DR   EnsemblGenomes-Tr; EBT00001758769.
DR   EnsemblGenomes-Tr; EBT00001758771.
DR   EnsemblGenomes-Tr; EBT00001758773.
DR   EnsemblGenomes-Tr; EBT00001758775.
DR   EnsemblGenomes-Tr; EBT00001758777.
DR   EnsemblGenomes-Tr; EBT00001758778.
DR   EnsemblGenomes-Tr; EBT00001758779.
DR   EnsemblGenomes-Tr; EBT00001758780.
DR   EnsemblGenomes-Tr; EBT00001758781.
DR   EnsemblGenomes-Tr; EBT00001758782.
DR   EnsemblGenomes-Tr; EBT00001758783.
DR   EnsemblGenomes-Tr; EBT00001758784.
DR   EnsemblGenomes-Tr; EBT00001758785.
DR   EnsemblGenomes-Tr; EBT00001758786.
DR   EnsemblGenomes-Tr; EBT00001758787.
DR   EnsemblGenomes-Tr; EBT00001758788.
DR   EnsemblGenomes-Tr; EBT00001758789.
DR   EnsemblGenomes-Tr; EBT00001758790.
DR   EnsemblGenomes-Tr; EBT00001758791.
DR   EnsemblGenomes-Tr; EBT00001758792.
DR   EnsemblGenomes-Tr; EBT00001758793.
DR   EnsemblGenomes-Tr; EBT00001758794.
DR   EnsemblGenomes-Tr; EBT00001758795.
DR   EnsemblGenomes-Tr; EBT00001758796.
DR   EnsemblGenomes-Tr; EBT00001758797.
DR   EnsemblGenomes-Tr; EBT00001758798.
DR   EnsemblGenomes-Tr; EBT00001758799.
DR   EnsemblGenomes-Tr; EBT00001758800.
DR   EnsemblGenomes-Tr; EBT00001758801.
DR   EnsemblGenomes-Tr; EBT00001758802.
DR   EnsemblGenomes-Tr; EBT00001758803.
DR   EnsemblGenomes-Tr; EBT00001758804.
DR   EnsemblGenomes-Tr; EBT00001758805.
DR   EnsemblGenomes-Tr; EBT00001758806.
DR   EnsemblGenomes-Tr; EBT00001758807.
DR   EnsemblGenomes-Tr; EBT00001758808.
DR   EnsemblGenomes-Tr; EBT00001758809.
DR   EnsemblGenomes-Tr; EBT00001758810.
DR   EnsemblGenomes-Tr; EBT00001758811.
DR   EnsemblGenomes-Tr; EBT00001758812.
DR   EnsemblGenomes-Tr; EBT00001758813.
DR   EnsemblGenomes-Tr; EBT00001758814.
DR   EnsemblGenomes-Tr; EBT00001758815.
DR   EnsemblGenomes-Tr; EBT00001758816.
DR   EnsemblGenomes-Tr; EBT00001758817.
DR   EnsemblGenomes-Tr; EBT00001758818.
DR   EnsemblGenomes-Tr; EBT00001758819.
DR   EnsemblGenomes-Tr; EBT00001758820.
DR   EnsemblGenomes-Tr; EBT00001758821.
DR   EnsemblGenomes-Tr; EBT00001758822.
DR   EnsemblGenomes-Tr; EBT00001758823.
DR   EnsemblGenomes-Tr; EBT00001758824.
DR   EnsemblGenomes-Tr; EBT00001758825.
DR   EnsemblGenomes-Tr; EBT00001758826.
DR   EnsemblGenomes-Tr; EBT00001758827.
DR   EnsemblGenomes-Tr; EBT00001758831.
DR   EnsemblGenomes-Tr; EBT00001758832.
DR   EnsemblGenomes-Tr; EBT00001758836.
DR   EnsemblGenomes-Tr; EBT00001758838.
DR   EnsemblGenomes-Tr; EBT00001758841.
DR   EnsemblGenomes-Tr; EBT00001758843.
DR   EnsemblGenomes-Tr; EBT00001758845.
DR   EnsemblGenomes-Tr; EBT00001758851.
DR   EnsemblGenomes-Tr; EBT00001758852.
DR   EnsemblGenomes-Tr; EBT00001758854.
DR   EnsemblGenomes-Tr; EBT00001758857.
DR   EnsemblGenomes-Tr; EBT00001758859.
DR   EnsemblGenomes-Tr; EBT00001758860.
DR   EnsemblGenomes-Tr; EBT00001758863.
DR   EnsemblGenomes-Tr; EBT00001758865.
DR   EnsemblGenomes-Tr; EBT00001758867.
DR   EnsemblGenomes-Tr; EBT00001758869.
DR   EnsemblGenomes-Tr; EBT00001758871.
DR   EnsemblGenomes-Tr; EBT00001758873.
DR   EnsemblGenomes-Tr; EBT00001758874.
DR   EnsemblGenomes-Tr; EBT00001758876.
DR   EnsemblGenomes-Tr; EBT00001758877.
DR   EnsemblGenomes-Tr; EBT00001758880.
DR   EnsemblGenomes-Tr; EBT00001758881.
DR   EnsemblGenomes-Tr; EBT00001758882.
DR   EnsemblGenomes-Tr; EBT00001758885.
DR   EnsemblGenomes-Tr; EBT00001758887.
DR   EnsemblGenomes-Tr; EBT00001758888.
DR   EnsemblGenomes-Tr; Smlt0016.
DR   EnsemblGenomes-Tr; Smlt0041.
DR   EnsemblGenomes-Tr; Smlt0055.
DR   EnsemblGenomes-Tr; Smlt0490A.
DR   EnsemblGenomes-Tr; Smlt1240.
DR   EnsemblGenomes-Tr; Smlt1296.
DR   EnsemblGenomes-Tr; Smlt1297.
DR   EnsemblGenomes-Tr; Smlt1332.
DR   EnsemblGenomes-Tr; Smlt1391.
DR   EnsemblGenomes-Tr; Smlt1395.
DR   EnsemblGenomes-Tr; Smlt1479.
DR   EnsemblGenomes-Tr; Smlt1480.
DR   EnsemblGenomes-Tr; Smlt1481.
DR   EnsemblGenomes-Tr; Smlt1632.
DR   EnsemblGenomes-Tr; Smlt1828.
DR   EnsemblGenomes-Tr; Smlt1977.
DR   EnsemblGenomes-Tr; Smlt2065.
DR   EnsemblGenomes-Tr; Smlt2227.
DR   EnsemblGenomes-Tr; Smlt2407A.
DR   EnsemblGenomes-Tr; Smlt2436.
DR   EnsemblGenomes-Tr; Smlt2437.
DR   EnsemblGenomes-Tr; Smlt2456.
DR   EnsemblGenomes-Tr; Smlt2476.
DR   EnsemblGenomes-Tr; Smlt2878.
DR   EnsemblGenomes-Tr; Smlt3044.
DR   EnsemblGenomes-Tr; Smlt3083A.
DR   EnsemblGenomes-Tr; Smlt3087.
DR   EnsemblGenomes-Tr; Smlt3368.
DR   EnsemblGenomes-Tr; Smlt3421.
DR   EnsemblGenomes-Tr; Smlt3626.
DR   EnsemblGenomes-Tr; Smlt4013.
DR   EnsemblGenomes-Tr; Smlt4033.
DR   EnsemblGenomes-Tr; Smlt4061.
DR   EnsemblGenomes-Tr; Smlt4134.
DR   EnsemblGenomes-Tr; Smlt4136.
DR   EnsemblGenomes-Tr; Smlt4443.
DR   EnsemblGenomes-Tr; Smlt4447A.
DR   EnsemblGenomes-Tr; Smlt4447C.
DR   EnsemblGenomes-Tr; Smlt4450.
DR   EnsemblGenomes-Tr; Smlt4451.
DR   EnsemblGenomes-Tr; Smlt4545.
DR   EnsemblGenomes-Tr; Smlt4547.
DR   EnsemblGenomes-Tr; Smlt4549.
DR   EnsemblGenomes-Tr; Smlt4665.
DR   EuropePMC; PMC2593287; 18842940.
DR   EuropePMC; PMC2607143; 18952876.
DR   EuropePMC; PMC2643945; 18419807.
DR   EuropePMC; PMC2789088; 19941653.
DR   EuropePMC; PMC3105724; 20882057.
DR   EuropePMC; PMC3486118; 22923593.
DR   EuropePMC; PMC3630922; 26038408.
DR   EuropePMC; PMC4005581; 23778655.
DR   EuropePMC; PMC4054175; 24769700.
DR   EuropePMC; PMC4187913; 25092711.
DR   EuropePMC; PMC4260517; 25538701.
DR   EuropePMC; PMC4432800; 26029670.
DR   EuropePMC; PMC4559654; 26388863.
DR   EuropePMC; PMC4960238; 27507963.
DR   EuropePMC; PMC5683369; 29158893.
DR   EuropePMC; PMC5845701; 28984234.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02221; sRNA-Xcc1.
DR   RFAM; RF02223; sX4.
DR   RFAM; RF02224; sX5.
DR   RFAM; RF02230; sX11.
DR   RFAM; RF02232; sX13.
DR   RFAM; RF02234; sX15.
DR   RFAM; RF02235; asX1.
DR   RFAM; RF02240; Xoo1.
DR   RFAM; RF02242; Xoo5.
DR   RFAM; RF02243; Xoo8.
DR   SILVA-LSU; AM743169.
DR   SILVA-SSU; AM743169.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4851126
FT                   /organism="Stenotrophomonas maltophilia K279a"
FT                   /strain="K279a"
FT                   /mol_type="genomic DNA"
FT                   /country="United Kingdom"
FT                   /db_xref="taxon:522373"
FT   CDS_pept        1..1332
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="Smlt0001"
FT                   /product="putative chromosomal replication initiator
FT                   protein DnaA"
FT                   /note="similarity:fasta; with=UniProt:P03004; Escherichia
FT                   coli.; dnaA; Chromosomal replication initiator protein
FT                   dnaA.; length=467; id 56.250%; ungapped id 59.559%;
FT                   E()=9.6e-78; 432 aa overlap; query 2-410; subject 36-466"
FT                   /note="similarity:fasta; with=UniProt:Q8PRG2; Xanthomonas
FT                   axonopodis pv. citri.; dnaA; Chromosomal replication
FT                   initiator protein dnaA.; length=442; id 89.512%; ungapped
FT                   id 89.731%; E()=2.2e-133; 410 aa overlap; query 2-411;
FT                   subject 34-442"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAN85568"
FT                   /db_xref="GOA:B2FUW1"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2FUW1"
FT                   /protein_id="CAN85568.1"
FT                   /translation="MDAWSRSLERLEAEFPPEDVHTWLKPLQADLRVDSLVLYAPNAFI
FT                   VDQVRELYLARIRELLAHFAGFSDVFLEIGSRPRPVEAQNAPVSTPSAHVSSEPQVPFA
FT                   GNLDNHYTFANFVEGRSNQLGLAAAFQAAQKPGDRAHNPLLLYGGTGLGKTHLMFAAGN
FT                   AMRQANPGAKVLYLRSEQFFSAMIRALQEKTMDQFKRQFQQVDALLIDDIQFFAGKDRT
FT                   QEEFFHTFNALFDGKQQIILTCDRYPREVEGLEARLKSRLAWGLSVAIEPPDFETRAAI
FT                   VLAKARERGAEIPDDVAFLIAKKMRSNVRDLEGALNTLTARANFTGRAITTEFAQETLR
FT                   DLLRAQQQAISIPNIQKTVADYYGLQIKDLLSKRRTRSLARPRQVAMALTKELTEHSLP
FT                   EIGDAFAGRDHTTVLHACRQIRTLMETDGKLREDWDKLIRKLSE"
FT   misc_feature    319..978
FT                   /gene="dnaA"
FT                   /locus_tag="Smlt0001"
FT                   /note="HMMPfam hit to PF00308, Bacterial dnaA protein,
FT                   score 4.9e-120"
FT                   /inference="protein motif:HMMPfam:PF00308"
FT   misc_feature    1051..1260
FT                   /gene="dnaA"
FT                   /locus_tag="Smlt0001"
FT                   /note="HMMPfam hit to PF08299, Bacterial dnaA protein
FT                   helix-turn-helix, score 1.3e-41"
FT                   /inference="protein motif:HMMPfam:PF08299"
FT   CDS_pept        1608..2708
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="Smlt0002"
FT                   /product="putative DNA polymerase III beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="similarity:fasta; with=UniProt:P0A988
FT                   (EMBL:J01602;); Escherichia coli.; dnaN; DNA polymerase III
FT                   subunit beta (EC 2.7.7.7).; length=366; id 50.678%;
FT                   ungapped id 51.515%; E()=6.2e-62; 369 aa overlap; query
FT                   1-366; subject 1-366"
FT                   /note="similarity:fasta; with=UniProt:Q3BZT0
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; dnaN; DNA polymerase III beta chain (EC
FT                   2.7.7.7).; length=366; id 89.344%; ungapped id 89.344%;
FT                   E()=1.7e-110; 366 aa overlap; query 1-366; subject 1-366"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43620"
FT                   /db_xref="GOA:B2FT80"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B2FT80"
FT                   /protein_id="CAQ43620.1"
FT                   /translation="MRFTLQREAFLKPLAQVVNVVERRQTLPVLANFLVQVQNGQLSLT
FT                   GTDLEVEMVSRIAVEDAQDGETTIPARKLFEIIRALPDGSRITVSQTGDKITVQAGRSR
FT                   FTLATLPSNDFPSVDEVEATERVAIGEATLKELIERTAFAMAQQDVRYYLNGLLFDLRG
FT                   DALRTVATDGHRLALCETDLAKPSGSKRQIIVPRKGVTELQRLLESGDREIELEVGRSH
FT                   VRVKRDDVTFTSKLIDGRFPDYEAVIPIGADREVKVDREALRASLQRAAILSNEKYRGI
FT                   RVEVSPGNLKISAHNPEQEEAQEEIEADTTVSDLAIGFNVNYLLDALSALRDEEVIIQL
FT                   RDSNSSALVRESSSEKSRHVVMPLRL"
FT   misc_feature    1608..1964
FT                   /gene="dnaN"
FT                   /locus_tag="Smlt0002"
FT                   /note="HMMPfam hit to PF00712, DNA polymerase III beta
FT                   subunit, N-te, score 1.2e-54"
FT                   /inference="protein motif:HMMPfam:PF00712"
FT   misc_feature    1989..2336
FT                   /gene="dnaN"
FT                   /locus_tag="Smlt0002"
FT                   /note="HMMPfam hit to PF02767, DNA polymerase III beta
FT                   subunit, cent, score 1.3e-50"
FT                   /inference="protein motif:HMMPfam:PF02767"
FT   misc_feature    2340..2702
FT                   /gene="dnaN"
FT                   /locus_tag="Smlt0002"
FT                   /note="HMMPfam hit to PF02768, DNA polymerase III beta
FT                   subunit, C-te, score 1e-40"
FT                   /inference="protein motif:HMMPfam:PF02768"
FT   misc_feature    2717..2728
FT                   /note="tgttccacgtgg"
FT   misc_feature    2718..2731
FT                   /note="gttccacgtggaac"
FT   misc_feature    complement(2718..2731)
FT                   /note="gttccacgtggaac"
FT   misc_feature    complement(2718..2729)
FT                   /note="tccacgtggaac"
FT   misc_feature    2720..2732
FT                   /note="tccacgtggaacc"
FT   misc_feature    2720..2731
FT                   /note="tccacgtggaac"
FT   repeat_region   2760..2768
FT                   /rpt_unit_seq="(t)9"
FT   misc_feature    complement(2772..2784)
FT                   /note="tccacgtggaacc"
FT   misc_feature    complement(2773..2784)
FT                   /note="tccacgtggaac"
FT   CDS_pept        complement(2957..3274)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0003"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43621"
FT                   /db_xref="UniProtKB/TrEMBL:B2FT81"
FT                   /protein_id="CAQ43621.1"
FT                   /translation="MDKKALLPDLPNYPQVPPQPEGPLYRGFQLHKSLENQLDNAFFHE
FT                   IWAHHHHHALDLYPDLEARPALIRPQPTLWTVTSADEATTAIADAIRFIHPTRSGHPQS
FT                   G"
FT   misc_feature    complement(3560..3571)
FT                   /note="tgttccacgtgg"
FT   CDS_pept        3704..4798
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /gene_synonym="uvrF"
FT                   /locus_tag="Smlt0004"
FT                   /product="putative DNA replication and repair protein RecF"
FT                   /note="similarity:fasta; with=UniProt:P0A7H0
FT                   (EMBL:K02179;); Escherichia coli.; recF; DNA replication
FT                   and repair protein recF.; length=356; id 34.072%; ungapped
FT                   id 35.143%; E()=4.6e-32; 361 aa overlap; query 3-360;
FT                   subject 2-354"
FT                   /note="similarity:fasta; with=UniProt:Q8PEH3
FT                   (EMBL:AE012093;); Xanthomonas campestris pv. campestris.;
FT                   recF; DNA replication and repair protein recF.; length=368;
FT                   id 73.757%; ungapped id 73.961%; E()=1.4e-104; 362 aa
FT                   overlap; query 1-361; subject 1-362"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43622"
FT                   /db_xref="GOA:B2FT82"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2FT82"
FT                   /protein_id="CAQ43622.1"
FT                   /translation="MLIRRLALHQLRRFSAVDLSPQPGLNLLTGDNGAGKTSVLEALHL
FT                   MAYGRSFRGRVRDGLVRQGQEALEIFVEWDEQRADHPPHRRKAGLRHSGQDWKGRLDGE
FT                   DVAQLGNLCAALAVVTFEPGSHALVSGGGEPRRRFLDWGLFHVEPDFLSLWRRYSRALK
FT                   QRNALLKQGGPSRMLDTWDHELAEAGEPLTSRRQHYLERLQQRTVALAASLAPQLGIQG
FT                   LELSPGWRRHELPLADALLLARERDRQAGYTSVGPHRADWSVDFHSIPGRDALSRGQAK
FT                   LTALACLLAQAEDYAEQRGEWPVIALDDLASELDRTHQARVLERLLNGPAQIFITATET
FT                   PAALLDLTHIARFHVEHAQIVAVP"
FT   misc_feature    3707..4786
FT                   /gene="recF"
FT                   /locus_tag="Smlt0004"
FT                   /note="HMMPfam hit to PF02463, RecF/RecN/SMC N terminal
FT                   domain, score 4e-08"
FT                   /inference="protein motif:HMMPfam:PF02463"
FT   repeat_region   4094..4101
FT                   /rpt_unit_seq="(g)8"
FT   misc_feature    4134..4145
FT                   /note="tgttccacgtgg"
FT   misc_feature    4135..4148
FT                   /note="gttccacgtggaac"
FT   misc_feature    complement(4135..4148)
FT                   /note="gttccacgtggaac"
FT   misc_feature    complement(4135..4146)
FT                   /note="tccacgtggaac"
FT   misc_feature    4137..4149
FT                   /note="tccacgtggaacc"
FT   misc_feature    4137..4148
FT                   /note="tccacgtggaac"
FT   misc_feature    complement(4758..4770)
FT                   /note="tccacgtggaacc"
FT   misc_feature    4759..4772
FT                   /note="gttccacgtggaac"
FT   misc_feature    complement(4759..4772)
FT                   /note="gttccacgtggaac"
FT   misc_feature    complement(4759..4770)
FT                   /note="tccacgtggaac"
FT   misc_feature    4761..4772
FT                   /note="tccacgtggaac"
FT   misc_feature    complement(4762..4773)
FT                   /note="tgttccacgtgg"
FT   CDS_pept        4911..7370
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="Smlt0005"
FT                   /product="putative DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="similarity:fasta; with=UniProt:P0AES6
FT                   (EMBL:D87842;); Escherichia coli.; gyrB; DNA gyrase subunit
FT                   B (EC 5.99.1.3).; length=803; id 61.084%; ungapped id
FT                   62.000%; E()=1.4e-185; 812 aa overlap; query 11-819;
FT                   subject 1-803"
FT                   /note="similarity:fasta; with=UniProt:Q8PEH2
FT                   (EMBL:AE012093;); Xanthomonas campestris pv. campestris.;
FT                   gyrB; DNA gyrase subunit B.; length=814; id 80.512%;
FT                   ungapped id 81.404%; E()=0; 821 aa overlap; query 1-819;
FT                   subject 1-814"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43623"
FT                   /db_xref="GOA:B2FT83"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:B2FT83"
FT                   /protein_id="CAQ43623.1"
FT                   /translation="MSDEQNTPANNGNYDANSITALEGLEAVRKRPGMYIGDVHDGTGL
FT                   HHMVFEVVDNSIDEALAGHADHVAVTIHADGSVSVSDNGRGIPTGKHEQMSAKLGREVS
FT                   AAEVVMTVLHAGGKFDDNSYKVSGGLHGVGVSVVNALSQKLLVDVFQNGFHYQQEFSNG
FT                   AAVTALAKLETTTKRGTTVRFWPSTVAFHDNVEFHYDILARRLRELSFLNSGVKIVLAD
FT                   ERGDGRRDDFHYEGGIRSFVEHLAQLKTPLHPNVISVTGEHNGIVVDVALQWTDSYQET
FT                   MYCFTNNIPQKDGGTHLAGFRGALTRVLNNYIEQNGIAKQAKINLTGDDMREGMIAVLS
FT                   VKVPDPSFSSQTKEKLVSSDVRPAVENAFGARLEEFLQENPNEAKAIAGKIVDAARARE
FT                   AARKARDLTRRKGALDIAGLPGKLADCQEKDPALSELFIVEGDSAGGSAKQGRNRKNQA
FT                   VLPLRGKILNVERARFDRMLSSDQVGTLITALGTGIGRDEYNPDKLRYHKIIIMTDADV
FT                   DGAHIRTLLLTFFYRQMPELIERGYVYIGLPPLYKIKQGKQELYLKDDPALDSYLASSA
FT                   VENAALVPATGEPGIEGLALEKLLLAYAAALDSIERNAHRYDRNLLEALVDFVPMDLES
FT                   LRAAGEGEGLDALAKRLNQGSLGSPRFTLELQEANDERPAAVLVTRRHMGEQHIQVLPM
FT                   SAFESGELRAIHQASKLLHGLVREGATISRGAKSIEVDSFAKAQNWLLEEAKRGRQIQR
FT                   FKGLGEMNPEQLWDTTVNPETRRLLQVRIEDAVAADQIFSTLMGDVVEPRRDFIEDNAL
FT                   KVANLDI"
FT   misc_feature    5028..5477
FT                   /gene="gyrB"
FT                   /locus_tag="Smlt0005"
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and H, score 1.5e-28"
FT                   /inference="protein motif:HMMPfam:PF02518"
FT   misc_feature    5619..6131
FT                   /gene="gyrB"
FT                   /locus_tag="Smlt0005"
FT                   /note="HMMPfam hit to PF00204, DNA gyrase B, score 5.7e-87"
FT                   /inference="protein motif:HMMPfam:PF00204"
FT   repeat_region   6092..6099
FT                   /rpt_unit_seq="(cg)4"
FT   misc_feature    6210..6548
FT                   /gene="gyrB"
FT                   /locus_tag="Smlt0005"
FT                   /note="HMMPfam hit to PF01751, Toprim domain, score
FT                   6.9e-06"
FT                   /inference="protein motif:HMMPfam:PF01751"
FT   repeat_region   6321..6328
FT                   /rpt_unit_seq="(cg)4"
FT   misc_feature    7137..7334
FT                   /gene="gyrB"
FT                   /locus_tag="Smlt0005"
FT                   /note="HMMPfam hit to PF00986, DNA gyrase B subunit,
FT                   carboxyl terminus, score 6.2e-44"
FT                   /inference="protein motif:HMMPfam:PF00986"
FT   repeat_region   complement(7384..7412)
FT                   /rpt_family="GC_rich"
FT                   /inference="nucleotide motif:RepeatScout"
FT   CDS_pept        7438..8283
FT                   /transl_table=11
FT                   /locus_tag="Smlt0006"
FT                   /product="putative transmembrane protease"
FT                   /note="similarity:fasta; with=UniProt:Q3BZS7
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; Putative membrane protease.; length=278;
FT                   id 58.088%; ungapped id 58.955%; E()=1.3e-50; 272 aa
FT                   overlap; query 10-279; subject 7-276"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43624"
FT                   /db_xref="GOA:B2FT84"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:B2FT84"
FT                   /protein_id="CAQ43624.1"
FT                   /translation="MSASAPVSAPPPVPPASAAPRAVSPLAGFFIDLGIAAVTLFGLSL
FT                   VSGLLWGLYRGVVVGYANAQAGAGAPDASSVAASLGQPGALAQILMALFATGGAALLLY
FT                   FWRRPANAAERHASRQALRRPSTWGWTLLVATLIVLGSNGIAFLAKQVGVEPVPTNLAL
FT                   MQSAIARFPLFLVLFAVVLAPAYEELLFRRVLFGRLWQAGRPGLGVVLSSLAFALIHEI
FT                   PGTSANGPAEIAQLWLVYGGMGAAFCWLYRRTGTLWAAVTAHALNNAVALAAMVFLGST
FT                   "
FT   sig_peptide     7438..7491
FT                   /locus_tag="Smlt0006"
FT                   /note="Signal peptide predicted for Smlt0006 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.656) with cleavage site
FT                   probability 0.651 between residues 18 and 19"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(7522..7590,7687..7755,7816..7884,7927..7995,
FT                   8053..8106,8134..8187,8206..8274)
FT                   /locus_tag="Smlt0006"
FT                   /note="7 probable transmembrane helices predicted for
FT                   Smlt0006 by TMHMM2.0 at aa 29-51, 84-106, 127-149, 164-186,
FT                   206-223, 233-250 and 257-279"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    7957..8262
FT                   /locus_tag="Smlt0006"
FT                   /note="HMMPfam hit to PF02517, CAAX amino terminal protease
FT                   family, score 1.2e-14"
FT                   /inference="protein motif:HMMPfam:PF02517"
FT   CDS_pept        8355..9161
FT                   /transl_table=11
FT                   /locus_tag="Smlt0007"
FT                   /product="putative peptidase"
FT                   /note="similarity:fasta; with=UniProt:Q8PRF7
FT                   (EMBL:AE011623;); Xanthomonas axonopodis pv. citri.;
FT                   Hypothetical protein XAC0006.; length=268; id 79.104%;
FT                   ungapped id 79.104%; E()=3.4e-79; 268 aa overlap; query
FT                   1-268; subject 1-268"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43625"
FT                   /db_xref="GOA:B2FT85"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:B2FT85"
FT                   /protein_id="CAQ43625.1"
FT                   /translation="MKQLLLALVITTLVSACATTTSPTGRRQMVGGVSQAQLDQLGAQA
FT                   FAETKQKEKISTDGRQNGYVQCVVNALVAQLPAQYRGVRWETAVFVDKEPNAFALPGGK
FT                   VGVNTGIFTVAKNQDQLAAVIGHEIGHVIARHHEERITRQMGAQTGLAVLGALAGAAYG
FT                   EGAASTVNQLGGMGAQTAFLLPGSRTQESEADVIGQRLMAQAGFNPAQAVDLWQNMMAA
FT                   SGGRSPQWLSTHPDPANRIQELRRDAPGLTPVYQQAQAAGLRPKCG"
FT   sig_peptide     8355..8408
FT                   /locus_tag="Smlt0007"
FT                   /note="Signal peptide predicted for Smlt0007 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.325 between residues 18 and 19"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    8556..9101
FT                   /locus_tag="Smlt0007"
FT                   /note="HMMPfam hit to PF01435, Peptidase family M48, score
FT                   6.5e-45"
FT                   /inference="protein motif:HMMPfam:PF01435"
FT   CDS_pept        9294..10481
FT                   /transl_table=11
FT                   /locus_tag="Smlt0008"
FT                   /product="conserved hypothetical TPR repeat family protein"
FT                   /note="similarity:fasta; with=UniProt:Q8PRF6
FT                   (EMBL:AE011623;); Xanthomonas axonopodis pv. citri.;
FT                   Hypothetical protein XAC0007.; length=397; id 74.937%;
FT                   ungapped id 75.127%; E()=3.3e-102; 395 aa overlap; query
FT                   2-395; subject 3-397"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43626"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B2FT86"
FT                   /protein_id="CAQ43626.1"
FT                   /translation="MIFRNHKAVLSVLVATALTGAVVTDAFAQSSRSSERGNRGGKQAK
FT                   AEALYPNATRQEPTVKASAKMGSKLQKMIDSYNKEKFPETRTQADAILADSAANEYDKS
FT                   LAAQLASQAAYQTDDAPAAIAYLKQVLQFNGLDNNGHFQSMLMLGQLQLQEDQTAEGLA
FT                   TLDKYFAESKSTKPEELIAKGQALYQLERYQEAIPVLKQAIAGSAEPKDNWNQLLMAAL
FT                   SEAGQSGEAVKEAEALAAKNPNDKKAQLNLASMYMQADQMDKAAAVMDKLRSSGQLTEE
FT                   REYKQLYSIYANTDKKEKDVIAVINEGLQKGILKPDYQVYLALAQSYYYSDQVPQAIDA
FT                   WQKAAPLSKDGETYLNLARVLHAEGRIPEAKQAAQQALAKGVKNQADAKKIINLK"
FT   sig_peptide     9294..9377
FT                   /locus_tag="Smlt0008"
FT                   /note="Signal peptide predicted for Smlt0008 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.702 between residues 28 and 29"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    9822..9923
FT                   /locus_tag="Smlt0008"
FT                   /note="HMMPfam hit to PF00515, Tetratricopeptide repeat,
FT                   score 0.083"
FT                   /inference="protein motif:HMMPfam:PF00515"
FT   misc_feature    10245..10346
FT                   /locus_tag="Smlt0008"
FT                   /note="HMMPfam hit to PF00515, Tetratricopeptide repeat,
FT                   score 0.25"
FT                   /inference="protein motif:HMMPfam:PF00515"
FT   misc_feature    10344..10421
FT                   /locus_tag="Smlt0008"
FT                   /note="HMMPfam hit to PF07721, Tetratricopeptide repeat,
FT                   score 0.0011"
FT                   /inference="protein motif:HMMPfam:PF07721"
FT   CDS_pept        10625..11293
FT                   /transl_table=11
FT                   /locus_tag="Smlt0009"
FT                   /product="putative proline-rich TonB dependent receptor
FT                   protein"
FT                   /note="similarity:fasta; with=UniProt:Q9RMT3
FT                   (EMBL:AE004458;); Pseudomonas aeruginosa.; tonB2; TonB2
FT                   (Hypothetical protein).; length=270; id 36.986%; ungapped
FT                   id 40.500%; E()=1.2e-17; 219 aa overlap; query 23-222;
FT                   subject 52-270"
FT                   /note="similarity:fasta; with=UniProt:O34261
FT                   (EMBL:AE012094;); Xanthomonas campestris pv. campestris.;
FT                   tonB; Protein tonB.; length=223; id 83.856%; ungapped id
FT                   84.234%; E()=1e-67; 223 aa overlap; query 1-222; subject
FT                   1-223"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43627"
FT                   /db_xref="GOA:B2FT87"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:B2FT87"
FT                   /protein_id="CAQ43627.1"
FT                   /translation="MTEQLVVHRYEQPDDKGLSWPRIVGIAFVIALHLAAFMMLLIPAV
FT                   APKAVAEKERNVMVTIVDAPPPPPPPPPPPPPTDTPPPPVKNLSPPKPSPVPPPPQAPV
FT                   VDVPEPRPSDIVTPPSPPAPPAPATSIEASVDISSKAMNPPRYPPAAFRAGIQGEVILI
FT                   IDVDANGNVTNVTVEKSSRNRDLDRAAMEAARKWRFNAAESGGKKAAGRVRVPVNFALN
FT                   "
FT   misc_feature    10691..10759
FT                   /locus_tag="Smlt0009"
FT                   /note="1 probable transmembrane helix predicted for
FT                   Smlt0009 by TMHMM2.0 at aa 23-45"
FT                   /inference="protein motif:TMHMM:2.0"
FT   repeat_region   complement(10815..10933)
FT                   /rpt_family="(CGG)n"
FT                   /inference="nucleotide motif:RepeatScout"
FT   repeat_region   10815..10829
FT                   /rpt_unit_seq="(cgc)5"
FT   repeat_region   10832..10855
FT                   /rpt_unit_seq="(ccg)8"
FT   repeat_region   10865..10876
FT                   /rpt_unit_seq="(ccg)4"
FT   repeat_region   10913..10924
FT                   /rpt_unit_seq="(ccg)4"
FT   repeat_region   10974..11001
FT                   /rpt_family="GC_rich"
FT                   /inference="nucleotide motif:RepeatScout"
FT   misc_feature    11054..11158
FT                   /locus_tag="Smlt0009"
FT                   /note="HMMPfam hit to PF03544, Gram-negative bacterial tonB
FT                   protein, score 1.5e-14"
FT                   /inference="protein motif:HMMPfam:PF03544"
FT   repeat_region   11365..11372
FT                   /rpt_unit_seq="(ca)4"
FT   CDS_pept        11388..12149
FT                   /transl_table=11
FT                   /gene="exbB1"
FT                   /locus_tag="Smlt0010"
FT                   /product="putative biopolymer transport exbB protein"
FT                   /note="similarity:fasta; with=UniProt:O34260
FT                   (EMBL:AE012094;); Xanthomonas campestris pv. campestris.;
FT                   exbB; Biopolymer transport exbB protein.; length=253; id
FT                   91.339%; ungapped id 92.063%; E()=5.2e-80; 254 aa overlap;
FT                   query 1-253; subject 1-253"
FT                   /note="similarity:fasta; with=UniProt:Q8PRF4
FT                   (EMBL:AE011624;); Xanthomonas axonopodis pv. citri.; exbB;
FT                   Biopolymer transport ExbB protein.; length=253; id 91.732%;
FT                   ungapped id 92.460%; E()=1.5e-80; 254 aa overlap; query
FT                   1-253; subject 1-253"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43628"
FT                   /db_xref="GOA:B2FT88"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:B2FT88"
FT                   /protein_id="CAQ43628.1"
FT                   /translation="MLQEIFIAAAAGGNPSNALSQMGFEHLIHEMTTKPGDFAVSWVVL
FT                   LTLIAMSAMSWYWTVINIFRATRLKSAADRVVSLFWDTPNAQDAIRAMEEQPASEPFSK
FT                   IALDAAQAAAHHQRAEGGATGGVGENLSRSEFVDRALRQAVTRESNKLQSGMTLLATVG
FT                   ATAPFVGLLGTVWGIYGALIKIGATGSASIDAVAGPVGEALIMTAIGLFVAIPAVFAFN
FT                   FFSKINSATISKFDTFAHDLHDFFATGSRVR"
FT   sig_peptide     11388..11447
FT                   /gene="exbB1"
FT                   /locus_tag="Smlt0010"
FT                   /note="Signal peptide predicted for Smlt0010 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.732) with cleavage site
FT                   probability 0.564 between residues 20 and 21"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(11499..11567,11868..11936,11994..12062)
FT                   /gene="exbB1"
FT                   /locus_tag="Smlt0010"
FT                   /note="3 probable transmembrane helices predicted for
FT                   Smlt0010 by TMHMM2.0 at aa 38-60, 161-183 and 203-225"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    11682..12107
FT                   /gene="exbB1"
FT                   /locus_tag="Smlt0010"
FT                   /note="HMMPfam hit to PF01618, MotA/TolQ/ExbB proton
FT                   channel family, score 2.1e-57"
FT                   /inference="protein motif:HMMPfam:PF01618"
FT   CDS_pept        12212..12637
FT                   /transl_table=11
FT                   /gene="exbD1"
FT                   /locus_tag="Smlt0011"
FT                   /product="putative biopolymer transport ExbD1 protein"
FT                   /note="similarity:fasta; with=UniProt:O34259
FT                   (EMBL:AE012094); Xanthomonas campestris pv. campestris.;
FT                   exbD1; Biopolymer transport exbD1 protein.; length=140; id
FT                   89.362%; ungapped id 90.000%; E()=8.1e-45; 141 aa overlap;
FT                   query 1-141; subject 1-140"
FT                   /note="similarity:fasta; with=UniProt:Q4V0R9
FT                   (EMBL:CP000050); Xanthomonas campestris pv. campestris
FT                   (strain 8004).; Biopolymer transport ExbD1 protein.;
FT                   length=140; id 89.362%; ungapped id 90.000%; E()=8.1e-45;
FT                   141 aa overlap; query 1-141; subject 1-140"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43629"
FT                   /db_xref="GOA:B2FT89"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:B2FT89"
FT                   /protein_id="CAQ43629.1"
FT                   /translation="MAFSSGNSGGPMADINVTPLVDVMLVLLIIFIITAPLMSHKVKVD
FT                   LPEANLIQKPEDAEKRSGPITLAVKEDGSIYWNDEEINKQTLESRLATAAQQTPQPPLN
FT                   LRGDRTTKMRVINDLTKVAQEQGMLDVGFVATKEKGQ"
FT   misc_feature    12233..12625
FT                   /gene="exbD1"
FT                   /locus_tag="Smlt0011"
FT                   /note="HMMPfam hit to PF02472, Biopolymer transport protein
FT                   ExbD/TolR, score 7.4e-15"
FT                   /inference="protein motif:HMMPfam:PF02472"
FT   misc_feature    12254..12322
FT                   /gene="exbD1"
FT                   /locus_tag="Smlt0011"
FT                   /note="1 probable transmembrane helix predicted for
FT                   Smlt0011 by TMHMM2.0 at aa 15-37"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        12641..13054
FT                   /transl_table=11
FT                   /gene="exbD2"
FT                   /locus_tag="Smlt0012"
FT                   /product="putative biopolymer transport ExbD2 protein"
FT                   /note="similarity:fasta; with=UniProt:O34258; Xanthomonas
FT                   campestris pv. campestris.; exbD2; Biopolymer transport
FT                   exbD2 protein.; length=136; id 83.824%; ungapped id
FT                   83.824%; E()=7.2e-38; 136 aa overlap; query 1-136; subject
FT                   1-136"
FT                   /note="similarity:fasta; with=UniProt:Q8PRF2; Xanthomonas
FT                   axonopodis pv. citri.; exbD2; Biopolymer transport ExbD2
FT                   protein.; length=137; id 84.672%; ungapped id 84.672%;
FT                   E()=1.5e-38; 137 aa overlap; query 1-137; subject 1-137"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43630"
FT                   /db_xref="GOA:B2FT90"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:B2FT90"
FT                   /protein_id="CAQ43630.1"
FT                   /translation="MAFSSGGGKGPMADINVTPLVDVMLVLLIIFIVTAPIMTYPIAVD
FT                   LPQRVLNPPPQLVEPPPPIELKIDASNQVSWNNSPINTSELQQRMEQEVQRDPTNQPEL
FT                   RIDASPDSEYDVMAKVLAAAKNAQMKKIGFVQQ"
FT   misc_feature    12662..13051
FT                   /gene="exbD2"
FT                   /locus_tag="Smlt0012"
FT                   /note="HMMPfam hit to PF02472, Biopolymer transport protein
FT                   ExbD/TolR, score 2.9e-05"
FT                   /inference="protein motif:HMMPfam:PF02472"
FT   misc_feature    12698..12766
FT                   /gene="exbD2"
FT                   /locus_tag="Smlt0012"
FT                   /note="1 probable transmembrane helix predicted for
FT                   Smlt0012 by TMHMM2.0 at aa 20-42"
FT                   /inference="protein motif:TMHMM:2.0"
FT   repeat_region   12818..12829
FT                   /rpt_unit_seq="(ccg)4"
FT   repeat_region   13115..13123
FT                   /rpt_unit_seq="(t)9"
FT   CDS_pept        13157..14617
FT                   /transl_table=11
FT                   /gene="cls"
FT                   /locus_tag="Smlt0013"
FT                   /product="putative cardiolipin synthetase"
FT                   /EC_number="2.7.8.-"
FT                   /note="similarity:fasta; with=UniProt:P45860; Bacillus
FT                   subtilis.; ywiE; Probable cardiolipin synthetase 1 (EC
FT                   2.7.8.-) (Cardiolipin synthase 1) (CL synthase 1).;
FT                   length=500; id 32.724%; ungapped id 34.773%; E()=3.1e-47;
FT                   492 aa overlap; query 37-512; subject 22-500"
FT                   /note="similarity:fasta; with=UniProt:Q8PRE9; Xanthomonas
FT                   axonopodis pv. citri.; cls; Cardiolipin synthetase.;
FT                   length=486; id 72.840%; ungapped id 72.840%; E()=2.3e-144;
FT                   486 aa overlap; query 27-512; subject 1-486"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43631"
FT                   /db_xref="GOA:B2FT91"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR022924"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:B2FT91"
FT                   /protein_id="CAQ43631.1"
FT                   /translation="MLALFDSLRHWLDGIAHLGSILAVAYLLYLFALAGWIMLQKREPV
FT                   ATLSWILSLALLPYLGLFIYYLLGPQKVKRQRLRRGRARSGMEHYSDVCPPDADCTELA
FT                   KIAQATTGLAPSSATEVTWLVDGAATYAALLEAVAQARDHVHLEYYIFNPDHAGTALRD
FT                   ALVERARAGVQVRLLLDAVGSSALPRRFLQPLIDAGGEAVWFHPRQLLKPFKRPWLNLR
FT                   THRKLVIVDGRLAFTGGINITDDEDESRKPNAYRDLHMRIRGHVVRSLQLVFAEDWLYA
FT                   SGQDPSRMDIARLWPADMPLRGDGAINAQVLVSGPDSGWETIHRLHVAAIQEAHERVWL
FT                   VTPYFVPGEAARMALTSAALGGLDVRLLVPKMSDSWFVTQAARSYFDELLHAGVKIYEY
FT                   GPRMLHTKAFIADDDVCIVGSANFDHRSFRLNFELSMMISDRDRVAALAGLLQGEFDRA
FT                   TRVHDQAGRSLWLHRLPEAFARLASPLL"
FT   misc_feature    order(13199..13267,13304..13363)
FT                   /gene="cls"
FT                   /locus_tag="Smlt0013"
FT                   /note="2 probable transmembrane helices predicted for
FT                   Smlt0013 by TMHMM2.0 at aa 15-37 and 50-69"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    13811..13894
FT                   /gene="cls"
FT                   /locus_tag="Smlt0013"
FT                   /note="HMMPfam hit to PF00614, Phospholipase D Active site
FT                   motif, score 3.9e-06"
FT                   /inference="protein motif:HMMPfam:PF00614"
FT   misc_feature    14354..14437
FT                   /gene="cls"
FT                   /locus_tag="Smlt0013"
FT                   /note="HMMPfam hit to PF00614, Phospholipase D Active site
FT                   motif, score 1.9e-06"
FT                   /inference="protein motif:HMMPfam:PF00614"
FT   CDS_pept        14658..14927
FT                   /transl_table=11
FT                   /locus_tag="Smlt0014"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q8PEG7; Xanthomonas
FT                   campestris pv. campestris.; Hypothetical protein XCC0013.;
FT                   length=89; id 49.425%; ungapped id 51.190%; E()=3.7e-12; 87
FT                   aa overlap; query 1-84; subject 1-87"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43632"
FT                   /db_xref="GOA:B2FT92"
FT                   /db_xref="UniProtKB/TrEMBL:B2FT92"
FT                   /protein_id="CAQ43632.1"
FT                   /translation="MYWLYLLLALGCFAFALKTPSAALMTLCLLAALAFLLAWVRGRYV
FT                   ARFGDLQRDPATLVDAEELRRLREQAQARRNADANDHDPSPLSK"
FT   sig_peptide     14658..14759
FT                   /locus_tag="Smlt0014"
FT                   /note="Signal peptide predicted for Smlt0014 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.993) with cleavage site
FT                   probability 0.328 between residues 34 and 35"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    14715..14783
FT                   /locus_tag="Smlt0014"
FT                   /note="1 probable transmembrane helix predicted for
FT                   Smlt0014 by TMHMM2.0 at aa 20-42"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        14937..15680
FT                   /transl_table=11
FT                   /locus_tag="Smlt0015"
FT                   /product="putative pyridoxal phosphate biosynthetic
FT                   protein"
FT                   /note="similarity:fasta; with=UniProt:O69158;
FT                   Bradyrhizobium japonicum.; pdxJ; Pyridoxal phosphate
FT                   biosynthetic protein pdxJ (PNP synthase).; length=250; id
FT                   36.694%; ungapped id 38.889%; E()=6.3e-11; 248 aa overlap;
FT                   query 3-247; subject 7-243"
FT                   /note="similarity:fasta; with=UniProt:Q8PEG8; Xanthomonas
FT                   campestris pv. campestris.; pdxJ; Pyridoxal phosphate
FT                   biosynthetic protein pdxJ (PNP synthase).; length=256; id
FT                   76.016%; ungapped id 76.016%; E()=9.3e-68; 246 aa overlap;
FT                   query 2-247; subject 3-248"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43633"
FT                   /db_xref="GOA:B2FT93"
FT                   /db_xref="InterPro:IPR004569"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036130"
FT                   /db_xref="UniProtKB/TrEMBL:B2FT93"
FT                   /protein_id="CAQ43633.1"
FT                   /translation="MTQLSVNVNKIAVLRNSRGGAEPDVVRAAQACLDAGAHGITVHPR
FT                   PDRRHITAEDVLALSTLTRARGVEFNIEGNPFAPPREGYPGLLPLCAQTRPAQATLVPD
FT                   GDGQITSDHGFDFERDAERLRPLVAELKAMGCRVSLFVDAGNPLLEQAAEVGADRVELY
FT                   TGPYAEAHAAGDAAAMLELFATAARRAQAMGLGVNAGHDLSQDNLRDFLAHVPDVLEVS
FT                   IGHALIGEALYDGLDATVRGYLALL"
FT   misc_feature    14940..15677
FT                   /locus_tag="Smlt0015"
FT                   /note="HMMPfam hit to PF03740, Pyridoxal phosphate
FT                   biosynthesis protein Pdx, score 1.7e-120"
FT                   /inference="protein motif:HMMPfam:PF03740"
FT   repeat_region   15126..15133
FT                   /rpt_unit_seq="(cg)4"
FT   CDS_pept        15782..16033
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="Smlt0016"
FT                   /product="conserved hypothetical protein, pseudogene"
FT                   /note="Similar to N-terminus to codon 80 of Xanthomonas
FT                   campestris pv. campestris hypothetical protein xcc0015.
FT                   UniProt:Q8PEG5 (364 aa) fasta scores: E()=4.4e-22, 75.949%
FT                   id in 79 aa"
FT                   /note="similarity:fasta; with=UniProt:Q8PEG5; Xanthomonas
FT                   campestris pv. campestris.; Hypothetical protein XCC0015.;
FT                   length=364; id 75.949%; ungapped id 75.949%; E()=4.4e-22;
FT                   79 aa overlap; query 1-79; subject 1-79"
FT                   /db_xref="PSEUDO:CAQ43634.1"
FT   CDS_pept        complement(16178..16402)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0017"
FT                   /product="putative DNA-binding protein"
FT                   /note="similarity:fasta; with=UniProt:Q52622; Proteus
FT                   vulgaris.; pvuIIC;; PvuIIC. PvuIIC.; length=84; id 40.000%;
FT                   ungapped id 40.000%; E()=1.1e-05; 60 aa overlap; query
FT                   10-69; subject 14-73"
FT                   /note="similarity:fasta; with=UniProt:Q63NB9; Burkholderia
FT                   pseudomallei (Pseudomonas pseudomallei).; Putative
FT                   DNA-binding regulatory protein.; length=81; id 44.928%;
FT                   ungapped id 44.928%; E()=1.2e-06; 69 aa overlap; query
FT                   6-74; subject 13-81"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43635"
FT                   /db_xref="GOA:B2FT95"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B2FT95"
FT                   /protein_id="CAQ43635.1"
FT                   /translation="MVEHTNQAKLADVIRAHRIDLGVSQEAFADHIQMHRAYYSKIERG
FT                   EKNLTLATLERVAKGMGTSMSALLRAAGL"
FT   misc_feature    complement(16199..16363)
FT                   /locus_tag="Smlt0017"
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix, score
FT                   1.4e-13"
FT                   /inference="protein motif:HMMPfam:PF01381"
FT   CDS_pept        16483..16818
FT                   /transl_table=11
FT                   /locus_tag="Smlt0018"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43636"
FT                   /db_xref="UniProtKB/TrEMBL:B2FT96"
FT                   /protein_id="CAQ43636.1"
FT                   /translation="MNFYLVCPELEFTLELPFSPMGREQVAMQMRRMQEEEGQARGFEY
FT                   RLAEELSKLIPQLTDWDIKPPTGAQMAYATSLCAQLGIPLPAATRRSRALMQIFLAEAK
FT                   ALHGQRS"
FT   CDS_pept        16909..18060
FT                   /transl_table=11
FT                   /locus_tag="Smlt0019"
FT                   /product="putative radical SAM domain protein"
FT                   /note="similarity:fasta; with=UniProt:Q8PRE6; Xanthomonas
FT                   axonopodis pv. citri.; Hypothetical protein XAC0017.;
FT                   length=375; id 65.041%; ungapped id 65.041%; E()=1.7e-97;
FT                   369 aa overlap; query 15-383; subject 7-375"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43637"
FT                   /db_xref="GOA:B2FT97"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:B2FT97"
FT                   /protein_id="CAQ43637.1"
FT                   /translation="MLRRLWLAIILTARPSQVVAMEQDARKAQVPLKGRGAASRVPSRF
FT                   DTTATVGVDDGWESVYQEMEDAPPLRTQVQEERARTVISHNSSPDVGFSASVNPYRGCE
FT                   HGCVYCFARPSHSYLSLSPGLDFETRLFAKTNAPERLRAEISKSNYKCTPIALGINTDG
FT                   YQPIERNYQITRQCLEVLADAKHPVSFVTKSALITRDVELLASMAKDRLVTVYFSVTTL
FT                   DRKLSAKLEPRAAAPHARLRAMNQLHEAGVPVGVLIAPVIPMITDHDLEAILEAAHEHG
FT                   ARAAGYVLLRLPNEIKDIWREWLELHYPDRAAHVLSLMRQMHGGKEYDASFGTRMSGTG
FT                   PVADLIRKRFEKKHRELGFTRLPALATHLFQPPQDKSPQGQLF"
FT   sig_peptide     16909..16968
FT                   /locus_tag="Smlt0019"
FT                   /note="Signal peptide predicted for Smlt0019 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.996 between residues 20 and 21"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    17197..17739
FT                   /locus_tag="Smlt0019"
FT                   /note="HMMPfam hit to PF04055, Radical SAM superfamily,
FT                   score 2.3e-18"
FT                   /inference="protein motif:HMMPfam:PF04055"
FT   CDS_pept        18258..19148
FT                   /transl_table=11
FT                   /locus_tag="Smlt0020"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q44Z00
FT                   (EMBL:AAHI01000025); Burkholderia cenocepacia AU 1054.;
FT                   Hypothetical protein.; length=314; id 33.453%; ungapped id
FT                   35.769%; E()=3.5e-22; 278 aa overlap; query 23-285; subject
FT                   24-298"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43638"
FT                   /db_xref="UniProtKB/TrEMBL:B2FT98"
FT                   /protein_id="CAQ43638.1"
FT                   /translation="MPKQVRGLSVYRSTIERLPQFRILSGPLTEHQAAMLGFDDLPLAG
FT                   ASIVPSAEGPATLFNARGKEIIRKDLPMVTKSRSINTSWKDWHGHTHHGTQTRSYETYP
FT                   REYVAPPGEFLTAVDTDSGIAMATRIIDRTEPEESIANLLNIYLECFQHFEIVDPDLAV
FT                   PVRVEKINWRILPPGKFPFDRAMQVLDSYLKQLTDSDRAVAKQRIRTITRHEPDFMAVG
FT                   LGGFSEYIVFGFTGRNRYVFESPESGNATYIFRNEWEAVSQLTKRQILQEQLQETRIIH
FT                   TSRWAVEVSEAIQRK"
FT   CDS_pept        19267..19740
FT                   /transl_table=11
FT                   /locus_tag="Smlt0021"
FT                   /product="conserved hypothetical protein"
FT                   /note="N-terminus is similar to hahella chejuensis (strain
FT                   kctc 2396). hypothetical protein. UniProt:Q2SGS8
FT                   (EMBL:CP000155 (90 aa) fasta scores: E()=4.9e-10, 54.795%
FT                   id in 73 aa"
FT                   /note="similarity:fasta; with=UniProt:Q2SGS8
FT                   (EMBL:CP000155;); Hahella chejuensis (strain KCTC 2396).;
FT                   Hypothetical protein.; length=90; id 54.795%; ungapped id
FT                   54.795%; E()=4.9e-10; 73 aa overlap; query 4-76; subject
FT                   18-90"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43639"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B2FT99"
FT                   /protein_id="CAQ43639.1"
FT                   /translation="MKPTILALDLEGTLISNAVSQIPRPGLHRFLEDVRSQFEELVLFT
FT                   TVPEALARRIAGLLAREGSVPAWFVELRYIHWSGRTKDLSYVSPHVGEAFLLDDHGPYV
FT                   HDGQERLWVEIPLFGSPYSSDDDGLQIAAERLTDRIIELQSASDLGHMIADHG"
FT   misc_feature    19279..19683
FT                   /locus_tag="Smlt0021"
FT                   /note="HMMPfam hit to PF03031, NLI interacting factor-like
FT                   phosphatase, score 0.094"
FT                   /inference="protein motif:HMMPfam:PF03031"
FT   repeat_region   20322..20329
FT                   /rpt_unit_seq="(a)8"
FT   CDS_pept        20360..21661
FT                   /transl_table=11
FT                   /locus_tag="Smlt0023"
FT                   /product="putative integrase/recombinase"
FT                   /note="Codons 165 to the C-terminus are similar to codons
FT                   85 to the C-terminus of Xanthomonas campestris pv.
FT                   campestris intIA site-specific recombinase intIA
FT                   (site-specific recombinase). UniProt:Q9AMK4 (327 aa) fasta
FT                   scores: E()=0.084, 30.909% id in 275 aa, and to Geobacter
FT                   sulfurreducens hypothetical protein. UniProt:Q74AC3 (457
FT                   aa) fasta scores: E()=0.0011, 27.124% id in 306 aa"
FT                   /note="similarity:fasta; with=UniProt:Q9AMK4; Xanthomonas
FT                   campestris pv. campestris.; intIA; Site-specific
FT                   recombinase IntIA (Site-specific recombinase).; length=327;
FT                   id 30.909%; ungapped id 37.778%; E()=0.084; 275 aa overlap;
FT                   query 165-423; subject 86-326"
FT                   /note="similarity:fasta; with=UniProt:Q74AC3; Geobacter
FT                   sulfurreducens.; Hypothetical protein.; length=457; id
FT                   27.124%; ungapped id 30.970%; E()=0.0011; 306 aa overlap;
FT                   query 116-397; subject 145-436"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43640"
FT                   /db_xref="GOA:B2FTA0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B2FTA0"
FT                   /protein_id="CAQ43640.1"
FT                   /translation="MVYDVEICTARAIASEATGIKCAQGVPLPEGFCFLVSRSDGTIVQ
FT                   PAFEFFADAHLTIGPKPKLACSKNTTAAIAADLTDFHHFLDARKKLVSDVDEDLLRSYA
FT                   DTLTDLDSAVTLDKLAAATIHRRWSTVTKLIAFCVKRGYLRKAPALLSKQTKRGTVQVL
FT                   DVGVDLPGLNDADELITALHPETVVGILDELGPNPVLERNGLVELAYATTAQRLMAELC
FT                   YQAGLRRAEVCDLKAKTILQARTEGRDPLTAVAIPVLGKGNKKRNVPVPVWLLNALKRY
FT                   AKGVRQRLVDLRLGYHKLEDHGVLFVLDANNRKHAGNPITPQIFDRHFAQAKDRLLKRL
FT                   SKERDLARYESTQRERITIHALRHTFALYTYMEKRANGDMDAIKYVQSVLGHSLRDTTE
FT                   SIYLRSANAFESETRESIRLHLEGQPFMRIGVEA"
FT   misc_feature    20954..21604
FT                   /locus_tag="Smlt0023"
FT                   /note="HMMPfam hit to PF00589, Phage integrase family,
FT                   score 2e-06"
FT                   /inference="protein motif:HMMPfam:PF00589"
FT   CDS_pept        22025..23593
FT                   /transl_table=11
FT                   /locus_tag="Smlt0024"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0024"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43641"
FT                   /db_xref="UniProtKB/TrEMBL:B2FTZ0"
FT                   /protein_id="CAQ43641.1"
FT                   /translation="MSGLVQYLTVKGVKISGPDDTPMDLGESFLTYLKGRDTTHPTVLS
FT                   VETQRHYYGTFKKVVLALHEMDPRWKVIRIPPKPFAGLPRKSKPKELDRAAWANVMKAA
FT                   VEECISTMDEVWPLLDRVHSALAQKKKGDAVSLSDPAEAIAQILANFDGHLPRQGAVHK
FT                   LPGVGKISESEYFRLRRLAHPIGGDLIPFFLVLAMHSGFNEQPLRTLTLNGISEHYPLG
FT                   QKRTVIKSSKRRAGSSAQGATQRAAFPASDHPLAPERLISFVIAWTKRIRDYAAGELAN
FT                   DFFLHAVSEGGRHKRRGMHIDSYSARTDDVTTRVTGYITLFCKRRGLKYSGSQANRLAF
FT                   SEAVDGLTDGDAFELRAMLGHRLLSTGQDSYQTTTMQHRQKEQLAGAMTAQERWVTSNG
FT                   KIDTRSARSDREQTAATQGFCCADPFQSPQPGQRHGKLCTSYGSCPACPLAAADPNEAY
FT                   ALARFLQLQELYEEARAELGSEIWRRKFENAYLALRDSWIPAVSTTANRQSAMMIMLTP
FT                   LPGLE"
FT   CDS_pept        23632..25704
FT                   /transl_table=11
FT                   /locus_tag="Smlt0025"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q35GX7
FT                   (EMBL:AALJ01000004;); Bradyrhizobium sp. BTAi1.;
FT                   Hypothetical protein.; length=624; id 22.609%; ungapped id
FT                   25.743%; E()=0.018; 690 aa overlap; query 1-679; subject
FT                   1-617"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43642"
FT                   /db_xref="UniProtKB/TrEMBL:B2FTZ1"
FT                   /protein_id="CAQ43642.1"
FT                   /translation="MAMPAARKVETAQAATLHPSFQVDYDSDVWTFAQTTVGQQKEFVT
FT                   VDWAIPVARGELLTDYKHRGLLSELKCYLKTAIIEDTVRMTVGSIPGTYMGMRELVKFM
FT                   GEREIHSLFDITTAMSWDYVEGLEEQYMTARSDAGRDRAWTHATAYKLIHPLTQIYEIA
FT                   DSLRARGGQAPCEAPFDGRKTYDVVTEPLGLARTGGLMPVPDEISVPILSYACEWIEYG
FT                   SEDVIRLQAEVIPMLIDARSATGPRRIACFRQIKRHIEEFQMSPIPGTLTPWHEPLATI
FT                   DRIDDAGDEREISGTQGLRRLILMTQSACSVLLQGCTGIRAHELIGLSLDHDPTLQHGV
FT                   VKSVTSLDGLMEVFSICGISAKREATRHEWTAGLRPLGTNHLPIVLKSVEVLVRLMEPW
FT                   RALSGTKSLMLSFSHAKSLPSGPDGIGRMTASRNSLLQREFAVEALTKKRGIETTQAVY
FT                   EVRYLRPQRWRITFAHYVFRSKPELMPALRTHFRHMSEQITDQGYIGNDAALLENLEGE
FT                   RVMETSRFLVQITLGRPIGGGPAQRLLMQHAESMTEALSKMDGETPIDKAVAYVKLTDL
FT                   RIWTGTYASCLIDMLPDRSSCNPQASLLTVRASPNFGLRSPGLCAGCKCCIILPEHKDF
FT                   WEDRLLKNQAIVQMERTNSRDQYSKIAMSRVVQSRAVLRMISNATGDASDRSGES"
FT   repeat_region   25178..25185
FT                   /rpt_unit_seq="(ga)4"
FT   CDS_pept        complement(25896..26756)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0026"
FT                   /product="putative ISXac3 like transposase"
FT                   /note="Similar to C-terminus from codon 105 of Aeromonas
FT                   salmonicida Tnp putative transposase. UniProt:Q8GLR2
FT                   (EMBL:AY129557) (383 aa) fasta scores: E()=2.1e-40, 42.912%
FT                   id in 261 aa, and to entire protein of Xanthomonas
FT                   campestris pv. vesicatoria (strain 85-10) isxac3
FT                   transposase. UniProt:Q3BUI8 (EMBL:AM039952) (286 aa) fasta
FT                   scores: E()=7.8e-103, 85.315% id in 286 aa"
FT                   /note="similarity:fasta; with=UniProt:Q8GLR2
FT                   (EMBL:AY129557); Aeromonas salmonicida.; tnp; Putative
FT                   transposase Tnp.; length=383; id 42.912%; ungapped id
FT                   43.580%; E()=2.1e-40; 261 aa overlap; query 7-266; subject
FT                   103-360"
FT                   /note="similarity:fasta; with=UniProt:Q3BUI8
FT                   (EMBL:AM039952); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; ISxac3 transposase.; length=286; id
FT                   85.315%; ungapped id 85.315%; E()=7.8e-103; 286 aa overlap;
FT                   query 1-286; subject 1-286"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43643"
FT                   /db_xref="GOA:B2FKD5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B2FKD5"
FT                   /protein_id="CAQ43643.1"
FT                   /translation="MIERCRDEFPVRLMCRCLRVSASGYYDWSKRLPSARERDNQRLLG
FT                   RIRELHEDSRGTLGAGRMHEDLAEEGETASLNRVARLMATDGLQGWPRPKRRGQRGKPA
FT                   LTPPGVRNLLERDFTALEPETRWVTDITELKTRQGKLYLCIVLDLFDQRVVGWSMHHRQ
FT                   DRQMVIRAVQMAVWQRQGSHPLILHSDRGSQFRSGDYQRYLAANGLVCSMSAVGHCGDN
FT                   AACEGFFGLLKRERVYRMTYPTLDAARADVFEYIERFHNPRMRRRVARQDQKFSALLQP
FT                   SVISG"
FT   misc_feature    complement(25920..26402)
FT                   /locus_tag="Smlt0026"
FT                   /note="HMMPfam hit to PF00665, Integrase core domain, score
FT                   3.3e-32"
FT                   /inference="protein motif:HMMPfam:PF00665"
FT   CDS_pept        complement(26765..27052)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0027"
FT                   /product="putative ISXac3 related insertion element"
FT                   /note="similarity:fasta; with=UniProt:Q46068
FT                   (EMBL:CGISABL); Corynebacterium glutamicum (Brevibacterium
FT                   flavum).; IS3 related insertion element.; length=97; id
FT                   36.170%; ungapped id 39.535%; E()=0.00011; 94 aa overlap;
FT                   query 4-92; subject 3-93"
FT                   /note="similarity:fasta; with=UniProt:Q3BYS7
FT                   (EMBL:AM039949); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; ISxac3 transposase.; length=95; id
FT                   91.489%; ungapped id 91.489%; E()=7.8e-30; 94 aa overlap;
FT                   query 1-94; subject 1-94"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43644"
FT                   /db_xref="GOA:B2FS60"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B2FS60"
FT                   /protein_id="CAQ43644.1"
FT                   /translation="MSKRRKFSTEFKRGAVEQASQPGVSCAQVARELGIRDALLTRWKR
FT                   EAQSRGQVAFGGTGTPRDEELARLKRELARVKKERDFLREAATFFAKGSS"
FT   misc_feature    complement(26804..27043)
FT                   /locus_tag="Smlt0027"
FT                   /note="HMMPfam hit to PF01527, Transposase, score 1.1e-20"
FT                   /inference="protein motif:HMMPfam:PF01527"
FT   CDS_pept        complement(27395..28816)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0028"
FT                   /product="conserved hypothetical protein"
FT                   /note="From codon 35, similar to Ralstonia eutropha
FT                   (Alcaligenes eutrophus) hypothetical protein.
FT                   UniProt:Q7WXI2 (440 aa) fasta scores: E()=7.8e-83, 52.403%
FT                   id in 437 aa, and entire protein is similar to Micrococcus
FT                   sp. 28 mc29. UniProt:Q8VPP4 (498 aa) fasta scores:
FT                   E()=3.4e-36, 34.221% id in 488 aa"
FT                   /note="similarity:fasta; with=UniProt:Q7WXI2; Ralstonia
FT                   eutropha (Alcaligenes eutrophus).; Hypothetical protein.;
FT                   length=440; id 52.403%; ungapped id 52.765%; E()=7.8e-83;
FT                   437 aa overlap; query 34-469; subject 3-437"
FT                   /note="similarity:fasta; with=UniProt:Q8VPP4; Micrococcus
FT                   sp. 28.; MC29.; length=498; id 34.221%; ungapped id
FT                   37.783%; E()=3.4e-36; 488 aa overlap; query 4-471; subject
FT                   12-473"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43645"
FT                   /db_xref="GOA:B2FTZ4"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2FTZ4"
FT                   /protein_id="CAQ43645.1"
FT                   /translation="MLPEIDLLAIQRGSITAPAGCGKTQLIAEALASHSGNRPILVLTH
FT                   TNAGVTALRTRLKRAGVPSSAYRLSTIDGFAMRLIAKFPARSGHHPQLLELNNAGSDYP
FT                   AIRESFRQLLDSGHIAAPIAATYARLLVDEYQDCSTVQHSIVSTLAALLPTCVLGDPLQ
FT                   AIFGFGGNRLVHWEQDVQSSFPAAGSLRTPWRWQIAGNEELGQWLLSQRHALTAGLPID
FT                   LTTAPSSVRWIQLVAGSEVQQRLTAARTNAPGSQGTVLVIGESMNVQGRHQLTSQTPGA
FT                   MAVEAVDMRDLVNFARQFNLQAPSALQDLATFSALMMTGVGTANLVTRVGTIRRGRART
FT                   PPTPVEAEAVAFESERTMTRALRLVDALAEQTGTRVYRPEILHCCRSAMRSVINGEQDL
FT                   LGAALHARERNRHLSRPIARRAVGSTLLLKGLEADIAVVLYPESMSVQNLYVALTRGAK
FT                   GLVICSSTPTLTPTP"
FT   CDS_pept        complement(28806..30533)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0029"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q7WXI3
FT                   (EMBL:AY305378); Ralstonia eutropha (Alcaligenes
FT                   eutrophus).; Hypothetical protein.; length=571; id 50.699%;
FT                   ungapped id 51.693%; E()=3.3e-96; 572 aa overlap; query
FT                   1-569; subject 1-564"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43646"
FT                   /db_xref="GOA:B2FTZ5"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:B2FTZ5"
FT                   /protein_id="CAQ43646.1"
FT                   /translation="MPRIRHLAIRNFRSIKALDWSPAPGINCLIGPGDSGKSTILDAID
FT                   LCLGARRSISFGDMDFFDLDVSEPIRIAVTFGELPASLMDIDVYGDFLRGFDSVFDTLE
FT                   DEPAAGLETVLTLLLQVGADLEPSWTLISDRSLQQGLERSLPWKERIVLAPARIGSFTS
FT                   SNLSWSRGSVLNRLTDERAELGAQLALAARQARANFGAQASPHLSQTLGIVRTTAQSLG
FT                   VDVGSMPQALLDSHSVSIGEGAIALHSEAGIPLRSLGTGSSRLLVTGLQRAAAESAPIA
FT                   LVDEVEYGLEPHRLMRLLDSLGAKETPPPLQAFLTTHSPVALRELSGEQLLVVRPRPAG
FT                   HVVISAGSTDEIQSTLRTDPEAFLAKSVIVCEGASEVGFVRGLDLWGVASKESSFLALG
FT                   GAYVNAGGGTPDNAFARATALMDLGYRVLVFIDADKPAAPGVAEAYLQSGGSLVTWRAG
FT                   MTLEDELFLCLPDTSIDALLLKAKERVGEDLMNQQLVAKSNGLTTLASIEALRPNSPYP
FT                   PDIRVLLGEVSRIKKNSWFKSLTTYQSIVLDIVSRGYANADASFKAVVDQLWAFTRAA"
FT   misc_feature    complement(29505..30527)
FT                   /locus_tag="Smlt0029"
FT                   /note="HMMPfam hit to PF02463, RecF/RecN/SMC N terminal
FT                   domain, score 8.9e-05"
FT                   /inference="protein motif:HMMPfam:PF02463"
FT   repeat_region   29944..29951
FT                   /rpt_unit_seq="(gc)4"
FT   CDS_pept        complement(31220..32554)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0032"
FT                   /product="putative MFS family transporter protein"
FT                   /note="Similar, but unfragmented, to Streptococcus
FT                   pneumoniae MefE macrolide-efflux pump (fragment).
FT                   UniProt:Q9RHW1 (402 aa) fasta scores: E()=1.2e-09, 22.475%
FT                   id in 396 aa, and similar, but truncated at the N-terminus,
FT                   to Rhizobium meliloti (Sinorhizobium meliloti) probable
FT                   nreb protein. UniProt:Q92YI4 (440 aa) fasta scores:
FT                   E()=2.2e-95, 59.551% id in 445 aa, and similar to entire
FT                   protein of Alcaligenes xylosoxydans xylosoxydans
FT                   (Achromobacter xylosoxidans) NreB protein. UniProt:Q44591
FT                   (474 aa) fasta scores: E()=7.1e-92, 57.494% id in 447 aa"
FT                   /note="similarity:fasta; with=UniProt:Q9RHW1; Streptococcus
FT                   pneumoniae.; mefE; Macrolide-efflux pump (Fragment).;
FT                   length=402; id 22.475%; ungapped id 25.070%; E()=1.2e-09;
FT                   396 aa overlap; query 10-385; subject 11-385"
FT                   /note="similarity:fasta; with=UniProt:Q92YI4; Rhizobium
FT                   meliloti (Sinorhizobium meliloti).; Probable NreB protein.;
FT                   length=440; id 59.551%; ungapped id 60.920%; E()=2.2e-95;
FT                   445 aa overlap; query 1-443; subject 1-437"
FT                   /note="similarity:fasta; with=UniProt:Q44591; Alcaligenes
FT                   xylosoxydans xylosoxydans (Achromobacter xylosoxidans).;
FT                   nreB; NreB protein.; length=474; id 57.494%; ungapped id
FT                   58.542%; E()=7.1e-92; 447 aa overlap; query 1-443; subject
FT                   29-471"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43647"
FT                   /db_xref="GOA:B2FTZ6"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2FTZ6"
FT                   /protein_id="CAQ43647.1"
FT                   /translation="MLEVLSHPAFRRLFGAQIVALVGTGLATVALALLAYDLAGSQAGA
FT                   VLGTALAIKMVVYVTLAPVSGALVPARLRKRVLIALDLVRAVVAVCLPFVTEIWQVYVL
FT                   IAVLQSASACFTPLFQSTIPEILQEERDYTRALSLSRLAYDLESLLSPALAAALLTIIS
FT                   FHGLFAGTSVGFILSALLVASTTFPALAAVSSKDGPYARAIRGMRIYLRTPRLQGLLAL
FT                   NLCAAAGGAMVFVNTVVMVRTVLGGAEEQVAWALAAFGGGSMLVALLLPKVLDRISDRT
FT                   VMLAAGLFMSVVLVTFLGVWFALKGHPGWTAVIPAWTLLGMAYAGLVTPGGRLLRRSAE
FT                   SADLPFLFAAQFSLSHVCWLIAYPLAGWVGARYGLHVALAALGILATLGLVAAWRRWPA
FT                   HDPEEIAHKHEHLAEDDPHLLAHRDVDGTHRHRFVIDQLHTRWPG"
FT   misc_feature    complement(order(31379..31438,31466..31525,31562..31630,
FT                   31643..31711,31745..31804,31832..31900,32006..32074,
FT                   32228..32296,32354..32422,32450..32518))
FT                   /locus_tag="Smlt0032"
FT                   /note="10 probable transmembrane helices predicted for
FT                   Smlt0032 by TMHMM2.0 at aa 13-35, 45-67, 87-109, 161-183,
FT                   219-241, 251-270, 282-304, 309-331, 344-363 and 373-392"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(31442..32518)
FT                   /locus_tag="Smlt0032"
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 1.6e-14"
FT                   /inference="protein motif:HMMPfam:PF07690"
FT   sig_peptide     complement(32450..32554)
FT                   /locus_tag="Smlt0032"
FT                   /note="Signal peptide predicted for Smlt0032 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.706) with cleavage site
FT                   probability 0.494 between residues 35 and 36"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(32720..32959)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43648"
FT                   /db_xref="UniProtKB/TrEMBL:B2FTZ7"
FT                   /protein_id="CAQ43648.1"
FT                   /translation="MKTHSAVIAGLLFSMSLFTTASAHDPALHADPAPPAAPKAKPTTC
FT                   EQLADRSKYKVDLKDAQTKALKERCDAQAAPKKK"
FT   sig_peptide     complement(32891..32959)
FT                   /locus_tag="Smlt0033"
FT                   /note="Signal peptide predicted for Smlt0033 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.942 between residues 23 and 24"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(32999..33637)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0034"
FT                   /product="putative transmembrane anchor protein"
FT                   /note="Similar to C-terminus from codon 170 of Ruegeria sp.
FT                   PR1b rc177. UniProt:Q8KW13 (352 aa) fasta scores:
FT                   E()=1.2e-05, 33.163% id in 196 aa"
FT                   /note="similarity:fasta; with=UniProt:Q8KW13; Ruegeria sp.
FT                   PR1b.; RC177.; length=352; id 33.163%; ungapped id 36.932%;
FT                   E()=1.2e-05; 196 aa overlap; query 21-211; subject 170-350"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0034"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43649"
FT                   /db_xref="GOA:B2FTZ8"
FT                   /db_xref="UniProtKB/TrEMBL:B2FTZ8"
FT                   /protein_id="CAQ43649.1"
FT                   /translation="MSITINQPLPTTGRLLKSTLVAAAIAGALLVTAVLPAEYGIDPTG
FT                   IGRALGLTALADGGSTAADPATPTSSTASDAATTLAEKAAAAFGANKGQSLDPAAVSLT
FT                   NGELRQDAMTITLEPGKGKEVKSHMAAGAGILFSWKATGDVAVDMHGERPDVKGAWTSY
FT                   AVEAAQREAHGTFVAPFEGTHGWYWQNRSDTPVTVSIELVGYQADIYQP"
FT   misc_feature    complement(33533..33601)
FT                   /locus_tag="Smlt0034"
FT                   /note="1 probable transmembrane helix predicted for
FT                   Smlt0034 by TMHMM2.0 at aa 13-35"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(33539..33637)
FT                   /locus_tag="Smlt0034"
FT                   /note="Signal peptide predicted for Smlt0034 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.977) with cleavage site
FT                   probability 0.778 between residues 33 and 34"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(33657..34388)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0035"
FT                   /product="putative transmembrane protein"
FT                   /note="similarity:fasta; with=UniProt:Q2SFW0
FT                   (EMBL:CP000155;); Hahella chejuensis (strain KCTC 2396).;
FT                   Hypothetical protein.; length=242; id 67.094%; ungapped id
FT                   67.672%; E()=2.2e-54; 234 aa overlap; query 10-243; subject
FT                   10-241"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43650"
FT                   /db_xref="GOA:B2FTZ9"
FT                   /db_xref="InterPro:IPR032809"
FT                   /db_xref="UniProtKB/TrEMBL:B2FTZ9"
FT                   /protein_id="CAQ43650.1"
FT                   /translation="MNHPSPFCTRNLSLTSSNKLFAWLSMLAAVLLPFAAFAHGVSEGD
FT                   QAFLEESTGRQLIAFTYLGAKHMVTGYDHLLFLFGVIFFLYRMRDVSIYVTLFAIGHST
FT                   TLLLGVLGGFHVDAYLVDAIIGLSVVYKALDNMGAFKRWFGVQPNTKIAVLVFGFFHGF
FT                   GLATKLQDFSLSPDGLVPNMLAFNVGVELGQLLALAGILIVMGFWRRLPSFNRQAYGVN
FT                   TILMTAGFVLIGMQLTGYFAS"
FT   misc_feature    complement(order(33669..33737,33771..33839,33867..33935,
FT                   33969..34037,34050..34118,34131..34184,34263..34331))
FT                   /locus_tag="Smlt0035"
FT                   /note="7 probable transmembrane helices predicted for
FT                   Smlt0035 by TMHMM2.0 at aa 20-42, 69-86, 91-113, 118-140,
FT                   152-174, 184-206 and 218-240"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(34275..34388)
FT                   /locus_tag="Smlt0035"
FT                   /note="Signal peptide predicted for Smlt0035 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.956 between residues 38 and 39"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(34385..37522)
FT                   /transl_table=11
FT                   /gene="smmL"
FT                   /locus_tag="Smlt0036"
FT                   /product="putative AcrA/AcrD/AcrF family protein"
FT                   /note="similarity:fasta; with=UniProt:Q48815; Legionella
FT                   pneumophila.; helA; Protein helA.; length=1052; id 61.700%;
FT                   ungapped id 61.996%; E()=0; 1047 aa overlap; query 1-1044;
FT                   subject 1-1045"
FT                   /note="similarity:fasta; with=UniProt:Q9A5Q7; Caulobacter
FT                   crescentus.; AcrB/AcrD/AcrF family protein.; length=1057;
FT                   id 69.231%; ungapped id 69.632%; E()=0; 1040 aa overlap;
FT                   query 1-1036; subject 15-1052"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43651"
FT                   /db_xref="GOA:B2FU00"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU00"
FT                   /protein_id="CAQ43651.1"
FT                   /translation="MLERIIRASIAHRWLVLLLVLALSGLGIWNYSKLPIDAVPDITNV
FT                   QVQINTEAPGYSPLEAEQRVTFPVETALAGLAKLEYTRSISRYGLSQVTVVFEDGTDIY
FT                   FARQQVAERLQQAGSQLPVGLKPSLGPVATGLGEIFMYTVEAESGAEETWTPMALRTLQ
FT                   DWVIRPQMRHLKGVTEVNTVGGYVRQFHITPDPKKLQAYGLTLQDVLEAVARSNTNVGA
FT                   GYIEKSGEQYLVRVPGQVADMAGLRKIVVANRDGMPLRVGDLAEVVEGTELRTGAATKD
FT                   GNEVVLGTAFMLIGENSRDVAQRTAAKLKDIDATLPDGVRAHPVYDRTELVDRTIETVK
FT                   KNLLEGALLVIAVLFLLLGNLRAALITAAVIPLTMLLTITGMVQNRVSANLMSLGALDF
FT                   GLIVDGAVIIVENCLRRFGERQHLQGRLLTREERFSLAASASAEVIKPSLFGLFIIAAV
FT                   YIPIFALSGVEGKMFHPMALTVVIALTGAMALSLTFVPAAVAQFVTGKVSEKETKAMRR
FT                   VTNVYGPMLERAVNARKVVVASAAVLTVLAGLLASRLGTEFIPNLDEGDIALHALRIPG
FT                   TSLTQAIGMQRQLEAAIKQFPEVDEVVAKIGTAEVATDPMPPSVADTFIMLKDRDQWPD
FT                   PRKPKAQLVAELEKVVRAIPGNNYEFTQPVQMRMNELIAGVRAEVAVKLYGDDLEQLAT
FT                   IGSQVENVASEIQGAADVKLEQITGLPLMTITPDLDALARYGVAIDDVQKTISVALGGE
FT                   SVGQVFEGDRRFDIVVRLSENLRQDVRTLASLPVAVAPGVSTGQERSFVPLGQLAKVEI
FT                   APGPNQISRENGKRRVVITSNVRGRDLGSFVEELRTKVGQEVQLPEGYWIEYGGTFEQL
FT                   ISASKRLSVVVPVVLVMIFGLLFMAFGSGKDAAIVFSGVPLALTGGVVALWLRDIPMSI
FT                   SAGVGFIALSGVAVLNGLVMISFIKNLREEGVPLHKAVTEGALTRLRPVLMTALVASLG
FT                   FLPMALNVGAGAEVQRPLATVVIGGIISSTLLTLLVLPALYRLVHREDSVLESRSS"
FT   misc_feature    complement(34421..37510)
FT                   /gene="smmL"
FT                   /locus_tag="Smlt0036"
FT                   /note="HMMPfam hit to PF00873, AcrB/AcrD/AcrF family, score
FT                   0"
FT                   /inference="protein motif:HMMPfam:PF00873"
FT   misc_feature    complement(order(34436..34504,34523..34591,34661..34729,
FT                   34754..34813,34823..34891,36023..36091,36119..36178,
FT                   36293..36352,36410..36478,37427..37495))
FT                   /gene="smmL"
FT                   /locus_tag="Smlt0036"
FT                   /note="10 probable transmembrane helices predicted for
FT                   Smlt0036 by TMHMM2.0 at aa 10-32, 349-371, 391-410,
FT                   449-468, 478-500, 878-900, 904-923, 932-954, 978-1000 and
FT                   1007-1029"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(37532..38767)
FT                   /transl_table=11
FT                   /gene="smmK"
FT                   /locus_tag="Smlt0037"
FT                   /product="putative cation efflux component protein"
FT                   /note="similarity:fasta; with=UniProt:Q48814; Legionella
FT                   pneumophila.; HelB.; length=400; id 32.410%; ungapped id
FT                   32.773%; E()=8.3e-37; 361 aa overlap; query 39-397; subject
FT                   42-400"
FT                   /note="similarity:fasta; with=UniProt:Q9A5Q8; Caulobacter
FT                   crescentus.; Cation efflux system protein, putative.;
FT                   length=420; id 48.756%; ungapped id 49.246%; E()=5.6e-67;
FT                   402 aa overlap; query 12-411; subject 21-420"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0037"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43652"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU01"
FT                   /protein_id="CAQ43652.1"
FT                   /translation="MNRYVFLILLPIALAACGGNESSQRAKPEDTAATAGDYERGPHRG
FT                   RMLRDGDFALEVTVYETNTPPHFRLYAYRNDKPLAPGEVKATIQLKRLDGEVNNFSFIP
FT                   EKDYLVGSGEVVEPHSFDVKADAVVGGKNYAWSYASYEGRTTIDPKAAADAGVVVESAE
FT                   PGTIRDTVSLMGNVAVDTGRFAAVKARFPGVVRSVAVEMGQRVSAGQTLATVEGNDSMR
FT                   TYSVTAPFSGVVLARSTSVGDVAADNTLFEIADLSEVWVDLRALGSDAERLSPGQMVTI
FT                   RSATGGLEATGKLQGILPLASAGQTVVARVALTNSEGRWRPGMAVSAEVVIAETEVPLT
FT                   VKESGLQRFRDFTVVFAQVGNSYEVRMLELGRRDGDRVEVLKGLKPGTRYVSEQSYLIR
FT                   ADIEKSGASHDH"
FT   misc_feature    complement(38009..38215)
FT                   /gene="smmK"
FT                   /locus_tag="Smlt0037"
FT                   /note="HMMPfam hit to PF00364, Biotin-requiring enzyme,
FT                   score 0.00023"
FT                   /inference="protein motif:HMMPfam:PF00364"
FT   sig_peptide     complement(38699..38767)
FT                   /gene="smmK"
FT                   /locus_tag="Smlt0037"
FT                   /note="Signal peptide predicted for Smlt0037 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.967) with cleavage site
FT                   probability 0.389 between residues 23 and 24"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(38764..40014)
FT                   /transl_table=11
FT                   /gene="smmJ"
FT                   /locus_tag="Smlt0038"
FT                   /product="putative cation efflux transporter component"
FT                   /note="similarity:fasta; with=UniProt:Q48809; Legionella
FT                   pneumophila.; HelC.; length=414; id 25.635%; ungapped id
FT                   27.520%; E()=2.1e-15; 394 aa overlap; query 23-403; subject
FT                   21-400"
FT                   /note="similarity:fasta; with=UniProt:Q8PF26; Xanthomonas
FT                   axonopodis pv. citri.; czcC; Cation efflux system protein.;
FT                   length=423; id 34.541%; ungapped id 35.930%; E()=1.1e-32;
FT                   414 aa overlap; query 6-408; subject 1-409"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0038"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43653"
FT                   /db_xref="GOA:B2FU02"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU02"
FT                   /protein_id="CAQ43653.1"
FT                   /translation="MKLRSLWALAIAGAYGVAVPGHAAEVLRLEDVVARALGTHPSVQA
FT                   DTARLEAVRSRAGREALPTPLVLGGELENVAGSGGLSGLDAAESTFRISKVLELGGKRA
FT                   ARQALGGAEVDAARSEADVTRIAIATLAAGRFVDVLAAQEHVEHAEERIKMASAMRREV
FT                   ARWVAAARNPDSDLRSAEIALLDAELKREQALQALESARMSLAATWGAPSPDFGSVAGD
FT                   TAVLPPLDDFDDLSRRLATTPQQRALDAQAGVIDARREIARASAKPDVSVGLGIRRLEA
FT                   TKDSGLVMSVSVPLGSRRRSDFSVAEADYELTSLKYRRQAQMLEMRQELFGIYQQLKQA
FT                   QSEVESVRQRQLPKAQQAFDQSRRGFEEGRFSFLVLSQAQQRLFDLREREVEAAARYLR
FT                   LLVEADRLTASALDIRP"
FT   misc_feature    complement(38788..39321)
FT                   /gene="smmJ"
FT                   /locus_tag="Smlt0038"
FT                   /note="HMMPfam hit to PF02321, Outer membrane efflux
FT                   protein, score 0.0011"
FT                   /inference="protein motif:HMMPfam:PF02321"
FT   misc_feature    complement(39385..39930)
FT                   /gene="smmJ"
FT                   /locus_tag="Smlt0038"
FT                   /note="HMMPfam hit to PF02321, Outer membrane efflux
FT                   protein, score 0.00081"
FT                   /inference="protein motif:HMMPfam:PF02321"
FT   sig_peptide     complement(39946..40014)
FT                   /gene="smmJ"
FT                   /locus_tag="Smlt0038"
FT                   /note="Signal peptide predicted for Smlt0038 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.998 between residues 23 and 24"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(40105..40473)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0039"
FT                   /product="putative transmembrane protein"
FT                   /note="similarity:fasta; with=UniProt:Q4J3U2
FT                   (EMBL:AAAU03000001); Azotobacter vinelandii AvOP.;
FT                   Hypothetical protein precursor.; length=121; id 30.088%;
FT                   ungapped id 34.694%; E()=0.025; 113 aa overlap; query
FT                   20-121; subject 11-119"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43654"
FT                   /db_xref="GOA:B2FU03"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU03"
FT                   /protein_id="CAQ43654.1"
FT                   /translation="MSAFSARHRRLIRFSLFVLMLLSVVVRPIVIQQGELHTAEHDIAA
FT                   TAEHGHSHGPGTGDNVDPKHASGVHSVLHQADVSFAGMLVSSNLNLATVPPASLLPGLH
FT                   SVDEPSGHRGSPFRPPIV"
FT   sig_peptide     complement(40378..40473)
FT                   /locus_tag="Smlt0039"
FT                   /note="Signal peptide predicted for Smlt0039 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.809) with cleavage site
FT                   probability 0.591 between residues 32 and 33"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(40381..40440)
FT                   /locus_tag="Smlt0039"
FT                   /note="1 probable transmembrane helix predicted for
FT                   Smlt0039 by TMHMM2.0 at aa 12-31"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        40895..41482
FT                   /transl_table=11
FT                   /locus_tag="Smlt0040"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar, but truncated at the C-terminus, to
FT                   Rhodobacter capsulatus (Rhodopseudomonas capsulata) RypA
FT                   hypothetical protein. UniProt:O07839 (EMBL:RCDCTP) (419 aa)
FT                   fasta scores: E()=2.8e-28, 45.745% id in 188 aa"
FT                   /note="similarity:fasta; with=UniProt:O07839 (EMBL:RCDCTP);
FT                   Rhodobacter capsulatus (Rhodopseudomonas capsulata).;
FT                   Hypothetical protein rypA.; length=419; id 45.745%;
FT                   ungapped id 47.778%; E()=2.8e-28; 188 aa overlap; query
FT                   2-183; subject 4-189"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43655"
FT                   /db_xref="GOA:B2FU04"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR022778"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU04"
FT                   /protein_id="CAQ43655.1"
FT                   /translation="MSRTSNSHPLQIATLPIGVNGGAIGVTFAPGKYQDVAMTGSWARD
FT                   LDIDLASIVAWGAQHLITLIEPWEFEELRITSLAERAKAHGLMWHGLPIKDGAAPDARL
FT                   LLPWQSTGPQFAAELLSGSRIVVHCKGGLGRAGTVASMLLIDTGCAPDGIDAIAKVRSV
FT                   RPGAVETAEQEEFILNWPARRASSLGVVAMPG"
FT   CDS_pept        41597..42457
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="Smlt0041"
FT                   /product="conserved hypothetical protein, pseudogene"
FT                   /note="Similar to Xanthomonas campestris pv. campestris
FT                   hypothetical protein xcc0015. UniProt:Q8PEG5
FT                   (EMBL:AE012094) (364 aa) fasta scores: E()=4.2e-86, 77.352%
FT                   id in 287 aa"
FT                   /note="similarity:fasta; with=UniProt:Q8PEG5
FT                   (EMBL:AE012094); Xanthomonas campestris pv. campestris.;
FT                   Hypothetical protein XCC0015.; length=364; id 77.352%;
FT                   ungapped id 78.723%; E()=4.2e-86; 287 aa overlap; query
FT                   3-286; subject 80-364"
FT   CDS_pept        42650..45037
FT                   /transl_table=11
FT                   /locus_tag="Smlt0042"
FT                   /product="putative RHS-repeat protein"
FT                   /note="Codons 35 to 740 are similar to codons 560 to 1240
FT                   of Methanosarcina barkeri (strain Fusaro/DSM 804)
FT                   hypothetical protein. UniProt:Q466C0 (EMBL:CP000099) (2096
FT                   aa) fasta scores: E()=1.7e-15, 23.699% id in 730 aa, and
FT                   codons 80 to 760 are similar to codons 1490 to 2165 of
FT                   bacillus subtilis. WapA UniProt:Q07833 (EMBL:D29985 (2334
FT                   aa) fasta scores: E()=0.0098, 22.269% id in 714 aa."
FT                   /note="similarity:fasta; with=UniProt:Q07833
FT                   (EMBL:D29985;); Bacillus subtilis.; wapA; Wall-associated
FT                   protein precursor.; length=2334; id 22.269%; ungapped id
FT                   25.000%; E()=0.0098; 714 aa overlap; query 80-759; subject
FT                   1495-2164"
FT                   /note="similarity:fasta; with=UniProt:Q466C0
FT                   (EMBL:CP000099;); Methanosarcina barkeri (strain Fusaro/DSM
FT                   804).; Hypothetical protein.; length=2096; id 23.699%;
FT                   ungapped id 27.074%; E()=3.2e-15; 730 aa overlap; query
FT                   33-732; subject 568-1236"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43657"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU05"
FT                   /protein_id="CAQ43657.1"
FT                   /translation="MTHVATRNTLQSRLLLLPLLSLPMTLATAANTLETVQVTATLPVG
FT                   GGGAGGFGFGGGSGVHLSESQMDNGGGGGAIPTETAKEQPTDDKEKDCNGRKGNPVVLY
FT                   SGNKVEPELDFASQGEMGLFLQRNYNHYWSATGLFGNHWLSNFDYSLAFTDANQLAWVQ
FT                   RPDGRRIKYLKDPASGRWYEDKAQPIAYLAANGDGTFTLRNENNGTEIYNAEGYITRLS
FT                   NEQGVSWTFSYTDRYLQKVTHSSGRSISFGWTNGQVSQVTDPAGNIYRYTYTPNVFGNG
FT                   RGRLASTTLPGAPATTISYHYEDGRFPGALTGKSFDGVRYSTFAYDAERRAISTEHNGG
FT                   IERFRFSYAVRSTEPVLPPPAPARPGGVRADEERGWCEQRPGGSRICYQPRSLPVDSLP
FT                   MESALGMTAAAAPSLTRPVDIDVTVINPLGRSTTYTFKDGKIVSTKGDPSPNCPASYKE
FT                   QSYDANGYPDLVHDFQDNLTNFDYSAQGYLLKRVEAVGSTAERTTLQEWDTARNRLLKT
FT                   TVVGDLEVAYTYDDRGNVASVTERNLTARGVPSQTRVTRTTYSYHANGLKASIKIDGPL
FT                   PQDDVTSTFNNQGDLTSTTNALGHTISYSNFNGLGLPGRIVNANGGVRELTYDGRGRVV
FT                   SDRTSSGTGWATTAIGYTSAGDIASLTQPDGVTVRYGYDAGRRLTHEVRSLGDGTWAWT
FT                   RHSYNNASNRTRTEVSQTDYPIDTAVKGMIDEITHDGQWNWFARGWACSTGSAGSIQVD
FT                   GYAEGNVYLGSTQANLASEPGVAAACQASGNGYRYQLPISLA"
FT   sig_peptide     42650..42736
FT                   /locus_tag="Smlt0042"
FT                   /note="Signal peptide predicted for Smlt0042 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.899 between residues 29 and 30"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    43406..43534
FT                   /locus_tag="Smlt0042"
FT                   /note="HMMPfam hit to PF05593, RHS Repeat, score 3.1"
FT                   /inference="protein motif:HMMPfam:PF05593"
FT   misc_feature    44093..44221
FT                   /locus_tag="Smlt0042"
FT                   /note="HMMPfam hit to PF05593, RHS Repeat, score 5.9"
FT                   /inference="protein motif:HMMPfam:PF05593"
FT   misc_feature    44234..44452
FT                   /locus_tag="Smlt0042"
FT                   /note="HMMPfam hit to PF05593, RHS Repeat, score 7.8"
FT                   /inference="protein motif:HMMPfam:PF05593"
FT   misc_feature    44468..44593
FT                   /locus_tag="Smlt0042"
FT                   /note="HMMPfam hit to PF05593, RHS Repeat, score 1.3"
FT                   /inference="protein motif:HMMPfam:PF05593"
FT   misc_feature    44603..44719
FT                   /locus_tag="Smlt0042"
FT                   /note="HMMPfam hit to PF05593, RHS Repeat, score 0.58"
FT                   /inference="protein motif:HMMPfam:PF05593"
FT   CDS_pept        45221..45865
FT                   /transl_table=11
FT                   /locus_tag="Smlt0043"
FT                   /product="putative wall-associated protein"
FT                   /note="Similar to codons 315 to 510 of Xanthomonas
FT                   axonopodis pv. citri. WapA UniProt:Q8PMX0 (EMBL:AE011761
FT                   (1199 aa) fasta scores: E()=2.8e-16, 36.364% id in 198 aa,
FT                   and to codons 315 to 510 of Xanthomonas campestris pv.
FT                   vesicatoria (strain 85-10). putative secreted protein
FT                   precursor. UniProt:Q3BVX8 (EMBL:AM039952 (990 aa) fasta
FT                   scores: E()=4.2e-16, 36.364% id in 198 aa"
FT                   /note="similarity:fasta; with=UniProt:Q8PMX0
FT                   (EMBL:AE011761;); Xanthomonas axonopodis pv. citri.; wapA;
FT                   Wall-associated protein.; length=1199; id 36.364%; ungapped
FT                   id 38.919%; E()=2.8e-16; 198 aa overlap; query 2-192;
FT                   subject 316-507"
FT                   /note="similarity:fasta; with=UniProt:Q3BVX8
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; Putative secreted protein precursor.;
FT                   length=990; id 36.364%; ungapped id 38.919%; E()=4.2e-16;
FT                   198 aa overlap; query 2-192; subject 317-508"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43658"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU06"
FT                   /protein_id="CAQ43658.1"
FT                   /translation="MGVNAATTVHIYAGGPAGAGTYLGSVTGTLVPNDDVKAACQSQGA
FT                   YWFGFTLDSNMRNAHGGKPIYVHGISPSGQAHLLLNRSGTFTVPAVVRNAEVVGASAYP
FT                   YQIFNGGSSTLIFEFRNTSNVVWNPGDTYLAFGLNQPNENIALSAPVPPGGVARFSRSV
FT                   GPNNPGSGNRTFSYVARMASGGVAWGAEAKVFLSVENNKGSCGRVVCERPR"
FT   CDS_pept        45995..48031
FT                   /transl_table=11
FT                   /locus_tag="Smlt0044"
FT                   /product="putative RHS-repeat protein"
FT                   /note="Codons 140 to 650 are similar to N-terminus to codon
FT                   520 of Acinetobacter sp. (strain adp1). putative
FT                   RHS-related protein. UniProt:Q6FD94 (EMBL:CR543861 (552 aa)
FT                   fasta scores: E()=5.4e-44, 30.451% id in 532 aa, and
FT                   N-terminus to codon 585 are similar to codon 705 to 1300 of
FT                   Xanthomonas campestris pv. vesicatoria (strain 85-10). RHS
FT                   family protein. UniProt:Q3BMW5 (EMBL:AM039952 (1437 aa)
FT                   fasta scores: E()=2.2e-35, 31.922% id in 614 aa"
FT                   /note="similarity:fasta; with=UniProt:Q6FD94
FT                   (EMBL:CR543861;); Acinetobacter sp. (strain ADP1).;
FT                   Putative RHS-related protein.; length=552; id 30.451%;
FT                   ungapped id 32.465%; E()=5.4e-44; 532 aa overlap; query
FT                   140-654; subject 1-516"
FT                   /note="similarity:fasta; with=UniProt:Q3BMW5
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; Rhs family protein.; length=1437; id
FT                   31.922%; ungapped id 34.938%; E()=2.2e-35; 614 aa overlap;
FT                   query 3-581; subject 704-1299"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43659"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU07"
FT                   /protein_id="CAQ43659.1"
FT                   /translation="MRYAYDAEGRVTQVTDSQNRVTRMSYDARGRLIQSIDAAGGKTQI
FT                   AYDHADRPIRVSDPRNLVTTYEFDGFGQMWKQVSPDTGTTQHQYDAAGLRTSTTRADGS
FT                   VVSFDYDGLGRMTSASAEDRTLGYSYDWCGNGKGLLCGTSGPGTATHFAYTANGSLQIR
FT                   RDFTDLSGQKTDYSTTYGYDGINRLSEITYPNGDKATYSYGSHGKPSALVATVDGTQRS
FT                   IISQASWKATGARGWLAYGNGLGRGYNHDPEGRLTAMSVWGPNSSKVSYWDYQYSGDGE
FT                   ITAIVDAVDPSMTQLIGYDSLSRLTQLTRFGVTNNLSYDAGGNHDRYQAGSQLTQYSID
FT                   PGSNRVLNYTNQDGSRQYQYDALGNRISETAGSRISTYEYDAFNRMSRSNIGGVATDYV
FT                   LNAQGQRVAKINQSTNSRYFYAGQNQLMTELNNGVWTNYFWFDGELVGLARSGQHNYVH
FT                   TDHLGRPEFVTSPSQQTVWKAYNYAYGRSVQKDEIGGLNIGFPGQYYDAESGLWYNGFR
FT                   DYDASIGRYVQSDPIGLAGGMNTYAYVSGNPISRTDPWGLTQCDIDVAFSFAKQNNPDL
FT                   KFGNGAPQVDIPRPGDEGRSDLYGDGRIHLNKRYLDVLDWAGVYNVLDTIIHEGFHFTR
FT                   PRKLQTEENGWDHRYISPEATKRAREQVYNYDKARKATCECTQ"
FT   misc_feature    46007..46120
FT                   /locus_tag="Smlt0044"
FT                   /note="HMMPfam hit to PF05593, RHS Repeat, score 2.2e-09"
FT                   /inference="protein motif:HMMPfam:PF05593"
FT   misc_feature    46133..46240
FT                   /locus_tag="Smlt0044"
FT                   /note="HMMPfam hit to PF05593, RHS Repeat, score 0.0075"
FT                   /inference="protein motif:HMMPfam:PF05593"
FT   misc_feature    46259..46369
FT                   /locus_tag="Smlt0044"
FT                   /note="HMMPfam hit to PF05593, RHS Repeat, score 2.1e-05"
FT                   /inference="protein motif:HMMPfam:PF05593"
FT   misc_feature    46538..46654
FT                   /locus_tag="Smlt0044"
FT                   /note="HMMPfam hit to PF05593, RHS Repeat, score 0.0029"
FT                   /inference="protein motif:HMMPfam:PF05593"
FT   misc_feature    46742..46870
FT                   /locus_tag="Smlt0044"
FT                   /note="HMMPfam hit to PF05593, RHS Repeat, score 2.8"
FT                   /inference="protein motif:HMMPfam:PF05593"
FT   misc_feature    47072..47176
FT                   /locus_tag="Smlt0044"
FT                   /note="HMMPfam hit to PF05593, RHS Repeat, score 0.0015"
FT                   /inference="protein motif:HMMPfam:PF05593"
FT   CDS_pept        48028..48621
FT                   /transl_table=11
FT                   /locus_tag="Smlt0045"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43660"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU08"
FT                   /protein_id="CAQ43660.1"
FT                   /translation="MKFFVYAAYSLLSLAFCTQLIHARELHECIVVSQASNVTDMPDGL
FT                   DEFEQRLWTANSGQIVRKGADTLLLLRVFSEAPGVMDSQQYTKITGILKGYAPSADKAP
FT                   DVGSARLTSGGAGFAHKGDYWLSDAAAVELRQPHSHSSRMEVKVTAVGWNSYRKEHRPF
FT                   DLRFTCQLREIPVDRLSAWQGGNGDLWLSFGPTK"
FT   sig_peptide     48028..48096
FT                   /locus_tag="Smlt0045"
FT                   /note="Signal peptide predicted for Smlt0045 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.977) with cleavage site
FT                   probability 0.975 between residues 23 and 24"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(48633..49343)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0046"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q8PRE5
FT                   (EMBL:AE011624); Xanthomonas axonopodis pv. citri.;
FT                   Hypothetical protein XAC0018.; length=305; id 72.368%;
FT                   ungapped id 72.368%; E()=2e-72; 228 aa overlap; query
FT                   8-235; subject 77-304"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0046"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43661"
FT                   /db_xref="GOA:B2FU09"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU09"
FT                   /protein_id="CAQ43661.1"
FT                   /translation="MHEQGPVDFIEVIHNAVPSEVCAAIVERMRAAQGLRPGAVGSGVF
FT                   PELKHSKDLRISGLDGWQDVDHQLQHAVFNGLLTYLRRYPQALIAPLMLQIQDSNGQPR
FT                   RLSAEDFPDMPPQQLADLARTCLRPGAINLQWYAAGEGGYPYWHCELYPKDAQAETLHR
FT                   HVLWTLYLNDEFEEGETEFLFQGRKIAPRTGSLLIAPTAFTHTHRGNRPQGGDKFIATS
FT                   WILFQSAQKLFGGG"
FT   CDS_pept        complement(49452..50468)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0047"
FT                   /product="putative fructose-1,6-bisphosphatase
FT                   (d-fructose-1,6-bisphosphate 1-phosphohydrolase)"
FT                   /EC_number="3.1.3.11"
FT                   /note="similarity:fasta; with=UniProt:P09195 (EMBL:TAFBP);
FT                   Triticum aestivum (Wheat).; FBP;
FT                   Fructose-1,6-bisphosphatase, chloroplast precursor (EC
FT                   3.1.3.11) (D- fructose-1,6-bisphosphate 1-phosphohydrolase)
FT                   (FBPase).; length=409; id 42.433%; ungapped id 44.828%;
FT                   E()=2.8e-48; 337 aa overlap; query 5-329; subject 75-405"
FT                   /note="similarity:fasta; with=UniProt:Q8PE85
FT                   (EMBL:AE012103); Xanthomonas campestris pv. campestris.;
FT                   cbbFC; Fructose-1,6-bisphosphatase.; length=338; id
FT                   83.432%; ungapped id 83.432%; E()=6.7e-114; 338 aa overlap;
FT                   query 1-338; subject 1-338"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43662"
FT                   /db_xref="GOA:B2FU10"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2FU10"
FT                   /protein_id="CAQ43662.1"
FT                   /translation="MSRTSLTRFLIQEQHAGRINADLRQLIAVVARACTSISIAVSKGA
FT                   LGGVLGDAGTGNVQGEAQKKLDVISNEILLEANAWGGHLAACASEEMDHSQPVPDIYPR
FT                   GDFLLLFDPLDGSSNIDVNVSVGTIFSVLRCPTNVELPGDDAFLQPGSKQIAAGYCIYG
FT                   PSTQLVLTVGHGTHAFTLDREKGEFVLTTENMQIPAATQEFAINMSNQRHWEAPMQAYV
FT                   GDLLAGKEGTRGKNFNMRWIASMVADVHRILTRGGIFIYPWDKKDPSKAGKLRLMYEAN
FT                   PMGLLVEQAGGAAWTGRERILDIQPDQLHQRVPVFLGSREEVAEAVRYHHAHDNAQG"
FT   misc_feature    complement(49470..50459)
FT                   /locus_tag="Smlt0047"
FT                   /note="HMMPfam hit to PF00316, Fructose-1-6-bisphosphatase,
FT                   score 2.8e-164"
FT                   /inference="protein motif:HMMPfam:PF00316"
FT   CDS_pept        complement(50702..51904)
FT                   /transl_table=11
FT                   /gene="aspC"
FT                   /locus_tag="Smlt0048"
FT                   /product="putative aspartate aminotransferase"
FT                   /EC_number="2.6.1.1"
FT                   /note="similarity:fasta; with=UniProt:P72173
FT                   (EMBL:AE004738); Pseudomonas aeruginosa.; aspC; Aspartate
FT                   aminotransferase (EC 2.6.1.1) (Transaminase A) (AspAT).;
FT                   length=398; id 61.558%; ungapped id 61.869%; E()=7.4e-92;
FT                   398 aa overlap; query 1-397; subject 1-397"
FT                   /note="similarity:fasta; with=UniProt:Q5H700
FT                   (EMBL:AE013598); Xanthomonas oryzae pv. oryzae.; tyrB;
FT                   Aromatic-amino-acid aminotransferase.; length=416; id
FT                   79.950%; ungapped id 79.950%; E()=9.4e-121; 399 aa overlap;
FT                   query 1-399; subject 17-415"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43663"
FT                   /db_xref="GOA:B2FU11"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU11"
FT                   /protein_id="CAQ43663.1"
FT                   /translation="MSFFANVELVPGDPILGLTEAYNADSRPTKVNLGVGIYYDESGRI
FT                   PLLRAVKQIEQQLAAEAKPRGYLPIDGLPAYTQATRELVFGKDSPLLAAGRVTTAQTVG
FT                   GSGALRVGADVLKKLLPHATVALSNPSWENHRAVFSAAGFDVLDYTYFDPSTHGVDFDG
FT                   MLADLGKLDAGTVVLLHACCHNPTGADLTVTQWKQVAQLLKDKQLFPFIDMAYQGFDKG
FT                   IEQDGAAVRIIAEAGIDSFIVANSYSKSFSLYGERVGALSMVAPTAADAKAVQSQVKRV
FT                   IRTIYSSPSTHGAALVAGVLTNPELRAMWEQELTEMRERIHALRQGLVEKLAAAGAPQF
FT                   GFINEQAGMFSYSGLSREQVERLRDEFGIYAVGTGRICVAALNQNNLEYVAKAVATVAK
FT                   G"
FT   misc_feature    complement(50723..51823)
FT                   /gene="aspC"
FT                   /locus_tag="Smlt0048"
FT                   /note="HMMPfam hit to PF00155, Aminotransferase class I and
FT                   II, score 1.2e-108"
FT                   /inference="protein motif:HMMPfam:PF00155"
FT   CDS_pept        52076..54169
FT                   /transl_table=11
FT                   /locus_tag="Smlt0049"
FT                   /product="putative iron transporter protein"
FT                   /note="similarity:fasta; with=UniProt:Q3YE91
FT                   (EMBL:DQ141608;); Vibrio parahaemolyticus.; PvuA.;
FT                   length=712; id 22.394%; ungapped id 24.651%; E()=8.5e-12;
FT                   710 aa overlap; query 21-696; subject 34-712"
FT                   /note="similarity:fasta; with=UniProt:Q4V0I1
FT                   (EMBL:CP000050;); Xanthomonas campestris pv. campestris
FT                   (strain 8004).; Iron transporter.; length=727; id 66.277%;
FT                   ungapped id 67.359%; E()=1.6e-180; 685 aa overlap; query
FT                   21-696; subject 43-725"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43664"
FT                   /db_xref="GOA:B2FU12"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU12"
FT                   /protein_id="CAQ43664.1"
FT                   /translation="MNPAARRRCLPLSALLLSPWAAVAEPAPTALPAVQVQAARVPGID
FT                   PFALPASQDTVWIDASRAGTGAQLSEALAGVPGLLARDRQNFAQDTQLSIRGFGARSTF
FT                   GVRGVRVLIDGVPATMPDGQGQLSHASLLGAERIEVLRGPFSALYGNSSGGVLQVWSAQ
FT                   GQAGDPWRLRVNAGADNTLSVGAQLKGAGQVLDYNIAANHFRTDGWRDHSRARRESLNA
FT                   RIGGELGGGRLELLLNALDAPDAQDPLGLTRAQVAADPRQATAVAHQYNTRKTVRQQQA
FT                   GLRWTRETGAQRWQLMGYAGQRAVRQYLPIPPAPQTNSPLHAGGVIDLQGGYGGLDARW
FT                   GWHGDLAGRPLDLVAGLSADRQRQHRTGFENFIGSALGVRGRLRRDQIDVVQNVDQFTQ
FT                   AWWQWSPRWSLLAGLRHSAVRFESNDRYIVGANPDDSGHRRYQATTPVAGVSFEASPQW
FT                   RLHAAVGRGFETPTFNELGYRADGQAGLALDLAAARSRSIEVGSKWHAQDGNQLDISLF
FT                   RADTDDELAVASNIGGRSTYRNIGRTRRQGLELQYRQPLAEHLELQLAWTWLQAQVRSP
FT                   YLTSNTLVAAGSRLPGVPRQQAFARLQWSPADWQWALEATASSDTVVNDVATERAPGYA
FT                   LLHLEAGRRWTLPGGELRAFARLENVLDQAYIGSVIVNDGNGRFYEPGPGRRANVGLQW
FT                   SWR"
FT   sig_peptide     52076..52147
FT                   /locus_tag="Smlt0049"
FT                   /note="Signal peptide predicted for Smlt0049 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.990 between residues 24 and 25"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    52208..52543
FT                   /locus_tag="Smlt0049"
FT                   /note="HMMPfam hit to PF07715, TonB-dependent Receptor Plug
FT                   Domain, score 5.3e-17"
FT                   /inference="protein motif:HMMPfam:PF07715"
FT   repeat_region   52715..52722
FT                   /rpt_unit_seq="(cg)4"
FT   misc_feature    53408..54163
FT                   /locus_tag="Smlt0049"
FT                   /note="HMMPfam hit to PF00593, TonB dependent receptor,
FT                   score 2.3e-29"
FT                   /inference="protein motif:HMMPfam:PF00593"
FT   repeat_region   53962..53969
FT                   /rpt_unit_seq="(gc)4"
FT   CDS_pept        complement(54249..54665)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0050"
FT                   /product="conserved hypothetical protein"
FT                   /note="Codons 105 to the C-terminus are similar to codons
FT                   23 to the C-terminus of xanthomonas campestris pv.
FT                   campestris (strain 8004). hypothetical protein.
FT                   UniProt:Q4UQ58 (EMBL:CP000050 (55 aa) fasta scores:
FT                   E()=0.00022, 70.588% id in 34 aa"
FT                   /note="similarity:fasta; with=UniProt:Q4UQ58
FT                   (EMBL:CP000050;); Xanthomonas campestris pv. campestris
FT                   (strain 8004).; Hypothetical protein.; length=55; id
FT                   70.588%; ungapped id 70.588%; E()=0.00022; 34 aa overlap;
FT                   query 105-138; subject 22-55"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43665"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU13"
FT                   /protein_id="CAQ43665.1"
FT                   /translation="MFMTPGSQRLYLRGGVVESPKGRYQTMSRETSRDPLRENHPPIPG
FT                   EQRGKRDADNADYRGTGAPFFDAEHDHLPVKHEAEQAAQDRKDGGDRHRGGQESPLKRR
FT                   ERKQRASDNQDEALEETFPASDPTSPFVPAKAPD"
FT   CDS_pept        54734..55132
FT                   /transl_table=11
FT                   /locus_tag="Smlt0051"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q8PR35; Xanthomonas
FT                   axonopodis pv. citri.; Hypothetical protein XAC0131.;
FT                   length=152; id 50.794%; ungapped id 51.200%; E()=9.5e-22;
FT                   126 aa overlap; query 2-127; subject 23-147"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43666"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU14"
FT                   /protein_id="CAQ43666.1"
FT                   /translation="MPRLERPAPSVFNALLDPLGQRSAQRRTRRHEDPQAVAQDYLQYM
FT                   LSDYEERRGQSHRNWRDLCPVYAFALTTHAADWPRGDAADTCEELAEHWEQMRGQSRLG
FT                   WSQARPVVEDAWRALDHIPAAAVRPLLQ"
FT   repeat_region   55081..55088
FT                   /rpt_unit_seq="(gc)4"
FT   repeat_region   55101..55112
FT                   /rpt_unit_seq="(cgg)4"
FT   CDS_pept        55297..56217
FT                   /transl_table=11
FT                   /locus_tag="Smlt0052"
FT                   /product="putative Ku domain protein"
FT                   /note="similarity:fasta; with=UniProt:Q8PE77
FT                   (EMBL:AE012104); Xanthomonas campestris pv. campestris.;
FT                   Hypothetical protein XCC0104.; length=313; id 76.677%;
FT                   ungapped id 78.431%; E()=2.4e-86; 313 aa overlap; query
FT                   1-306; subject 1-313"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43667"
FT                   /db_xref="GOA:B2FU15"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR009187"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU15"
FT                   /protein_id="CAQ43667.1"
FT                   /translation="MARPIWTGTLSFGLLNVPVSLMSGERKVDLQFRMLDSRDRKPIRF
FT                   ERVNADTGEEVPWKDIVKAYEYDKGSYVVLEEGDIRSAAPESHEAVEVESFVDAAQIDP
FT                   RYYEKPYLLVPGKKAEKGYVLLRETLRSTGKVGIARVVVRTREYLCAVMPHEDALVLMI
FT                   LRYPQELVDPEDYKLPTGKLSDYRITSKETAMAEQLIESMAGDWDPSQYHDEFRERLQQ
FT                   VLNKRIKSKGGTTRVDDEPAPREDASTNVVDFMALLQKSLDANKRTPAKKAATRKATAK
FT                   SPVKKAAKKTTKKAAKKTAPRRKAG"
FT   misc_feature    55324..55902
FT                   /locus_tag="Smlt0052"
FT                   /note="HMMPfam hit to PF02735, Ku70/Ku80 beta-barrel
FT                   domain, score 1.9e-42"
FT                   /inference="protein motif:HMMPfam:PF02735"
FT   CDS_pept        56221..58707
FT                   /transl_table=11
FT                   /locus_tag="Smlt0053"
FT                   /product="putative ATP-dependent DNA ligase"
FT                   /note="Similar to C-terminus of ralstonia eutropha (strain
FT                   jmp134) (alcaligenes eutrophus). ATP dependent DNA ligase,
FT                   C-terminal:ATP dependent DNA ligase, central.
FT                   UniProt:Q46SV9 (EMBL:CP000091 (930 aa) fasta scores:
FT                   E()=1.8e-108, 40.502% id in 837 aa, and to entire protein
FT                   of rhizobium meliloti (sinorhizobium meliloti).
FT                   hypothetical protein smb20685. UniProt:Q92TV3
FT                   (EMBL:AL591985 (818 aa) fasta scores: E()=6.8e-102, 39.074%
FT                   id in 842 aa"
FT                   /note="similarity:fasta; with=UniProt:Q46SV9
FT                   (EMBL:CP000091;); Ralstonia eutropha (strain JMP134)
FT                   (Alcaligenes eutrophus).; ATP dependent DNA ligase,
FT                   C-terminal:ATP dependent DNA ligase, central.; length=930;
FT                   id 40.502%; ungapped id 42.481%; E()=1.8e-108; 837 aa
FT                   overlap; query 2-823; subject 110-922"
FT                   /note="similarity:fasta; with=UniProt:Q92TV3
FT                   (EMBL:AL591985;); Rhizobium meliloti (Sinorhizobium
FT                   meliloti).; Hypothetical protein SMb20685.; length=818; id
FT                   39.074%; ungapped id 41.384%; E()=6.8e-102; 842 aa overlap;
FT                   query 3-826; subject 6-818"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43668"
FT                   /db_xref="GOA:B2FU16"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014143"
FT                   /db_xref="InterPro:IPR014144"
FT                   /db_xref="InterPro:IPR014145"
FT                   /db_xref="InterPro:IPR014146"
FT                   /db_xref="InterPro:IPR033651"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU16"
FT                   /protein_id="CAQ43668.1"
FT                   /translation="MSLHQYRRKRRLGGGAGQTTEPDDTPAPGDPKQRPTFVIQLHHAS
FT                   SRHYDFRLEMDGVLKSWAVPKGPSLRVGEKRLAVEVEDHPLSYAGFEGDIPEGHYGAGH
FT                   VEVFDHGTWACEGDPLQALAAGKIDFVLHGQRLAGGWKLVRTAMKGRQVQWLLIKRGDG
FT                   EARDAEADDLLTAPMPKRTPAAKKRSADKTARAAPVARTTTRKADVRWHARALQLHGAR
FT                   DAPYPHAFKPQLTDHRDSAPDGDRWLHEIKWDGYRLLADLHDGEVKLRSRNGLDWTDDF
FT                   PEVVQAVQALPVRDARLDGELVVLDKEGRSDFAALQRVIDGSSKQPLRYIVFDLPGVAG
FT                   ADISRAPLLERKALLKELIGPAPGTLAFSEHVIDHGPQVFDASGKAGFEGTVSKQVDAP
FT                   YVNTRARSWVKVKHEDTDEFLIVGYTAPKGSRVGFGSLLLATPDKGGLRYVGRVGTGFD
FT                   DQSLRALLKALQPLAVKTPVLQLPAHVPFRAASVRWVKPVAVAEVAFRGWGKEGLLRQA
FT                   SFKRLRSDKQKEDLGMSTADTETGGEVEITHPERVVFPRQKLRKGDVADYYQRMARWIL
FT                   PEIAGRPLSLLRCPDGVGKACFFQKHHGPGLGDAVHAVPLQQKSGREDYVYVDDARGLL
FT                   QLVQMNTLELHPWGATVADPEHPDRLVFDLDPGEGVSWAQVKAAARDVRDRLQEVGLQS
FT                   FVRLSGGKGVHVVVPLQPKAGWDEAKAFCEAFAQAMALEQPDRYVATMSKAKRGGVIFI
FT                   DWLRNTRGATSVCSWSLRARDAAGVAVPLRWEELARVSAADAFPMAKALARAKRLKGDP
FT                   WQGIARLKQRLPSLKR"
FT   misc_feature    56914..57456
FT                   /locus_tag="Smlt0053"
FT                   /note="HMMPfam hit to PF01068, ATP dependent DNA ligase
FT                   domain, score 5.8e-31"
FT                   /inference="protein motif:HMMPfam:PF01068"
FT   repeat_region   57430..57437
FT                   /rpt_unit_seq="(cg)4"
FT   misc_feature    57508..57735
FT                   /locus_tag="Smlt0053"
FT                   /note="HMMPfam hit to PF04679, ATP dependent DNA ligase C
FT                   terminal re, score 8.6e-11"
FT                   /inference="protein motif:HMMPfam:PF04679"
FT   repeat_region   57606..57613
FT                   /rpt_unit_seq="(gc)4"
FT   repeat_region   58530..58539
FT                   /rpt_unit_seq="(gc)5"
FT   repeat_region   58627..58634
FT                   /rpt_unit_seq="(gc)4"
FT   repeat_region   complement(58701..58731)
FT                   /rpt_family="R=14"
FT                   /inference="nucleotide motif:RepeatScout"
FT   CDS_pept        complement(58779..59117)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0054"
FT                   /product="putative transmembrane protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0054"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43669"
FT                   /db_xref="GOA:B2FU17"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU17"
FT                   /protein_id="CAQ43669.1"
FT                   /translation="MLSLALVSSVAGWLPPLLGLSPDSNSVQLGWDLAFSVLGGVAGIS
FT                   FATYYAPCWPRSHGFSIWSLIALGCGYAMWTAGADFPFWFVISLLASLPLQLLVGWWFG
FT                   RRPSRDLR"
FT   misc_feature    complement(order(58809..58877,58887..58946,58965..59033))
FT                   /locus_tag="Smlt0054"
FT                   /note="3 probable transmembrane helices predicted for
FT                   Smlt0054 by TMHMM2.0 at aa 29-51, 58-77 and 81-103"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(join(59378..60244,70874..71014))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="Smlt0055"
FT                   /product="putative alcohol dehydrogenase, pseudogene"
FT                   /note="Similar to N-terminus of Rhizobium meliloti
FT                   (Sinorhizobium meliloti) AdhA alcohol dehydrogenase (ec
FT                   1.1.1.1). UniProt:O31186 (340 aa) fasta scores:
FT                   E()=1.7e-07, 73.171% id in 41 aa, and to Bradyrhizobium
FT                   japonicum alcohol dehydrogenase. UniProt:Q89IH9 (341 aa)
FT                   fasta scores: E()=8.2e-09, 73.171% id in 41 aa"
FT                   /note="similarity:fasta; with=UniProt:O31186; Rhizobium
FT                   meliloti (Sinorhizobium meliloti).; adhA; Alcohol
FT                   dehydrogenase (EC 1.1.1.1).; length=340; id 73.171%;
FT                   ungapped id 73.171%; E()=1.7e-07; 41 aa overlap; query
FT                   4-44; subject 2-42"
FT                   /note="similarity:fasta; with=UniProt:Q89IH9;
FT                   Bradyrhizobium japonicum.; Alcohol dehydrogenase.;
FT                   length=341; id 73.171%; ungapped id 73.171%; E()=8.2e-09;
FT                   41 aa overlap; query 4-44; subject 3-43"
FT                   /db_xref="PSEUDO:CAQ43670.1"
FT   misc_feature    complement(59492..59905)
FT                   /locus_tag="Smlt0072"
FT                   /note="HMMPfam hit to PF00107, Zinc-binding dehydrogenase,
FT                   score 2e-39"
FT                   /inference="protein motif:HMMPfam:PF00107"
FT   misc_feature    complement(order(59993..60244,70874..70930))
FT                   /locus_tag="Smlt0072"
FT                   /note="HMMPfam hit to PF08240, Alcohol dehydrogenase
FT                   GroES-like domain, score 2e-35"
FT                   /inference="protein motif:HMMPfam:PF08240"
FT   CDS_pept        60466..61656
FT                   /transl_table=11
FT                   /locus_tag="Smlt0056"
FT                   /product="putative integrase"
FT                   /note="similarity:fasta; with=UniProt:Q93UI5; Escherichia
FT                   coli.; Integrase-like gene 1.; length=401; id 38.579%;
FT                   ungapped id 40.000%; E()=7.8e-46; 394 aa overlap; query
FT                   1-389; subject 1-385"
FT                   /note="similarity:fasta; with=UniProt:Q8XY92; Ralstonia
FT                   solanacearum (Pseudomonas solanacearum).; PUTATIVE
FT                   INTEGRASE PROPHAGE PROTEIN.; length=405; id 51.269%;
FT                   ungapped id 51.662%; E()=7.5e-74; 394 aa overlap; query
FT                   1-393; subject 1-392"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43671"
FT                   /db_xref="GOA:B2FU19"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU19"
FT                   /protein_id="CAQ43671.1"
FT                   /translation="MPLTDTAIRKTKPSASVQKLRDGGGLYLLLRPDGAKWWRWDYRRP
FT                   VTGKRNTLSLGTYPDVSLAVARERHVAARKLLAGGIDPGEHRKAQKKAVVESSASTFEA
FT                   VAAEYFSMRAGKLSAESISHERRIVERDLNPYLGRSPVGAIPARELLDALRRIESRGAV
FT                   KTAHRARGIAGRVFRYAIATGRADRNPADDLRGALASSEVQHFPSITDPSLITGLLRAT
FT                   HGYQGSPVVQAALRLAPLVFVRPGELRHALWDDIDLDAGQWRFTATKTGQPHIVPLAVQ
FT                   AVAILRELHPLTCRAKYVFPCMIGKGRPMSENAVNGALRRLGYESGSMTGHGFRAMART
FT                   VLDEVLGFRPDYIEHQLAHAVRDPNGRAYNRTAHLVERAKMMQAWADYLDGLRTSP"
FT   misc_feature    61117..61602
FT                   /locus_tag="Smlt0056"
FT                   /note="HMMPfam hit to PF00589, Phage integrase family,
FT                   score 3e-07"
FT                   /inference="protein motif:HMMPfam:PF00589"
FT   repeat_region   61657..61664
FT                   /rpt_unit_seq="(c)8"
FT   CDS_pept        62251..62523
FT                   /transl_table=11
FT                   /locus_tag="Smlt0057"
FT                   /product="putative phage DNA-binding protein"
FT                   /note="similarity:fasta; with=UniProt:P12552; Bacteriophage
FT                   P4.; Hypothetical protein ORF88 (Putative DNA-binding
FT                   protein).; length=88; id 38.272%; ungapped id 40.789%;
FT                   E()=3e-06; 81 aa overlap; query 1-81; subject 4-79"
FT                   /note="similarity:fasta; with=UniProt:Q7P0B9;
FT                   Chromobacterium violaceum.; Probable prophage regulatory
FT                   protein.; length=72; id 50.000%; ungapped id 50.000%;
FT                   E()=4.9e-07; 58 aa overlap; query 28-85; subject 14-71"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43672"
FT                   /db_xref="GOA:B2FU20"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU20"
FT                   /protein_id="CAQ43672.1"
FT                   /translation="MLGSPTPPATAPGQPADHSRHDAGRGERFLRKPEVLSRTGISRSH
FT                   LYGLMKRGRFPASIPLSPRVTVWLESDVDAWIATHIPDTHLRVQP"
FT   misc_feature    62329..62481
FT                   /locus_tag="Smlt0057"
FT                   /note="HMMPfam hit to PF05930, Prophage CP4-57 regulatory
FT                   protein (AlpA), score 5.7e-25"
FT                   /inference="protein motif:HMMPfam:PF05930"
FT   CDS_pept        62520..62723
FT                   /transl_table=11
FT                   /locus_tag="Smlt0058"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43673"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU21"
FT                   /protein_id="CAQ43673.1"
FT                   /translation="MKDTIVLTISNQKFNLSPEEAKFLAEHLRTAVAQPNLALNFSQSR
FT                   TAQGGRIALSRGVAGSRSVTDC"
FT   CDS_pept        62733..63020
FT                   /transl_table=11
FT                   /locus_tag="Smlt0059"
FT                   /product="putative bacteriophage transcriptional regulator
FT                   protein"
FT                   /note="similarity:fasta; with=UniProt:Q8Y0S9; Ralstonia
FT                   solanacearum (Pseudomonas solanacearum).; PUTATIVE
FT                   BACTERIOPHAGE TRANSCRIPTIONAL ACTIVATOR-RELATED
FT                   TRANSCRIPTION REGULATOR PROTEIN.; length=73; id 40.000%;
FT                   ungapped id 40.000%; E()=1.1e-06; 70 aa overlap; query
FT                   8-77; subject 1-70"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0059"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43674"
FT                   /db_xref="InterPro:IPR007684"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU22"
FT                   /protein_id="CAQ43674.1"
FT                   /translation="MTSSRAFLRCPHCDTAAIVRTSVLHSKLLRESLLQCRNALCGHTF
FT                   SAYTEIVRTHTQSACPRNDICLPISSPAERAALSAQAKQEPVTTPGKARR"
FT   misc_feature    62757..62897
FT                   /locus_tag="Smlt0059"
FT                   /note="HMMPfam hit to PF04606, Ogr/Delta-like zinc finger,
FT                   score 8e-14"
FT                   /inference="protein motif:HMMPfam:PF04606"
FT   CDS_pept        63050..63526
FT                   /transl_table=11
FT                   /locus_tag="Smlt0060"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43675"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU23"
FT                   /protein_id="CAQ43675.1"
FT                   /translation="MQHCPVAAQSATGFSSPNPKAHQRPSTDARRFFVARCVVAGDCLP
FT                   VLRRAVRGGRKACRLLGSGLLTAYRPSPRLAARWRIPTYPRNPAMSHDTLAAPSRFATR
FT                   IAHHLGEIADTLDWDHSRWLALTARLEATGKAPEALTLGEVQHAIAATVQEAAR"
FT   CDS_pept        63523..63738
FT                   /transl_table=11
FT                   /locus_tag="Smlt0061"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q883U7; Pseudomonas
FT                   syringae pv. tomato.; Hypothetical protein.; length=253; id
FT                   35.938%; ungapped id 40.351%; E()=5.5; 64 aa overlap; query
FT                   8-71; subject 26-82"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43676"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU24"
FT                   /protein_id="CAQ43676.1"
FT                   /translation="MNVSALNFAVANDDAATHDLFSAVRQLQRIHTMPMAALTQLVAAL
FT                   ERRPGALEALSVGQLLVMVRDAEVAA"
FT   CDS_pept        63735..64385
FT                   /transl_table=11
FT                   /locus_tag="Smlt0062"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43677"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU25"
FT                   /protein_id="CAQ43677.1"
FT                   /translation="MNTETVRVSGVPGVADGVLSATITDTWFDAERTAHIVEVARRIER
FT                   LHSKASRRLAIVSGELDEALEGHPLEDRLRERLLWPLERDCLELATVAARVRVRLSLFA
FT                   PAQSQEQFDRGMALQLADLQAEQAAVEPPQERAPSAAPMPYGYWISEDSFNRVERARSA
FT                   SLLLSSVGEGIGESVALSFDAVAASAAYVHEDLAAVVASARHSSQMEADDDAA"
FT   repeat_region   64139..64146
FT                   /rpt_unit_seq="(gc)4"
FT   CDS_pept        64372..65223
FT                   /transl_table=11
FT                   /locus_tag="Smlt0063"
FT                   /product="putative primase domain protein"
FT                   /note="Similar to codons 340 to 623 of Escherichia coli
FT                   TraC DNA primase (ec 2.7.7.-) (replication primase).
FT                   UniProt:P27189 (EMBL:ECRP4TRA) (1061 aa) fasta scores:
FT                   E()=9.7e-30, 40.283% id in 283 aa, and to Pelobacter
FT                   propionicus DSM 2379 toprim. UniProt:Q3G182
FT                   (EMBL:AAJH01000013) (277 aa) fasta scores: E()=5.2e-40,
FT                   44.364% id in 275 aa. This CDS is similar to the C-terminus
FT                   of TraC starting at a Met codon"
FT                   /note="similarity:fasta; with=UniProt:P27189
FT                   (EMBL:ECRP4TRA); Escherichia coli.; traC; DNA primase traC
FT                   (EC 2.7.7.-) (Replication primase).; length=1061; id
FT                   40.283%; ungapped id 42.697%; E()=9.7e-30; 283 aa overlap;
FT                   query 4-274; subject 656-934"
FT                   /note="similarity:fasta; with=UniProt:Q3G182
FT                   (EMBL:AAJH01000013); Pelobacter propionicus DSM 2379.;
FT                   TOPRIM.; length=277; id 44.364%; ungapped id 45.522%;
FT                   E()=5.2e-40; 275 aa overlap; query 1-274; subject 1-269"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43678"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU26"
FT                   /protein_id="CAQ43678.1"
FT                   /translation="MTRPEGFIAALRAAGLCVATGDAVLANGRLCRVRAEGDGSGQRSG
FT                   WYVLHAGPPQAGAYGNWKTGLNESWCEAGSEALSEADRAMLREAVVRAQRQQQAERAQR
FT                   QAVARQQARERWQRASAATPDHPYLVAKGVGVHGLRQLDGLLLVPLRDAQGRLWSLQTI
FT                   AADGSKRFLAGGRKRGLYYAVGRTVSDVVCIAEGYATAASIHEATGHPTAVAFDAGNLE
FT                   PVACALRAKFPSAVIVVCADDDAATASRLGINPGVANAQRAADAVGGVVAMPPRPSHEA
FT                   TS"
FT   misc_feature    64939..65193
FT                   /locus_tag="Smlt0063"
FT                   /note="HMMPfam hit to PF01751, Toprim domain, score 0.0012"
FT                   /inference="protein motif:HMMPfam:PF01751"
FT   CDS_pept        65282..67132
FT                   /transl_table=11
FT                   /locus_tag="Smlt0064"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q5WXM2; Legionella
FT                   pneumophila (strain Lens).; Hypothetical protein.;
FT                   length=591; id 44.704%; ungapped id 45.191%; E()=5.8e-93;
FT                   557 aa overlap; query 54-609; subject 35-586"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43679"
FT                   /db_xref="InterPro:IPR009270"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU27"
FT                   /protein_id="CAQ43679.1"
FT                   /translation="MSNVTSVDFNDAAKNAGTGAVRGSIQRAVRKGAKGRTKGNKDAVD
FT                   SASAARAHYQLNETGVYYVGVTEDGDLAEPVFVCSPLKVEAKTRDSQSEQWGRLLTWTD
FT                   ADGHPHQWAAPAEMLVGDPREFVRQLAAGGVEMSAHRNTMQRLLAYIIQERIDTRARNV
FT                   AVPGWHEGRYVLPNGESYGNGAERLVYQHSGGLQHHYAAVGSLEDWRCDVARRCQDNSR
FT                   LVLAVSAMFAGPLLHFTGATGGGFHLVGSSSSGKSTALRVAASVVGPPEYAREWRSTAN
FT                   GLEGVAVLHNDATLILDELAQIDPKQAGDAAYLLANGNGKSRANRAGEARAAARWRVLI
FT                   LSAGEVGLAQHMAEVGKQARAGQSVRLADVPAEAEGGHGVFERLHDASDGAALSALLKD
FT                   AAARTYGAPWPLWMGYLTQQDSPTLTAQLRESTDRFLASYVPEDASGEVRRVAERFAVV
FT                   AFAGELASTCRHRITGWPKGEATRGVATCFQAWLQRRGGSGSADTDELLARVRAFFEAH
FT                   GESRLELLRGPEGTVPVRDRVGFRRFDEVGLTEYLVLQEAFRRELCAGFDVRLAARTLA
FT                   EAGWLKRSADGRPSQAVRIPGLGAIRVFVFDPRKVHDSGL"
FT   misc_feature    65408..66286
FT                   /locus_tag="Smlt0064"
FT                   /note="HMMPfam hit to PF06048, Domain of unknown function
FT                   (DUF927), score 6.3e-05"
FT                   /inference="protein motif:HMMPfam:PF06048"
FT   repeat_region   66807..66818
FT                   /rpt_unit_seq="(gcgt)3"
FT   CDS_pept        67166..67954
FT                   /transl_table=11
FT                   /locus_tag="Smlt0065"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43680"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU28"
FT                   /protein_id="CAQ43680.1"
FT                   /translation="MSASPPSFQRRFNMSNIETTTTTTSELATQPGEGAEVASVSENRR
FT                   RLNELAQQLASAVQRKRALVGKVDTMQRAKQAAQGDAAAARQQWGAKLRQSDGTLTRDI
FT                   QKLRANERSALSLAEEYEAMEGEIAAELPRLELELAEAADRCLSTTNGVIREAASQAYG
FT                   QLLEQAGDSLAVAFALFSRAENAGVNHRQAASDDELASAFFGNLCNAVRHRLDDATVTE
FT                   QVAERLALPPMDMSEVDMQLAGSTAARIRRRVELNAEGVA"
FT   repeat_region   67220..67237
FT                   /rpt_unit_seq="(acc)6"
FT   CDS_pept        67990..68991
FT                   /transl_table=11
FT                   /gene="Q"
FT                   /locus_tag="Smlt0066"
FT                   /product="putative phage portal vertex protein"
FT                   /note="similarity:fasta; with=UniProt:P25480; Bacteriophage
FT                   P2.; Q; Presumed portal vertex protein (GpQ).; length=344;
FT                   id 46.526%; ungapped id 47.095%; E()=3.8e-62; 331 aa
FT                   overlap; query 2-328; subject 9-339"
FT                   /note="similarity:fasta; with=UniProt:Q8P6J8; Xanthomonas
FT                   campestris pv. campestris.; Q; Phage-related capsid
FT                   packaging protein.; length=343; id 66.766%; ungapped id
FT                   67.988%; E()=3.5e-95; 334 aa overlap; query 3-332; subject
FT                   10-341"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43681"
FT                   /db_xref="InterPro:IPR006430"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="InterPro:IPR030935"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU29"
FT                   /protein_id="CAQ43681.1"
FT                   /translation="MPAPSAGTAGAITAFSFGEPTPVLDSRGLFDYLECWRNGRYYEPP
FT                   ITLSGLSRTTRSNPFLHSGLIFKRNMLVRTFVPHRLLDRTAFSQMALDYLVFGMAYMER
FT                   QISYSGRLLQLQPLMAQYMRRGVQPGEFFQVRAGRAEHEFAPGSVYQLREADTDQEIYG
FT                   MPEWLAVVQSALLNESATLFRRRYYTNGSHAGFILYMTDPQPEGMDVDALRQALRDSRG
FT                   PGNFRNLFVHSPNGKKDGLQLIPISEVAAKDEFTGIKRVTRDDILAALRIPPQLLGIVP
FT                   QNAGGFGSIRDAATVWASMELAPLQSRMAMVNEWIGEDVITFAPFDLAPGAT"
FT   sig_peptide     67990..68043
FT                   /gene="Q"
FT                   /locus_tag="Smlt0066"
FT                   /note="Signal peptide predicted for Smlt0066 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.698) with cleavage site
FT                   probability 0.687 between residues 18 and 19"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    68071..68970
FT                   /gene="Q"
FT                   /locus_tag="Smlt0066"
FT                   /note="HMMPfam hit to PF04860, Phage portal protein, score
FT                   2.9e-60"
FT                   /inference="protein motif:HMMPfam:PF04860"
FT   CDS_pept        complement(69087..69434)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0067"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q88AB0; Pseudomonas
FT                   syringae pv. tomato.; Hypothetical protein.; length=116; id
FT                   57.000%; ungapped id 58.163%; E()=2.3e-16; 100 aa overlap;
FT                   query 4-103; subject 18-115"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43682"
FT                   /db_xref="GOA:B2FU30"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR039554"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU30"
FT                   /protein_id="CAQ43682.1"
FT                   /translation="MSKNPHIGSSFDDFLESEGLLEESASVAVKRVIAWQVAEAMKVAK
FT                   VSKSDLAKRMNTSRSQLDRVLDEADTGLTLDTLSRAATALGYRIHVDLVPPKQQGSKRR
FT                   KDATEATVRAA"
FT   CDS_pept        complement(69431..69772)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0068"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:P44031; Haemophilus
FT                   influenzae.; Hypothetical protein HI0660.; length=119; id
FT                   31.579%; ungapped id 35.294%; E()=8.1e-05; 114 aa overlap;
FT                   query 6-111; subject 3-112"
FT                   /note="similarity:fasta; with=UniProt:Q5X919; Legionella
FT                   pneumophila (strain Paris).; Hypothetical protein.;
FT                   length=107; id 47.143%; ungapped id 47.826%; E()=3.8e-06;
FT                   70 aa overlap; query 45-113; subject 38-107"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0068"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43683"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU31"
FT                   /protein_id="CAQ43683.1"
FT                   /translation="MKTVLDVRFYRSASADEPVRIWLKEEVSAEARRAIGGDIKTVQLG
FT                   WPMGMPLVRKMDDRLWEVRSSIPEGIARVMFTTVKQDMVLLHGFVKKSDKTPKADLAVA
FT                   KKRRDEVIK"
FT   misc_feature    complement(69440..69604)
FT                   /locus_tag="Smlt0068"
FT                   /note="HMMPfam hit to PF05973, Phage derived protein
FT                   Gp49-like (DUF891), score 6.5e-13"
FT                   /inference="protein motif:HMMPfam:PF05973"
FT   CDS_pept        complement(69882..70085)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0069"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43684"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU32"
FT                   /protein_id="CAQ43684.1"
FT                   /translation="MRTIRWEQLVTLVTGRTAKTRLIDWLTTARRPFQASQRRLDYVTG
FT                   DCPAPRRQDARTHHRFHRGYLL"
FT   CDS_pept        complement(71111..71749)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0073"
FT                   /product="putative khg/kdpg aldolase"
FT                   /EC_number="4.1.2.14"
FT                   /note="similarity:fasta; with=UniProt:Q9JR44
FT                   (EMBL:AL162756;); Neisseria meningitidis serogroup A.; eda;
FT                   2-keto-4-hydroxyglutarate aldolase (EC 4.1.3.16).;
FT                   length=212; id 51.429%; ungapped id 51.923%; E()=1.7e-35;
FT                   210 aa overlap; query 1-210; subject 1-208"
FT                   /note="similarity:fasta; with=UniProt:P0A955
FT                   (EMBL:L20897;); Escherichia coli.; eda; KHG/KDPG aldolase
FT                   [Includes: 4-hydroxy-2-oxoglutarate aldolase (EC 4.1.3.16)
FT                   (2-keto-4-hydroxyglutarate aldolase) (KHG-aldolase);
FT                   2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14)
FT                   (Phospho-2- dehydro-3-deoxygluconate aldolase)
FT                   (Phospho-2-keto-3-deoxygluconate aldolase)
FT                   (2-keto-3-deoxy-6-phosphogluconate aldolase)
FT                   (KDPG-aldolase)].; length=213; id 49.495%; ungapped id
FT                   49.495%; E()=1.1e-29; 198 aa overlap; query 10-207; subject
FT                   10-207"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43685"
FT                   /db_xref="GOA:B2FU33"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031337"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU33"
FT                   /protein_id="CAQ43685.1"
FT                   /translation="MSSADPRLRALLKLAPVIPVYTPEDVNEAVEVAQALFRGGLPVIE
FT                   VTLRTPQALDAIKAMVEAVPDAVIGAGTVLNAAQMQAAKQAGARFAVSPGATPALYAAA
FT                   RDADLPYLPGAATASDLILGLEHGTDTFKFFPAVQAGGAALLAAWHGPFADVRFCPTGG
FT                   ISAQTAPQFLHLPNVLCVGGSWLTTPALLQTRDWDAIERLAREASVLAS"
FT   misc_feature    complement(71141..71728)
FT                   /locus_tag="Smlt0073"
FT                   /note="HMMPfam hit to PF01081, KDPG and KHG aldolase, score
FT                   2.8e-80"
FT                   /inference="protein motif:HMMPfam:PF01081"
FT   repeat_region   71434..71441
FT                   /rpt_unit_seq="(cg)4"
FT   repeat_region   71483..71490
FT                   /rpt_unit_seq="(gc)4"
FT   repeat_region   71719..71726
FT                   /rpt_unit_seq="(gc)4"
FT   CDS_pept        complement(71863..72519)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0074"
FT                   /product="putative cysteine dioxygenase type I"
FT                   /note="similarity:fasta; with=UniProt:Q2AMT9
FT                   (EMBL:AAOY01000058;); Bacillus weihenstephanensis KBAB4.;
FT                   Cysteine dioxygenase type I.; length=192; id 31.515%;
FT                   ungapped id 32.704%; E()=2.8e-10; 165 aa overlap; query
FT                   39-200; subject 13-174"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43686"
FT                   /db_xref="GOA:B2FU34"
FT                   /db_xref="InterPro:IPR010300"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU34"
FT                   /protein_id="CAQ43686.1"
FT                   /translation="MNAGATRANTNIPLTMLRYSRGMDLQTSPFPAFRGRDRLIAAVDA
FT                   AMTSGDAGRITADLQLALQEAIADSRIELPECVHRPVSDHYARRPLYHSQEHGYSVIAM
FT                   SWGPGQGTPLHDHDAMWCVEGVWLGELEITRYELLECAGERWRFRRHAALRGGCGSAGS
FT                   LIPPHEYHTLRNASDEALAISVHVYEAPMERSAVFDPLGGDWYQRRIQALQADAV"
FT   misc_feature    complement(71917..72381)
FT                   /locus_tag="Smlt0074"
FT                   /note="HMMPfam hit to PF05995, Cysteine dioxygenase type I,
FT                   score 1.1e-06"
FT                   /inference="protein motif:HMMPfam:PF05995"
FT   repeat_region   72496..72503
FT                   /rpt_unit_seq="(cg)4"
FT   CDS_pept        72692..73747
FT                   /transl_table=11
FT                   /locus_tag="Smlt0075"
FT                   /product="putative LacI family transcriptional regulator"
FT                   /note="similarity:fasta; with=UniProt:Q8PE33; Xanthomonas
FT                   campestris pv. campestris.; Transcriptional regulator lacI
FT                   family.; length=355; id 68.768%; ungapped id 69.364%;
FT                   E()=4.8e-85; 349 aa overlap; query 1-347; subject 4-351"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0075"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43687"
FT                   /db_xref="GOA:B2FU35"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU35"
FT                   /protein_id="CAQ43687.1"
FT                   /translation="MSVRNMSDAALPASKGKAATINDIARLSGVSKKTVSRIINNSPLV
FT                   RKDTRDKVEALMREVGYVPDPLARGLAFRRSFLIGLVYDDPGAQCIVDLQHGALEALRG
FT                   TGYELVVHPCNSQDPDCADGVRRFVQQQKLHGVILGPRASESVALAQMLDDIDCRYVRI
FT                   NAHASEEDVQAVVTHDRDGAAAAAGYLLSLGHRDIAVIAGPGDRRAARERTHGFLDRLA
FT                   QVGLTLPGERVLEAGDTFESGVHAAERLLLGGQRPSAIFAGNDEMAAGVYQVALRAGIA
FT                   VPQQLSIVSYDDSPLASRLWPPLTSVRRHVSDIGRVAASMLVQADVPDAPTAASVHPQL
FT                   MVRGSCRAVDA"
FT   misc_feature    72746..72823
FT                   /locus_tag="Smlt0075"
FT                   /note="HMMPfam hit to PF00356, Bacterial regulatory
FT                   proteins, lacI fami, score 1.5e-10"
FT                   /inference="protein motif:HMMPfam:PF00356"
FT   misc_feature    72917..73729
FT                   /locus_tag="Smlt0075"
FT                   /note="HMMPfam hit to PF00532, Periplasmic binding proteins
FT                   and sugar b, score 2e-10"
FT                   /inference="protein motif:HMMPfam:PF00532"
FT   CDS_pept        complement(73912..74382)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0076"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0076"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43688"
FT                   /db_xref="InterPro:IPR029278"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU36"
FT                   /protein_id="CAQ43688.1"
FT                   /translation="MSVETKPRKRVRVIAGDVYAVPLDAEHQSFGYIRAYRDVDIAVLP
FT                   VLSKGRILSITQISTLNSVLDVFLFQEAIREGRWPRVGNVPFEDDASAWAPPRKQVAAI
FT                   RPDVRMVVFQGHFIPAAKFGQYDNLPEFRKFDENDVIEEILRRSGDFLVFDS"
FT   CDS_pept        complement(74625..75518)
FT                   /transl_table=11
FT                   /gene="phhA"
FT                   /locus_tag="Smlt0077"
FT                   /product="putative phenylalanine-4-hydroxylase"
FT                   /EC_number="1.14.16.1"
FT                   /note="similarity:fasta; with=UniProt:Q8PQZ5
FT                   (EMBL:AE011641;); Xanthomonas axonopodis pv. citri.; pah;
FT                   Phenylalanine hydroxylase.; length=296; id 84.589%;
FT                   ungapped id 84.589%; E()=8.7e-103; 292 aa overlap; query
FT                   6-297; subject 5-296"
FT                   /note="similarity:fasta; with=UniProt:P30967
FT                   (EMBL:AE016825;); Chromobacterium violaceum.; phhA;
FT                   Phenylalanine-4-hydroxylase (EC 1.14.16.1) (PAH)
FT                   (Phe-4-monooxygenase).; length=297; id 65.799%; ungapped id
FT                   66.292%; E()=1.9e-71; 269 aa overlap; query 29-297; subject
FT                   31-297"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0077"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43689"
FT                   /db_xref="GOA:B2FU37"
FT                   /db_xref="InterPro:IPR001273"
FT                   /db_xref="InterPro:IPR005960"
FT                   /db_xref="InterPro:IPR018301"
FT                   /db_xref="InterPro:IPR019774"
FT                   /db_xref="InterPro:IPR036329"
FT                   /db_xref="InterPro:IPR036951"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU37"
FT                   /protein_id="CAQ43689.1"
FT                   /translation="MDLAQPRRVEHQQTDKGYVPVYTTALVEQPWDTYTADDHATWSTL
FT                   YQRQRELLVGRACQEFLDAQDEMGMSAHMIPRFEQLNEVLGAATGWTLVGVEGLLPELD
FT                   FFDHLANRRFPVTWWIRRPDQIDYIAEPDLFHDLFGHVPLLMNPVFADYMEAYGRGGVK
FT                   AHAIGPDALQNLTRLYWYTVEFGLIDTPEGLRIYGAGIVSSKGESLYSLESAAPNRIGF
FT                   DLQRIMRTKYRIDTFQKTYFVIDSFEQLMQATSPDFTPIYAALASQAHLPAGDVQGDDR
FT                   VFQKGTGEGWADGGDV"
FT   misc_feature    complement(74718..75503)
FT                   /gene="phhA"
FT                   /locus_tag="Smlt0077"
FT                   /note="HMMPfam hit to PF00351, Biopterin-dependent aromatic
FT                   amino acid h, score 6.5e-12"
FT                   /inference="protein motif:HMMPfam:PF00351"
FT   CDS_pept        75644..76129
FT                   /transl_table=11
FT                   /locus_tag="Smlt0078"
FT                   /product="putative AsnC family transcriptional regulator"
FT                   /note="similarity:fasta; with=UniProt:Q8PQZ4
FT                   (EMBL:AE011641;); Xanthomonas axonopodis pv. citri.;
FT                   Transcriptional regulator asnC family.; length=160; id
FT                   71.698%; ungapped id 71.698%; E()=1.6e-38; 159 aa overlap;
FT                   query 1-159; subject 1-159"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43690"
FT                   /db_xref="GOA:B2FU38"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU38"
FT                   /protein_id="CAQ43690.1"
FT                   /translation="MAGEVQFDRTDIRLLAEIQRDGRATNAELAARVNLSPSACLRRLQ
FT                   RLESEGVIVGYGARLEPRQLRLGLQAFVRVQLEKHDQAAIGHFVDSVQAWDEVVACHAL
FT                   TGDMDYLLHVYVRDLEHFSRFLLDRLLNAGGVADANSSFVLRTVKGFQALPLSQLES"
FT   misc_feature    75854..76084
FT                   /locus_tag="Smlt0078"
FT                   /note="HMMPfam hit to PF01037, AsnC family, score 1.3e-29"
FT                   /inference="protein motif:HMMPfam:PF01037"
FT   CDS_pept        76325..77020
FT                   /transl_table=11
FT                   /locus_tag="Smlt0079"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0079"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43691"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU39"
FT                   /protein_id="CAQ43691.1"
FT                   /translation="MPAAAGASPQIANAQPLALSCGTTEFVGMTSNSSTLAKRQCNGSY
FT                   VYGIGVSVNEAVENLNGFMAVLQAGVSCSADASSIVSGAYGKGVFAQFVCNGWSIAGVG
FT                   NSPTTAARNSLAIATEMAATGTHCAAPLQGSYYPESWGFRFRYDCGNTQTLKSWSISGL
FT                   GASIDDANVIAMRLMRYSTAAGQSCNFEKAEINGVILHATLVCNGSYIHGYGSSVTAAA
FT                   NDALAQIGA"
FT   CDS_pept        complement(77067..78059)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0080"
FT                   /product="putative patatin-like phospholipase"
FT                   /note="similarity:fasta; with=UniProt:Q3YML9
FT                   (EMBL:DQ077748;); uncultured bacterium.; Patatin-like
FT                   phospholipase.; length=287; id 49.831%; ungapped id
FT                   53.455%; E()=1.4e-43; 295 aa overlap; query 1-289; subject
FT                   1-281"
FT                   /note="similarity:fasta; with=UniProt:Q8PE24
FT                   (EMBL:AE012112;); Xanthomonas campestris pv. campestris.;
FT                   Hypothetical protein XCC0159.; length=345; id 73.977%;
FT                   ungapped id 77.370%; E()=9.8e-78; 342 aa overlap; query
FT                   2-330; subject 3-342"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43692"
FT                   /db_xref="GOA:B2FU40"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU40"
FT                   /protein_id="CAQ43692.1"
FT                   /translation="MSLFRPRMLLSVALIGLLAGCGGDPVRPTPPPAPTVVPQAKPVKI
FT                   GIALGGGAAKGFAHIGVIKMLEANGFEPAVVSGTSAGSVVGALYASGMDAFQMQSKAVA
FT                   LDEASIRDVRLFSGGLVQGQKLQDYVNEQVANRPAERLKKPFAAVATQLETGERAIFVR
FT                   GNVGQAVRASSSIPGVFEPVKIGGRNYIDGGVVSPVPVDAARQLGADFVIAVDISSKAS
FT                   GKAPTDMLGIVNQSISIMGQRLGEQELARADIVIRPKVLDIGAADFSQRGTAILEGEKA
FT                   AMAAMPQIRARIQQLQRARAAAAAPAPVAAPKCEEASRLGKLMGRKDKC"
FT   misc_feature    complement(77445..77921)
FT                   /locus_tag="Smlt0080"
FT                   /note="HMMPfam hit to PF01734, Patatin-like phospholipase,
FT                   score 4.7e-45"
FT                   /inference="protein motif:HMMPfam:PF01734"
FT   sig_peptide     complement(77991..78059)
FT                   /locus_tag="Smlt0080"
FT                   /note="Signal peptide predicted for Smlt0080 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.915) with cleavage site
FT                   probability 0.403 between residues 23 and 24"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(78510..79526)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0082"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q3BZC0
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; Hypothetical protein.; length=335; id
FT                   75.000%; ungapped id 76.577%; E()=3.9e-98; 340 aa overlap;
FT                   query 1-338; subject 1-335"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43693"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR025640"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU41"
FT                   /protein_id="CAQ43693.1"
FT                   /translation="MTQWYFHASAQAERIGPLDDEAARRYAQANPRALAWCQGMSGWTP
FT                   IAEVAELQAVAPGMPNTPPPVPVGASGRADDIEFRIVGHEMQFVEIELDPGESAIAEAG
FT                   ALMFKDATVQMDTVFGAANGDQGGGFMGKVMAAGKRVLTGESLFATVYTQSGHGKGKVA
FT                   FAAPYPGTVLAMKLDQHGGRLICQKDSFLAGARGVQIGVQFQRKIMTGLFGGEGFIMQK
FT                   LEGDGWVFIHAGGCVVERELAAGERLDVDTGCVVAYHPTVDMDVRRVAGIKSMLFGGEG
FT                   VFLATLTGPGKVWLQSLPFSRLAGRMWMAAPQGGGQNRGEGSVLGGLGRMLDGDNRF"
FT   misc_feature    complement(78594..79298)
FT                   /locus_tag="Smlt0082"
FT                   /note="HMMPfam hit to PF01987, Protein of unknown function
FT                   DUF124, score 1.2e-97"
FT                   /inference="protein motif:HMMPfam:PF01987"
FT   repeat_region   79427..79434
FT                   /rpt_unit_seq="(gc)4"
FT   CDS_pept        79684..81954
FT                   /transl_table=11
FT                   /locus_tag="Smlt0083"
FT                   /product="putative TonB dependent receptor protein"
FT                   /note="similarity:fasta; with=UniProt:Q9R9W7
FT                   (EMBL:AF126201;); Pseudomonas putida.; SftP.; length=778;
FT                   id 28.730%; ungapped id 32.725%; E()=2.6e-24; 811 aa
FT                   overlap; query 3-756; subject 8-776"
FT                   /note="similarity:fasta; with=UniProt:Q1GX69
FT                   (EMBL:CP000356;); Sphingopyxis alaskensis RB2256.;
FT                   TonB-dependent receptor precursor.; length=754; id 47.375%;
FT                   ungapped id 49.116%; E()=1.3e-126; 762 aa overlap; query
FT                   11-756; subject 4-754"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43694"
FT                   /db_xref="GOA:B2FU42"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU42"
FT                   /protein_id="CAQ43694.1"
FT                   /translation="MSPTRTSRGRLPVARPLVAALSALLPLVAAAQETPAAKDPVALDA
FT                   LQVTAQRRVENAKDVPVALSAIQGEKLDVLGSAGDDIRFLAARVPSLNIESSYGRAFPR
FT                   FYIRGLGNTDFDLNASQPVSLVYDDVVQESPLLKGFPLFDLANVEVLRGPQGTLFGRNT
FT                   PAGVVKFDSARPSQDADGYVRVGYGSYNSWNVQGAYGGPLTDRWSARVSAIYQRRDDWV
FT                   DNTRAGAPNSGFEGYDEAAGRVQFLYEGDDFEALFNLHKRKLNGTARLFRANIIQKGGN
FT                   SLVENFDRDKVANDGVNFSDLETWGGSARLQWNLGSVTLHSITGYETAESLNRGDIDGG
FT                   YGAAFLGAGNYGPGLIPFSSESADGLPHHRQWTQEVRIESNEWGRFDWQAGVFYFDEDV
FT                   TINNFNYDSLTPGNPQTGHVVQNQRNKAWAVFASGDFDVTDRFKLRAGVRYTQDKKDFS
FT                   ASVLQAVPFGTPVSGPYLANTDVNDVSWDVSGVYKLTDDINAYARVAKGFRAPSIQGRL
FT                   AFAPGLSQADSEKVLSYEAGIKADLFERRARLGLSVFRYNVDGQQLIAVGGSNNTATLL
FT                   NADKTIGQGVELDLEAYLADNVLLTFGSSYNDTEIKDKDLAVAICGGGCTINDPTTVIN
FT                   GQTYALVNGNPLPQAPKWIHNATLRVGFPLSDGSELYAYTDWAYRSAVNFFIYESPEFR
FT                   GRSSLEGGLRLGYNWDYGQYDVAVFGRNLTNQTRVVGAIDFNNLTGFLNEPRTWGVEFT
FT                   AKF"
FT   sig_peptide     79684..79776
FT                   /locus_tag="Smlt0083"
FT                   /note="Signal peptide predicted for Smlt0083 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.988 between residues 31 and 32"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    79849..80184
FT                   /locus_tag="Smlt0083"
FT                   /note="HMMPfam hit to PF07715, TonB-dependent Receptor Plug
FT                   Domain, score 3e-16"
FT                   /inference="protein motif:HMMPfam:PF07715"
FT   repeat_region   79941..79948
FT                   /rpt_unit_seq="(cg)4"
FT   repeat_region   80606..80613
FT                   /rpt_unit_seq="(gc)4"
FT   misc_feature    81136..81951
FT                   /locus_tag="Smlt0083"
FT                   /note="HMMPfam hit to PF00593, TonB dependent receptor,
FT                   score 5.2e-23"
FT                   /inference="protein motif:HMMPfam:PF00593"
FT   repeat_region   81319..81326
FT                   /rpt_unit_seq="(cg)4"
FT   repeat_region   82058..82065
FT                   /rpt_unit_seq="(gc)4"
FT   CDS_pept        complement(82066..82905)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0084"
FT                   /product="putative phosphatase"
FT                   /note="similarity:fasta; with=UniProt:Q2PT43
FT                   (EMBL:DQ303409;); uncultured bacterium.; PhoC.; length=281;
FT                   id 49.466%; ungapped id 51.103%; E()=1.7e-45; 281 aa
FT                   overlap; query 3-274; subject 1-281"
FT                   /note="similarity:fasta; with=UniProt:Q8P342
FT                   (EMBL:AE012551;); Xanthomonas campestris pv. campestris.;
FT                   phoC; Phosphatase.; length=280; id 56.767%; ungapped id
FT                   57.854%; E()=1.8e-54; 266 aa overlap; query 9-272; subject
FT                   11-273"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0084"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43695"
FT                   /db_xref="GOA:B2FU43"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR001011"
FT                   /db_xref="InterPro:IPR018296"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU43"
FT                   /protein_id="CAQ43695.1"
FT                   /translation="MSLISHPARPLLGLAVVAALAGCAATATKPTAVEANITTKAVGYL
FT                   DKSAVPASLDLVPAPPVAGSAALALDEQVSREARALRGSPRFAQAGVDAELGFPEGANH
FT                   FSCAADIDVDAVKTPALYRLLERSRIDASAATKAAKNHYQRPRPFMVNGEPTCSPKDEE
FT                   GLRKNGSYPSGHTSIGWAWALILSEIAPDRADAIQARGRNYGESRLVCNVHWQSDILEG
FT                   RFMGAAAVARLHDNAAFNKDLLAARKEIAAARKAGLHSSRDCTTENAVLKVRPQSAL"
FT   misc_feature    complement(82180..82545)
FT                   /locus_tag="Smlt0084"
FT                   /note="HMMPfam hit to PF01569, PAP2 superfamily, score
FT                   2.4e-11"
FT                   /inference="protein motif:HMMPfam:PF01569"
FT   sig_peptide     complement(82825..82905)
FT                   /locus_tag="Smlt0084"
FT                   /note="Signal peptide predicted for Smlt0084 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.324 between residues 27 and 28"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        83169..84047
FT                   /transl_table=11
FT                   /locus_tag="Smlt0085"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q2ZX12
FT                   (EMBL:AALB01000001;); Shewanella putrefaciens CN-32.;
FT                   Hypothetical protein precursor.; length=287; id 69.176%;
FT                   ungapped id 69.675%; E()=3.2e-79; 279 aa overlap; query
FT                   13-290; subject 10-287"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0085"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43696"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU44"
FT                   /protein_id="CAQ43696.1"
FT                   /translation="MRSTATGSTVLALLLGLATAPAQAADVVGVAFVHGTGAQTNATQD
FT                   YWQPAIIDTVRQGLPNSSNYVVINCDFTQYMWKPEAAGCLANQLTSFIDSRGITQLVVI
FT                   THSNGGNVVRWILSNPTYDSRYPKIIRTVRKVTALAPSSAGTPLADAVLNGNTFETSLG
FT                   WLLGYKNDAVRQQQVASMATYNAQNLYGTAGRPALPKPFRAVVGSDVESAVWDSNSYCG
FT                   GYAANVGLEFTQNWLSSCSDGFLECSSQKAAGTTWFTDKARTQGAEPLSHNQSRRECFG
FT                   LGTLLRNDLTQ"
FT   sig_peptide     83169..83240
FT                   /locus_tag="Smlt0085"
FT                   /note="Signal peptide predicted for Smlt0085 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.999 between residues 24 and 25"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        84059..85261
FT                   /transl_table=11
FT                   /locus_tag="Smlt0086"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q33XG7
FT                   (EMBL:AALS01000004;); Shewanella sp. PV-4.; Hypothetical
FT                   protein precursor.; length=428; id 31.421%; ungapped id
FT                   35.593%; E()=1.4e-11; 401 aa overlap; query 19-389; subject
FT                   34-417"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0086"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43697"
FT                   /db_xref="InterPro:IPR031979"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU45"
FT                   /protein_id="CAQ43697.1"
FT                   /translation="MTIQSTLLAGAVLAALSLSAAQAAQPLQAARAGDQVPAALVAAPL
FT                   PADDSERAPLSFAWALDPAQSLQAATPYASVSRSYWQQVDGTQLQRGLDLPLTAADAVI
FT                   QLSPAEGARAVPANSLQVRDPAGRSSVARSVDARALQEAGMPVSDGSSMLRTGATSAAG
FT                   AYTLQSAQAQGRYVVQVLEPNSPLRLEVQANQGQVLAGGNLQLQARLLEDGATPATLAS
FT                   RRSSLGGEALLVAPDGRSWPQRLLRTTDGALRAQVRIPADVGNAQGLWELQVFAQADGV
FT                   LRDGKVAFAVARPTARFSGQAAPDPASRQVALPLQVAAAGRYEARGTLYATGRDGQLKP
FT                   VAQAHAAAWFDGPGRGQLVLPFDQAALPAGFGAPYELRDLQLQDQSRMAPIESRALALR
FT                   F"
FT   sig_peptide     84059..84127
FT                   /locus_tag="Smlt0086"
FT                   /note="Signal peptide predicted for Smlt0086 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.888 between residues 23 and 24"
FT                   /inference="protein motif:SignalP:2.0"
FT   repeat_region   84466..84475
FT                   /rpt_unit_seq="(cg)5"
FT   CDS_pept        complement(85445..86266)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0087"
FT                   /product="putative ATP-binding component of ABC transporter
FT                   protein"
FT                   /note="similarity:fasta; with=UniProt:Q8PQZ0
FT                   (EMBL:AE011642;); Xanthomonas axonopodis pv. citri.; ylmA;
FT                   ABC transporter ATP-binding protein.; length=281; id
FT                   75.746%; ungapped id 75.746%; E()=1.6e-56; 268 aa overlap;
FT                   query 6-273; subject 13-280"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0087"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43698"
FT                   /db_xref="GOA:B2FU46"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU46"
FT                   /protein_id="CAQ43698.1"
FT                   /translation="MTAAPSVAELPPLIELDRATVVRGQVKVLHGLSLRIAQGQHTALL
FT                   GPNGCGKSTFIKLITRELYPLAQGDGSVAVKVLGQNRWQVDRLRSQLGIVTGDLSSNLA
FT                   DMPGLTVEQAVLSGFFASYVVPAFREVTADMRTRVGETLAMTGALSLRERAYAELSAGE
FT                   TRRVLIARALVNRPQALLLDEPSTGLDLVAREQLVATMRVLAQQGITLVLVTHHIEEII
FT                   PEIERVVLLRDGRVLADGTRAELLRSAPLSAVFGGPITVCEQEGRLTAYAG"
FT   misc_feature    complement(85565..86152)
FT                   /locus_tag="Smlt0087"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   2.6e-40"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   CDS_pept        86328..87620
FT                   /transl_table=11
FT                   /locus_tag="Smlt0088"
FT                   /product="putative fatty acid desaturase"
FT                   /note="similarity:fasta; with=UniProt:O65797
FT                   (EMBL:AC024174;); Arabidopsis thaliana (Mouse-ear cress).;
FT                   ADS1; Delta-9 acyl-lipid desaturase 1 (EC 1.14.19.-).;
FT                   length=305; id 29.804%; ungapped id 32.340%; E()=1.1e-15;
FT                   255 aa overlap; query 49-295; subject 61-303"
FT                   /note="similarity:fasta; with=UniProt:Q3BZB8
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; Fatty acid desaturase precursor.;
FT                   length=401; id 82.750%; ungapped id 82.750%; E()=9.4e-138;
FT                   400 aa overlap; query 31-430; subject 2-401"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43699"
FT                   /db_xref="GOA:B2FU47"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU47"
FT                   /protein_id="CAQ43699.1"
FT                   /translation="MTVAITAAGMQFATQAPMMSAIPASIRRAAMPDALMSLLTGGVLG
FT                   LGWWAMLGVLLVFTQITIFSVTLYLHRSQAHRGVDFHPALAHVFRFWLWLTTSMITREW
FT                   VAIHRKHHAKVETEDDPHSPVTRGIGTVFWHGVELYREARGMRADIEQYGRGTPDDAIE
FT                   RHLYTPHATLGPVLLLAINSVLFGLPGVALWAIQMAWIPFWAAGVVNGLGHWWGYRNYE
FT                   SADTSTNLTPWGFWIGGEELHNNHHAFPSSARFAMRRWEFDIGWSAIRLLQALRLAKVL
FT                   RVAPAMDVRPNIAVPDAETLKALLSHRFQAMTDYQRNVFMPALREEAAHAGAKLRRLLP
FT                   RRLRRGLVNDGRWLKPDSRAQLSEWVAQRPRIRTLVEYRARLAALLEARGHDAAERLHQ
FT                   LQAWCREAEESGIAALQAYAARLKGYSLVGA"
FT   misc_feature    86469..87125
FT                   /locus_tag="Smlt0088"
FT                   /note="HMMPfam hit to PF00487, Fatty acid desaturase, score
FT                   5.1e-08"
FT                   /inference="protein motif:HMMPfam:PF00487"
FT   misc_feature    order(86469..86537,86847..86915)
FT                   /locus_tag="Smlt0088"
FT                   /note="2 probable transmembrane helices predicted for
FT                   Smlt0088 by TMHMM2.0 at aa 48-70 and 174-196"
FT                   /inference="protein motif:TMHMM:2.0"
FT   repeat_region   87462..87469
FT                   /rpt_unit_seq="(cg)4"
FT   CDS_pept        87617..87949
FT                   /transl_table=11
FT                   /locus_tag="Smlt0089"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q8PE20
FT                   (EMBL:AE012112;); Xanthomonas campestris pv. campestris.;
FT                   Hypothetical protein XCC0163.; length=117; id 60.000%;
FT                   ungapped id 61.165%; E()=7.3e-20; 105 aa overlap; query
FT                   6-110; subject 15-117"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43700"
FT                   /db_xref="GOA:B2FU48"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU48"
FT                   /protein_id="CAQ43700.1"
FT                   /translation="MRAGYGVLLAVLLPGAALAQVTDTASYLQRMDSDGDGKVSEAEYV
FT                   QWMLYAFDRMDRNGDGVLSAEELPGGKGRAIRREQQRQVIVQRFHKQDANGDGVLDARE
FT                   LAAPPR"
FT   sig_peptide     87617..87673
FT                   /locus_tag="Smlt0089"
FT                   /note="Signal peptide predicted for Smlt0089 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.996 between residues 19 and 20"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        87969..88781
FT                   /transl_table=11
FT                   /gene="fpg"
FT                   /gene_synonym="mutM"
FT                   /locus_tag="Smlt0090"
FT                   /product="putative formamidopyrimidine-dna glycosylase
FT                   (fapy-dna glycosylase) (dna-(apurinic or apyrimidinic site)
FT                   lyase mutm)"
FT                   /EC_number="4.2.99.18"
FT                   /note="similarity:fasta; with=UniProt:Q9L7T2
FT                   (EMBL:AE004473;); Pseudomonas aeruginosa.; mutM;
FT                   Formamidopyrimidine-DNA glycosylase (EC 3.2.2.23) (Fapy-DNA
FT                   glycosylase) (DNA-(apurinic or apyrimidinic site) lyase
FT                   mutM) (EC 4.2.99.18) (AP lyase mutM).; length=269; id
FT                   60.967%; ungapped id 60.967%; E()=7.7e-57; 269 aa overlap;
FT                   query 2-270; subject 1-269"
FT                   /note="similarity:fasta; with=UniProt:Q8P3C4
FT                   (EMBL:AE012540;); Xanthomonas campestris pv. campestris.;
FT                   mutM; Formamidopyrimidine-DNA glycosylase (EC 3.2.2.23)
FT                   (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site)
FT                   lyase mutM) (EC 4.2.99.18) (AP lyase mutM).; length=270; id
FT                   79.630%; ungapped id 79.926%; E()=2.5e-76; 270 aa overlap;
FT                   query 2-270; subject 1-270"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0090"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43701"
FT                   /db_xref="GOA:B2FU49"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2FU49"
FT                   /protein_id="CAQ43701.1"
FT                   /translation="MPELPEVETTRRGLAPHLQGRRVHGVILRRADLRWPIPPEVAELL
FT                   PGQRIEDIRRRAKYLLLDTAIGSAVLHLGMSGSLRVLPGDTPLRAHDHVDISLDNGRLL
FT                   RFNDPRRFGSLLWQPAGEVHPLLQGLGPEPLDDAFDGDYLFARSRGRSAPVKTFLMDQA
FT                   VVVGVGNIYAAESLFKAGISPLREAGKISRERYQRLADAVKEILGYAITRGGTTLRDFI
FT                   SPDGAPGYFEQELLVYGRDGLPCPNCGRALKHATIGQRASVWCSHCQR"
FT   misc_feature    87972..88313
FT                   /gene="fpg"
FT                   /locus_tag="Smlt0090"
FT                   /note="HMMPfam hit to PF01149, Formamidopyrimidine-DNA
FT                   glycosylase N-, score 1.5e-39"
FT                   /inference="protein motif:HMMPfam:PF01149"
FT   repeat_region   88232..88239
FT                   /rpt_unit_seq="(gc)4"
FT   misc_feature    88356..88634
FT                   /gene="fpg"
FT                   /locus_tag="Smlt0090"
FT                   /note="HMMPfam hit to PF06831, Formamidopyrimidine-DNA
FT                   glycosylase H2, score 3.8e-41"
FT                   /inference="protein motif:HMMPfam:PF06831"
FT   CDS_pept        88888..90492
FT                   /transl_table=11
FT                   /gene="mdoD"
FT                   /locus_tag="Smlt0091"
FT                   /product="putative glucan biosynthesis protein d precursor"
FT                   /note="similarity:fasta; with=UniProt:P40120
FT                   (EMBL:X15860;); Escherichia coli.; mdoD; Glucans
FT                   biosynthesis protein D precursor.; length=551; id 45.290%;
FT                   ungapped id 47.529%; E()=5.4e-88; 552 aa overlap; query
FT                   1-534; subject 1-544"
FT                   /note="similarity:fasta; with=UniProt:Q3BM95
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; opgD; Periplasmic glucan biosynthesis
FT                   protein.; length=550; id 80.970%; ungapped id 81.733%;
FT                   E()=6.1e-185; 536 aa overlap; query 1-534; subject 18-550"
FT                   /note="similarity:fasta; with=UniProt:Q8P3C6
FT                   (EMBL:AE012540;); Xanthomonas campestris pv. campestris.;
FT                   opgD; Glucans biosynthesis protein D precursor.;
FT                   length=533; id 80.784%; ungapped id 81.544%; E()=1.1e-184;
FT                   536 aa overlap; query 1-534; subject 1-533"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0091"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43702"
FT                   /db_xref="GOA:B2FU50"
FT                   /db_xref="InterPro:IPR007444"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014438"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR023724"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2FU50"
FT                   /protein_id="CAQ43702.1"
FT                   /translation="MQRRDFIRNASLALAAFGLPSLPACAASRSGQMGLRRLGQPQPFD
FT                   FATLKGQARALAQAPYKSHKRVLPGRLEGLDWDQYQSIGYRQDHALWADQPGKFQAKFF
FT                   HLGLYFHSPVRMFDVVDGKAQELAYDGAAFNYGKSGIKDGELPADLGFAGFRLNTRKDT
FT                   DRDFAAFLGASYFRAVGKEGQYGQSARGLAIDTGMGKPEEFPDFIAYYLEQPSADSDTI
FT                   VVYGLLDSPSVAGAYRFAITNGDVLLMDIDSALYPRKAIERLGIAPCTSMYQVGENDRR
FT                   MAWDWRPEIHDTDGLSLWTGAGEWIWRPLLNPRNLRFNMFVDRNPRGFGLLQRDRNFDH
FT                   YQDDGVFYEKRPCLWVEPKGEWGEGSVQLVEIPTVDETFDNIVAFWNPKEKPQPGQELL
FT                   VGYRLYWGAEPPARPPLAHCVASRTGLGGVVGKKREYFSWRFAVDFEGGELARLIDKGE
FT                   VEAVVEASRGRVEIVSARPLREINGYRAMFDLVPPEGSTEQIDIRLFLRSGGKTLTETW
FT                   LYQYTPPPAGAPERTLY"
FT   sig_peptide     88888..88965
FT                   /gene="mdoD"
FT                   /locus_tag="Smlt0091"
FT                   /note="Signal peptide predicted for Smlt0091 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.797 between residues 26 and 27"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    89017..90465
FT                   /gene="mdoD"
FT                   /locus_tag="Smlt0091"
FT                   /note="HMMPfam hit to PF04349, Periplasmic glucan
FT                   biosynthesis protein, Mdo, score 9.1e-304"
FT                   /inference="protein motif:HMMPfam:PF04349"
FT   repeat_region   89044..89053
FT                   /rpt_unit_seq="(gc)5"
FT   repeat_region   90495..90703
FT                   /rpt_family="R=3"
FT                   /inference="nucleotide motif:RepeatScout"
FT   repeat_region   90543..90987
FT                   /rpt_family="R=8"
FT                   /inference="nucleotide motif:RepeatScout"
FT   repeat_region   complement(90826..91045)
FT                   /rpt_family="R=3"
FT                   /inference="nucleotide motif:RepeatScout"
FT   repeat_region   90966..90983
FT                   /rpt_unit_seq="(ttgctg)3"
FT   CDS_pept        complement(91047..91667)
FT                   /transl_table=11
FT                   /gene="tdk"
FT                   /locus_tag="Smlt0092"
FT                   /product="putative thymidine kinase"
FT                   /EC_number="2.7.1.21"
FT                   /note="similarity:fasta; with=UniProt:P23331
FT                   (EMBL:X51523;); Escherichia coli.; tdk; Thymidine kinase
FT                   (EC 2.7.1.21).; length=205; id 60.317%; ungapped id
FT                   60.638%; E()=1e-40; 189 aa overlap; query 1-189; subject
FT                   1-188"
FT                   /note="similarity:fasta; with=UniProt:Q4UNV0
FT                   (EMBL:CP000050;); Xanthomonas campestris pv. campestris
FT                   (strain 8004).; tdk; Thymidine kinase (EC 2.7.1.21).;
FT                   length=209; id 83.981%; ungapped id 83.981%; E()=2.3e-67;
FT                   206 aa overlap; query 1-206; subject 1-206"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0092"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43703"
FT                   /db_xref="GOA:B2FU51"
FT                   /db_xref="InterPro:IPR001267"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU51"
FT                   /protein_id="CAQ43703.1"
FT                   /translation="MAKLYFYYSAMNAGKTTTLLQSAHNYRERGMRVAILTPRLDDRAG
FT                   AGVVASRIGLRADGMAFDRDTDLQHWVEQDLAANGPMGCVLVDEAQFLTRAQVWQLSEV
FT                   VDQLRIPVLCYGLRTDFRGELFEGSQYLLAWADEMQEIKTICHSGKKATMTVRVDEHGH
FT                   AVKDGPQVEIGGNDRYVSVSRAEFKKITRGEGRIDPAQAPLPL"
FT   misc_feature    complement(91107..91664)
FT                   /gene="tdk"
FT                   /locus_tag="Smlt0092"
FT                   /note="HMMPfam hit to PF00265, Thymidine kinase, score
FT                   1.2e-65"
FT                   /inference="protein motif:HMMPfam:PF00265"
FT   CDS_pept        complement(91677..92408)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0093"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0093"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43704"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU52"
FT                   /protein_id="CAQ43704.1"
FT                   /translation="MKAKQAPRFCLLLGLSMAAAVTARECPVEAPRQIPSTVLTGGFFD
FT                   AHPDLFWRSMAQRAERDRQPARALDYYTRSARYADKFSQAMVARLYQEGLGTRADPVMA
FT                   YIWMDLAAERMYHDFLVLREHYWARLDALQQAQAIERGQQIYADYGDRVAKPRMERALR
FT                   DGRQQITGSRLGYVSSGLIVVQRRGNEQGIVTPGSIVYDNDYWRAADYWCLQDNYWRPA
FT                   RTPSVEIGRPDAVRDDKAVDD"
FT   sig_peptide     complement(92340..92408)
FT                   /locus_tag="Smlt0093"
FT                   /note="Signal peptide predicted for Smlt0093 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.791 between residues 23 and 24"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(92447..93229)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0094"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43705"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU53"
FT                   /protein_id="CAQ43705.1"
FT                   /translation="MHAVPKLLIRHRSTGARCMRPTASAALLGTLLLLLAPLAARSADC
FT                   APDAGASLQSALMTPGFLQAHPDLHWRELGLQSWRQGRPDHALVRFKRAAAHADKLSQS
FT                   LVARMYQEGTGTAPDPVLAYIWMDLAAERGYRDLLLERERYWNRLDAAQRQRVLAEGPA
FT                   LYAAYGDATAKPRMEAAMRVGRSGMTGSRTGWVSSMLQVELSDGPEAGWPTRGDDYYRD
FT                   AYWDPAAYWCMQDRIWEQEFRGRSVEVGPLSPVGGAGR"
FT   misc_feature    complement(92825..92932)
FT                   /locus_tag="Smlt0094"
FT                   /note="HMMPfam hit to PF08238, Sel1 repeat, score 3.3e-05"
FT                   /inference="protein motif:HMMPfam:PF08238"
FT   sig_peptide     complement(93104..93229)
FT                   /locus_tag="Smlt0094"
FT                   /note="Signal peptide predicted for Smlt0094 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.996) with cleavage site
FT                   probability 0.784 between residues 42 and 43"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        93275..95251
FT                   /transl_table=11
FT                   /gene="rep"
FT                   /locus_tag="Smlt0095"
FT                   /product="putative ATP-dependent DNA helicase Rep"
FT                   /EC_number="3.6.1.-"
FT                   /note="similarity:fasta; with=UniProt:P09980
FT                   (EMBL:M11055;); Escherichia coli.; rep; ATP-dependent DNA
FT                   helicase rep (EC 3.6.1.-).; length=673; id 45.224%;
FT                   ungapped id 46.832%; E()=1.2e-100; 670 aa overlap; query
FT                   4-656; subject 3-666"
FT                   /note="similarity:fasta; with=UniProt:Q8P3D2
FT                   (EMBL:AE012539;); Xanthomonas campestris pv. campestris.;
FT                   rep; ATP-dependent DNA helicase.; length=658; id 84.043%;
FT                   ungapped id 84.043%; E()=0; 658 aa overlap; query 1-658;
FT                   subject 1-658"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0095"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43706"
FT                   /db_xref="GOA:B2FU54"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU54"
FT                   /protein_id="CAQ43706.1"
FT                   /translation="MHGLNPPQAAAVLHIEGPLLVLAGAGSGKTRVIVEKIAHLIGSGR
FT                   YPARRIAAITFTNKSAKEMRERVAKRLREQDADEVTICTFHALGLKFLQIEHAAVGLKR
FT                   GFSIFDADDAAAQIKDLMYGAKPDDIEDMKNLVSRAKNAGLSPEQAMAAARSNREKEAA
FT                   SVYERYQLRLTAFNAVDFDDLIRLPVQILEENPEIALAWRERIGYLLVDECQDTNDAQY
FT                   RLLKQLAGDKGNFTCVGDDDQSIYAWRGANPENLQQMGRDYPALEIIKLEQNYRCSNRV
FT                   LRAANALIANNPHEHLKKLWSDQADGERIRVWECRNSEHEAEKVAAEIAFVAQSRNVPW
FT                   SDFCILFRGNFQSRPLEKAMQLLRIPYHLTGGTMFLERQEVKDTLAWLRLLVNPDDDTA
FT                   FMRAVQSPKRDVGAGTLARLAELAQEKDMPMAQAAEAIGALQQLPPRAANSLARFTDIL
FT                   RDLRAQMRQVTSGDMIRKVAKESGLLSELRQQAKEEASYQRRANNIEELAQWFEGGPRG
FT                   ATAADLAGQLALLSRSDKDEGGNQVRMMTMHASKGLEFPYVFIVGCEDGVLPHQVSLDE
FT                   GNLQEERRLLYVGITRAKIQLWMSYSKLTRKFGEHVRLKPSRFFDEIPAEEIQRDGADP
FT                   VADAARKKERASAGLAAIEALFD"
FT   misc_feature    93284..94723
FT                   /gene="rep"
FT                   /locus_tag="Smlt0095"
FT                   /note="HMMPfam hit to PF00580, UvrD/REP helicase, score
FT                   1.3e-183"
FT                   /inference="protein motif:HMMPfam:PF00580"
FT   repeat_region   94657..94664
FT                   /rpt_unit_seq="(gc)4"
FT   repeat_region   complement(95296..95423)
FT                   /rpt_family="R=8"
FT                   /inference="nucleotide motif:RepeatScout"
FT   CDS_pept        95512..96036
FT                   /transl_table=11
FT                   /locus_tag="Smlt0096"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q8PER0
FT                   (EMBL:AE012081;); Xanthomonas axonopodis pv. citri.;
FT                   Acetyltransferase.; length=184; id 42.683%; ungapped id
FT                   42.683%; E()=7.8e-19; 164 aa overlap; query 4-167; subject
FT                   11-174"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0096"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43707"
FT                   /db_xref="GOA:B2FU55"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU55"
FT                   /protein_id="CAQ43707.1"
FT                   /translation="MQPIESERLRLRAIEPDRDAAPMLALLNDPGFVRFIGDRNVRSEE
FT                   QARDYIALRVLHSYALNGFGMYAIERLSDGAWLGNAGLVRRDGLPGPDIGYAVLSEFAG
FT                   QGYAGEAARAVFAHARAGLGLHDLYGITDLDNVVSGKILLGLGMQERGVIQLPGVDSPS
FT                   RLYATPGAAQI"
FT   repeat_region   95866..95873
FT                   /rpt_unit_seq="(gc)4"
FT   CDS_pept        complement(96114..96767)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0097"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q3BMA2
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; Hypothetical protein.; length=222; id
FT                   66.822%; ungapped id 68.421%; E()=4.6e-47; 214 aa overlap;
FT                   query 6-216; subject 3-214"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0097"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43708"
FT                   /db_xref="InterPro:IPR007432"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2FU56"
FT                   /protein_id="CAQ43708.1"
FT                   /translation="MTDSVQTPDVPLLDAVQARLLGCLVEKEATTPDTYPLTVNAAQSA
FT                   ANQKTAREPVMNIDAGSVQHALRQLEALGLARQHFSSRADRYEHRLQAALDLTRQQTVL
FT                   LALLLLRGPQTLGELITRSERLHRFADTDEARHAIERLQQRALLVVLPRASGQREDRYM
FT                   HLLCGEVDGAALAARYASSGGGSSDAADPGLAERVAQLEAAVAELQAQLAELRG"
FT   misc_feature    complement(96246..96731)
FT                   /locus_tag="Smlt0097"
FT                   /note="HMMPfam hit to PF04337, Protein of unknown function,
FT                   DUF480, score 2.9e-84"
FT                   /inference="protein motif:HMMPfam:PF04337"
FT   repeat_region   96329..96336
FT                   /rpt_unit_seq="(gc)4"
FT   repeat_region   96516..96523
FT                   /rpt_unit_seq="(cg)4"
FT   CDS_pept        96869..97792
FT                   /transl_table=11
FT                   /gene="hel"
FT                   /locus_tag="Smlt0098"
FT                   /product="putative lipoprotein E precursor (outer membrane
FT                   protein p4)"
FT                   /note="similarity:fasta; with=UniProt:P26093
FT                   (EMBL:L42023;); Haemophilus influenzae.; hel; Lipoprotein E
FT                   precursor (Outer membrane protein P4) (OMP P4).;
FT                   length=274; id 34.800%; ungapped id 40.278%; E()=5.8e-15;
FT                   250 aa overlap; query 61-301; subject 46-270"
FT                   /note="similarity:fasta; with=UniProt:Q8P3D6
FT                   (EMBL:AE012538;); Xanthomonas campestris pv. campestris.;
FT                   lppC; Acid phosphatase.; length=318; id 77.389%; ungapped
FT                   id 79.412%; E()=5e-88; 314 aa overlap; query 1-306; subject
FT                   4-317"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43709"
FT                   /db_xref="GOA:B2FU57"
FT                   /db_xref="InterPro:IPR005519"
FT                   /db_xref="InterPro:IPR006423"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU57"
FT                   /protein_id="CAQ43709.1"
FT                   /translation="MRRPVSLSLTLLATAALGLSACKRVDAPAAEAAAPEAPAAAAKAD
FT                   GALDATANDNLNAVLWMQRAQEYKAITEQTYRAAADHLDAALKEAHWDALVPEERGNEA
FT                   KGLKPAVVLDVDETVLDNSPYQARLVRDGKEYDELSWDQWVAEKKAKAIPGVVDFAKAA
FT                   NAKGVTLLYISNRAVHLKDATLANLREQGLPVADDSVFLGLGTVVEGCEQAGSEKNCRR
FT                   RLAGQKYRVLMQFGDQLGDFVEVTANTNEGRDALLQQYHDWFGERWWMLPNPTYGGFEP
FT                   AQFNNDYSHSRQARHDAKRAALDYAP"
FT   sig_peptide     96869..96964
FT                   /gene="hel"
FT                   /locus_tag="Smlt0098"
FT                   /note="Signal peptide predicted for Smlt0098 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.674 between residues 32 and 33"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    96953..97705
FT                   /gene="hel"
FT                   /locus_tag="Smlt0098"
FT                   /note="HMMPfam hit to PF03767, HAD superfamily, subfamily
FT                   IIIB (Acid, score 7.1e-47"
FT                   /inference="protein motif:HMMPfam:PF03767"
FT   repeat_region   97057..97064
FT                   /rpt_unit_seq="(gc)4"
FT   repeat_region   97527..97538
FT                   /rpt_unit_seq="(gcc)4"
FT   CDS_pept        97789..98514
FT                   /transl_table=11
FT                   /gene="pyrF"
FT                   /locus_tag="Smlt0099"
FT                   /product="putative orotidine 5'-phosphate decarboxylase"
FT                   /EC_number="4.1.1.23"
FT                   /note="similarity:fasta; with=UniProt:Q59654
FT                   (EMBL:AE004714;); Pseudomonas aeruginosa.; pyrF; Orotidine
FT                   5'-phosphate decarboxylase (EC 4.1.1.23) (OMP
FT                   decarboxylase) (OMPDCase) (OMPdecase).; length=232; id
FT                   41.150%; ungapped id 42.466%; E()=1.3e-20; 226 aa overlap;
FT                   query 14-234; subject 8-231"
FT                   /note="similarity:fasta; with=UniProt:Q3BMA4
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; pyrF; Orotidine 5'-phosphate decarboxylase
FT                   (EC 4.1.1.23) (OMP decarboxylase) (OMPDCase) (OMPdecase).;
FT                   length=243; id 82.353%; ungapped id 82.353%; E()=2.8e-67;
FT                   238 aa overlap; query 1-238; subject 1-238"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0099"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43710"
FT                   /db_xref="GOA:B2FU58"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2FU58"
FT                   /protein_id="CAQ43710.1"
FT                   /translation="MSRAPLPLRDDERLIFALDVPDRAQALEWVDRLGDSVAFYKIGME
FT                   LLASGEYFQVLDELARRDKRVFVDLKFFDIPATAAAVIKRLSQWPVSYATIHGWHPAMM
FT                   EACAAANSSDMRLLAVTVLTSMGRPDLAQMGIDREPVDVVVERALAAQAAGIDGVIASG
FT                   QEAGPIRAATGAGFSIVCPGIRPGGPVGDDQKRTVGVAQAFADGADAIVVGRPIRLATD
FT                   PQAAARAIQQEIASALAAR"
FT   misc_feature    97822..98478
FT                   /gene="pyrF"
FT                   /locus_tag="Smlt0099"
FT                   /note="HMMPfam hit to PF00215, Orotidine 5'-phosphate
FT                   decarboxylase / HUMP, score 1e-60"
FT                   /inference="protein motif:HMMPfam:PF00215"
FT   CDS_pept        98939..99892
FT                   /transl_table=11
FT                   /locus_tag="Smlt0101"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to codons 215 to the C-terminus of
FT                   Xanthomonas campestris pv. campestris hypothetical protein
FT                   xcc4130. UniProt:Q8P3E2 (537 aa) fasta scores: E()=8.8e-44,
FT                   48.113% id in 318 aa"
FT                   /note="similarity:fasta; with=UniProt:Q8P3E2; Xanthomonas
FT                   campestris pv. campestris.; Hypothetical protein XCC4130.;
FT                   length=537; id 48.113%; ungapped id 49.675%; E()=8.8e-44;
FT                   318 aa overlap; query 1-315; subject 216-526"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0101"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43711"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU59"
FT                   /protein_id="CAQ43711.1"
FT                   /translation="MSVAVRGRSARGWGLAAMLLLAVAACRESAQDPAKPAAEPVAAVQ
FT                   AMALRLAEDDLVGYAKLSVPPSQYQRLQQAWTEGHSQWPLTELPLGDQLLPMLAALRKP
FT                   NASAELQRSFDRQLAGQAGAVRQAAQSMGNFGVQYLRHQKGYTPGQQAHYIALVETLAS
FT                   WAQGAPISDRARARSTIAALVGAANKVGFDDEAGLQAAGMEGSLAQLAPFIHTLKAVLG
FT                   SYGLGVDDALRSVRGELLSVEGDNALVRLRYDLAGREMSLQLPLSRREGHWYLTRTLAD
FT                   TDALLRKAEAARAAASPSPAEAPAEGGEAATPPPKP"
FT   sig_peptide     98939..99028
FT                   /locus_tag="Smlt0101"
FT                   /note="Signal peptide predicted for Smlt0101 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.987) with cleavage site
FT                   probability 0.906 between residues 30 and 31"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        99901..102528
FT                   /transl_table=11
FT                   /gene="plsB"
FT                   /locus_tag="Smlt0102"
FT                   /product="putative glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.15"
FT                   /note="similarity:fasta; with=UniProt:P0A7A7
FT                   (EMBL:AF106625;); Escherichia coli.; plsB;
FT                   Glycerol-3-phosphate acyltransferase (EC 2.3.1.15) (GPAT).;
FT                   length=806; id 39.003%; ungapped id 40.559%; E()=4.1e-94;
FT                   782 aa overlap; query 50-821; subject 3-764"
FT                   /note="similarity:fasta; with=UniProt:Q8P3E3
FT                   (EMBL:AE012537;); Xanthomonas campestris pv. campestris.;
FT                   plsB; Glycerol-3-phosphate acyltransferase (EC 2.3.1.15)
FT                   (GPAT).; length=886; id 86.183%; ungapped id 87.171%;
FT                   E()=0; 883 aa overlap; query 1-873; subject 1-883"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0102"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43712"
FT                   /db_xref="GOA:B2FU60"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR022284"
FT                   /db_xref="InterPro:IPR028354"
FT                   /db_xref="InterPro:IPR041728"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU60"
FT                   /protein_id="CAQ43712.1"
FT                   /translation="MSKQNPLPFPGEESQSTPADTVPASPSTGTGPNPVPPPVHARPAG
FT                   RRPLWARLLGRLVEPWLSLKIEPEDPGQYNDGRPVMYVLEDYGLSNALILDKACRQAGL
FT                   PSPLVPLAGDPTGRKRAYLALSRRSSSNSLIPEQRGAKTHSDSLAKVLQAHRVRDDLDV
FT                   HLVPVSIFVGRAPDKQSGWFAVLFSENWALVGRFRRLLAVLLNGRSTIVRFAPPISLRS
FT                   IIDEGLEPERTVRKLQRVLRTHFRRIRESVIGPDLSTRRLLVDQVLAAEPVREAIAAQA
FT                   KRDNSKTADAWKKAHAYAWEIAADYSSPVVRSASFMLSHVWNRIYAGVLVHHLDKFKAA
FT                   APGHEVVYVPSHRSHMDYLLLSYLLYDRGIVPPHIVAGINLNLPVVGTLLRKGGAFFIR
FT                   RSIRGNALYSAVLSEYVAQLVAGGYSLEYFVEGGRSRTGRLLQPKGGMISMTLRAFLRQ
FT                   PRKPVLFQPIYIGYEKLMEGGSYLDELSGRPKEKESIWSLLWGIPKVLKQNYGQVVVNF
FT                   GEPIALNDVLAEKAPEWKGEAVSEDEKPAWLSTTVDTLAERIQVRINGAADVNPINLLA
FT                   LALLSTPKHAMGEADLIAQIELCKTLLVEMPYSDRVTVTPHSPERIIAHAEEINVLTRI
FT                   KHPLGDVLSVSGDTAVLLSYFRNNVLHLFTASSWVACCFQNNRRMSRTGLVQLGRTVYP
FT                   FLQAELFLPWSEDEFAQRIDQTINVFVREGLLQNVNDDDGGILARNTGQTDEVFRLRAI
FT                   GHSLQQAFERYYIAISVLVKNGPGVLGAAELESLCQQAAQRLSLLYAPAAPEFFDRTLF
FT                   RGFIQKLRELRLVWPDENSKLLFDERLDAWAKDAKFILGRELRHTIERVSPEAARPDEP
FT                   APQD"
FT   misc_feature    100882..101313
FT                   /gene="plsB"
FT                   /locus_tag="Smlt0102"
FT                   /note="HMMPfam hit to PF01553, Acyltransferase, score
FT                   5.3e-34"
FT                   /inference="protein motif:HMMPfam:PF01553"
FT   CDS_pept        102902..103831
FT                   /transl_table=11
FT                   /locus_tag="Smlt0103"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q87B85; Xylella
FT                   fastidiosa (strain Temecula1/ATCC 700964).; Hypothetical
FT                   protein.; length=312; id 78.218%; ungapped id 79.264%;
FT                   E()=2.5e-94; 303 aa overlap; query 3-304; subject 13-312"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0103"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43713"
FT                   /db_xref="GOA:B2FU61"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2FU61"
FT                   /protein_id="CAQ43713.1"
FT                   /translation="MEPMSAVISLPDPQPRAARDPRVAEREQHKLAKRLRRQVGEAIAD
FT                   FGMIEAGDKVMVCLSGGKDSYTLLDVLLQLQKKAPVPFELVAVNLDQKQPDFPEHVLPE
FT                   YLAGLGVPYHIIEQDTYSVVSRVIPEGKTMCSLCSRLRRGALYNYAETHGFTKIALGHH
FT                   RDDMVATFFMNLFHHAKLSGMPPKLRSDDGKHVVIRPLAYVRESDIVDYAQARQFPIIP
FT                   CNLCGSQENLQRRQVGLMLKQWEKDHPGRIEQIARAMGEVRPSQLADTTLFDFMALGRR
FT                   DDAPLPDAHAWLAGSPADADADPETPTV"
FT   misc_feature    103061..103675
FT                   /locus_tag="Smlt0103"
FT                   /note="HMMPfam hit to PF01171, PP-loop family, score 5e-12"
FT                   /inference="protein motif:HMMPfam:PF01171"
FT   repeat_region   103666..103673
FT                   /rpt_unit_seq="(cg)4"
FT   CDS_pept        103868..104773
FT                   /transl_table=11
FT                   /gene="rdgC"
FT                   /locus_tag="Smlt0104"
FT                   /product="putative recombination-associated protein"
FT                   /note="similarity:fasta; with=UniProt:P36767; Escherichia
FT                   coli.; rdgC; Recombination-associated protein rdgC.;
FT                   length=303; id 33.333%; ungapped id 33.673%; E()=4.5e-28;
FT                   297 aa overlap; query 1-295; subject 2-297"
FT                   /note="similarity:fasta; with=UniProt:Q8PEW7; Xanthomonas
FT                   axonopodis pv. citri.; rdgC; Recombination-associated
FT                   protein rdgC.; length=301; id 81.728%; ungapped id 81.728%;
FT                   E()=2.5e-98; 301 aa overlap; query 1-301; subject 1-301"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0104"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43714"
FT                   /db_xref="GOA:B2FU62"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU62"
FT                   /protein_id="CAQ43714.1"
FT                   /translation="MFFRNLTFFRFPTTTDFSEVDTLLPHALLKPVGALEMNSRGFISP
FT                   FGREEKELLSHRIAEHLWLTVGGEDKILPAAVVNDLLERKLEEIEEKEGRRPGGRERKR
FT                   MKDDLLHELLPRAFVKSSRNDAFIDLQHGYVAVDTSSRKTGEYFMSDIRGLLGSFPAMP
FT                   LNAEVAPRSILTGWIAGEPLPTGLSLGEECEMKDPVEGGAVVKCQHQELRCDEIDKHLD
FT                   AGKQVTKLALIFEDNLSFVIGDDLIVRKLKFLDGALDQLEHADEDGRRAEFDARFALQS
FT                   AEIRRLFLLLEEAFKLSKAD"
FT   misc_feature    103868..104767
FT                   /gene="rdgC"
FT                   /locus_tag="Smlt0104"
FT                   /note="HMMPfam hit to PF04381, Putative exonuclease, RdgC,
FT                   score 6.1e-154"
FT                   /inference="protein motif:HMMPfam:PF04381"
FT   CDS_pept        104833..105612
FT                   /transl_table=11
FT                   /locus_tag="Smlt0105"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q8P3H4; Xanthomonas
FT                   campestris pv. campestris.; Hypothetical protein XCC4097.;
FT                   length=263; id 72.308%; ungapped id 73.152%; E()=1.4e-71;
FT                   260 aa overlap; query 1-259; subject 3-260"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0105"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43715"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU63"
FT                   /protein_id="CAQ43715.1"
FT                   /translation="MSRLLRRLISPTPPATVQRDTVRLRLEDAEIEVLRVRDPRARRIK
FT                   LSVDERGARLTLPPRASLVMGERFLEQHRDWLALQLRQYQGQGLPAPLQPGEDGVLPLR
FT                   GELLPLRWQEGRYARLEIDAHGACVQWPTRGGDATLRRLLREFYEAQTRADVGRWLPKY
FT                   LPTLPRAPSRLRLKVMSSQWGSLAPDGSMALDLALVLGRPEAFEYVLVHELCHLIQPNH
FT                   SPAFWHEVEQRFPAWREQRDYFQLEGRRLKAMLRQLL"
FT   misc_feature    104956..105573
FT                   /locus_tag="Smlt0105"
FT                   /note="HMMPfam hit to PF01863, Protein of unknown function
FT                   DUF45, score 3.4e-57"
FT                   /inference="protein motif:HMMPfam:PF01863"
FT   repeat_region   104987..104994
FT                   /rpt_unit_seq="(gc)4"
FT   repeat_region   105701..105708
FT                   /rpt_unit_seq="(gc)4"
FT   repeat_region   complement(105758..105878)
FT                   /rpt_family="R=4"
FT                   /inference="nucleotide motif:RepeatScout"
FT   repeat_region   complement(105760..105830)
FT                   /rpt_family="R=6"
FT                   /inference="nucleotide motif:RepeatScout"
FT   CDS_pept        complement(105938..106804)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0106"
FT                   /product="putative methylglyoxal synthase"
FT                   /note="Codons 150 to to C-terminus are similar to
FT                   agrobacterium tumefaciens (strain c58/atcc 33970). mgsa
FT                   UniProt:Q8UIV6 (EMBL:AE007869 (127 aa) fasta scores:
FT                   E()=1.4e-07, 45.217% id in 115 aa, and entire protein is
FT                   similar to bordetella avium (strain 197n). mgsa
FT                   UniProt:Q2L230 (EMBL:AM167904 (298 aa) fasta scores:
FT                   E()=3.2e-76, 70.318% id in 283 aa"
FT                   /note="similarity:fasta; with=UniProt:Q8UIV6
FT                   (EMBL:AE007869;); Agrobacterium tumefaciens (strain
FT                   C58/ATCC 33970).; mgsA; Methylglyoxal synthase (EC 4.2.3.3)
FT                   (MGS).; length=127; id 45.217%; ungapped id 49.524%;
FT                   E()=1.4e-07; 115 aa overlap; query 152-265; subject 2-107"
FT                   /note="similarity:fasta; with=UniProt:Q2L230
FT                   (EMBL:AM167904;); Bordetella avium (strain 197N).; mgsA;
FT                   Putative methylglyoxal synthase (EC 4.2.3.3).; length=298;
FT                   id 70.318%; ungapped id 70.567%; E()=3.2e-76; 283 aa
FT                   overlap; query 1-282; subject 6-288"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0106"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43716"
FT                   /db_xref="GOA:B2FU64"
FT                   /db_xref="InterPro:IPR004363"
FT                   /db_xref="InterPro:IPR018148"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU64"
FT                   /protein_id="CAQ43716.1"
FT                   /translation="MRIGLAANRLHHHDARAALFRWLRVSEPGLRELGVSLHAVGRTHD
FT                   AIQRQGFLTGYAGLHRYPYGREGGLMKLVAEVVGMGPDRTLDGAVYLIDPVDPSSVFPE
FT                   ATALKRQCVIHGKPFISTVATARDWIEVERIHAGLAADAGADDLHAFEGQTLALIAHDA
FT                   MKPAMLAFADEHFDVLARFGERVATGTTGQRLNELAWSRGWPSDTPWVTRYQSGPMGGD
FT                   AQIADRVLEGRCQRAIFFEDPHVARQHEADIQLLERAVTTVTDQAVCITAPRVAARWAA
FT                   AAALRAG"
FT   repeat_region   complement(105953..105993)
FT                   /rpt_family="GC_rich"
FT                   /inference="nucleotide motif:RepeatScout"
FT   repeat_region   105953..105967
FT                   /rpt_unit_seq="(cgc)5"
FT   repeat_region   106423..106430
FT                   /rpt_unit_seq="(cg)4"
FT   repeat_region   106755..106762
FT                   /rpt_unit_seq="(gc)4"
FT   CDS_pept        106963..109380
FT                   /transl_table=11
FT                   /locus_tag="Smlt0107"
FT                   /product="putative sensor histidine kinase transcriptional
FT                   regulatory protein two-component regulator"
FT                   /note="Codons 50 to the C-terminus are similar to codons
FT                   330 to 1090 of Bordetella bronchiseptica (Alcaligenes
FT                   bronchisepticus) BvgS virulence sensor protein bvgs
FT                   precursor (ec 2.7.13.3). UniProt:P26762 (1238 aa) fasta
FT                   scores: E()=1.8e-38, 30.670% id in 776 aa, and codons 400
FT                   to the C-terminus are similar to the N-terminus to codon
FT                   430 of Chromobacterium violaceum probable sensory box
FT                   histidine kinase/response regulator (ec 2.7.3.-).
FT                   UniProt:Q7NWX7 (552 aa) fasta scores: E()=2.7e-42, 40.244%
FT                   id in 410 aa"
FT                   /note="similarity:fasta; with=UniProt:P26762; Bordetella
FT                   bronchiseptica (Alcaligenes bronchisepticus).; bvgS;
FT                   Virulence sensor protein bvgS precursor (EC 2.7.13.3).;
FT                   length=1238; id 30.670%; ungapped id 33.102%; E()=1.8e-38;
FT                   776 aa overlap; query 55-791; subject 331-1088"
FT                   /note="similarity:fasta; with=UniProt:Q7NWX7;
FT                   Chromobacterium violaceum.; Probable sensory box histidine
FT                   kinase/response regulator (EC 2.7.3.-).; length=552; id
FT                   40.244%; ungapped id 41.457%; E()=2.7e-42; 410 aa overlap;
FT                   query 404-802; subject 15-423"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0107"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43717"
FT                   /db_xref="GOA:B2FU65"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU65"
FT                   /protein_id="CAQ43717.1"
FT                   /translation="MPIVNAAGLRAATAVVAGLLLPALAAAADCRTPLRIAWPADRAPL
FT                   SSSEQGQPRGLSAQYLKLLGAQRPLQMQPLPTAAIAEGTVPPDVQALLGWSRSQLPTGW
FT                   VASAPYVQLPQVIVRRRDASPVLGLEALRGGTVASPDPLSLVGALTEQASGVQLLPPAP
FT                   IDDALSLLGTGLVDAVVANLGEVEAALRHYQGEPLVIAAPAGIDDAPVLATVPACADVI
FT                   PVFERAVSQLTANEREAIRTAWLPNQPRHPPSASPLRWLVPASLTLLALMLVYAFGYWR
FT                   VHRESERRRVAAQRLQEVTSNLPAVVYQVRRSATGHYSFPQIAGDVQALFGISVETALI
FT                   DHQRLLAAVHPDDRSRLMDTVDAAALARGPIDVTFRTRSPQGWRWVHSHGRPLSLDSGD
FT                   VEWSGYWIDVSGVQARTHALAEARRAAEQAALAKAHFLATMSHEIRTPMSTLLGMLERL
FT                   EGSDLDHRQQQVLVTVGDAAQMLRQILDDVLHSQRLQALPPQLRPTSVAALVRAVQQLL
FT                   MPVAASRGLHLRIQLDPELQAGSLADGLRLRQILFNLAGNALKFTEHGGVDLQVQVLQQ
FT                   HDRGQRLRLQVSDSGVGISPERQQAVFAAYTQAEASTTRRFGGSGLGLAICRELAASME
FT                   AELCLRSAPGKGTTVWLELDLDACELPAEALPLPAEAARPLSSARVLVAEDHPTNLHLL
FT                   EQRLHDLGLQVHACTDGRQAFEAWQARAFDLVITDCHMPHMDGFALARAIRADACAVRA
FT                   QVPIIALTASALGRTREACREAGIDHFLAKPVAAQELRGLLAVLLAPESMRQ"
FT   sig_peptide     106963..107037
FT                   /locus_tag="Smlt0107"
FT                   /note="Signal peptide predicted for Smlt0107 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.647 between residues 25 and 26"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    107920..108198
FT                   /locus_tag="Smlt0107"
FT                   /note="HMMPfam hit to PF08447, PAS fold, score 9.3e-07"
FT                   /inference="protein motif:HMMPfam:PF08447"
FT   misc_feature    108256..108453
FT                   /locus_tag="Smlt0107"
FT                   /note="HMMPfam hit to PF00512, His Kinase A
FT                   (phosphoacceptor) domain, score 6.9e-17"
FT                   /inference="protein motif:HMMPfam:PF00512"
FT   misc_feature    108586..108933
FT                   /locus_tag="Smlt0107"
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HS, score 4.3e-34"
FT                   /inference="protein motif:HMMPfam:PF02518"
FT   misc_feature    108997..109347
FT                   /locus_tag="Smlt0107"
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 1.8e-29"
FT                   /inference="protein motif:HMMPfam:PF00072"
FT   CDS_pept        complement(109366..110811)
FT                   /transl_table=11
FT                   /gene="gltD"
FT                   /locus_tag="Smlt0108"
FT                   /product="putative glutamate synthase [nadph] small chain"
FT                   /EC_number="1.4.1.13"
FT                   /note="similarity:fasta; with=UniProt:P09832; Escherichia
FT                   coli.; gltD; Glutamate synthase [NADPH] small chain (EC
FT                   1.4.1.13) (Glutamate synthase subunit beta) (NADPH-GOGAT)
FT                   (GLTS beta chain).; length=471; id 57.829%; ungapped id
FT                   59.570%; E()=1.1e-95; 479 aa overlap; query 4-479; subject
FT                   2-469"
FT                   /note="similarity:fasta; with=UniProt:Q8PEE9; Xanthomonas
FT                   campestris pv. campestris.; gltD; Glutamate synthase, beta
FT                   subunit.; length=493; id 86.902%; ungapped id 87.265%;
FT                   E()=1.1e-151; 481 aa overlap; query 1-479; subject 1-481"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0108"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43718"
FT                   /db_xref="GOA:B2FU66"
FT                   /db_xref="InterPro:IPR006006"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU66"
FT                   /protein_id="CAQ43718.1"
FT                   /translation="MSRKHAFQFLDLPRTMPQRIPVELRTSGDWGELYGKFGKEDAQYQ
FT                   AGRCLDCGNPYCSWKCPVHNAIPQWLQLVQENRIHEAATLCHSTNPLPEVCGRVCPQDR
FT                   LCEGSCTLEEFGAVTIGAVEKYIVDTALATGWRPDLGAVQPTGRSVAVIGAGPAGLACA
FT                   DRLARAGIAAVVYDRYEQIGGLLQFGIPSFKLDKDVIHRRREVLEGMGVQFRLGVEIGR
FT                   DLSVQQLLDSHDAVFVGTGAYRYTDGGLDGQDLKGVLPALPFLVQNSRIVGGDDPKGRP
FT                   IAGWEDSIALPDLNGKRVVVLGGGDTGMDCVRSAVRLGAAKVTCAYRRDEANMPGSARE
FT                   VANAREEGVRFLFNRQPLSIEAGADDEVIGVTVVETRLGEPDANGRQNAVPIEGSESLL
FT                   EADVVIIAFGFSPTVPAWLAEHGVEGRSNGRIVAGGKDRLPFQTAHPRLFAGGDAVRGA
FT                   DLVVTAVAEGRDAAASIIRLLAH"
FT   misc_feature    complement(109435..110367)
FT                   /gene="gltD"
FT                   /locus_tag="Smlt0108"
FT                   /note="HMMPfam hit to PF07992, Pyridine
FT                   nucleotide-disulphide oxidoreduc, score 1.4e-06"
FT                   /inference="protein motif:HMMPfam:PF07992"
FT   misc_feature    complement(109585..109920)
FT                   /gene="gltD"
FT                   /locus_tag="Smlt0108"
FT                   /note="HMMPfam hit to PF00070, Pyridine
FT                   nucleotide-disulphide oxidoreduc, score 2.8e-06"
FT                   /inference="protein motif:HMMPfam:PF00070"
FT   repeat_region   109794..109801
FT                   /rpt_unit_seq="(cg)4"
FT   repeat_region   110306..110313
FT                   /rpt_unit_seq="(gc)4"
FT   CDS_pept        complement(110896..115350)
FT                   /transl_table=11
FT                   /gene="gltB"
FT                   /locus_tag="Smlt0109"
FT                   /product="putative glutamate synthase [nadph] large chain
FT                   precursor"
FT                   /EC_number="1.4.1.13"
FT                   /note="similarity:fasta; with=UniProt:P09831; Escherichia
FT                   coli.; gltB; Glutamate synthase [NADPH] large chain
FT                   precursor (EC 1.4.1.13) (Glutamate synthase subunit alpha)
FT                   (NADPH-GOGAT) (GLTS alpha chain).; length=1517; id 53.504%;
FT                   ungapped id 54.050%; E()=0; 1484 aa overlap; query 9-1484;
FT                   subject 33-1509"
FT                   /note="similarity:fasta; with=UniProt:Q8PEE8; Xanthomonas
FT                   campestris pv. campestris.; gltB; Glutamate synthase, alpha
FT                   subunit.; length=1490; id 85.848%; ungapped id 86.312%;
FT                   E()=0; 1491 aa overlap; query 1-1484; subject 1-1490"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43719"
FT                   /db_xref="GOA:B2FU67"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU67"
FT                   /protein_id="CAQ43719.1"
FT                   /translation="MAPRNRQGLYDPRSERDACGFGMVAQLDDQPSRLLVDTAIAALSR
FT                   MTHRGGVAADGLTGDGCGLLLRRPDAFLKLLASEAGITTAARFAAGLVFLPHDADAAQA
FT                   CRAQLQAQVEAVGCKVAGWREVPTDDSVCGQLARDTLPRIEQVFVDAGVGQDDAGFALA
FT                   LFLARRRSEQQLREHADFYVTTLTPDAISYKGMVLPDKLSRFFPDLQRRELASSAIVFH
FT                   QRFSTNTLPRWPLAHPFRMLAHNGEINTIEGNRRWAQARSKVWKTPRFHIGEFDPVISM
FT                   HGSDSQSLDNMLELMVAGGMELIQALRILVPPATQSLEFKDPDLAAFYEFHGLNSEPWD
FT                   GPAGIVACDSRYAVCTLDRNGLRPARWMLTADRHFLVASEAGVWEVPTERVVRKGKLGP
FT                   GEMIAIDLKRGDLLDSDAVDRINRGRAPYKQWLQQGVTYLQTELIDPSLVEEPFDEGTL
FT                   RSYHKLYQLSSEEVEQVLRPLAETEQEATGSMGDDTPMAVLSQRSRPLYDYFRQAFAQV
FT                   TNPPIDPLREDCAMSLSTQLGKETNIFHAGPETVNHVILNSPVLSQRKLRQLLKMEQYV
FT                   QANRLLDLSYSEDEGLRAGIERICAEAEQAARDGMVMLLLSDRYPVAGRPMVHALLATS
FT                   AIHHHLSRLGLRCDVNLIVETGTARDPHHMACLLGFGATAVYPYLAYQTLFDLGRRGIL
FT                   KLSKGGEQSQIGRRYRKGVYKGLSKIISKMGICTVASYRGAQLFEIIGLEPEVVDLCFP
FT                   DTASRIGGAGFARLDADARELCAQAWDAQQDVDVGGLLKYVHGGEYHMYNPDVVTTLQR
FT                   AARSGDPRAWQQYCDAVHARPPSALRDLLELVPAATPVPLDEVAPASTLFPRFDTAAIS
FT                   LGALSPEAHEALAIAMNRLGGRSNSGEGGEDPARYGTAKRSKIKQVASGRFGVTAEYLV
FT                   NAEVLQIKVAQGAKPGEGGQLPGHKVNELIARLRYARPGIGLISPPPHHDIYSIEDLAQ
FT                   LIYDLKQVNPTALVSVKLVSHAGVGTIAAGVVKAGADLITISGHDGGTGASPVSSIRYA
FT                   GVPWELGVAEAHQALLANDLRGRTLLQTDGGLKTGLDVVKAALLGADSFGFGTAPMIVL
FT                   GCKYLRICHLNNCATGVATQDERLRENHFTGQPERVENFFRLLAEEVRGWLAYLGARSL
FT                   EEIVGRTDLLRQIEAAPRDGVRVDLSRLLADARYEGSHCAAQRLYESPDGLATQMDGLL
FT                   APAIEHKRGGEHRFLIHNTDRSIGTRLAGAVARAHGNQGMAEAPLELRFRGSAGQSFGA
FT                   FNVGGLHLEVEGEANDYVGKGMAGGRLVVRPPRGARFEARSTAIIGNTCLYGATGGELF
FT                   AAGRAGERFAVRNSGALAVVEGAGDHCCEYMTDGVVLVLGKVGLNFGAGFTGGLAYVLD
FT                   VDRDFVDRYNHELIDIHRVSAEGFENYRQHLHRLIGRHRELTGSIWAQQILDEFRDYIG
FT                   KFWLVKPKAASIESLTETLRRAA"
FT   misc_feature    complement(111043..111642)
FT                   /gene="gltB"
FT                   /locus_tag="Smlt0109"
FT                   /note="HMMPfam hit to PF01493, GXGXG motif, score 3e-94"
FT                   /inference="protein motif:HMMPfam:PF01493"
FT   repeat_region   111391..111398
FT                   /rpt_unit_seq="(gc)4"
FT   repeat_region   111573..111582
FT                   /rpt_unit_seq="(gc)5"
FT   misc_feature    complement(111859..112953)
FT                   /gene="gltB"
FT                   /locus_tag="Smlt0109"
FT                   /note="HMMPfam hit to PF01645, Conserved region in
FT                   glutamate synthas, score 7.2e-220"
FT                   /inference="protein motif:HMMPfam:PF01645"
FT   repeat_region   112419..112430
FT                   /rpt_unit_seq="(gcg)4"
FT   misc_feature    complement(113116..113979)
FT                   /gene="gltB"
FT                   /locus_tag="Smlt0109"
FT                   /note="HMMPfam hit to PF04898, Glutamate synthase central
FT                   domain, score 2.3e-160"
FT                   /inference="protein motif:HMMPfam:PF04898"
FT   repeat_region   113526..113533
FT                   /rpt_unit_seq="(cg)4"
FT   misc_feature    complement(114208..115296)
FT                   /gene="gltB"
FT                   /locus_tag="Smlt0109"
FT                   /note="HMMPfam hit to PF00310, Glutamine amidotransferases
FT                   class-II, score 1.3e-169"
FT                   /inference="protein motif:HMMPfam:PF00310"
FT   CDS_pept        116026..117081
FT                   /transl_table=11
FT                   /locus_tag="Smlt0110"
FT                   /product="putative viral-like DNA topoisomerase"
FT                   /note="similarity:fasta; with=UniProt:P68698
FT                   (EMBL:AY243312;); Vaccinia virus (strain Western
FT                   Reserve/WR) (VACV).; TOP1; DNA topoisomerase 1 (EC
FT                   5.99.1.2) (DNA topoisomerase I) (Late protein H7).;
FT                   length=314; id 23.288%; ungapped id 25.856%; E()=0.0043;
FT                   292 aa overlap; query 31-311; subject 7-280"
FT                   /note="similarity:fasta; with=UniProt:Q8PEE6
FT                   (EMBL:AE012097;); Xanthomonas campestris pv. campestris.;
FT                   Hypothetical protein XCC0034.; length=394; id 72.917%;
FT                   ungapped id 73.134%; E()=6.7e-96; 336 aa overlap; query
FT                   9-343; subject 17-352"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0110"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43720"
FT                   /db_xref="GOA:B2FU68"
FT                   /db_xref="InterPro:IPR001631"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013500"
FT                   /db_xref="InterPro:IPR014711"
FT                   /db_xref="InterPro:IPR035447"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU68"
FT                   /protein_id="CAQ43720.1"
FT                   /translation="MPTPSTPERQAARAAGLRYVDDTQPGISRRRAGKGFSYRDADGHA
FT                   IRDATTLQRIRALAIPPAYTAVWICAHANGHLQATGRDARGRKQYRYHPDWARERDAGK
FT                   FDRIIAFGEALPTLRRRLSRDLKRPGFPKEKVLAMVVALLADTLVRVGNETYAQQNRSF
FT                   GLTTLRNRHLELLRGGRVRMRFRGKSGQLQEVTVGDRRLGLLVRRLQQLPGQALFQYRD
FT                   DDGALQPVDSGAVNDYLREVMGEDFTAKDFRTWGGTVAAVQAFAATELPEPASQRALAQ
FT                   AQRAVVCEVASLLGNTPAVCRKAYIDPCVFAGWERGELATLAGLRGPRQWEQATLRVLR
FT                   RARRLSRSRSR"
FT   repeat_region   116059..116066
FT                   /rpt_unit_seq="(gc)4"
FT   repeat_region   116853..116860
FT                   /rpt_unit_seq="(gc)4"
FT   CDS_pept        complement(117059..117442)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0111"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q8PEE4; Xanthomonas
FT                   campestris pv. campestris.; Hypothetical protein XCC0036.;
FT                   length=156; id 54.135%; ungapped id 60.000%; E()=5.4e-12;
FT                   133 aa overlap; query 8-127; subject 24-156"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0111"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43721"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU69"
FT                   /protein_id="CAQ43721.1"
FT                   /translation="MMCTAFIPPPRAPSHPARNHTRNASMKHAIATAAVCFALAACSST
FT                   PVAQVQPIDGVISGQCHSDRVRGALGLAASDATVARARVDSDSLHVRVLRHDGPRVPPA
FT                   SEGGDRLTIEKGRTNNITAIYCG"
FT   sig_peptide     complement(117299..117442)
FT                   /locus_tag="Smlt0111"
FT                   /note="Signal peptide predicted for Smlt0111 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.988) with cleavage site
FT                   probability 0.561 between residues 48 and 49"
FT                   /inference="protein motif:SignalP:2.0"
FT   repeat_region   117565..117572
FT                   /rpt_unit_seq="(c)8"
FT   CDS_pept        117870..118703
FT                   /transl_table=11
FT                   /locus_tag="Smlt0112"
FT                   /product="putative short-chain dehydrogenase/reductase"
FT                   /note="Similar, but truncated at the N-terminus, to
FT                   rhizobium loti (mesorhizobium loti). oxidoreductase,
FT                   short-chain dehydrogenase/reductase family. UniProt:Q987Y1
FT                   (EMBL:BA000012 (287 aa) fasta scores: E()=3.2e-57, 60.073%
FT                   id in 273 aa, and similar to entire protein of bordetella
FT                   bronchiseptica (alcaligenes bronchisepticus). putative
FT                   short-chain dehydrogenase. UniProt:Q7WIK5 (EMBL:BX640445
FT                   (335 aa) fasta scores: E()=9e-64, 65.091% id in 275 aa"
FT                   /note="similarity:fasta; with=UniProt:Q987Y1
FT                   (EMBL:BA000012;); Rhizobium loti (Mesorhizobium loti).;
FT                   Oxidoreductase, short-chain dehydrogenase/reductase
FT                   family.; length=287; id 60.073%; ungapped id 60.073%;
FT                   E()=3.2e-57; 273 aa overlap; query 2-274; subject 14-286"
FT                   /note="similarity:fasta; with=UniProt:Q7WIK5
FT                   (EMBL:BX640445;); Bordetella bronchiseptica (Alcaligenes
FT                   bronchisepticus).; Putative short-chain dehydrogenase.;
FT                   length=335; id 65.091%; ungapped id 65.091%; E()=9e-64; 275
FT                   aa overlap; query 1-275; subject 59-333"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0112"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43722"
FT                   /db_xref="GOA:B2FU70"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU70"
FT                   /protein_id="CAQ43722.1"
FT                   /translation="MPAQQLAKPGHEHELELAPRFLAPDYTGSGKLQGMRAIVTGGDSG
FT                   IGRAVAVLFAREGADVAVLHLDEAEDADITRQHVEREGGRCVVIAGDVRDPRFCDKAVK
FT                   QVAKAFGGIDILVNNAAFQLHCERLEDLEDAHLQETLQTNIGGYIQMARAVLPHLGEGA
FT                   SIINTGSETGIFGSKALIDYSATKGAIHAFTKSLASQLLPRGIRVNCVAPGPVWTPLNP
FT                   ADKPAQDVAEFGKDSDMGRPAQPEELSPAYVFLASPACASYISGVILPVMGGPRG"
FT   misc_feature    117972..118475
FT                   /locus_tag="Smlt0112"
FT                   /note="HMMPfam hit to PF00106, short chain dehydrogenase,
FT                   score 9.5e-22"
FT                   /inference="protein motif:HMMPfam:PF00106"
FT   repeat_region   118323..118330
FT                   /rpt_unit_seq="(gc)4"
FT   CDS_pept        118826..120241
FT                   /transl_table=11
FT                   /locus_tag="Smlt0113"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q8PNA9; Xanthomonas
FT                   axonopodis pv. citri.; Hypothetical protein XAC1164.;
FT                   length=437; id 46.819%; ungapped id 55.422%; E()=1.3e-26;
FT                   393 aa overlap; query 14-352; subject 1-386"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0113"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43723"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU71"
FT                   /protein_id="CAQ43723.1"
FT                   /translation="MPEMDISAAADEVVALLRQNDARGAAARLEALHNGQRAVVQESLD
FT                   RYIAARGATELEALRRSGGVSATDAATVKPMLDRLSDATRPPRMPDAAETAGLSQAQQY
FT                   DVYGSIVAQRGNAAANDAMATQDRVVLGLRDENRTTEARGRGVYDDRIVVLWKDAQDHG
FT                   HVREFNQATTEPTAQYDGHAKTTPRSPGFGNVAPRTKTEGEDVNGDRVKDLGRLGEGTT
FT                   EMRATTHPRNGHPDEFALRPSQAAITAGAGRVERDTNGDGWFDARDTQGVQHLNDTFKI
FT                   HRGSRSNTDSAGCQTIGGGEYDDFVATVRGTPGQNRWQYVLTSVAPGQARGLGQDTPLA
FT                   ANDDPRQPQHRDHALQQQISTHLQALGGRYAEHADDYSLVLLREAKAAGITRVDQIVAS
FT                   NPSGGRAAGETLFLVQGNPGDPAAVRAGVNAAEVRETAVETSLRQLQQQAREQGAPVPA
FT                   PAQQHEAPAMGGR"
FT   CDS_pept        120245..121057
FT                   /transl_table=11
FT                   /locus_tag="Smlt0114"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar, but extended at the N-terminus, to
FT                   Xanthomonas axonopodis pv. citri hypothetical protein
FT                   xac1163. UniProt:Q8PNB0 (224 aa) fasta scores: E()=4.8e-10,
FT                   30.435% id in 230 aa, and similar, but truncated at the
FT                   N-terminus, to Xanthomonas axonopodis pv. citri
FT                   hypothetical protein xac1162. UniProt:Q8PNB1 (348 aa) fasta
FT                   scores: E()=1.4e-08, 30.435% id in 276 aa"
FT                   /note="similarity:fasta; with=UniProt:Q8PNB0; Xanthomonas
FT                   axonopodis pv. citri.; Hypothetical protein XAC1163.;
FT                   length=224; id 30.435%; ungapped id 33.816%; E()=4.8e-10;
FT                   230 aa overlap; query 55-268; subject 1-223"
FT                   /note="similarity:fasta; with=UniProt:Q8PNB1; Xanthomonas
FT                   axonopodis pv. citri.; Hypothetical protein XAC1162.;
FT                   length=348; id 30.435%; ungapped id 34.568%; E()=1.4e-08;
FT                   276 aa overlap; query 4-253; subject 57-325"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0114"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43724"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU72"
FT                   /protein_id="CAQ43724.1"
FT                   /translation="MVRLPLMSGLPWVLLLACSACAPAGEYTVPVAPAAKPEAKPETLP
FT                   AQAGPTERGLPALPEASGSAHSGGRYAALPEPARRVLAQLKCNVESAGNAQVLSIPAQG
FT                   GQQDFMVTDRSGPRFRYWMRSFSSNGGTTGYLVQLQDCPATTTGMRAYIAQGAAPLQDV
FT                   TASLLAQAELPDTATMTAYQDRGAGDLFAFIGQLDKVPVVRWVAEADPEQPLADDARSF
FT                   DHGNAIHGGFLRWNQDHFEVARTVPAGLWPCDDSPLLPCRGDPFVTGR"
FT   sig_peptide     120245..120316
FT                   /locus_tag="Smlt0114"
FT                   /note="Signal peptide predicted for Smlt0114 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.993) with cleavage site
FT                   probability 0.645 between residues 24 and 25"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(120992..122143)
FT                   /transl_table=11
FT                   /gene="ampC"
FT                   /locus_tag="Smlt0115"
FT                   /product="putative beta-lactamase precursor
FT                   (cephalosporinase)"
FT                   /EC_number="3.5.2.6"
FT                   /note="similarity:fasta; with=UniProt:P45460; Yersinia
FT                   enterocolitica.; ampC; Beta-lactamase precursor (EC
FT                   3.5.2.6) (Cephalosporinase).; length=388; id 24.935%;
FT                   ungapped id 28.657%; E()=1e-08; 385 aa overlap; query
FT                   1-347; subject 2-374"
FT                   /note="similarity:fasta; with=UniProt:Q7NC81; Gloeobacter
FT                   violaceus.; Gll3098 protein.; length=364; id 31.806%;
FT                   ungapped id 34.302%; E()=9.3e-26; 371 aa overlap; query
FT                   4-365; subject 6-358"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0115"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43725"
FT                   /db_xref="GOA:B2FU73"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU73"
FT                   /protein_id="CAQ43725.1"
FT                   /translation="MSRPMLRVLLMLISALPFAAVSASQDQANDQTRRLIRQIMLEQRI
FT                   PGLQIAVVKDGQTVLSEAYGLANVENGVLASRDTRFPLNSATKAFTGVATAQLAQQGQL
FT                   DLDAPASRYLDDLPPAWRDVRIHQLLAHTSGLPDILDAKGLLGGGSEAQAWAAVTAQPL
FT                   EAEPGQRFAYNQTNYVLLARIIAKQSGMPYERFLATGQFSSARMARTTFGDSYDLIPDA
FT                   ATMYSLAPRATDAADAPSRLSHWFYDIPPSLWAGGGILTTADDTARWLVALTEGRLLPE
FT                   TALRRMWSAERLADGRAGPWAGGWPVLRASPDLQVAGIGGARSAFVVYPERGVAVVVLT
FT                   NLVGANPQQFIPRIADFYARDASTPSHERVAPARQQRAVIAGP"
FT   misc_feature    complement(121061..122050)
FT                   /gene="ampC"
FT                   /locus_tag="Smlt0115"
FT                   /note="HMMPfam hit to PF00144, Beta-lactamase, score
FT                   1.6e-68"
FT                   /inference="protein motif:HMMPfam:PF00144"
FT   repeat_region   121526..121533
FT                   /rpt_unit_seq="(gc)4"
FT   sig_peptide     complement(122060..122143)
FT                   /gene="ampC"
FT                   /locus_tag="Smlt0115"
FT                   /note="Signal peptide predicted for Smlt0115 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.467 between residues 28 and 29"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        122305..122691
FT                   /transl_table=11
FT                   /locus_tag="Smlt0116"
FT                   /product="putative transcriptional regulatory protein"
FT                   /note="similarity:fasta; with=UniProt:P06555; Bacillus
FT                   licheniformis.; blaI; Penicillinase repressor (Regulatory
FT                   protein blaI) (Beta-lactamase repressor protein).;
FT                   length=128; id 22.951%; ungapped id 22.951%; E()=0.039; 122
FT                   aa overlap; query 6-127; subject 7-128"
FT                   /note="similarity:fasta; with=UniProt:Q8PR94; Xanthomonas
FT                   axonopodis pv. citri.; mecI; Methicillin resistance
FT                   protein.; length=128; id 75.591%; ungapped id 75.591%;
FT                   E()=3.2e-31; 127 aa overlap; query 1-127; subject 1-127"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0116"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43726"
FT                   /db_xref="GOA:B2FU74"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU74"
FT                   /protein_id="CAQ43726.1"
FT                   /translation="MRGKTIGDQELALLQYIDEHAPATVGEVASGYGEARGLARSTVLT
FT                   MMERLRAKGYLQRRQQDGVYRYQATRGPQSVLQGAVAQFVDNTLQGSVSPFVAYLSQRQ
FT                   QVSDNELAELEALVAQLQSRRHEG"
FT   misc_feature    122320..122664
FT                   /locus_tag="Smlt0116"
FT                   /note="HMMPfam hit to PF03965, Penicillinase repressor,
FT                   score 1.1e-37"
FT                   /inference="protein motif:HMMPfam:PF03965"
FT   CDS_pept        122695..124692
FT                   /transl_table=11
FT                   /locus_tag="Smlt0117"
FT                   /product="putative transmembrane BlaR protein"
FT                   /note="similarity:fasta; with=UniProt:Q8PED5; Xanthomonas
FT                   campestris pv. campestris.; Ankyrin-like protein.;
FT                   length=570; id 44.254%; ungapped id 46.995%; E()=1.2e-45;
FT                   583 aa overlap; query 3-568; subject 2-567"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0117"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43727"
FT                   /db_xref="GOA:B2FU75"
FT                   /db_xref="InterPro:IPR008756"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU75"
FT                   /protein_id="CAQ43727.1"
FT                   /translation="MDTTMLIPMLERLGWTSLQTVLLVALVYGLCRALPSLSAATRCRL
FT                   WWLVSLQAVLGLFWSQPLQLAWLPAPQAVAMTATDVAADIVYPLAPEASAQLLAAMPLP
FT                   AAEVPAVAWWAVALAALWLSGVLMMALRTFGEWRRCRALLAAAYPCEDEALVQALQLAS
FT                   DAHGVRRAPRLWMSMQVDAPQLVGPFRPVLLLPAGDNVLQGDALDLALTHELQHLQRRD
FT                   LQWGLLPALAQHLFFFHPLLRLSVREYAQAREEAVDAAVVGQHGASRQAYGRLLLQLGV
FT                   APQPHLGVASAAPSTTSLKRRLLSLQSHRSCPRLLAVALTAVVVVVGVAPMRLVAAPVP
FT                   PAPPAPPAAPTAVVPPPPKAPEAPPAPASAARVPAEPVAPAPPAEPADMEEPSGPDDAD
FT                   VADVADVDDAAGMDEDHDGTTTTSSITTYGRLDLGKSPREAFVLVDGDSTFANGGMDDV
FT                   MVARRQLGKGPALWFRQGDKRYVVRDPMLIQSLQRAYAGAADLGRQQSELGRQQSALGR
FT                   QQGDLGKQMGEMGRLQGEEARRLALAAAEAARSAMAAHDINREAAAEAAKAARGATNDA
FT                   AVAREAAREAAAEARRAMQEVDNETARASRTRAMQRLASQQSELASRQTTLGSQQAALG
FT                   ERQARVHAQASQQAQQVIARALASGKAERL"
FT   misc_feature    order(122737..122796,122830..122898,123019..123087,
FT                   123637..123705)
FT                   /locus_tag="Smlt0117"
FT                   /note="4 probable transmembrane helices predicted for
FT                   Smlt0117 by TMHMM2.0 at aa 15-34, 46-68, 109-131 and
FT                   315-337"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    123241..123525
FT                   /locus_tag="Smlt0117"
FT                   /note="HMMPfam hit to PF05569, BlaR1 peptidase M56, score
FT                   5.1e-30"
FT                   /inference="protein motif:HMMPfam:PF05569"
FT   repeat_region   123269..123280
FT                   /rpt_unit_seq="(tgc)4"
FT   repeat_region   123661..123675
FT                   /rpt_unit_seq="(gtg)5"
FT   repeat_region   complement(123703..123768)
FT                   /rpt_family="GC_rich"
FT                   /inference="nucleotide motif:RepeatScout"
FT   repeat_region   123804..123811
FT                   /rpt_unit_seq="(cg)4"
FT   repeat_region   124653..124660
FT                   /rpt_unit_seq="(cg)4"
FT   repeat_region   124721..124728
FT                   /rpt_unit_seq="(g)8"
FT   CDS_pept        complement(124759..125073)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0118"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q88K30; Pseudomonas
FT                   putida (strain KT2440).; Hypothetical protein.; length=124;
FT                   id 33.333%; ungapped id 35.417%; E()=2.7e-05; 102 aa
FT                   overlap; query 6-104; subject 26-124"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0118"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43728"
FT                   /db_xref="InterPro:IPR021719"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU76"
FT                   /protein_id="CAQ43728.1"
FT                   /translation="MRLNPLVLLAILPLAACSHAGSSTSHDPAPAPVADAAHECKPEAL
FT                   DAFTGRTADEATIKKLVADSGARNARVVKPGMAVTMDFRQDRVTVQVDAQNRIERASCG
FT                   "
FT   sig_peptide     complement(125014..125073)
FT                   /locus_tag="Smlt0118"
FT                   /note="Signal peptide predicted for Smlt0118 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.697 between residues 20 and 21"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(125140..126063)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0119"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q8PEC8; Xanthomonas
FT                   campestris pv. campestris.; Hypothetical protein XCC0053.;
FT                   length=321; id 66.454%; ungapped id 70.034%; E()=5.6e-71;
FT                   313 aa overlap; query 1-302; subject 10-317"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0119"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43729"
FT                   /db_xref="GOA:B2FU77"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU77"
FT                   /protein_id="CAQ43729.1"
FT                   /translation="MAANDARQPPAERSVFAWVEQEIRHKPTGAAVSTPAPAPLRRPEV
FT                   GGLHRLLGLRSRGGAAPARASAQDRQLPGEEIAPGLFLIESLQPQPIPTAPLSLAFAKR
FT                   EDQHVAARDLLFFDTETTGLAGGTGTRAFMIGAADWHVCPQRGEGLRIRQLLMSTMAAE
FT                   EAMLATFASWLQPSTVFCSYNGRSYDAPLLKARYRLARQRDPITALDHVDLLYPTRRRY
FT                   RGTWENCRLSTIERQLLRVVREDDLPGSEAPGAWLRFLRGGDAVNLRRVADHNHQDVVT
FT                   LALLLQRLVHEEQRERETLALALVGQ"
FT   repeat_region   125151..125168
FT                   /rpt_unit_seq="(ccagcg)3"
FT   CDS_pept        complement(126165..128654)
FT                   /transl_table=11
FT                   /gene="lhr"
FT                   /locus_tag="Smlt0120"
FT                   /product="putative helicase"
FT                   /note="similarity:fasta; with=UniProt:Q6H8N2; Halobacterium
FT                   volcanii (Haloferax volcanii).; lhr; Putative helicase
FT                   Lhr.; length=918; id 28.453%; ungapped id 32.595%;
FT                   E()=2.4e-11; 362 aa overlap; query 92-421; subject 71-418"
FT                   /note="similarity:fasta; with=UniProt:Q8PEC7; Xanthomonas
FT                   campestris pv. campestris.; ATP-dependent RNA helicase.;
FT                   length=802; id 88.510%; ungapped id 88.959%; E()=0; 792 aa
FT                   overlap; query 29-816; subject 1-792"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0120"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43730"
FT                   /db_xref="GOA:B2FU78"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU78"
FT                   /protein_id="CAQ43730.1"
FT                   /translation="MAYELAKRTADAEQKLATRDGLPARDGALLSARLQRRYQDRITGS
FT                   FAIPGREGRYAPIPDSVPPALAAALKARGIEQLYSHQAEAWEASQRGEHVAIVTPTASG
FT                   KSLCYTLPVVSAAMQDKAKALYLFPTKALAQDQVAELLELNRAGDLGVKAFTFDGDTPG
FT                   DARQAIRLHGDIVVSNPDMLHQAILPHHTKWAQFFENLRYIVIDEVHTYRGVFGSHVTN
FT                   VLRRLKRICAFYGVQPQFILCSATIGNPQAHAEALIEAPVTAITESGAPSGPKQVLLWN
FT                   PPVINPDLGLRASARSQSNRIARIAIKSGLKTLVFAQTRLMVEVLTKYLKDIFDHDPRK
FT                   PPRIRAYRGGYLPTERRETERAMRAGNIDGIVSTSALELGVDIGSLDVVILNGYPGSVA
FT                   ATWQRFGRAGRRQQPALGVMVASSQPLDQYVVRHPDFFAEASPEHARIAPDQPLILFDH
FT                   IRCAAFELPFRVGDGFGPIDPEVFLEALAETEVIHREGERWEWIADSYPANAVSLRAVA
FT                   DGNFVVVDRSDGRQQIIAEVDYSAAALTLYEGAIHMVQSTPYQVETLDWEGRKAYVTRT
FT                   HVDYYTDSIDFTKLKVLDRFDGGVAGRGDSHHGEVHVVRRVAGYKKIRYYTHENIGYGP
FT                   VNLPDQELHTTAVWWQLPQALLLRAFASKQDALDGFLGAAYALHIVATVAVMADARDLQ
FT                   KSVGNGDGSWFAIADQSGRGQLRGSEGDPGGVELLQEFVPTVYLYDNFPGGVGLSEPLW
FT                   QRQAELVQGARELVQRCDCRAGCPACVGPVLAAQEDDETSPRALALRVLDLFDADACQH
FT                   VPDVVVTTRDPMELLAP"
FT   repeat_region   126266..126273
FT                   /rpt_unit_seq="(gc)4"
FT   repeat_region   126362..126369
FT                   /rpt_unit_seq="(cg)4"
FT   misc_feature    complement(127419..127646)
FT                   /gene="lhr"
FT                   /locus_tag="Smlt0120"
FT                   /note="HMMPfam hit to PF00271, Helicase conserved
FT                   C-terminal domain, score 1.5e-14"
FT                   /inference="protein motif:HMMPfam:PF00271"
FT   misc_feature    complement(127893..128420)
FT                   /gene="lhr"
FT                   /locus_tag="Smlt0120"
FT                   /note="HMMPfam hit to PF00270, DEAD/DEAH box helicase,
FT                   score 3.6e-39"
FT                   /inference="protein motif:HMMPfam:PF00270"
FT   repeat_region   128556..128563
FT                   /rpt_unit_seq="(gc)4"
FT   CDS_pept        128872..129384
FT                   /transl_table=11
FT                   /locus_tag="Smlt0121"
FT                   /product="conserved hypothetical protein"
FT                   /note="N-terminus to codon 170 is similar to Homo sapiens
FT                   (Human) rfx1 mhc class ii regulatory factor rfx1 (rfx)
FT                   (enhancer factor c) (ef-c). UniProt:P22670 (979 aa) fasta
FT                   scores: E()=0.071, 25.806% id in 155 aa"
FT                   /note="similarity:fasta; with=UniProt:P22670; Homo sapiens
FT                   (Human).; RFX1; MHC class II regulatory factor RFX1 (RFX)
FT                   (Enhancer factor C) (EF-C).; length=979; id 25.806%;
FT                   ungapped id 27.972%; E()=0.071; 155 aa overlap; query
FT                   20-170; subject 16-162"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0121"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43731"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU79"
FT                   /protein_id="CAQ43731.1"
FT                   /translation="MARRGTQGALLAGMLLAGIAQAQQAAPVAVPDPAPVPPVDASAAT
FT                   TAPISTALPQDNVTTLGEVRALKPEDEPLDLYRFKNPVKFGDNRFSRDWSEPPSPEQVS
FT                   MGGGYIMMGVVKGVMAAAKGVNKLTGGPSQIQAAVARPPPELSAEQQRRALRFSQEQNA
FT                   GDAPPVK"
FT   sig_peptide     128872..128937
FT                   /locus_tag="Smlt0121"
FT                   /note="Signal peptide predicted for Smlt0121 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.850 between residues 22 and 23"
FT                   /inference="protein motif:SignalP:2.0"
FT   repeat_region   129327..129334
FT                   /rpt_unit_seq="(gc)4"
FT   CDS_pept        129425..130099
FT                   /transl_table=11
FT                   /locus_tag="Smlt0122"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q4V0E6
FT                   (EMBL:CP000050;); Xanthomonas campestris pv. campestris
FT                   (strain 8004).; Hypothetical protein.; length=223; id
FT                   56.164%; ungapped id 58.019%; E()=7.6e-44; 219 aa overlap;
FT                   query 7-220; subject 5-221"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0122"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43732"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU80"
FT                   /protein_id="CAQ43732.1"
FT                   /translation="MSLRSFCLLAALLPASAFASGIADDGACRNGAFPSEQSRFALARV
FT                   VDAPRLYLLGDMDGCPAKGEPACRQRSYVVNGDTVVTGRDLGAYRCAFFPNRVGGSAGW
FT                   VDRSKLQPLPVAVPSLQDWAGNWKDGDNGLRITVQGGQLHVEGDAYWPSANPTPEQRPY
FT                   GPNMGQVEARAAPRGADVEFVEDTCKVRVHSLGEVLIVADNSECGGMNVRFNGVYRRAG
FT                   SR"
FT   sig_peptide     129425..129481
FT                   /locus_tag="Smlt0122"
FT                   /note="Signal peptide predicted for Smlt0122 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.963 between residues 19 and 20"
FT                   /inference="protein motif:SignalP:2.0"
FT   repeat_region   129938..129945
FT                   /rpt_unit_seq="(gc)4"
FT   CDS_pept        complement(130159..131967)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0123"
FT                   /product="putative transmembrane protein"
FT                   /note="similarity:fasta; with=UniProt:Q1N7P1
FT                   (EMBL:AAQG01000028;); Sphingomonas sp. SKA58.; Hypothetical
FT                   protein.; length=597; id 39.101%; ungapped id 41.228%;
FT                   E()=1.4e-46; 601 aa overlap; query 11-602; subject 8-586"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0123"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43733"
FT                   /db_xref="GOA:B2FU81"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU81"
FT                   /protein_id="CAQ43733.1"
FT                   /translation="MNASAVNLWIAPALALIVVIASVRQPRADTAHPGRRWVVIALQIV
FT                   VATLLYFCLAPPTRQQPAGGLVVLGVDAGKADSLPASEGPLLLLPEAADVPGAQRVPDL
FT                   ATALRQHPAATLTLVGAGLVARDRDAVLPPDVRWQAAPEPRGWIALQPPADVAPGARFD
FT                   VLAQARGAAKAKAELLDPADSVVDRTEVADDGRVQLSGVARAEGRSVFQLRLLDADGHV
FT                   VDSVPVPQQTLPSAPLRLLVRAGAPGPELKYLRRWAADAGIRVQVQADTGAGLSIGDGA
FT                   VSIDAASLTRSDLLLLDERSLAALSAGQLAAVRQALRDGLGVLVRSAGAPSASARQRLR
FT                   DLGLPVQGDGSSHPLELPGDGESAVLAARRGPLAAGTLPTGYGEEADRSSHSAALSSLE
FT                   ALALQAPGSNALLHDRGGQAVGGWRAVGKGRIGLLPLTDSWRWVLAGRDDRHGELWSDV
FT                   VATLARAQGSGDALWSPQPISWAGERQALCGVQAPLQAFNLRGDSVALIADGATSALRC
FT                   AGWWPREAGWQRLQHGDSIVWRYVFDPKDAAALHRQAMIDATTQALASSTSANASVMQP
FT                   VPGSRWPWWLAFVLCASLLWWLERRR"
FT   misc_feature    complement(order(130174..130227,131794..131862,
FT                   131899..131955))
FT                   /locus_tag="Smlt0123"
FT                   /note="3 probable transmembrane helices predicted for
FT                   Smlt0123 by TMHMM2.0 at aa 5-23, 36-58 and 581-598"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(131964..134129)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0124"
FT                   /product="putative transmembrane protein"
FT                   /note="similarity:fasta; with=UniProt:Q9A4K2; Caulobacter
FT                   crescentus (Caulobacter vibrioides).; Hypothetical protein
FT                   CC2829.; length=749; id 46.122%; ungapped id 48.222%;
FT                   E()=8.4e-101; 735 aa overlap; query 1-717; subject 28-748"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0124"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43734"
FT                   /db_xref="GOA:B2FU82"
FT                   /db_xref="UniProtKB/TrEMBL:B2FU82"
FT                   /protein_id="CAQ43734.1"
FT                   /translation="MNTLQHAWQRARRRRALITLLLGLPWALAATVLALRLAGFDTACV
FT                   VGTVSLLACAAFATAHVRQLDRQWLQRQLDGSGASEDSADLLFADAATLNPLQQRQRTH
FT                   VLAMLERAMPELRPRWPRGALALCWIAGLAIVVLAFGWPRSGPGSVPVRTPVPGSAAAA
FT                   GPLRLQSTRLRIDAPAYTGQATLTQNALDAKVAADSRLSWSLRFDRAPDKAWLQFHDGR
FT                   RLPLSEREGQWQAQDVARMPLLYRVVSEPALAETRLHRLDVVADRAPSVRVLEPTASLV
FT                   LGTPGQRQWALRFEASDDYGVAAQATLSITTTQGSGENITFVKRSVTLAGSGEATARRF
FT                   AHTLDLAALGAQPGNDVIAQLEVRDNHAPTPQTGRSSSVILRLPSAEVALGAELEGRIK
FT                   KTLPAYFRSQRQIIIDAEALIRQRRSLAAEDFVKRSDAIGVDQRILRLRYGQFLGEESE
FT                   GAPKPPPTSDLPTSDAPTADGHDDDHEHDHGAQAGAQDDHGHDHGSTANADIPPVFGSE
FT                   TDVLSEYGHTHDHAEATTLLDPQTRATLKAALDQMWSAEGELRQGRPEQALPFAYKALG
FT                   FIKQVQQAERIYLARVGPELPPIDESRRLGGDRAGLASRELPLAARTPPDPAIVEAWQR
FT                   LGDDNGAPDLDALAAWQQRNAAYLPDALDLAAAIEQLRIEPDCGDCRQRLRAQLWRALQ
FT                   RPLPQTMRRSAADAMGQRYLDALEAQP"
FT   misc_feature    complement(order(133704..133772,133944..134003,
FT                   134013..134081))
FT                   /locus_tag="Smlt0124"
FT                   /note="3 probable transmembrane helices predicted for
FT                   Smlt0124 by TMHMM2.0 at aa 17-39, 43-62 and 120-142"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(134028..134129)
FT                   /locus_tag="Smlt0124"
FT                   /note="Signal peptide predicted for Smlt0124 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.423 between residues 34 and 35"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(134126..135247)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0125"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q8PE92; Xanthomonas
FT                   campestris pv. campestris.; Hypothetical protein XCC0089.;
FT                   length=393; id 45.038%; ungapped id 49.441%; E()=2.6e-29;
FT                   393 aa overlap; query 2-367; subject 9-393"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0125"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43735"
FT                   /db_xref="GOA:B2FH92"
FT                   /db_xref="InterPro:IPR011933"
FT                   /db_xref="InterPro:IPR024163"
FT                   /db_xref="UniProtKB/TrEMBL:B2FH92"
FT                   /protein_id="CAQ43735.1"
FT                   /translation="MTLLFPLGLAALAAGLLPLLIHLARRHPYTPLDFAALRWLRAQIR
FT                   PRQRIRFDDWPLLLVRLLLLAALALLLARPALTGPAPAPTAWTVVAPGLDATALRGTAE
FT                   AGNWHWLAPGFPAIDEVPPASTASLPSLLRELDAQLPAGTALTVHVPDPLPGLDGARLQ
FT                   LSREVQWRPQPIQVSEQPSAATLSRLRVHSDASAVVQHWLNALQRAWGRQAPLAPLVAD
FT                   ALPERGEIGVWSRTGALPANWQAWLQDGGRVVTAGKPAAEASILLRNTEGTPLLWQQRI
FT                   GHGVLLSLPGDWDASGNAALRDPQLPRALLLALQPPTAPRLGDARDQAPQRAALPAATP
FT                   PLREPTPWLLLAVVLLFALERWMASSARRRVAA"
FT   misc_feature    complement(135017..135199)
FT                   /locus_tag="Smlt0125"
FT                   /note="HMMPfam hit to PF07584, Protein of unknown function
FT                   (DUF1550), score 9.9e-15"
FT                   /inference="protein motif:HMMPfam:PF07584"
FT   CDS_pept        complement(135244..136140)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0126"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q8PE91; Xanthomonas
FT                   campestris pv. campestris.; Hypothetical protein XCC0090.;
FT                   length=298; id 66.436%; ungapped id 66.436%; E()=2.8e-73;
FT                   289 aa overlap; query 6-294; subject 6-294"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0126"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43736"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B2FH93"
FT                   /protein_id="CAQ43736.1"
FT                   /translation="MNAGTPLTLPPELRARLRTLRVRPRLASGASGIGQHASRSRGAGL
FT                   EFAQYRAYEPGDELRQVDWKLYARSDRFFVRESERESPITVWLLLDATASAGQADRAAP
FT                   QRTRLDHMRGVAACVVELALQQGDRFGLLAINGDGLQLVPAANGARQRDRVHLQLHALQ
FT                   ARGGWPVADRLRPLWERVRPGDLLLAIGDGFDEAGIVLLEQLASARREVALLQILTADE
FT                   RDFPFGAGHRFRDPETGEELLGDGAAIRTDYLQRFADARNALQSRLQASGIASATGWLD
FT                   QPLDQPLQALFGRRGGA"
FT   misc_feature    complement(135898..136140)
FT                   /locus_tag="Smlt0126"
FT                   /note="HMMPfam hit to PF01882, Protein of unknown function
FT                   DUF58, score 0.0018"
FT                   /inference="protein motif:HMMPfam:PF01882"
FT   CDS_pept        complement(136148..137131)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0127"
FT                   /product="putative ATPase, possible regulator"
FT                   /note="similarity:fasta; with=UniProt:Q8PR48; Xanthomonas
FT                   axonopodis pv. citri.; moxR; Methanol dehydrogenase
FT                   regulator.; length=330; id 84.498%; ungapped id 85.276%;
FT                   E()=7.1e-98; 329 aa overlap; query 1-326; subject 1-329"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0127"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43737"
FT                   /db_xref="GOA:B2FH94"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:B2FH94"
FT                   /protein_id="CAQ43737.1"
FT                   /translation="MTSPDLDSLLPRLDELRAALARAVVGQNTVVEQLLTGLLAGGHCL
FT                   LEGAPGLGKTLLVRSLGQALELQFRRVQFTPDLMPSDILGTELLEEDHGTGHRHFRFQQ
FT                   GPIFTHLLLADELNRTPPKTQAALLEAMQERTVSYAGTTYALPAPFFVLATQNPIEQAG
FT                   TYPLPEAQLDRFLLHVLVDYPSEDEERQVLEQTTGGATDAVPKVMDADAVIALQAAVRQ
FT                   VHVSPDVLAWITRLVRASRPGDGAPAAINQWVKWGAGPRAGQSLVLAAKARALLQGRFA
FT                   ATREDVQALAAPVMRHRLLLSFAAEAEQKRADDVVAALLQAVPFPG"
FT   misc_feature    complement(136583..137005)
FT                   /locus_tag="Smlt0127"
FT                   /note="HMMPfam hit to PF07728, ATPase family associated
FT                   with various cellul, score 5.9e-11"
FT                   /inference="protein motif:HMMPfam:PF07728"
FT   misc_feature    complement(136601..137005)
FT                   /locus_tag="Smlt0127"
FT                   /note="HMMPfam hit to PF07726, ATPase family associated
FT                   with various cellul, score 1.1e-82"
FT                   /inference="protein motif:HMMPfam:PF07726"
FT   CDS_pept        complement(137148..137855)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0128"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q8PR47; Xanthomonas
FT                   axonopodis pv. citri.; Hypothetical protein XAC0119.;
FT                   length=223; id 81.416%; ungapped id 82.511%; E()=6.7e-78;
FT                   226 aa overlap; query 1-226; subject 1-223"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0128"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43738"
FT                   /db_xref="InterPro:IPR025297"
FT                   /db_xref="UniProtKB/TrEMBL:B2FH95"
FT                   /protein_id="CAQ43738.1"
FT                   /translation="MDRRACLRWLAAAASAAALPAWAQAGPRSSRYDFWFTRLQYDSGD
FT                   WDVDARMPSNLITSLIDYTSLRVDPQEHVVALADPRMLEAPFCYLAGHTLVEFNAAERQ
FT                   NFVRYVRNGGFVFVDDCNHDIDGLFATSFEAQMGRLFGPRALQKLPNSHPLYRSFFRFP
FT                   DGPPATSFELNGWGDDLVHDYLKGIEVDGRLGLLYSNKDYGCEWDYDWRNKRFLAEDNT
FT                   RFGVNIVMYALNN"
FT   sig_peptide     complement(137787..137828)
FT                   /locus_tag="Smlt0128"
FT                   /note="Signal peptide predicted for Smlt0128 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.938) with cleavage site
FT                   probability 0.615 between residues 14 and 15"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(137855..139189)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0129"
FT                   /product="putative modulator of DNA gyrase"
FT                   /note="similarity:fasta; with=UniProt:Q8PR46; Xanthomonas
FT                   axonopodis pv. citri.; TldD protein.; length=444; id
FT                   86.937%; ungapped id 86.937%; E()=8.4e-155; 444 aa overlap;
FT                   query 1-444; subject 1-444"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43739"
FT                   /db_xref="GOA:B2FH96"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:B2FH96"
FT                   /protein_id="CAQ43739.1"
FT                   /translation="MSIFTEAQAKAILDKVIALSKADECTAVLAGAIDGNIRFALNNVS
FT                   TSGIVDNTELAVTVAFGKRVGTASINEFDDAALERVVRRAEDLARLAPENPEFMPAIGK
FT                   QTYRASPTFSESTAAIDPAFRAKVAADSIAPCRGHGLIAAGFLEDGQGFQATANSNGNF
FT                   AYQRTTNFNYTCTVRTEDGRGSGWVGRNLKDAADFKADQDIRIAMRKATESAEAKALEP
FT                   GKYTVILEPAAAAGLISFMMNFFSARSADEGRSFLSKKGGGNKLGEQVYDPRVTMIADP
FT                   WHPDAPVLPWDNEGLPRERMAIIENGRIANLDYSRFWAQKQGKTAKASPGNLLMSGGDK
FT                   STAELVRGTQKGILVTRTWYIRMVDPQTVLLTGLTRDGTFYIENGQIKHPVKNFRFNES
FT                   PVIMLNNIEELGKPVRVAGDESSYVMMIPPMKLRDFTFTSLSDAV"
FT   misc_feature    complement(138254..139123)
FT                   /locus_tag="Smlt0129"
FT                   /note="HMMPfam hit to PF01523, Putative modulator of DNA
FT                   gyrase, score 3.3e-12"
FT                   /inference="protein motif:HMMPfam:PF01523"
FT   CDS_pept        complement(139211..140791)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0130"
FT                   /product="putative modulator of DNA gyrase"
FT                   /note="similarity:fasta; with=UniProt:Q9L6I6
FT                   (EMBL:AF234655;); Streptomyces lincolnensis.; lmbIH;
FT                   length=483; id 30.120%; ungapped id 32.397%; E()=4.6e-24;
FT                   498 aa overlap; query 24-516; subject 5-472"
FT                   /note="similarity:fasta; with=UniProt:Q3BZJ0
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; Putative modulator of DNA gyrase
FT                   precursor.; length=544; id 86.692%; ungapped id 86.692%;
FT                   E()=2.6e-177; 526 aa overlap; query 1-526; subject 19-544"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0130"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43740"
FT                   /db_xref="GOA:B2FH97"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:B2FH97"
FT                   /protein_id="CAQ43740.1"
FT                   /translation="MPSFFGKVIAAEQLQSSLDLGLKKRLADAALAAARQAGATYCDVR
FT                   IGRYLRQFVITREDKVQNVVNTESTGVGIRVIVNGAWGFAATNALGTADVAKAAQQAAA
FT                   IAKANAGVQTAPVQLAKAPGVGEVSWRTPIRKNAMEVPIKDKVGLLLDVNAAAMGAGAS
FT                   FVNSMLFLVNEQKYFASTDGSYIDQDVHRIWAPMTVTAIDKSSGKFRTRSGLSSPMGLG
FT                   YEYLDGAAAGKVVGPNGVVNYSSSYDMKEDAIAAARQAQEKLKAPSVKPGKYDLVLDPS
FT                   HTWLTIHESIGHPLELDRVLGYEANYAGTSFATLDKREQHFQYGSELVNIFADKTQPGS
FT                   LGAVAYDDEGVKCKRWDLISNGKLVDYQTIRDQAHILGKTESDGCCYADSWSSVQFQRM
FT                   ANVSMAPGKKPLSVPDLIKDVENGIYIIGDGSFSIDQQRYNAQFGGQLFYEIKNGQITR
FT                   MLEDVAYQIRTPEFWNACTAVADERDYRLGGSFFDGKGQPGQVSAVSHGSSTARFNGIN
FT                   VINTARSLG"
FT   misc_feature    complement(139691..140674)
FT                   /locus_tag="Smlt0130"
FT                   /note="HMMPfam hit to PF01523, Putative modulator of DNA
FT                   gyrase, score 2.3e-48"
FT                   /inference="protein motif:HMMPfam:PF01523"
FT   CDS_pept        complement(140876..142507)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0131"
FT                   /product="putative peptidase/modulator of DNA gyrase"
FT                   /note="similarity:fasta; with=UniProt:Q9L6I6
FT                   (EMBL:AF234655;); Streptomyces lincolnensis.; LmbIH.;
FT                   length=483; id 29.116%; ungapped id 31.317%; E()=2.3e-22;
FT                   498 aa overlap; query 40-532; subject 5-472"
FT                   /note="similarity:fasta; with=UniProt:Q3BZI9
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; Putative modulator of DNA gyrase
FT                   precursor.; length=542; id 75.092%; ungapped id 75.092%;
FT                   E()=5.8e-166; 542 aa overlap; query 1-542; subject 1-542"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0131"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43741"
FT                   /db_xref="GOA:B2FH98"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:B2FH98"
FT                   /protein_id="CAQ43741.1"
FT                   /translation="MQRREFLAFSGLGLAGLLLPHSRAIAAEQLLAPVDTAQRRRLADV
FT                   ALAAARTAKASYCDVRIGRYLNQSVITREHQVGNVTNRESSGVGVRVIVNGAWGFAATH
FT                   QQTEAAVRAAVEQAAAIARANASIQTRPVQLAPTPSVGEVHWKTPIRRNAMAVPIQDKV
FT                   ELLLALNAAALNAGADYINSTLFLVNEQKYFASSDGSFIDQDIHRIWLPFTATAIDKAS
FT                   GRFRTRAGLSSPMGMGYEFLDGDARGKVQLPGGITAYRDSYDPVEDAIAAARHAREKLK
FT                   APSVKPGKYDLVLDPSNLFLTIHENVGHPLELDRVLGYEANYAGTSFATLDKRDAGFRW
FT                   GSDIVTFFADKTQPGSLGAVGYDDEGVKTQRWDLVRDGILVDYQATRDEAHILGRDASH
FT                   GCSYADSWSSVQFQRMANVSLAPGKQPLSVEDMIKDVENGIWIHGRGSYSIDQQRYNAQ
FT                   FGGQLYYQIKDGKIAGMVEDAAYQIRTPEFWNACTAICDERDFRLGGSFFDGKGQPGQV
FT                   SAVSHGSSTTRFNGINIINTARSLGA"
FT   misc_feature    complement(141359..142342)
FT                   /locus_tag="Smlt0131"
FT                   /note="HMMPfam hit to PF01523, Putative modulator of DNA
FT                   gyrase, score 1.1e-54"
FT                   /inference="protein motif:HMMPfam:PF01523"
FT   repeat_region   141676..141683
FT                   /rpt_unit_seq="(cg)4"
FT   sig_peptide     complement(142430..142507)
FT                   /locus_tag="Smlt0131"
FT                   /note="Signal peptide predicted for Smlt0131 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.962 between residues 26 and 27"
FT                   /inference="protein motif:SignalP:2.0"
FT   repeat_region   142514..142523
FT                   /rpt_unit_seq="(tc)5"
FT   repeat_region   142619..142817
FT                   /rpt_family="R=3"
FT                   /inference="nucleotide motif:RepeatScout"
FT   repeat_region   complement(142665..143104)
FT                   /rpt_family="R=8"
FT                   /inference="nucleotide motif:RepeatScout"
FT   repeat_region   complement(142945..143158)
FT                   /rpt_family="R=3"
FT                   /inference="nucleotide motif:RepeatScout"
FT   CDS_pept        143201..143815
FT                   /transl_table=11
FT                   /locus_tag="Smlt0133"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q5H6Y2
FT                   (EMBL:AE013598;); Xanthomonas oryzae pv. oryzae.;
FT                   Hypothetical protein.; length=267; id 56.190%; ungapped id
FT                   58.416%; E()=7.9e-42; 210 aa overlap; query 1-202; subject
FT                   56-265"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0133"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43742"
FT                   /db_xref="InterPro:IPR010342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2FH99"
FT                   /protein_id="CAQ43742.1"
FT                   /translation="MSSKPYSEACERNREPIATALDPWMGDRRRVLEIGSGTGQHAAFF
FT                   AERWPWLRWQPSDHPDHLPGIEAWRAEAALLNLLPPAALQVELPPAPGLSLPQGSTFDA
FT                   AFTANTLHIMGWEHVQALFAALPPLLRHGALLAVYGPFNYGGRYTSDSNAQFDAWLKAR
FT                   DPRSGIRDVEAVQALAEDNGFTRLRDVAMPANNRLLLWRLG"
FT   misc_feature    143210..143809
FT                   /locus_tag="Smlt0133"
FT                   /note="HMMPfam hit to PF06080, Protein of unknown function
FT                   (DUF938), score 8.5e-94"
FT                   /inference="protein motif:HMMPfam:PF06080"
FT   CDS_pept        complement(143816..145138)
FT                   /transl_table=11
FT                   /gene="hipA"
FT                   /locus_tag="Smlt0134"
FT                   /product="putative survival protein HipA"
FT                   /note="similarity:fasta; with=UniProt:P23874
FT                   (EMBL:M61242;); Escherichia coli.; hipA; Protein hipA.;
FT                   length=440; id 42.377%; ungapped id 44.787%; E()=4.3e-62;
FT                   446 aa overlap; query 1-434; subject 1-434"
FT                   /note="similarity:fasta; with=UniProt:Q395X4
FT                   (EMBL:CP000152;);/NCIB 9086/R18194)).; Uncharacterized
FT                   protein related to capsule biosynthesis enzymes- like.;
FT                   length=446; id 53.687%; ungapped id 54.060%; E()=1.3e-95;
FT                   434 aa overlap; query 4-435; subject 10-442"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43743"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHA0"
FT                   /protein_id="CAQ43743.1"
FT                   /translation="MGTLQVWMNGVEVALWDDVRNGSSRLSYVSQWISSPQSRPLSLSL
FT                   PLLPDGESHRGNVVNDYFDNLLPDNVAIRNRIRDRFATRGSDTFDLLEAIGRDCVGAVQ
FT                   LLPPARPPEDIQQITCEVLDEAGVATILRQVTTGNLPGAPSRDDAFRISIAGAQEKTGL
FT                   LLHAGKWCIPTGNTPSTHIFKLPLGIVGNMRADMHQSVENEWLCMHLLSAFDIPVAETQ
FT                   MGRFNDQRALIVERFDRRLSADRRWWLRLPQEDMCQVFGLPAARKYESDGGPGIVPIMD
FT                   LLRQSEHPEDRAIFFKTQILFWMLAATDGHAKNFSVHLEAGGRFRLTPVYDVLSVYPIL
FT                   GRGPNQLDPRNAQLAMAVHGKNRHRKLHLVRRRHWNETARACGVADGAEPWIKTLIAAV
FT                   EPAIQQVTRQLPDDFPSNVSEPIFNGLRAAAARLSSMAPEA"
FT   repeat_region   143997..144004
FT                   /rpt_unit_seq="(gc)4"
FT   misc_feature    complement(144143..144391)
FT                   /gene="hipA"
FT                   /locus_tag="Smlt0134"
FT                   /note="HMMPfam hit to PF07804, HipA-like C-terminal domain,
FT                   score 4.3e-36"
FT                   /inference="protein motif:HMMPfam:PF07804"
FT   misc_feature    complement(144422..144682)
FT                   /gene="hipA"
FT                   /locus_tag="Smlt0134"
FT                   /note="HMMPfam hit to PF07805, HipA-like N-terminal domain,
FT                   score 6.6e-19"
FT                   /inference="protein motif:HMMPfam:PF07805"
FT   repeat_region   145005..145012
FT                   /rpt_unit_seq="(ag)4"
FT   CDS_pept        complement(145142..145399)
FT                   /transl_table=11
FT                   /gene="hipB"
FT                   /locus_tag="Smlt0135"
FT                   /product="putative HTH-type transcriptional regulator HipB"
FT                   /note="similarity:fasta; with=UniProt:P23873
FT                   (EMBL:M61242;); Escherichia coli.; hipB; HTH-type
FT                   transcriptional regulator hipB.; length=88; id 27.059%;
FT                   ungapped id 28.395%; E()=0.037; 85 aa overlap; query 5-85;
FT                   subject 4-88"
FT                   /note="similarity:fasta; with=UniProt:Q6MXQ9
FT                   (EMBL:BX664015;); Serratia marcescens.; Putative
FT                   transcriptional regulator.; length=99; id 46.479%; ungapped
FT                   id 46.479%; E()=3.6e-08; 71 aa overlap; query 6-76; subject
FT                   5-75"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0135"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43744"
FT                   /db_xref="GOA:B2FHA1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHA1"
FT                   /protein_id="CAQ43744.1"
FT                   /translation="MDRPLHTVRTAQQLAPLMRAFRRQAGLSQAQLAERLGISRQAVGA
FT                   LERDPASASFERLMRIWAVLGLEVSLQQRSPQENTSSLEW"
FT   misc_feature    complement(145184..145348)
FT                   /gene="hipB"
FT                   /locus_tag="Smlt0135"
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix, score
FT                   9.9e-13"
FT                   /inference="protein motif:HMMPfam:PF01381"
FT   CDS_pept        complement(145561..149274)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0136"
FT                   /product="putative ferredoxin oxidoreductase"
FT                   /note="similarity:fasta; with=UniProt:Q3BZB0
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; Putative ferredoxin oxidoreductase.;
FT                   length=1247; id 80.192%; ungapped id 81.169%; E()=0; 1247
FT                   aa overlap; query 2-1237; subject 5-1247"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0136"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43745"
FT                   /db_xref="GOA:B2FHA2"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHA2"
FT                   /protein_id="CAQ43745.1"
FT                   /translation="MPADPTGPAMTSTAQLTSPSSADLLDRDYTLDHKYTRNEGRIYLS
FT                   GVQALVRLPLMQRLRDAAEGIDSAGFVSGYRGSPLGGFDLELWRARKHLEAAKVKFTPG
FT                   LNEDLGATMVWGTQQTNLFPGANVQGVFGMWYGKGPGVDRCGDVFKHANAAGTSRYGGV
FT                   LALAADDHACRSSTLPHGSEDEFVSAMMPVLNPAGVQDILDMGLLGWAMSRYTGRWVGF
FT                   KTIAETVESSASVQVDPMARRIVLPEDFEMPSGGLNIRWPDPPLDQEMRLHRYAVKAAQ
FT                   AFARANGIDKVVMDAPRARLGIVTTGKSYLDVLQALEYLGLDEAACADIGIRVYKVGMT
FT                   WPLEPQGIARFAQGLEDIIVVEEKRAFIERQMKEQFFNWPASWGQRPSIVGKYDESGEW
FT                   ILPSTGELTPATIAGVIGRRIQKFFNNESIEQRLQWMQQKEAELALPRASFPRVPHYCS
FT                   GCPHNTSTQVPEGSRALAGIGCHYMVTWMDRSTDTFTHMGGEGVTWAGQAPFTDTPHVF
FT                   QNLGDGTYFHSGSLAIRQAVAAGVNITYKILYNDAVAMTGGQPVDGPLSVPDIAKQMRA
FT                   EGIHTIVVLSDNIGKWTGQREHFPSDVEFHDRSELEEVQKRLREVKGVSILIYEQTCAT
FT                   EKRRRRKRGKLEDPQKRVLINSLVCEGCGDCGKKSFCVSVLPKETEFGRKREIDQSNCN
FT                   KDYSCVNGFCPSFVTVHGGQPRKGSKRDASTLLDNLPAPTIRGTLEQPWNILITGVGGT
FT                   GVVTIGALLGMAGHLEGKGATVLDQTGLAQKGGAVTTHIRIARRPDDIHAVRIAAGEAD
FT                   LVLGCDMVVVNDYWALSKVRAGRSQVVLNTYEAMPGTFTTRPDMQFPAADIIAGVRVAL
FT                   GGQEPLLLDATQLATALLGDAIAANLFILGYAWQQGLVPLSFESLMRAIELNGAAVAMN
FT                   QQAFAWGRLAVVDPQAVQQAAGLVHNRHTDTESTPGPLHPLPPGEWEGNEWGATAAPRN
FT                   TGDERELRGLPSHGGDVAFLPLDDARLSRSLDEMIERRAAFLVDYQDAAYANRYRSLVE
FT                   RVRAAEAERIGGSTALTETVARYLFKLMAYKDEYEVARLYTSGDFQRRLQQQFEGDYQL
FT                   RFHLAPPLFAKKDEQGRLLKKEYGPWMFKAFGLLAKLKFLRGGRLDVFGRTEERRMERQ
FT                   LIADYEATVQLLLDGLEDGRLALAVEIASVPEHIRGFGHVKEAHYEQAKAREAALLAQW
FT                   RNPKALHIVQVA"
FT   misc_feature    complement(146458..147024)
FT                   /locus_tag="Smlt0136"
FT                   /note="HMMPfam hit to PF01558, Pyruvate
FT                   ferredoxin/flavodoxin oxidoreductas, score 9.5e-06"
FT                   /inference="protein motif:HMMPfam:PF01558"
FT   repeat_region   148376..148385
FT                   /rpt_unit_seq="(cg)5"
FT   repeat_region   149002..149011
FT                   /rpt_unit_seq="(gc)5"
FT   CDS_pept        149419..150054
FT                   /transl_table=11
FT                   /locus_tag="Smlt0137"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q3BZA9
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; Putative secreted protein precursor.;
FT                   length=223; id 50.980%; ungapped id 51.232%; E()=1.7e-36;
FT                   204 aa overlap; query 9-211; subject 20-223"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0137"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43746"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHA3"
FT                   /protein_id="CAQ43746.1"
FT                   /translation="MSVPGKILASVLLASGAATAWAAPAMPAPQEFYFDSDLAAAPMVA
FT                   MQGEGDELVTQLVRLRERGRRAVEATVQLASVASTQGRAELADQLYGEALKEAPAQSSA
FT                   GRSVRWNYGWDLLRQGKPEAALEQWLSSAGNARSKPSWVPPTYALALWRMGQKQEAVQW
FT                   YAAAVRTEPSQWSTSANYAQLLPQWREDERASLAEVQQAWAAAPPAWP"
FT   sig_peptide     149419..149484
FT                   /locus_tag="Smlt0137"
FT                   /note="Signal peptide predicted for Smlt0137 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.960 between residues 22 and 23"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(150175..151659)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0138"
FT                   /product="putative ATPase"
FT                   /note="similarity:fasta; with=UniProt:Q9I5R4
FT                   (EMBL:AE004500;); Pseudomonas aeruginosa.; Probable
FT                   ATPase.; length=493; id 49.899%; ungapped id 50.615%;
FT                   E()=2.5e-85; 495 aa overlap; query 2-493; subject 3-493"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0138"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43747"
FT                   /db_xref="GOA:B2FHA4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHA4"
FT                   /protein_id="CAQ43747.1"
FT                   /translation="MSELQDLSALIRANTPLIVIETQDEGRIVDLFRQTLMHVWRALHR
FT                   WSITEGLRRIDLDSEDPPAGPPDASAALQMIRQAGQRGVYLLLDFHPYLGYASHQRALR
FT                   DLIQRRHSEPHVLVLIGAKVELPAELEALAVRFNPRLPDANALLKMLREEADAYAREHG
FT                   GRRVEVESEAVKKILKNLQGLSLVDARRIARQLIYADGALRDDDLPQLARLKFELLNRS
FT                   GHLFFEHDSARFGDVAGANRLKRWINQRRVAFIAGSAPAGLDPPRGMLLLGVQGCGKSM
FT                   LAKATAAGFGVPLLRLDVGALYNKYHGETEANLRQALASAEQLAPCVLWMDEIEKGLAS
FT                   GGEDGGVSRRVLGHLLTWMAERKAPVFIVATANQVHELPAELLRKGRFDEIFFVDLPSP
FT                   EVRVELLRLHLGRRQLNADDFALPALAAAANGFSGAEIEQAIVAGLYAAHAEGRPLDTE
FT                   LLMNEIRATRPLSVLMAEQVEALRAWASGRTVSADD"
FT   misc_feature    complement(150313..150858)
FT                   /locus_tag="Smlt0138"
FT                   /note="HMMPfam hit to PF00004, ATPase family associated
FT                   with various cellul, score 3.9e-51"
FT                   /inference="protein motif:HMMPfam:PF00004"
FT   CDS_pept        151783..152412
FT                   /transl_table=11
FT                   /locus_tag="Smlt0139"
FT                   /product="putative Cob/MinD/ParA nucleotide binding
FT                   protein"
FT                   /note="similarity:fasta; with=UniProt:Q4V0A3
FT                   (EMBL:CP000050;); Xanthomonas campestris pv. campestris
FT                   (strain 8004).; Partition protein.; length=210; id 76.442%;
FT                   ungapped id 76.442%; E()=4e-57; 208 aa overlap; query
FT                   1-208; subject 1-208"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43748"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHA5"
FT                   /protein_id="CAQ43748.1"
FT                   /translation="MKTILVAGSKGGVGKTTVATHLAAYAALQGRATVIADADPQGSST
FT                   RWAQRRAGLESAVLPIDVYRKKQWAQKLPDGTETVIIDAPAGALADDIPHFLDAADAVV
FT                   VPVLPSALDIEAIVGFLNSLAQNPRVHSRKLPVGLVLNRTKPWTQTSQQALQMLAEWPY
FT                   PVVAQLRDSQSYVVMTGLGRSLFDYRSAQVREHQADWEPLLSWLKL"
FT   CDS_pept        152462..152938
FT                   /transl_table=11
FT                   /locus_tag="Smlt0140"
FT                   /product="putative phosphoglycerate mutase family protein"
FT                   /note="similarity:fasta; with=UniProt:Q8PQX6
FT                   (EMBL:AE011644;); Xanthomonas axonopodis pv. citri.;
FT                   Hypothetical protein XAC0193.; length=158; id 72.152%;
FT                   ungapped id 72.152%; E()=5e-42; 158 aa overlap; query
FT                   1-158; subject 1-158"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0140"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43749"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHA6"
FT                   /protein_id="CAQ43749.1"
FT                   /translation="MRELILLRHAHAEPATPGQADLDRPLSPVGLAEAEAAGKWLKENN
FT                   LLPDCVLCSPARRTRETLEAVLGTIGYVEKRLEDRIYEATPGTLAALVDDRRDLDRVLI
FT                   VGHNPGLERLVALMTEGTSSDYRGMPPAGIAVLGFPREASIEPGVASLNAFWWP"
FT   misc_feature    152468..152803
FT                   /locus_tag="Smlt0140"
FT                   /note="HMMPfam hit to PF00300, Phosphoglycerate mutase
FT                   family, score 1.9e-20"
FT                   /inference="protein motif:HMMPfam:PF00300"
FT   CDS_pept        152943..153560
FT                   /transl_table=11
FT                   /locus_tag="Smlt0141"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q8PQX5
FT                   (EMBL:AE011644;); Xanthomonas axonopodis pv. citri.;
FT                   Hypothetical protein XAC0194.; length=190; id 58.602%;
FT                   ungapped id 59.890%; E()=1.4e-40; 186 aa overlap; query
FT                   20-205; subject 9-190"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0141"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43750"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHA7"
FT                   /protein_id="CAQ43750.1"
FT                   /translation="MSLARRSRYLLPALLALGPAWAAVPTPTTLPPVVAEAHRVMRLDT
FT                   QRSQIGFEVRTRFGQRIEGLFPHFEGRIEILSDGRHQVHLKMFTRSVEIPGKARYTGWM
FT                   RGEEFFDAGRHPVVEFDSLPYWPETVESGGDINGRLTLRGISHPETLKVEKAECARPGY
FT                   DCDVVSRGTVQRGRYGMDSWQLALSDRVTFVLRARLSEAPKP"
FT   sig_peptide     152943..153008
FT                   /locus_tag="Smlt0141"
FT                   /note="Signal peptide predicted for Smlt0141 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.999 between residues 22 and 23"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    153069..153548
FT                   /locus_tag="Smlt0141"
FT                   /note="HMMPfam hit to PF04264, YceI like family, score
FT                   1.6e-15"
FT                   /inference="protein motif:HMMPfam:PF04264"
FT   CDS_pept        153557..155605
FT                   /transl_table=11
FT                   /locus_tag="Smlt0142"
FT                   /product="putative phospholipase"
FT                   /note="similarity:fasta; with=UniProt:Q3BZA4
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; Phospholipase precursor.; length=672; id
FT                   73.824%; ungapped id 75.150%; E()=1.2e-133; 680 aa overlap;
FT                   query 4-682; subject 4-672"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43751"
FT                   /db_xref="GOA:B2FHA8"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHA8"
FT                   /protein_id="CAQ43751.1"
FT                   /translation="MNFLLRVLALATVLLGSGCASLSNAERDRAEAIAVQARSTVVDCQ
FT                   RADRCAQDSPLRALAGRAFTESTPERPRHYATLLDEGEGALVARLNLLRSATRSIDLQT
FT                   YIFDKDDSARLVIDELLAASRRGVKVRLLIDQLSAISDLQILGALSGAHQNFQLRVYNP
FT                   TFGKARLNYFDYAGSVLCCFRRFNQRMHNKLLVIDDAIGVVGGRNYQDDYYDWDREYNF
FT                   RDRDVLIAGPEARAMAANFDAFWRAHRSVPAERLNDVGRTLLREGVPTLPPASFRRPER
FT                   VQRVSAEANDTEFVTRSFVDTALPVASVRYVADLPRKHRREKADAPLAGQHVTEPQLDA
FT                   LIASAQKEVILQTPYLVLSKPAQKLFRELRKRPQPPRVVVSSNSLAATDNPIVYALSYK
FT                   YKRRNMRELGFNIFEYKPFPLDAPVDYRNLLPDPIAAPGGGDEGGRNPLIGGSAAGSNA
FT                   RGGSSSGSDAGSRQGPLNRHSDGAYDNARARRRAAGSEVETRLLRTETRPSFLGSKAVN
FT                   KPLPVTRKGARMGLHAKSLVVDRRIGVVGTHNFDPRSENYNTEGAVIIDDPVFAEELAQ
FT                   SILRDTHPQNSWTVAPRAKPPVLSGLNYSVGKASEALPILDFWPWRYATDYEFKPGPEC
FT                   PQPLPRQDPDFHRCYVAVGDFPEVNVGPKWLLVRMLTAFGAGLVPIL"
FT   sig_peptide     153557..153631
FT                   /locus_tag="Smlt0142"
FT                   /note="Signal peptide predicted for Smlt0142 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.660 between residues 25 and 26"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    154112..154195
FT                   /locus_tag="Smlt0142"
FT                   /note="HMMPfam hit to PF00614, Phospholipase D Active site
FT                   motif, score 0.0019"
FT                   /inference="protein motif:HMMPfam:PF00614"
FT   repeat_region   154868..154875
FT                   /rpt_unit_seq="(g)8"
FT   repeat_region   155133..155140
FT                   /rpt_unit_seq="(gc)4"
FT   misc_feature    155135..155218
FT                   /locus_tag="Smlt0142"
FT                   /note="HMMPfam hit to PF00614, Phospholipase D Active site
FT                   motif, score 0.0038"
FT                   /inference="protein motif:HMMPfam:PF00614"
FT   CDS_pept        155616..156050
FT                   /transl_table=11
FT                   /locus_tag="Smlt0143"
FT                   /product="putative thioesterase"
FT                   /note="similarity:fasta; with=UniProt:P77781
FT                   (EMBL:AP009048;); Escherichia coli.; ydiI; Esterase ydiI
FT                   (EC 3.1.-.-).; length=136; id 53.676%; ungapped id 54.074%;
FT                   E()=3.7e-25; 136 aa overlap; query 4-139; subject 2-136"
FT                   /note="similarity:fasta; with=UniProt:Q3BZA3
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; Hypothetical protein.; length=142; id
FT                   72.857%; ungapped id 72.857%; E()=1.4e-37; 140 aa overlap;
FT                   query 5-144; subject 3-142"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0143"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43752"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHA9"
FT                   /protein_id="CAQ43752.1"
FT                   /translation="MAQVFREAVSIEQLNALSRNTAIESLGIVFSAAGEDWLQATMPVD
FT                   ERTRQPYGILHGGASVVLAETLGSSAGNLCVDTGKQVCVGLEINANHVRAVRSGTVTGT
FT                   ARALHVGRSTQLWEIRIEDEQGRLVCISRLTLAVVAAGHG"
FT   misc_feature    155769..156005
FT                   /locus_tag="Smlt0143"
FT                   /note="HMMPfam hit to PF03061, Thioesterase superfamily,
FT                   score 6.6e-21"
FT                   /inference="protein motif:HMMPfam:PF03061"
FT   CDS_pept        156143..156961
FT                   /transl_table=11
FT                   /locus_tag="Smlt0144"
FT                   /product="putative transmembrane acetyltransferase"
FT                   /note="similarity:fasta; with=UniProt:Q4V098
FT                   (EMBL:CP000050;); Xanthomonas campestris pv. campestris
FT                   (strain 8004).; Acetyltransferase.; length=267; id 70.229%;
FT                   ungapped id 71.318%; E()=5.7e-68; 262 aa overlap; query
FT                   12-269; subject 4-265"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43753"
FT                   /db_xref="GOA:B2FHB0"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHB0"
FT                   /protein_id="CAQ43753.1"
FT                   /translation="MTALRYRARMTSPTPAPRGGVARVCRYLYRVPLLLVHIIVFLPLI
FT                   LIGMLPPWGELRVGEATFGAKVVNWWQGGLMWIFGFRLVQVGAPLPGAVLFVANHVSWV
FT                   DICILHSQRMMGFVAKREIASWPLVGWLAARGQTIFHQRGSTESLGGVMQVMADRLREG
FT                   KAVGVFPEGRTRGGHEVGPFHARIFQAAVETGVPVQPVALVYGAKGDAQTIVAFGPNES
FT                   FFANFLRLLGEPARRAEVHFLAPIGAQDLEGRRRIAETSRARIVAAMSAG"
FT   misc_feature    156233..156301
FT                   /locus_tag="Smlt0144"
FT                   /note="1 probable transmembrane helix predicted for
FT                   Smlt0144 by TMHMM2.0 at aa 31-53"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    156380..156754
FT                   /locus_tag="Smlt0144"
FT                   /note="HMMPfam hit to PF01553, Acyltransferase, score
FT                   9.2e-23"
FT                   /inference="protein motif:HMMPfam:PF01553"
FT   repeat_region   156541..156548
FT                   /rpt_unit_seq="(cg)4"
FT   repeat_region   156924..156933
FT                   /rpt_unit_seq="(cg)5"
FT   CDS_pept        156969..158003
FT                   /transl_table=11
FT                   /locus_tag="Smlt0145"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q8PE03
FT                   (EMBL:AE012114;); Xanthomonas campestris pv. campestris.;
FT                   Hypothetical protein XCC0180.; length=328; id 66.972%;
FT                   ungapped id 67.178%; E()=1.1e-89; 327 aa overlap; query
FT                   16-341; subject 1-327"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0145"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43754"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHB1"
FT                   /protein_id="CAQ43754.1"
FT                   /translation="MALIPPPVLDAGTPTLHAADYQPPRWLRNPHLQSMLSSSRMRLQR
FT                   GLLLLAATGAVSEELILDGGDGVRLQGWHSHVEGREPKGIALLLHGWEGSAESSYMRMA
FT                   AARMIEQGFDVVRLNFRDHGNTHHLNPGIFHSNLIDEVVHAAGDIAQRWPQLPLVAAGY
FT                   SLGGNFVLRLALRAPAAGVPLLRVASVCPVLDPALTMESIENGPAMYDWYFRRKWAGSL
FT                   RRKRDLFPELSDCDDRVLKLDIRALTAWLVERHTSFGSLQAYFDGYSIAGDRLSSLQVP
FT                   ADILMAQDDPVIPYATFSNWQLPGQARLETACWGGHCGFIENWRGDGFSERWVAQRLQR
FT                   VLQA"
FT   repeat_region   157107..157118
FT                   /rpt_unit_seq="(ctg)4"
FT   repeat_region   157493..157500
FT                   /rpt_unit_seq="(gc)4"
FT   CDS_pept        158060..160129
FT                   /transl_table=11
FT                   /locus_tag="Smlt0146"
FT                   /product="putative TPR repeat protein"
FT                   /note="similarity:fasta; with=UniProt:Q8PQX0
FT                   (EMBL:AE011644;); Xanthomonas axonopodis pv. citri.;
FT                   Hypothetical protein XAC0199.; length=710; id 54.928%;
FT                   ungapped id 55.007%; E()=2.6e-141; 690 aa overlap; query
FT                   1-689; subject 21-710"
FT                   /note="similarity:fasta; with=UniProt:Q8PE02
FT                   (EMBL:AE012114;); Xanthomonas campestris pv. campestris.;
FT                   Hypothetical protein XCC0181.; length=690; id 54.638%;
FT                   ungapped id 54.717%; E()=4.3e-141; 690 aa overlap; query
FT                   1-689; subject 1-690"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0146"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43755"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHB2"
FT                   /protein_id="CAQ43755.1"
FT                   /translation="MQDQIIQALRQNQADQAVQLAQAWTRDEPGQANAHRWLALALQQQ
FT                   GNAEEAMEALQQALRLAPDDAQLHLQHAGLLLALRQFEGADEALVRTTGLDPNSFSAYL
FT                   MQAHLAIGRNDFDEAQRISTLAARVEPDHPELLTIDGMVALRRGDADRALALLSAASKA
FT                   LPDDTRVLYALGFAYLGKDMLAFAEQSFRRVLELNPSLSSLHGLVVQLALRQGNVPAAA
FT                   EAMQVALQQPEMDVPSMRRLAGELSLRNGQPLQALDYLLPLLETQPEDRQVLQLLLMSW
FT                   QRLGREDEARARLDAVLDTDDQLHDVWLARLAIEQVGSESAVTAVERWMAAMPAHLPAL
FT                   EARLRLHDMAGEHAQAEAIAERIVSLEPGRVSGETRLVEGLLQRDPAAAVARVQALIEL
FT                   APEEHRADLRTWMGEIQDRAGQPQDALRTWLSLQADQAPQRLPLPPQAKSPPSWPDKGS
FT                   IDGDASSAPIFLWGPPGSGVERVATGLAAASPVLRSDRYTNTPPDDAFQNYNTLQDLAS
FT                   GVLTPERLVQRWREQLPARGLQSDTVIDWLLWWDNALLWALRPQLPQGRLVLVLRDPRD
FT                   MLLDWVAYGAAAPLAMTSLAEASEWLTRALTQIATLHEDDLYPHVLLRIDQIGNDPQAM
FT                   AELLGRLFERPMPPAAQLGAPRLPAGHWRNYRDVMSAAFAQLTPVAVRLGYPEE"
FT   misc_feature    158144..158254
FT                   /locus_tag="Smlt0146"
FT                   /note="HMMPfam hit to PF07720, Tetratricopeptide repeat,
FT                   score 0.089"
FT                   /inference="protein motif:HMMPfam:PF07720"
FT   misc_feature    158153..158254
FT                   /locus_tag="Smlt0146"
FT                   /note="HMMPfam hit to PF07719, Tetratricopeptide repeat,
FT                   score 4.5e-08"
FT                   /inference="protein motif:HMMPfam:PF07719"
FT   misc_feature    158153..158230
FT                   /locus_tag="Smlt0146"
FT                   /note="HMMPfam hit to PF07721, Tetratricopeptide repeat,
FT                   score 0.011"
FT                   /inference="protein motif:HMMPfam:PF07721"
FT   repeat_region   158437..158444
FT                   /rpt_unit_seq="(cg)4"
FT   misc_feature    158561..158662
FT                   /locus_tag="Smlt0146"
FT                   /note="HMMPfam hit to PF07719, Tetratricopeptide repeat,
FT                   score 0.0022"
FT                   /inference="protein motif:HMMPfam:PF07719"
FT   repeat_region   159216..159227
FT                   /rpt_unit_seq="(ccg)4"
FT   CDS_pept        160140..160751
FT                   /transl_table=11
FT                   /locus_tag="Smlt0147"
FT                   /product="putative phosphatidylethanolamine-binding
FT                   protein"
FT                   /note="similarity:fasta; with=UniProt:Q8PE01
FT                   (EMBL:AE012114;); Xanthomonas campestris pv. campestris.;
FT                   Hypothetical protein XCC0182.; length=203; id 78.218%;
FT                   ungapped id 78.218%; E()=6.3e-66; 202 aa overlap; query
FT                   1-202; subject 1-202"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0147"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43756"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHB3"
FT                   /protein_id="CAQ43756.1"
FT                   /translation="MQLTSHSLTNGAPIDREFAAGDANGFAPDRNPHLAWSGAPAGTRS
FT                   FLLVCVDPDVPTVPETVGRGDMSVPRDQPRCDFVHWVMADIPATVQEIAAGSCSDGFVV
FT                   KGKPAPAGPAGSRQGLNDFTGWFAGNPDMAGDYLGYDGPYPPFNDERMHRYFFRVFALD
FT                   VASLDLPQRFTAADAYRAMHGHVLAEAALHGTYTLNPALG"
FT   misc_feature    160155..160736
FT                   /locus_tag="Smlt0147"
FT                   /note="HMMPfam hit to PF01161,
FT                   Phosphatidylethanolamine-binding protein, score 1.5e-07"
FT                   /inference="protein motif:HMMPfam:PF01161"
FT   CDS_pept        complement(160836..161459)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0148"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q8PE00
FT                   (EMBL:AE012114;); Xanthomonas campestris pv. campestris.;
FT                   Hypothetical protein XCC0183.; length=274; id 31.544%;
FT                   ungapped id 33.099%; E()=2e-05; 149 aa overlap; query
FT                   63-207; subject 34-179"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0148"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43757"
FT                   /db_xref="InterPro:IPR005184"
FT                   /db_xref="InterPro:IPR038670"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHB4"
FT                   /protein_id="CAQ43757.1"
FT                   /translation="MEGRPRGRPSSWSVGPAAGRLPCAALPTHGCCRPAADTTRMHREI
FT                   GMKHVPVLIIAALLAMSANVAAASTPSTPSTPSTDQLEAHLWQLVRATNAQGKRIDALF
FT                   VRGRAPYTLRFQSGFMSELNLCNHVSNEYRLQGNLLILRNSVQTTALCVDQRLPTQQKL
FT                   AGKLMHGEGSAPTLALDDRGALVLRNARGDTAVFEPAALQADGR"
FT   repeat_region   161224..161250
FT                   /rpt_unit_seq="(gtgctgggc)3"
FT   CDS_pept        complement(161464..162291)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0149"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q1I8U0
FT                   (EMBL:CT573326;); Pseudomonas entomophila L48.;
FT                   Hypothetical protein.; length=271; id 47.893%; ungapped id
FT                   50.403%; E()=3e-38; 261 aa overlap; query 12-269; subject
FT                   13-263"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0149"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43758"
FT                   /db_xref="InterPro:IPR005184"
FT                   /db_xref="InterPro:IPR025485"
FT                   /db_xref="InterPro:IPR038670"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHB5"
FT                   /protein_id="CAQ43758.1"
FT                   /translation="MNRKLTLLLPLALMAACSQTPAPAGTGGDDVAPAAAKAADQQTLA
FT                   HLDAQRLQSQHWLLQQATGADGKRIDALFAREDKPVTLDFADGRLSVSNTCNRMGGGYT
FT                   LADGKLTVSAMASTMMACTDKALMALDEAVSSRLQGELKAEQDADGKLTLTTAKGDVLV
FT                   FNPEPTAETRYGGAGETVFLEVAAKTEKCSHPLIPDYQCLQVREVKFDDKGLKQGEPGK
FT                   FENFYGNIEGYTHEDGVRNVVRVKRYEVKNPPADAPSQAYVLDMVVESAIEKK"
FT   misc_feature    complement(161824..162141)
FT                   /locus_tag="Smlt0149"
FT                   /note="HMMPfam hit to PF03724, Domain of unknown function
FT                   (306), score 1.4e-24"
FT                   /inference="protein motif:HMMPfam:PF03724"
FT   repeat_region   complement(162184..162233)
FT                   /rpt_family="GC_rich"
FT                   /inference="nucleotide motif:RepeatScout"
FT   sig_peptide     complement(162220..162291)
FT                   /locus_tag="Smlt0149"
FT                   /note="Signal peptide predicted for Smlt0149 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.662 between residues 24 and 25"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(162365..163159)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0150"
FT                   /product="putative transmembrane
FT                   undecaprenyl-diphosphatase"
FT                   /note="similarity:fasta; with=UniProt:Q8PDZ9
FT                   (EMBL:AE012114;); Xanthomonas campestris pv. campestris.;
FT                   uppP; Undecaprenyl-diphosphatase (EC 3.6.1.27)
FT                   (Undecaprenyl pyrophosphate phosphatase) (Bacitracin
FT                   resistance protein).; length=263; id 77.481%; ungapped id
FT                   77.481%; E()=3e-70; 262 aa overlap; query 1-262; subject
FT                   1-262"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0150"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43759"
FT                   /db_xref="GOA:B2FHB6"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2FHB6"
FT                   /protein_id="CAQ43759.1"
FT                   /translation="MSDLLSALLLGILEGLTEFLPISSTGHLLIAQHWLGARSDFFNIV
FT                   IQAGAIVAVVLVFRQRLLQLATGFNQRGNREYVFKLGAAFLVTAVVGLVVRKAGWSLPE
FT                   TVSPVAWALIIGGVWMLLVEAYTARLPDRDQVTWTVAIGVGLAQVVAGVFPGTSRSASA
FT                   IFLAMLLGLSRRAAAAEFVFLVGIPTMFAASAYTFLEMAKAGQLGSEDWADVGVAFLAA
FT                   AITGFVVVKWLMGYIKSHRFTAFAIYRIALGAALLLWLPSGS"
FT   misc_feature    complement(order(162371..162430,162458..162526,
FT                   162563..162631,162689..162754,162791..162847,
FT                   162875..162928,162986..163039))
FT                   /locus_tag="Smlt0150"
FT                   /note="7 probable transmembrane helices predicted for
FT                   Smlt0150 by TMHMM2.0 at aa 41-58, 78-95, 105-123, 136-157,
FT                   177-199, 212-234 and 244-263"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(162392..163144)
FT                   /locus_tag="Smlt0150"
FT                   /note="HMMPfam hit to PF02673, Bacitracin resistance
FT                   protein BacA, score 2.1e-100"
FT                   /inference="protein motif:HMMPfam:PF02673"
FT   repeat_region   complement(162622..162642)
FT                   /rpt_family="GC_rich"
FT                   /inference="nucleotide motif:RepeatScout"
FT   CDS_pept        163383..164792
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="Smlt0151"
FT                   /product="putative glutamine synthetase (glutamate--ammonia
FT                   ligase)"
FT                   /EC_number="6.3.1.2"
FT                   /note="similarity:fasta; with=UniProt:P15124
FT                   (EMBL:AE017282;); Methylococcus capsulatus.; glnA;
FT                   Glutamine synthetase (EC 6.3.1.2) (Glutamate--ammonia
FT                   ligase).; length=469; id 68.803%; ungapped id 68.803%;
FT                   E()=2.2e-133; 468 aa overlap; query 1-468; subject 1-468"
FT                   /note="similarity:fasta; with=UniProt:Q8PDZ8
FT                   (EMBL:AE012114;); Xanthomonas campestris pv. campestris.;
FT                   glnA; Glutamine synthetase.; length=469; id 90.832%;
FT                   ungapped id 90.832%; E()=8.1e-176; 469 aa overlap; query
FT                   1-469; subject 1-469"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0151"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43760"
FT                   /db_xref="GOA:B2FHB7"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHB7"
FT                   /protein_id="CAQ43760.1"
FT                   /translation="MSVENVEKLIKDNQIEFVDLRFVDMRGVEQHVTFPVSIVEPSLFE
FT                   EGKMFDGSSIAGWKGINESDMVLLPDTASAYVDPFYADPTIVISCDILDPATMQPYGRC
FT                   PRGIAKRAEAYLKSSGIAETAFFGPEPEFFIFDSVRFANEMGNTFFKVDSEEAAWNSGA
FT                   KYDGANSGYRPGVKGGYFPVPPTDTLHDLRAEMCKTLEQVGIEVEVQHHEVATAGQCEI
FT                   GTKFSTLVQKADELLRMKYVIKNVAHRNGKTVTFMPKPIVGDNGSGMHVHQSLSKGGTN
FT                   LFSGDGYGGLSQLALWYIGGIFKHAKAINAFANSGTNSYKRLVPGFEAPVMLAYSARNR
FT                   SASCRIPWVSNPKARRIEMRFPDPIQSGYLTFTALMMAGLDGIKNQIDPGAPSDKDLYD
FT                   LPPEEEKLIPQVCSSLDQALEALDKDREFLKAGGVMSDDFIDGYIALKMQEVTKFRAAT
FT                   HPLEYQLYYAS"
FT   misc_feature    163422..163667
FT                   /gene="glnA"
FT                   /locus_tag="Smlt0151"
FT                   /note="HMMPfam hit to PF03951, Glutamine synthetase,
FT                   beta-Grasp domain, score 1.3e-43"
FT                   /inference="protein motif:HMMPfam:PF03951"
FT   misc_feature    163686..164531
FT                   /gene="glnA"
FT                   /locus_tag="Smlt0151"
FT                   /note="HMMPfam hit to PF00120, Glutamine synthetase,
FT                   catalytic domain, score 1.3e-164"
FT                   /inference="protein motif:HMMPfam:PF00120"
FT   CDS_pept        165140..165478
FT                   /transl_table=11
FT                   /gene="glnB"
FT                   /locus_tag="Smlt0152"
FT                   /product="nitrogen regulatory protein p-ii"
FT                   /note="similarity:fasta; with=UniProt:Q52905
FT                   (EMBL:AL591787;); Rhizobium meliloti (Sinorhizobium
FT                   meliloti).; glnB; Nitrogen regulatory protein P-II.;
FT                   length=112; id 75.000%; ungapped id 75.000%; E()=1.1e-25;
FT                   112 aa overlap; query 1-112; subject 1-112"
FT                   /note="similarity:fasta; with=UniProt:Q3BZ93
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; glnB; Nitrogen regulatory protein P-II.;
FT                   length=112; id 91.964%; ungapped id 91.964%; E()=7.2e-32;
FT                   112 aa overlap; query 1-112; subject 1-112"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0152"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43761"
FT                   /db_xref="GOA:B2FHB8"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHB8"
FT                   /protein_id="CAQ43761.1"
FT                   /translation="MKLISAIIRPFKLDEVREALSDAGVSGITVTEVKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKIKIETVVTDERADAVIEAIQSSAGTGKIGDGKIFVTAVEQVIRIRT
FT                   GEIGADAL"
FT   misc_feature    165149..165454
FT                   /gene="glnB"
FT                   /locus_tag="Smlt0152"
FT                   /note="HMMPfam hit to PF00543, Nitrogen regulatory protein
FT                   P-II, score 1.8e-67"
FT                   /inference="protein motif:HMMPfam:PF00543"
FT   CDS_pept        165506..166930
FT                   /transl_table=11
FT                   /gene="amtB"
FT                   /locus_tag="Smlt0153"
FT                   /product="putative ammonia channel precursor (ammonia
FT                   transporter)"
FT                   /note="similarity:fasta; with=UniProt:P69680
FT                   (EMBL:AE005174;); Escherichia coli O157:H7.; amtB; Ammonia
FT                   channel precursor (Ammonia transporter).; length=428; id
FT                   57.447%; ungapped id 58.554%; E()=7.5e-76; 423 aa overlap;
FT                   query 55-474; subject 11-428"
FT                   /note="similarity:fasta; with=UniProt:Q8PDZ7
FT                   (EMBL:AE012115;); Xanthomonas campestris pv. campestris.;
FT                   amtB; Ammonium transporter.; length=491; id 69.311%;
FT                   ungapped id 70.789%; E()=5.3e-101; 479 aa overlap; query
FT                   3-474; subject 16-491"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0153"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43762"
FT                   /db_xref="GOA:B2FHB9"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR002229"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHB9"
FT                   /protein_id="CAQ43762.1"
FT                   /translation="MRLLTGWQARFHVVWLLMLLSALAAGAWPGNAHAQAQVSPLPSES
FT                   VAVEPLQDTAAAAAAPAVAEAAAAYDHGDVAWMLTSTLLVLLMVVPGLALFYGGLVRSK
FT                   NVLSVLSQILVVFSLVLLLWVAYGYSAVFSAGNPFFGSFTEFAFLKGFTPESVGNTPIK
FT                   GLPDYLFVAFQSTFAGITTALIVGAFAERIKFRAVLLFSALWFTLSYIPMAHIVWGGGY
FT                   LGELGAIDFAGGTVVHINAGVAGLVAAWFVGKRLGYGQTALKPHNVPFTYIGAMLLWVG
FT                   WFGFNAGSAAAADTVASLAFLNTVLATAAAVLGWTLVEAISKGKPSALGAASGAVAGLV
FT                   GITPACGTVGPLGAIIIGFVAGVVCVWGVTGLKRLLKVDDTADVFGVHGVGGIVGAILT
FT                   GVFSAQSLGGTKAGLDIAHQVWVQVVSVGLTVVWSAVVTAVILLVVKVVVGLRVTEEAE
FT                   RTGLDVTSHGESAYEA"
FT   sig_peptide     165506..165607
FT                   /gene="amtB"
FT                   /locus_tag="Smlt0153"
FT                   /note="Signal peptide predicted for Smlt0153 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.996 between residues 34 and 35"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(165542..165601,165734..165802,165821..165889,
FT                   166007..166075,166094..166162,166205..166264,
FT                   166301..166360,166388..166456,166490..166558,
FT                   166568..166621,166658..166726,166769..166837)
FT                   /gene="amtB"
FT                   /locus_tag="Smlt0153"
FT                   /note="12 probable transmembrane helices predicted for
FT                   Smlt0153 by TMHMM2.0 at aa 13-32, 77-99, 106-128, 168-190,
FT                   197-219, 234-253, 266-285, 295-317, 329-351, 355-372,
FT                   385-407 and 422-444"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    165731..166921
FT                   /gene="amtB"
FT                   /locus_tag="Smlt0153"
FT                   /note="HMMPfam hit to PF00909, Ammonium Transporter Family,
FT                   score 9.9e-162"
FT                   /inference="protein motif:HMMPfam:PF00909"
FT   repeat_region   166428..166439
FT                   /rpt_unit_seq="(ccg)4"
FT   CDS_pept        167154..167900
FT                   /transl_table=11
FT                   /locus_tag="Smlt0154"
FT                   /product="putative N-acetylmuramoyl-L-alanine amidase"
FT                   /note="similarity:fasta; with=UniProt:Q4UPV6
FT                   (EMBL:CP000050;); Xanthomonas campestris pv. campestris
FT                   (strain 8004).; N-acetylmuramoyl-L-alanine amidase.;
FT                   length=266; id 64.198%; ungapped id 65.272%; E()=2.7e-61;
FT                   243 aa overlap; query 1-243; subject 8-246"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0154"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43763"
FT                   /db_xref="GOA:B2FHC0"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHC0"
FT                   /protein_id="CAQ43763.1"
FT                   /translation="MHPIRTVLMLSACLLLAACASAPQETRNPLATWVPSPNQNARTPV
FT                   IIVIHHTEQKSVQQSLHTLRTANSGGPVSAHYLVGADGHRYQLVADERRAWHAGAGRWG
FT                   TITDLNSASIGIELDNDGRSPFSAAQIESLIVLLRDLTSRLNIPPRQVIGHADLAPTRK
FT                   QDPSRFFPWQQLAEVGFGVWPRAADGAAPEGFDAWNALARFGYPLDNREATVAAFHRRF
FT                   RGRDDLPKTLDAEDARILYSLLLQTP"
FT   sig_peptide     167154..167219
FT                   /locus_tag="Smlt0154"
FT                   /note="Signal peptide predicted for Smlt0154 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.489 between residues 22 and 23"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    167250..167702
FT                   /locus_tag="Smlt0154"
FT                   /note="HMMPfam hit to PF01510, N-acetylmuramoyl-L-alanine
FT                   amidase, score 2.3e-32"
FT                   /inference="protein motif:HMMPfam:PF01510"
FT   repeat_region   167704..167711
FT                   /rpt_unit_seq="(cg)4"
FT   CDS_pept        167968..169134
FT                   /transl_table=11
FT                   /locus_tag="Smlt0155"
FT                   /product="putative murein degrading transcglycosylase"
FT                   /note="similarity:fasta; with=UniProt:Q4ZY34
FT                   (EMBL:CP000075;); Pseudomonas syringae pv. syringae (strain
FT                   B728a).; MltA:3D precursor.; length=403; id 72.340%;
FT                   ungapped id 73.315%; E()=1.4e-103; 376 aa overlap; query
FT                   14-387; subject 15-387"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0155"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43764"
FT                   /db_xref="GOA:B2FHC1"
FT                   /db_xref="InterPro:IPR005300"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR026044"
FT                   /db_xref="InterPro:IPR034654"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHC1"
FT                   /protein_id="CAQ43764.1"
FT                   /translation="MIDSATFVKRRHCILLAAAVLAGCATTAPRTGSEAPTPTMPPAAT
FT                   YAKAAWSALPPVSNSDLQAGFVAWRSSCTRLKNDAVWAKPCATAAAVSDKDPAAIRQFL
FT                   QRDLDAYALRAGGHQADGLITGYYEPIYAGSLTRTDKATVPVYGTPDDLVVVQLESLYP
FT                   ELKGKRLRGRVEGKVLKPYDDAGTIAAQGANAPVLAWLTDPMDLQLLQIQGSGRVRLAD
FT                   GKQVRLAYAEQNGHPYRAVGRWLVDQGQLKKEDVTMDAIRAWARANPARVPELLRSNPS
FT                   YVFFVRNPDSPEGPRGSLNVPLTAGYSVAVDRSVVPLGSLLWLSTTRPDGTPVVRPVAA
FT                   QDTGGAIAGEVRADLYWGSGDAAGKLAGDMKQKGNIWMLWPKGAPLPN"
FT   sig_peptide     167968..168048
FT                   /locus_tag="Smlt0155"
FT                   /note="Signal peptide predicted for Smlt0155 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.486 between residues 27 and 28"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    168259..168876
FT                   /locus_tag="Smlt0155"
FT                   /note="HMMPfam hit to PF03562, MltA N-terminal domain,
FT                   score 1.3e-110"
FT                   /inference="protein motif:HMMPfam:PF03562"
FT   repeat_region   168774..168781
FT                   /rpt_unit_seq="(cg)4"
FT   misc_feature    168886..169107
FT                   /locus_tag="Smlt0155"
FT                   /note="HMMPfam hit to PF06725, 3D domain, score 1.2e-34"
FT                   /inference="protein motif:HMMPfam:PF06725"
FT   CDS_pept        169243..169557
FT                   /transl_table=11
FT                   /locus_tag="Smlt0156"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q2SGE7
FT                   (EMBL:CP000155;); Hahella chejuensis (strain KCTC 2396).;
FT                   Hypothetical protein.; length=86; id 35.000%; ungapped id
FT                   35.897%; E()=0.014; 80 aa overlap; query 18-96; subject
FT                   2-80"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0156"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43765"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHC2"
FT                   /protein_id="CAQ43765.1"
FT                   /translation="MTYAKHNAKRGAKSAAKKYYKHWAESGLGKGNVLMEARGEKIVRQ
FT                   VEIYGTKMVWADEHAHSDDRFLLADQPVSFLDFDEDDEISAREFEAAWKKAREATGYPV
FT                   "
FT   CDS_pept        169665..171710
FT                   /transl_table=11
FT                   /locus_tag="Smlt0157"
FT                   /product="putative TonB dependent transport protein"
FT                   /note="Similar to ) escherichia coli. feca UniProt:P13036
FT                   (EMBL:M20981 (774 aa) fasta scores: E()=2.7e-12, 23.547% id
FT                   in 671 aa, and to ) xanthomonas axonopodis pv. citri. feca
FT                   UniProt:Q8PPJ6 (EMBL:AE011697 (681 aa) fasta scores: E()=0,
FT                   77.827% id in 681 aa"
FT                   /note="similarity:fasta; with=UniProt:P13036
FT                   (EMBL:M20981;); Escherichia coli.; fecA; Iron(III)
FT                   dicitrate transport protein fecA precursor.; length=774; id
FT                   23.547%; ungapped id 26.555%; E()=2.7e-12; 671 aa overlap;
FT                   query 53-681; subject 138-774"
FT                   /note="similarity:fasta; with=UniProt:Q8PPJ6
FT                   (EMBL:AE011697;); Xanthomonas axonopodis pv. citri.; fecA;
FT                   TonB-dependent receptor.; length=681; id 77.827%; ungapped
FT                   id 77.827%; E()=0; 681 aa overlap; query 1-681; subject
FT                   1-681"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0157"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43766"
FT                   /db_xref="GOA:B2FHC3"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHC3"
FT                   /protein_id="CAQ43766.1"
FT                   /translation="MKTPTLVAALAAAPFAPEAFAQSADAALTLGKVQVHQHGEGQLSA
FT                   RQVLTSVDVLGADQIEDRNVSHSWELLGQMPGIQLTETRQGAESGKVSFRAFNGEGYLN
FT                   AIKTLIDGIPSNVNSGNQRFIDMLFPLDISYIEVVRGTNDPRYGLHNIGGNVNFGTRQG
FT                   GSYTDARLAYGSYNTRDAQLAVGREANGFAQNYFVGTQASDGYRDHDTSKKYSLGGKWF
FT                   FGTLDEGLRVGLTARAYHHEADEPGFMTAEELRTLRRGSELRNGNDGDDRDMRQIAAHV
FT                   DLKLSDALTFGTRLYYNRYEDDRRVTFSDLPTGNLPRQRRVWDERQTGLLSTLTWQASP
FT                   ALTVEGGLNYEQQDNGYIRERYAYAEPTDYSQPPARVQNDDRHSFDNWGAYVQAVYQPV
FT                   EAWKIVPAYRVDRFSGRTHLMNGITARLQDYGSIGQPKLSIIHSLGQTTHVYANWGRTF
FT                   QVLTGSTAPAYLTPGQAPMQPSTNTGMELGLKFQPFQGAQARLAVWQQDAENEVSNMPA
FT                   TGTTVTLGKTRRRGVDAQLSLQLGDDWTVWASHAYQEAKITRDDRDAGISLQGREVAAT
FT                   PRHISNLGVDYRATDALRLGLQARAQGDYYLEERNVAGKFGGFAVLDLSAAYQLTPRFS
FT                   VDLQLKNVTGRQYAYAWYDSFFWDSARPMFSPAPGRSVFVGLNMKL"
FT   sig_peptide     169665..169727
FT                   /locus_tag="Smlt0157"
FT                   /note="Signal peptide predicted for Smlt0157 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.964 between residues 21 and 22"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    169794..170129
FT                   /locus_tag="Smlt0157"
FT                   /note="HMMPfam hit to PF07715, TonB-dependent Receptor Plug
FT                   Domain, score 5.2e-19"
FT                   /inference="protein motif:HMMPfam:PF07715"
FT   repeat_region   169795..169802
FT                   /rpt_unit_seq="(gc)4"
FT   repeat_region   170370..170377
FT                   /rpt_unit_seq="(gc)4"
FT   misc_feature    170967..171707
FT                   /locus_tag="Smlt0157"
FT                   /note="HMMPfam hit to PF00593, TonB dependent receptor,
FT                   score 2.5e-20"
FT                   /inference="protein motif:HMMPfam:PF00593"
FT   CDS_pept        171881..172942
FT                   /transl_table=11
FT                   /gene="glnL"
FT                   /locus_tag="Smlt0158"
FT                   /product="putative nitrogen regulation protein nr(ii)"
FT                   /EC_number="2.7.13.3"
FT                   /note="similarity:fasta; with=UniProt:P0AFB5
FT                   (EMBL:K02176;); Escherichia coli.; glnL; Nitrogen
FT                   regulation protein NR(II) (EC 2.7.13.3).; length=349; id
FT                   36.599%; ungapped id 38.024%; E()=1e-29; 347 aa overlap;
FT                   query 2-339; subject 5-347"
FT                   /note="similarity:fasta; with=UniProt:Q3BZ91
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; ntrB; Two-component system sensor
FT                   protein.; length=351; id 77.419%; ungapped id 77.419%;
FT                   E()=1.4e-96; 341 aa overlap; query 8-348; subject 8-348"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0158"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43767"
FT                   /db_xref="GOA:B2FHC4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHC4"
FT                   /protein_id="CAQ43767.1"
FT                   /translation="MSDPAPPPSLDALGTPLAWAGADGCIAGCNPAFARWLGVSVRRLL
FT                   GRPLVALEVQGEALAHFLARDERDSLRLNRLALAVPGEAPRFAEGWMSRRDDGGWLLEA
FT                   HPVDEFPGLDPTQALPSALSAALKGLAHELRNPLAGLKGAAQLLARRAAQRDAGERELI
FT                   ELIGSEIERLNGLLDQLLSPAPAAPHAELNIHAALERVLRLAESEAGWAVRLQRDYDPS
FT                   IPEFHGDADRLTQAVWNLVRNAIQAGAGNITLRTRVEHGVRIAEQLHTLALRLEIADDG
FT                   RGVPEELAEHLFLPLVSGRAEGTGLGLALAQQVAREHRGTLTYRSRPGHTVFTLLLPIV
FT                   SGAAPAEEAPRDV"
FT   misc_feature    172244..172447
FT                   /gene="glnL"
FT                   /locus_tag="Smlt0158"
FT                   /note="HMMPfam hit to PF00512, His Kinase A
FT                   (phosphoacceptor) domain, score 1.8e-13"
FT                   /inference="protein motif:HMMPfam:PF00512"
FT   repeat_region   complement(172425..172445)
FT                   /rpt_family="GC_rich"
FT                   /inference="nucleotide motif:RepeatScout"
FT   misc_feature    172562..172900
FT                   /gene="glnL"
FT                   /locus_tag="Smlt0158"
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HSP90, score 7.7e-32"
FT                   /inference="protein motif:HMMPfam:PF02518"
FT   CDS_pept        172935..174383
FT                   /transl_table=11
FT                   /gene="glnG"
FT                   /locus_tag="Smlt0159"
FT                   /product="putative nitrogen regulation protein nr(i)"
FT                   /note="similarity:fasta; with=UniProt:P0AFB8
FT                   (EMBL:D16509;); Escherichia coli.; glnG; Nitrogen
FT                   regulation protein NR(I).; length=469; id 51.404%; ungapped
FT                   id 51.965%; E()=1.5e-78; 463 aa overlap; query 11-473;
FT                   subject 6-463"
FT                   /note="similarity:fasta; with=UniProt:Q4V088
FT                   (EMBL:CP000050;); Xanthomonas campestris pv. campestris
FT                   (strain 8004).; Two-component system regulatory protein.;
FT                   length=476; id 76.299%; ungapped id 77.590%; E()=2.6e-125;
FT                   481 aa overlap; query 1-479; subject 1-475"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0159"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43768"
FT                   /db_xref="GOA:B2FHC5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010114"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHC5"
FT                   /protein_id="CAQ43768.1"
FT                   /translation="MSESSSSPQRIWVVDDDRAVRFVLCTALREAGYQVVDFDSAAPAL
FT                   QALSEGPPPALLFTDVRMPGDDGLVLLDKLKAALPQLPVVVMSAYTDVASTAGAFRGGA
FT                   HEFLSKPFDLDDAVALAQRVLPAVAPALAAATPAAEAHSDQPPQLVGDTPPMRALFRAI
FT                   GRLAQAPLAVLITGETGTGKELVANALHRESPRAQGPFVALNTAAIPSELLESELFGHE
FT                   AGAFTGAQRRHIGRFEQADGGTLFLDEIGDMPLPLQTRLLRVLAQGEFFRVGGRELIRV
FT                   DVRVVAATHQDLEGLVAQGKFRADLLHRLDVVRLQLPPLRERREDIAQLASTFLAAAAR
FT                   KLDTPPKRLTAAALQALREHDWPGNVRELENVCWRMAALAAADTIGVADVDTALNRTRG
FT                   RRSSTTSADPGQWEALLAEWARRQLAEGVEGLHAQVRERVDHALLEAALQITHGRRAEA
FT                   AARLGLGRNTLTRKLGAGRRRGGH"
FT   misc_feature    172959..173300
FT                   /gene="glnG"
FT                   /locus_tag="Smlt0159"
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 3.3e-27"
FT                   /inference="protein motif:HMMPfam:PF00072"
FT   misc_feature    173379..174044
FT                   /gene="glnG"
FT                   /locus_tag="Smlt0159"
FT                   /note="HMMPfam hit to PF00158, Sigma-54 interaction domain,
FT                   score 1.2e-141"
FT                   /inference="protein motif:HMMPfam:PF00158"
FT   repeat_region   173402..173409
FT                   /rpt_unit_seq="(gc)4"
FT   repeat_region   173518..173525
FT                   /rpt_unit_seq="(cg)4"
FT   misc_feature    174240..174362
FT                   /gene="glnG"
FT                   /locus_tag="Smlt0159"
FT                   /note="HMMPfam hit to PF02954, Bacterial regulatory
FT                   protein, Fis fam, score 2.5e-09"
FT                   /inference="protein motif:HMMPfam:PF02954"
FT   repeat_region   complement(174353..174378)
FT                   /rpt_family="GC_rich"
FT                   /inference="nucleotide motif:RepeatScout"
FT   CDS_pept        174477..175046
FT                   /transl_table=11
FT                   /gene="sodC1"
FT                   /locus_tag="Smlt0160"
FT                   /product="putative superoxide dismutase [Cu-Zn]"
FT                   /EC_number="1.15.1.1"
FT                   /note="similarity:fasta; with=UniProt:Q9C0N4
FT                   (EMBL:AF248049;); bacillisporus).; SOD1; Superoxide
FT                   dismutase [Cu-Zn] (EC 1.15.1.1).; length=153; id 40.278%;
FT                   ungapped id 43.609%; E()=1.2e-12; 144 aa overlap; query
FT                   52-187; subject 11-151"
FT                   /note="similarity:fasta; with=UniProt:Q3BZ89
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; sodC1; Superoxide dismutase precursor (EC
FT                   1.15.1.1).; length=200; id 58.549%; ungapped id 60.106%;
FT                   E()=9e-39; 193 aa overlap; query 1-189; subject 1-192"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0160"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43769"
FT                   /db_xref="GOA:B2FHC6"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR036423"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHC6"
FT                   /protein_id="CAQ43769.1"
FT                   /translation="MRLSFAILPLSAAVLLSACGSAPKKTEPTPPPPTVVSAAKQGEAN
FT                   IAPASASIVSGRIALMVEPGGIHITGLIGGLQPMQQAGFHIHERGDCSAVDASSAGNHF
FT                   NPGGAAHGRAGTGKHHLGDMDNLRADAQGRANVDIHLKGVTLGGGAATDIAGRALVVHA
FT                   NADDYRSQPAGNAGVRIACGVIRVVR"
FT   sig_peptide     174477..174548
FT                   /gene="sodC1"
FT                   /locus_tag="Smlt0160"
FT                   /note="Signal peptide predicted for Smlt0160 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.997) with cleavage site
FT                   probability 0.644 between residues 24 and 25"
FT                   /inference="protein motif:SignalP:2.0"
FT   repeat_region   174564..174575
FT                   /rpt_unit_seq="(ccg)4"
FT   misc_feature    174591..175034
FT                   /gene="sodC1"
FT                   /locus_tag="Smlt0160"
FT                   /note="HMMPfam hit to PF00080, Copper/zinc superoxide
FT                   dismutase (SODC), score 4.3e-26"
FT                   /inference="protein motif:HMMPfam:PF00080"
FT   CDS_pept        175078..175704
FT                   /transl_table=11
FT                   /gene="sodC2"
FT                   /locus_tag="Smlt0161"
FT                   /product="putative superoxide dismutase"
FT                   /note="similarity:fasta; with=UniProt:Q2NM35
FT                   (EMBL:AY880950;); Bombus ignitus.; sod; Sod.; length=151;
FT                   id 47.260%; ungapped id 53.077%; E()=5.9e-14; 146 aa
FT                   overlap; query 68-204; subject 9-147"
FT                   /note="similarity:fasta; with=UniProt:Q3BZ88
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; sodC2; Superoxide dismutase precursor (EC
FT                   1.15.1.1).; length=215; id 65.865%; ungapped id 68.159%;
FT                   E()=2.3e-43; 208 aa overlap; query 1-204; subject 1-205"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0161"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43770"
FT                   /db_xref="GOA:B2FHC7"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR036423"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHC7"
FT                   /protein_id="CAQ43770.1"
FT                   /translation="MRLIHTSLFAAIAALGLAACNQQPAAPQAETPPAAPADGATTEPA
FT                   ATPAPAAAPAADATASAELAPTQGNETKGSVTFKVVDGKVHVTGQISGLKPGSEHGFHI
FT                   HEKGDCSAPDGMSAGGHFNPGKQDHGNVATDPHHGGDMPNIKADDKGVATIDGPVSSNV
FT                   NIGKGDDFDIIGRGLIVHADADDYKTQPTGNAGARLACAVIQKAQ"
FT   sig_peptide     175078..175152
FT                   /gene="sodC2"
FT                   /locus_tag="Smlt0161"
FT                   /note="Signal peptide predicted for Smlt0161 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.494 between residues 25 and 26"
FT                   /inference="protein motif:SignalP:2.0"
FT   repeat_region   complement(175169..175189)
FT                   /rpt_family="GC_rich"
FT                   /inference="nucleotide motif:RepeatScout"
FT   misc_feature    175249..175695
FT                   /gene="sodC2"
FT                   /locus_tag="Smlt0161"
FT                   /note="HMMPfam hit to PF00080, Copper/zinc superoxide
FT                   dismutase (SODC), score 7e-45"
FT                   /inference="protein motif:HMMPfam:PF00080"
FT   repeat_region   175664..175671
FT                   /rpt_unit_seq="(gc)4"
FT   CDS_pept        complement(175805..176905)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0162"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0162"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43771"
FT                   /db_xref="GOA:B2FHC8"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHC8"
FT                   /protein_id="CAQ43771.1"
FT                   /translation="MDTHARSRTNCMLCRLQCAGLTLLAAAVCGLPIMAQAAVPVAATP
FT                   TCTVAPAFAAAVAEPEVYDSHISFSNTVKVQVNVDAQGRAHDARVLNGSRNRVLDDAAR
FT                   QAALSWKYQCTGPGGIAQPVVPVPEPACRLDRLSWADNEPRFSSAVRSSGLRGSAEVWL
FT                   RPVAGDPAKTEVKIGRSSGDARIDDTLLNAARNWRLTCPPDAPVKHPWISFTQSFNFEP
FT                   RRQPAATEASEPEPDDVVIANDALLEFGTVAGFVEALPKMKGVDLAPDQSSQPGMTLYN
FT                   TSLGAIMREIEMTEGRLKPVTMTHWLVMVPPHRTAPAVVRTFKREVIDAKTGKAHMQTD
FT                   ISILCESGPAECAELRRRRDTLLRSP"
FT   misc_feature    complement(176777..176845)
FT                   /locus_tag="Smlt0162"
FT                   /note="1 probable transmembrane helix predicted for
FT                   Smlt0162 by TMHMM2.0 at aa 21-43"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(176795..176905)
FT                   /locus_tag="Smlt0162"
FT                   /note="Signal peptide predicted for Smlt0162 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.997) with cleavage site
FT                   probability 0.470 between residues 37 and 38"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(176971..177858)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0163"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q8PQV9
FT                   (EMBL:AE011646;); Xanthomonas axonopodis pv. citri.;
FT                   Hypothetical protein XAC0212.; length=301; id 68.367%;
FT                   ungapped id 68.601%; E()=7.2e-80; 294 aa overlap; query
FT                   1-294; subject 8-300"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0163"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43772"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHC9"
FT                   /protein_id="CAQ43772.1"
FT                   /translation="MSKPDPAMNALGVLALELAGGEVPRQAVLSAEQAGELADRVGRDL
FT                   SKLVPQVAELDLVFAAAHFDPAEVLRPGWPIHRRLEELQMRAPGRNQGPRLLAFGTDAQ
FT                   GDVPLPFQADASLVGGGLRVVPFLLTGSDVATTNAVAEALEDTLLANGMAHADTALMAQ
FT                   NTFGARIEHARYFTVNDLAAMMSMQYDNQGLAALWPLIETAIMAPGEDEWLNAAPEPLL
FT                   RYTHGEARMALFDPAGWCAHYDHGKNDCDRLKGIYEQFLMRQRQMAAVLEAHGVPVLFV
FT                   HCEAGQDARELLAR"
FT   repeat_region   176988..176995
FT                   /rpt_unit_seq="(cg)4"
FT   CDS_pept        177952..179247
FT                   /transl_table=11
FT                   /gene="fadI"
FT                   /locus_tag="Smlt0164"
FT                   /product="putative 3-ketoacyl-CoA thiolase"
FT                   /EC_number="2.3.1.16"
FT                   /note="similarity:fasta; with=UniProt:P76503
FT                   (EMBL:AJ586889;); Escherichia coli.; fadI; 3-ketoacyl-CoA
FT                   thiolase (EC 2.3.1.16) (Fatty acid oxidation complex
FT                   subunit beta) (Beta-ketothiolase) (Acetyl-CoA
FT                   acyltransferase) (Acyl- CoA ligase) (ACSs).; length=436; id
FT                   38.303%; ungapped id 39.387%; E()=1.2e-53; 436 aa overlap;
FT                   query 1-430; subject 5-434"
FT                   /note="similarity:fasta; with=UniProt:Q3BZ84
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; Acetyl-CoA acyltransferase (EC 2.3.1.16).;
FT                   length=431; id 90.487%; ungapped id 90.487%; E()=7.6e-154;
FT                   431 aa overlap; query 1-431; subject 1-431"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0164"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43773"
FT                   /db_xref="GOA:B2FHD0"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHD0"
FT                   /protein_id="CAQ43773.1"
FT                   /translation="MPGISMPNARPVAILGGVRIPFCRQNTAYSDVGNLGMSVRTLGAL
FT                   VERFGLHGQQLGEVAMGAVIKHSSDWNLGREATLSSGLSPLTPGITLQRACGTSLDSII
FT                   TVANKIALGQIESGIGGGSDTTSDVPIVYGKKLRARLLAANRAKSTGDKIRALTSGFKF
FT                   SELKPEFPGVAEPRTGKSMGDHCEDMAKEWNISRDSQDEWAVSSHKKLAAAYERGFFND
FT                   LIAPFRGVERDNILRPDTSLEKLATLKPAFDKVSGRGTLTAANSTPLTDGAAAVLLASE
FT                   EWARAHGHEPQAYLRDAHVSAVDFVHGEGLLMAPTVAVPEMLKRNGLTLQDFDIYEIHE
FT                   AFAAQVLCTLRAWESEDYCRNRLGLDAPMGRIDPDKINLLGSSLATGHPFAATGARVIA
FT                   TAAKQLAERGGGRALVSICTAGGMGVVAIVER"
FT   misc_feature    177976..178797
FT                   /gene="fadI"
FT                   /locus_tag="Smlt0164"
FT                   /note="HMMPfam hit to PF00108, Thiolase, N-terminal domain,
FT                   score 3.6e-54"
FT                   /inference="protein motif:HMMPfam:PF00108"
FT   repeat_region   178362..178371
FT                   /rpt_unit_seq="(gc)5"
FT   misc_feature    178816..179244
FT                   /gene="fadI"
FT                   /locus_tag="Smlt0164"
FT                   /note="HMMPfam hit to PF02803, Thiolase, C-terminal domain,
FT                   score 1e-35"
FT                   /inference="protein motif:HMMPfam:PF02803"
FT   CDS_pept        complement(179367..180662)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0165"
FT                   /product="putative transmembrane HemY porphyrin
FT                   biosynthesis protein"
FT                   /note="similarity:fasta; with=UniProt:Q8PDY8
FT                   (EMBL:AE012116;); Xanthomonas campestris pv. campestris.;
FT                   hemY; Porphyrin biosynthesis protein.; length=421; id
FT                   55.122%; ungapped id 55.392%; E()=1.7e-78; 410 aa overlap;
FT                   query 1-408; subject 1-410"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0165"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43774"
FT                   /db_xref="GOA:B2FHD1"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHD1"
FT                   /protein_id="CAQ43774.1"
FT                   /translation="MKPLQSLVVLLLAVAIGVVAAQWLGADDLNRFGEVTLRYGGYDYH
FT                   SNLPKVALLSVIAVLVLWLLWSLIAAPFRAWGRYRRKQGRVRLIDGLQAYEHGQWQRAE
FT                   KLLDGAAKDPEVSAVALANAVRSAQARADGPAGEALLQRLGESDATLQALLRAEQLLAR
FT                   DLPVDAINALDVAAIQPLPPRGLWLRTEALARAGRAHEAYGQLGALRQSKVLPAESNSE
FT                   LEARLAAQALLEAADVNALAAQWEATPKALRPTPDVVGAYASRAVALNWDEPALLALEQ
FT                   ALDQRWDDELVALYGRLPAERLATRQANLARWRNVHDGSAALHLAQGRVALAQQQWDAA
FT                   DTFLHEAIAAGAGAPAWEALGELFAQRGEHALAAQCLANALRLQRGEDSVALVRGSEAP
FT                   LRATVEEQPIAVQPPVYDANEERDEFGNPRLP"
FT   misc_feature    complement(180264..180653)
FT                   /locus_tag="Smlt0165"
FT                   /note="HMMPfam hit to PF07219, HemY protein N-terminus,
FT                   score 9e-28"
FT                   /inference="protein motif:HMMPfam:PF07219"
FT   misc_feature    complement(order(180444..180512,180585..180644))
FT                   /locus_tag="Smlt0165"
FT                   /note="2 probable transmembrane helices predicted for
FT                   Smlt0165 by TMHMM2.0 at aa 7-26 and 51-73"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(180600..180662)
FT                   /locus_tag="Smlt0165"
FT                   /note="Signal peptide predicted for Smlt0165 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.713 between residues 21 and 22"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(180669..181646)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0166"
FT                   /product="putative uroporphyrinogen III C-methyltransferase
FT                   HemX"
FT                   /note="similarity:fasta; with=UniProt:Q8PQV6
FT                   (EMBL:AE011646;); Xanthomonas axonopodis pv. citri.;
FT                   Hypothetical protein XAC0215.; length=325; id 52.454%;
FT                   ungapped id 53.271%; E()=1.8e-53; 326 aa overlap; query
FT                   1-325; subject 1-322"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0166"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43775"
FT                   /db_xref="GOA:B2FHD2"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHD2"
FT                   /protein_id="CAQ43775.1"
FT                   /translation="MNETPPVSPPRRPVRWLLPLAGVVVLGVGGYAGWYVWQQQQHEQE
FT                   AQAQTMAVQLQGLEATLDALRRDQRATSQRLQDAATTNRVLRDEMLGLSQRSALLEENL
FT                   AKLADSANQGRQAVQRDEAELLLTQAAQRLNYADDVEGARRLYAQAATALADLPDSDGL
FT                   NLRQALVQERDALDALGAGPRVQSLQRLDALARALQGLPSQVTGNAATDTAKPWWQSTL
FT                   APFVDITPSRQNGPLTAAERRNADDALQLELTLARAAIERGDRTGRDTALERVEHWAQR
FT                   RWPDSPALRAQRAELKALRELPLQASNTVLGSTLQQLRTQTDRR"
FT   misc_feature    complement(180675..181643)
FT                   /locus_tag="Smlt0166"
FT                   /note="HMMPfam hit to PF04375, HemX, score 1.6e-05"
FT                   /inference="protein motif:HMMPfam:PF04375"
FT   repeat_region   180773..180780
FT                   /rpt_unit_seq="(gc)4"
FT   repeat_region   180874..180881
FT                   /rpt_unit_seq="(gc)4"
FT   repeat_region   181215..181222
FT                   /rpt_unit_seq="(gc)4"
FT   misc_feature    complement(181536..181604)
FT                   /locus_tag="Smlt0166"
FT                   /note="1 probable transmembrane helix predicted for
FT                   Smlt0166 by TMHMM2.0 at aa 15-37"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(181751..182551)
FT                   /transl_table=11
FT                   /gene="hemD"
FT                   /locus_tag="Smlt0167"
FT                   /product="putative uroporphyrinogen-iii synthase (uros)
FT                   (uroporphyrinogen-iii cosynthetase) (hydroxymethylbilane
FT                   hydrolyase [cyclizing])"
FT                   /EC_number="4.2.1.75"
FT                   /note="similarity:fasta; with=UniProt:P48246
FT                   (EMBL:AE004938;); Pseudomonas aeruginosa.; hemD;
FT                   Uroporphyrinogen-III synthase (EC 4.2.1.75) (UROS)
FT                   (Uroporphyrinogen- III cosynthetase) (Hydroxymethylbilane
FT                   hydrolyase [cyclizing]).; length=251; id 30.924%; ungapped
FT                   id 32.766%; E()=7.6e-11; 249 aa overlap; query 16-255;
FT                   subject 3-246"
FT                   /note="similarity:fasta; with=UniProt:Q5GVD1
FT                   (EMBL:AE013598;); Xanthomonas oryzae pv. oryzae.; hemD;
FT                   Uroporphyrinogen-III synthase.; length=267; id 50.958%;
FT                   ungapped id 51.550%; E()=6.2e-37; 261 aa overlap; query
FT                   3-263; subject 7-264"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0167"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43776"
FT                   /db_xref="GOA:B2FHD3"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHD3"
FT                   /protein_id="CAQ43776.1"
FT                   /translation="MADHTIPTGAAGSEPGWTFISLRPQGQNSALRRAVAGLGGHVVAL
FT                   PPWRLQRLNGMPVVRQLQRALNCDRVVFTSPAAVAAAASLLPLAEAQRSPWLTVGEGTA
FT                   RALRAQGVGEVHAPQRMDSEGLLALPVLAEARGLRIGLVTAPGGRGLIAAHLQAAGATI
FT                   ERADVYQRRLLRLPPRTLARLPHSAQPWVLAVSSGEALQHFWQQLPPALQQRLQAQATV
FT                   VVASERLGDQAHALGLQRVVRAAGPTTAQLVAAAHATLTVPAAT"
FT   misc_feature    complement(181787..182476)
FT                   /gene="hemD"
FT                   /locus_tag="Smlt0167"
FT                   /note="HMMPfam hit to PF02602, Uroporphyrinogen-III
FT                   synthase HemD, score 4.5e-07"
FT                   /inference="protein motif:HMMPfam:PF02602"
FT   repeat_region   182235..182242
FT                   /rpt_unit_seq="(gc)4"
FT   CDS_pept        182596..183063
FT                   /transl_table=11
FT                   /locus_tag="Smlt0168"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q3BZ79
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; Hypothetical protein.; length=180; id
FT                   57.396%; ungapped id 58.788%; E()=6.1e-30; 169 aa overlap;
FT                   query 5-169; subject 11-179"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0168"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43777"
FT                   /db_xref="InterPro:IPR012660"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHD4"
FT                   /protein_id="CAQ43777.1"
FT                   /translation="MSVDALTSSLAALQDVLDCMPAVRAMQIQLDGYADGVLRITAPLA
FT                   ANVNDKGNAFGGSLASVLTLSGWALVSLRLRLAGHDAEVYVADSNLRYLAPVYEDLHAH
FT                   AEAAEATGWDAFLNTFRQRRKARISIIATQPGADGKPAAEFSGRFVAFAKG"
FT   CDS_pept        183096..183521
FT                   /transl_table=11
FT                   /locus_tag="Smlt0169"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q8PQV2
FT                   (EMBL:AE011646;); Xanthomonas axonopodis pv. citri.;
FT                   Hypothetical protein XAC0219.; length=140; id 47.183%;
FT                   ungapped id 48.201%; E()=6.5e-22; 142 aa overlap; query
FT                   1-141; subject 1-140"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43778"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHD5"
FT                   /protein_id="CAQ43778.1"
FT                   /translation="MRRLIQFLMCSLLLVSAVASADDLSRKQRKLLEETQIAYGATIRW
FT                   GSMDDAIGYLDPKLRKEKPPTEFELNRYAQLRVSSYRERSSAALEGGLVERRVEIGVIN
FT                   QNTQAERTVMVVERWRWDPEAKRWWQTAGLPDLWKGQ"
FT   sig_peptide     183096..183158
FT                   /locus_tag="Smlt0169"
FT                   /note="Signal peptide predicted for Smlt0169 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.997 between residues 21 and 22"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        183579..184016
FT                   /transl_table=11
FT                   /locus_tag="Smlt0170"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q4V074
FT                   (EMBL:CP000050;); Xanthomonas campestris pv. campestris
FT                   (strain 8004).; Hypothetical protein.; length=158; id
FT                   72.222%; ungapped id 72.222%; E()=2.9e-34; 144 aa overlap;
FT                   query 1-144; subject 14-157"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0170"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43779"
FT                   /db_xref="GOA:B2FHD6"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHD6"
FT                   /protein_id="CAQ43779.1"
FT                   /translation="MNYEELLAFAGRNPMLSAALVGLTVAIIVTEIRRLFRGFKGIKPA
FT                   ELTQLMNAGGTVVVDLSASGDFEKGHIAGSRNAQASAFGPDNKLVANAKQSPVVLVCRS
FT                   GNASETAAKALKKAGFEKVYVLDGGIPAWQQAELPLVKGRN"
FT   misc_feature    183621..183674
FT                   /locus_tag="Smlt0170"
FT                   /note="1 probable transmembrane helix predicted for
FT                   Smlt0170 by TMHMM2.0 at aa 15-32"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    183705..183986
FT                   /locus_tag="Smlt0170"
FT                   /note="HMMPfam hit to PF00581, Rhodanese-like domain, score
FT                   4.6e-15"
FT                   /inference="protein motif:HMMPfam:PF00581"
FT   CDS_pept        184116..184634
FT                   /transl_table=11
FT                   /gene="secB"
FT                   /locus_tag="Smlt0171"
FT                   /product="putative protein-export SecB protein"
FT                   /note="similarity:fasta; with=UniProt:Q93TF4
FT                   (EMBL:AF359453;); Pseudomonas fluorescens.; secB;
FT                   Protein-export protein secB.; length=160; id 43.506%;
FT                   ungapped id 44.079%; E()=7.4e-22; 154 aa overlap; query
FT                   7-160; subject 6-157"
FT                   /note="similarity:fasta; with=UniProt:Q8PQV0
FT                   (EMBL:AE011647;); Xanthomonas axonopodis pv. citri.; secB;
FT                   Protein-export protein secB.; length=170; id 84.884%;
FT                   ungapped id 85.882%; E()=3.6e-54; 172 aa overlap; query
FT                   1-172; subject 1-170"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0171"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43780"
FT                   /db_xref="GOA:B2FHD7"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2FHD7"
FT                   /protein_id="CAQ43780.1"
FT                   /translation="MSEEITNGAAAPVDAATGPAFTVEKIYVKDVSFESPNAPTIFNDQ
FT                   VQPELQLNLNQQVQRLGENAFEVVLAVTLTCQAGERTAYVAEVKQAGVFGLVGLDPQSI
FT                   DVLLGTQCPNILFPYVRQLISDLIQAGGFPPFFLQPINFEGLYAETLRQRQEQGDAPSL
FT                   ADSEPAGNA"
FT   misc_feature    184116..184583
FT                   /gene="secB"
FT                   /locus_tag="Smlt0171"
FT                   /note="HMMPfam hit to PF02556, Preprotein translocase
FT                   subunit SecB, score 6.2e-50"
FT                   /inference="protein motif:HMMPfam:PF02556"
FT   CDS_pept        184655..185680
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="Smlt0172"
FT                   /product="putative glycerol-3-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.94"
FT                   /note="similarity:fasta; with=UniProt:P0A6S7
FT                   (EMBL:U00039;); Escherichia coli.; gpsA;
FT                   Glycerol-3-phosphate dehydrogenase [NAD(P)+] (EC 1.1.1.94)
FT                   (NAD(P)H- dependent glycerol-3-phosphate dehydrogenase).;
FT                   length=339; id 48.358%; ungapped id 48.503%; E()=6.5e-51;
FT                   335 aa overlap; query 1-334; subject 1-335"
FT                   /note="similarity:fasta; with=UniProt:Q8PDY0
FT                   (EMBL:AE012116;); Xanthomonas campestris pv. campestris.;
FT                   gpsA; Glycerol-3-phosphate dehydrogenase [NAD(P)+] (EC
FT                   1.1.1.94) (NAD(P)H- dependent glycerol-3-phosphate
FT                   dehydrogenase).; length=341; id 85.294%; ungapped id
FT                   85.294%; E()=7.8e-97; 340 aa overlap; query 1-340; subject
FT                   1-340"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0172"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43781"
FT                   /db_xref="GOA:B2FHD8"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2FHD8"
FT                   /protein_id="CAQ43781.1"
FT                   /translation="MSTTADKIAVLGAGSWGTALASLLARHGHPTVLWGRDAAVVEAID
FT                   QRHENPRYLPGIPLPDSLRATTDLASAVEGAAWILVVTPSHAFGETVRALAPLRPAGAG
FT                   VAWATKGFEPGSGRFLHEVAREVLGEDVPLAVVTGPSFAKEVTQGLPTAITVHGDVPEF
FT                   AQMVAEAMHGPAFRAYTGDDMVGAELGGAMKNVLAVATGVADGMQLGLNARAGLITRGL
FT                   NEMLRLAAAIGAKPETLMGLAGLGDLVLTCTGDLSRNRRLGLALGRGQTLQDAVREIGQ
FT                   VVESVQTADEVMRQARRHGIDLPISDRVRAVLHGEQTPEEGLRALLAREQKPEYPDTLF
FT                   K"
FT   sig_peptide     184655..184717
FT                   /gene="gpsA"
FT                   /locus_tag="Smlt0172"
FT                   /note="Signal peptide predicted for Smlt0172 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.676) with cleavage site
FT                   probability 0.572 between residues 21 and 22"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    184667..185134
FT                   /gene="gpsA"
FT                   /locus_tag="Smlt0172"
FT                   /note="HMMPfam hit to PF02737, 3-hydroxyacyl-CoA
FT                   dehydrogenase, NAD b, score 0.00014"
FT                   /inference="protein motif:HMMPfam:PF02737"
FT   misc_feature    184670..185149
FT                   /gene="gpsA"
FT                   /locus_tag="Smlt0172"
FT                   /note="HMMPfam hit to PF01210, NAD-dependent
FT                   glycerol-3-phosphate deh, score 4.7e-81"
FT                   /inference="protein motif:HMMPfam:PF01210"
FT   misc_feature    184673..185230
FT                   /gene="gpsA"
FT                   /locus_tag="Smlt0172"
FT                   /note="HMMPfam hit to PF03807, NADP oxidoreductase coenzyme
FT                   F420-depe, score 0.0021"
FT                   /inference="protein motif:HMMPfam:PF03807"
FT   misc_feature    184676..185140
FT                   /gene="gpsA"
FT                   /locus_tag="Smlt0172"
FT                   /note="HMMPfam hit to PF02558, Ketopantoate reductase
FT                   PanE/ApbA, score 0.00039"
FT                   /inference="protein motif:HMMPfam:PF02558"
FT   misc_feature    185198..185632
FT                   /gene="gpsA"
FT                   /locus_tag="Smlt0172"
FT                   /note="HMMPfam hit to PF07479, NAD-dependent
FT                   glycerol-3-phosphate deh, score 3.7e-68"
FT                   /inference="protein motif:HMMPfam:PF07479"
FT   CDS_pept        complement(185830..186261)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0173"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q1YVV8
FT                   (EMBL:AAPH01000060;); Photobacterium profundum 3TCK.;
FT                   Hypothetical protein.; length=130; id 35.135%; ungapped id
FT                   37.500%; E()=0.00057; 111 aa overlap; query 35-139; subject
FT                   18-127"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0173"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43782"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHD9"
FT                   /protein_id="CAQ43782.1"
FT                   /translation="MASPAIAHDAEGAKPAQPLPDIALPAPLDRVLRDYEQAWRTGDAR
FT                   ALGALFAEDGFVLQSNQPPVRGRSAIEAAYAGQGSSPLRLRALAYAVEGNTGYIIGAYS
FT                   YGNNVGDTGKFTLTLKRVGDGPWLIFSDMDNTSAPPRAR"
FT   CDS_pept        186389..187096
FT                   /transl_table=11
FT                   /locus_tag="Smlt0174"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0174"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43783"
FT                   /db_xref="InterPro:IPR036501"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHE0"
FT                   /protein_id="CAQ43783.1"
FT                   /translation="MDAAQIRQGHGMKMRITGMAMMAALLAACGQAPEKTGETAPAVAP
FT                   APTAEAPAAVATVVEKEPSAEDGVDPSVSDNEGEPEDPSAGGELTCVDNPLATHFFTLV
FT                   GGNTVDDCGRKDPKVLAAFNALMKSTAAAESADKEIPSLRERLLSGPSGPGELVVLQGE
FT                   PWWFYTACQAHDCPGTALAMLYSPDQSKMVGRLTARCRVWWLGEPTAEQRAQIEQRQPL
FT                   PDAALKEDSALCE"
FT   CDS_pept        complement(187157..187768)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0175"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q3H0P2
FT                   (EMBL:AAJB01000024;); Nocardioides sp. JS614.; Putative
FT                   cyclase.; length=342; id 27.097%; ungapped id 28.966%;
FT                   E()=0.9; 155 aa overlap; query 31-179; subject 17-167"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0175"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43784"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHE1"
FT                   /protein_id="CAQ43784.1"
FT                   /translation="MTCHRKRMAGLRKPVRLFDNACPPASPLVAPAGNPSAGYGGRSVE
FT                   ALCLPVSTSARFSSHVSARHLCVAAAVCPARSIAMSTPESSRLRTQYVPASADAPSEAL
FT                   HPHDPHGFIATLDRIGKGAAADGQPWPERHQMPGRRMALADADCALTGLRVALEMLLAA
FT                   ERVRQNGPDEEYVGDRVMEGLMMASLSLAAQVSARMRPEG"
FT   CDS_pept        complement(188012..189055)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0176"
FT                   /product="putative arsenite transmembrane efflux pump
FT                   transporter protein"
FT                   /note="similarity:fasta; with=UniProt:Q3SMW8
FT                   (EMBL:CP000115;); Nitrobacter winogradskyi (strain
FT                   Nb-255/ATCC 25391).; Arsenite efflux pump ACR3 precursor.;
FT                   length=351; id 74.336%; ungapped id 74.336%; E()=7.4e-87;
FT                   339 aa overlap; query 5-343; subject 1-339"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0176"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43785"
FT                   /db_xref="GOA:B2FHE2"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHE2"
FT                   /protein_id="CAQ43785.1"
FT                   /translation="MTSRMNLFERHLTLWVGLCIAVGTLLGHFLPGAFAVLASAEVAKV
FT                   NLPVAALIWLMIIPMLLKVDFRAMRQLQQHWKGIGVTLFINWAVKPFSMALLGWLFLRH
FT                   AFADWLPAAQIDSYIAGLILLAAAPCTAMVFVWSNLCRGDANFTLSQVALNDAIMVVAY
FT                   APVVALLLGLSAITVPWDTLLLSVGLYILVPVLVAALLRRWILSRGGEARLQRALRRLG
FT                   PLSLSALLLTLVLLFGFQGQQIVKQPLVIALIAVPILIQVYFTSGLAYLLNRRLGVAHC
FT                   VAGPSALIGASNFFELAVATAVGLFGVHSGAALATVVGVLIEVPVMLSVVRIVNRTQAW
FT                   YERREEH"
FT   misc_feature    complement(order(188054..188122,188135..188203,
FT                   188240..188308,188336..188404,188438..188506,
FT                   188534..188602,188639..188707,188750..188809,
FT                   188870..188923,188951..189019))
FT                   /locus_tag="Smlt0176"
FT                   /note="10 probable transmembrane helices predicted for
FT                   Smlt0176 by TMHMM2.0 at aa 13-35, 45-62, 83-102, 117-139,
FT                   152-174, 184-206, 218-240, 250-272, 285-307 and 312-334"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(188315..188908)
FT                   /locus_tag="Smlt0176"
FT                   /note="HMMPfam hit to PF01758, Sodium Bile acid symporter
FT                   family, score 1.5e-32"
FT                   /inference="protein motif:HMMPfam:PF01758"
FT   sig_peptide     complement(188942..189055)
FT                   /locus_tag="Smlt0176"
FT                   /note="Signal peptide predicted for Smlt0176 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.987) with cleavage site
FT                   probability 0.411 between residues 38 and 39"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(189052..189555)
FT                   /transl_table=11
FT                   /gene="arsC"
FT                   /locus_tag="Smlt0177"
FT                   /product="putative arsenate reductase ArsC"
FT                   /note="similarity:fasta; with=UniProt:O68022
FT                   (EMBL:AE004653;); Pseudomonas aeruginosa.; arsC; ArsC.;
FT                   length=156; id 47.436%; ungapped id 48.052%; E()=3.1e-22;
FT                   156 aa overlap; query 5-160; subject 3-156"
FT                   /note="similarity:fasta; with=UniProt:Q1MFA0
FT                   (EMBL:AM236080;); Rhizobium leguminosarum bv. viciae
FT                   (strain 3841).; arsC1; Putative arsenate reductase (EC
FT                   1.20.4.1).; length=176; id 56.250%; ungapped id 57.325%;
FT                   E()=5.8e-30; 160 aa overlap; query 4-161; subject 8-166"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0177"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43786"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHE3"
FT                   /protein_id="CAQ43786.1"
FT                   /translation="MTRNVLFLCTGNSARSVLAEATLRAWGGDRFSAFSAGSQPNGQIN
FT                   PFALAQLQAEGMPIEGLRSKSWDEFVDAAPMDLVITVCDAAAAEACPVVFGDFVRSHWG
FT                   LPDPAAVAGSDADKTAAFALAHAIVKARLRALLALPDSLWSDREALQHALDQIGQLQPT
FT                   DSMP"
FT   misc_feature    complement(189139..189549)
FT                   /gene="arsC"
FT                   /locus_tag="Smlt0177"
FT                   /note="HMMPfam hit to PF01451, Low molecular weight
FT                   phosphotyrosine protein, score 9.6e-24"
FT                   /inference="protein motif:HMMPfam:PF01451"
FT   sig_peptide     complement(189499..189555)
FT                   /gene="arsC"
FT                   /locus_tag="Smlt0177"
FT                   /note="Signal peptide predicted for Smlt0177 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.991) with cleavage site
FT                   probability 0.985 between residues 19 and 20"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(189593..189922)
FT                   /transl_table=11
FT                   /gene="arsR"
FT                   /locus_tag="Smlt0178"
FT                   /product="putative ArsR family transcriptional regulatory
FT                   protein"
FT                   /note="similarity:fasta; with=UniProt:Q3F8G7
FT                   (EMBL:AAJL01000008;); Burkholderia ambifaria AMMD.;
FT                   Regulatory protein, ArsR.; length=111; id 59.813%; ungapped
FT                   id 62.136%; E()=6.9e-19; 107 aa overlap; query 1-107;
FT                   subject 1-103"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0178"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43787"
FT                   /db_xref="GOA:B2FHE4"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHE4"
FT                   /protein_id="CAQ43787.1"
FT                   /translation="METSNAIAALTALGHATRLAAFRLLVEAGPAGRMAGDVATALQVP
FT                   PATLSFHLKELVQAGLVESESQGRHVCYRANFDAMNGLIEYLTHNCCAGSPTEQCMPTA
FT                   PACKG"
FT   misc_feature    complement(189731..189880)
FT                   /gene="arsR"
FT                   /locus_tag="Smlt0178"
FT                   /note="HMMPfam hit to PF01022, Bacterial regulatory
FT                   protein, arsR family, score 6.1e-06"
FT                   /inference="protein motif:HMMPfam:PF01022"
FT   CDS_pept        189940..190668
FT                   /transl_table=11
FT                   /gene="arsH"
FT                   /locus_tag="Smlt0179"
FT                   /product="putative arsenic resistance ArsH-like protein"
FT                   /note="similarity:fasta; with=UniProt:Q9L9D0
FT                   (EMBL:AF173880;); Thiobacillus ferrooxidans.; ArsH-like
FT                   protein.; length=240; id 68.584%; ungapped id 69.196%;
FT                   E()=1.4e-56; 226 aa overlap; query 5-228; subject 3-228"
FT                   /note="similarity:fasta; with=UniProt:Q13JU4
FT                   (EMBL:CP000271;); Burkholderia xenovorans (strain LB400).;
FT                   Putative arsinic resistance protein ArsH.; length=254; id
FT                   70.815%; ungapped id 72.687%; E()=2.3e-61; 233 aa overlap;
FT                   query 10-237; subject 5-236"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0179"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43788"
FT                   /db_xref="GOA:B2FHE5"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR014063"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHE5"
FT                   /protein_id="CAQ43788.1"
FT                   /translation="MNKPITSAHLPNLVDASLPQPDHRQLAAADLGPPRILLLYGSLRP
FT                   QSFSRKLALEAERLLRHLGCETRVFDPHALPMLDSVHPHHPEVQRLREWSQWSEGQVWV
FT                   SPERHGTVTGVFKNQIDWLPLEDGSVRPTQGRTLALLQVSGGSQSFNTVNTLRVLGRWM
FT                   RMLAIPNQSSVAKAWQEFDDDGRMKPSPYYDRVVDVMEELVKFTLLTRGRSDYLVDRYS
FT                   ERKGDAHAAALARAAEATAS"
FT   misc_feature    190039..190566
FT                   /gene="arsH"
FT                   /locus_tag="Smlt0179"
FT                   /note="HMMPfam hit to PF03358, NADPH-dependent FMN
FT                   reductase, score 2.6e-51"
FT                   /inference="protein motif:HMMPfam:PF03358"
FT   CDS_pept        complement(190697..191056)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0180"
FT                   /product="putative transmembrane protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0180"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43789"
FT                   /db_xref="GOA:B2FHE6"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHE6"
FT                   /protein_id="CAQ43789.1"
FT                   /translation="MSASSKRPPVDPLFQFLLSTMGGVFVFLFFVAREYLRGLGWLLGS
FT                   WDPNMGHATEDELISKANRSALLIAAVLLAWAFMGPSPYRHNWEIEVMGIGAGMLLAYV
FT                   VIIRLAASRVKRLLG"
FT   misc_feature    complement(order(190721..190789,190817..190870,
FT                   190961..191020))
FT                   /locus_tag="Smlt0180"
FT                   /note="3 probable transmembrane helices predicted for
FT                   Smlt0180 by TMHMM2.0 at aa 13-32, 63-80 and 90-112"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(191231..192034)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0181"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q2G597
FT                   (EMBL:CP000248;); Novosphingobium aromaticivorans (strain
FT                   DSM 12444).; Hypothetical protein precursor.; length=268;
FT                   id 42.424%; ungapped id 43.946%; E()=6.4e-28; 231 aa
FT                   overlap; query 16-245; subject 20-243"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0181"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43790"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHE7"
FT                   /protein_id="CAQ43790.1"
FT                   /translation="MAFAGHWHPSTQDCIARSRPIRTSSSPARRVLHAALAMALAVACS
FT                   GAASAKGKDKEAPEQRIAAVDELPPDQSVSETVIELAGWVVASKDNQGYPFAIMDKAAA
FT                   QVLIFGGDGKLRGAAPALFGSAIGDHSAPGVAKLALSAIPGHDRTTPAGRFIGGYGPSD
FT                   DAGRVLWVDYDSAVSMHPLPPGTPKEKRAQRLATPTPDDNRVTHGCINVSPAFYEQIVQ
FT                   STFEKGGVFYILPDKDSIAKTFPEFAQSRAAADGDEKKTAQHAGE"
FT   sig_peptide     complement(191885..192034)
FT                   /locus_tag="Smlt0181"
FT                   /note="Signal peptide predicted for Smlt0181 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.985) with cleavage site
FT                   probability 0.960 between residues 50 and 51"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(192081..192353)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0182"
FT                   /product="putative transmembrane protein"
FT                   /note="similarity:fasta; with=UniProt:Q2G598
FT                   (EMBL:CP000248;); Novosphingobium aromaticivorans (strain
FT                   DSM 12444).; Hypothetical protein precursor.; length=99; id
FT                   38.824%; ungapped id 45.833%; E()=0.3; 85 aa overlap; query
FT                   20-91; subject 14-98"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0182"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43791"
FT                   /db_xref="GOA:B2FHE8"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHE8"
FT                   /protein_id="CAQ43791.1"
FT                   /translation="MKLTKQHINAARAITVAIVATVSLGACATYKDEFATINSRLDQLD
FT                   VKVQGAAQSAESANQSAQQANQRLDQIEGRVQQLERAPAGRKPRG"
FT   sig_peptide     complement(192261..192353)
FT                   /locus_tag="Smlt0182"
FT                   /note="Signal peptide predicted for Smlt0182 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.971) with cleavage site
FT                   probability 0.380 between residues 31 and 32"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(192264..192332)
FT                   /locus_tag="Smlt0182"
FT                   /note="1 probable transmembrane helix predicted for
FT                   Smlt0182 by TMHMM2.0 at aa 10-32"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(192568..193518)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0183"
FT                   /product="conserved hypothetical protein"
FT                   /note="N-terminus to codon 150 is similar to the N-terminus
FT                   to codon 160 of streptomyces griseus subsp. griseus.
FT                   putative lantibiotic biosynthesis protein. UniProt:Q53IB5
FT                   (EMBL:AJ862840 (1105 aa) fasta scores: E()=2.8, 30.769% id
FT                   in 143 aa"
FT                   /note="similarity:fasta; with=UniProt:Q53IB5
FT                   (EMBL:AJ862840;); Streptomyces griseus subsp. griseus.;
FT                   Putative lantibiotic biosynthesis protein.; length=1105; id
FT                   30.769%; ungapped id 31.429%; E()=2.8; 143 aa overlap;
FT                   query 7-149; subject 18-157"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0183"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43792"
FT                   /db_xref="InterPro:IPR018728"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHE9"
FT                   /protein_id="CAQ43792.1"
FT                   /translation="MRALILIASPVALLQAQAAERIVSARHIVVQTDDVTRFFKVLDAN
FT                   QGRPSADDLQHGYLDAGTDALRSFTDRRIGSMERLARAIQDKPALFAKARTCATALPSI
FT                   RTRVAAAVDRLGALLPSARFPPVTVLVGRGNSGGVTTEAGVVIGLEALCNADWMQTDIG
FT                   DRFVHLIAHEYVHVQQPGARVDIEQPTLLYQTLLEGGAEYVAERISGQPANAHLQRWTQ
FT                   GRECALERAFLQDSMGTDLSRWLYNGPGDDARRGDLGYWIGYRIAHAYVARAADTRSGV
FT                   AELLDVQPGNAAALLEASGWQPACGAGGSTQTRMP"
FT   repeat_region   192697..192704
FT                   /rpt_unit_seq="(cg)4"
FT   sig_peptide     complement(193465..193518)
FT                   /locus_tag="Smlt0183"
FT                   /note="Signal peptide predicted for Smlt0183 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.996) with cleavage site
FT                   probability 0.960 between residues 18 and 19"
FT                   /inference="protein motif:SignalP:2.0"
FT   repeat_region   193666..193673
FT                   /rpt_unit_seq="(tc)4"
FT   CDS_pept        193725..194300
FT                   /transl_table=11
FT                   /locus_tag="Smlt0184"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q5GV20
FT                   (EMBL:AE013598;); Xanthomonas oryzae pv. oryzae.;
FT                   Hypothetical protein.; length=198; id 56.345%; ungapped id
FT                   58.730%; E()=2.8e-42; 197 aa overlap; query 3-191; subject
FT                   2-198"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0184"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43793"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR026364"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHF0"
FT                   /protein_id="CAQ43793.1"
FT                   /translation="MNKNSLLALGLLAALPFAASATDGLSYNYVEGGYVNTDAKGGDAD
FT                   GWKVKGSVAVHPNFHIFGDYSAQETDKFKNDVDQWRIGAGYNYGIAPNTDLVARVAYQK
FT                   FDMKHGLDFNGYSTEVGVRTAFNPYVEGYVMAGYEDYTKKHGINPDGEFYGRVGATAKF
FT                   NQNWGLSGEVKLAKAGDREWFVGPRFTW"
FT   sig_peptide     193725..193787
FT                   /locus_tag="Smlt0184"
FT                   /note="Signal peptide predicted for Smlt0184 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.970 between residues 21 and 22"
FT                   /inference="protein motif:SignalP:2.0"
FT   repeat_region   194340..194351
FT                   /rpt_unit_seq="(ct)6"
FT   CDS_pept        194397..195191
FT                   /transl_table=11
FT                   /locus_tag="Smlt0185"
FT                   /product="putative HTH transcriptional regulatory protein"
FT                   /note="similarity:fasta; with=UniProt:Q92P59
FT                   (EMBL:AL591789;); Rhizobium meliloti (Ensifer meliloti)
FT                   (Sinorhizobium meliloti).; PUTATIVE TRANSCRIPTION REGULATOR
FT                   PROTEIN.; length=296; id 46.032%; ungapped id 47.347%;
FT                   E()=1.8e-31; 252 aa overlap; query 13-259; subject 28-277"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0185"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43794"
FT                   /db_xref="GOA:B2FHF1"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHF1"
FT                   /protein_id="CAQ43794.1"
FT                   /translation="MGPVAPQCGMGDPSSLAGTGTTYQEHLAPAQLRGHFGQLWQSQLP
FT                   ADADGHITVLPDGCVDILWRDGALFVVGPDRVAAHPALAPGAQVLGARFRPGQALAALG
FT                   LPLAGIIGQAVPLADLKGAWANKAAASIGDTAPAQRLQRMAHCLQQHMGAAALDTPAQR
FT                   AHVLFQALAAGNATLDTLAAHLGLSPRSLRRFSQSQFGYGAKTLERILRLQRFLRHSRA
FT                   LPQHSLAMLAADAGYADQAHLSREARELAGMTASELRLEWGQ"
FT   CDS_pept        195259..195627
FT                   /transl_table=11
FT                   /locus_tag="Smlt0186"
FT                   /product="putative glyoxalase/bleomycin resistance protein"
FT                   /note="similarity:fasta; with=UniProt:Q8UF67
FT                   (EMBL:AE009112;); Agrobacterium tumefaciens (strain
FT                   C58/ATCC 33970).; Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase superfamily protein.; length=118; id
FT                   70.000%; ungapped id 70.000%; E()=1e-28; 110 aa overlap;
FT                   query 10-119; subject 7-116"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0186"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43795"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHF2"
FT                   /protein_id="CAQ43795.1"
FT                   /translation="MNPAAPHDAERRIDNIEFNVADIARSKRFYGEVFGWHFTDYGTAY
FT                   TEFDDGRLKGGFVADAPVRAHGGPLVILYCADLADAQQRVVAAGGEVVQAVFAFPGGRR
FT                   FHFRDLDGYELAVWSDVD"
FT   misc_feature    195292..195609
FT                   /locus_tag="Smlt0186"
FT                   /note="HMMPfam hit to PF00903, Glyoxalase/Bleomycin
FT                   resistance protein/Di, score 4.8e-14"
FT                   /inference="protein motif:HMMPfam:PF00903"
FT   CDS_pept        195751..196725
FT                   /transl_table=11
FT                   /locus_tag="Smlt0187"
FT                   /product="putative peroxidase"
FT                   /note="similarity:fasta; with=UniProt:Q2UBB0
FT                   (EMBL:AP007162;); Aspergillus oryzae.; Predicted
FT                   iron-dependent peroxidase.; length=315; id 62.215%;
FT                   ungapped id 62.215%; E()=1e-70; 307 aa overlap; query
FT                   18-324; subject 8-314"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0187"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43796"
FT                   /db_xref="GOA:B2FHF3"
FT                   /db_xref="InterPro:IPR006314"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHF3"
FT                   /protein_id="CAQ43796.1"
FT                   /translation="MNSQPAPITAVNHTLDNEPQQITAPLTHSAAFLVLKVKDDEASIA
FT                   KAREVLASTDDLIKNTAIREIERTFTCNVAIGHRVWQPLVGTTPPRELQPFREIKGATH
FT                   TAVSTPGDLLYHIRARTMDLIVAFERNLLMAFGDAVETVDDVAGFRYFDGRDLLDFVDG
FT                   TANPEGLSLPEATIVGEEDPEHAGGSYVVVQKYLHNLDAWRAQKTEAQEAIIGRTKHDN
FT                   IELDDAPADAQKSHKTLCTIEDADGEHEILRDNMPFANPGRGEYGTYFIGYTRRLWVIE
FT                   KMLERMFIGNPAPLHDRILDFSTATTGVTFFAPSRKVLADLGD"
FT   misc_feature    195805..196707
FT                   /locus_tag="Smlt0187"
FT                   /note="HMMPfam hit to PF04261, Dyp-type peroxidase family,
FT                   score 2e-105"
FT                   /inference="protein motif:HMMPfam:PF04261"
FT   repeat_region   196359..196366
FT                   /rpt_unit_seq="(gc)4"
FT   CDS_pept        196810..197226
FT                   /transl_table=11
FT                   /locus_tag="Smlt0188"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q4BLK2
FT                   (EMBL:AAEH02000011;); Burkholderia vietnamiensis G4.;
FT                   Hypothetical protein precursor.; length=154; id 38.028%;
FT                   ungapped id 41.221%; E()=1.2e-10; 142 aa overlap; query
FT                   3-136; subject 1-139"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0188"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43797"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHF4"
FT                   /protein_id="CAQ43797.1"
FT                   /translation="MAMARNTTGARRWWRPLAALFGALALGSAGVSAQEAPAHWMAYAA
FT                   AVGGQLQQRLQQEQDPQAQRVLEWLQAHPDAPTPLPVSVWIAADGRISKLEFDSLGDTQ
FT                   VDAALRATLQSAPLQAAPPADMRQPLRLGLVLTQ"
FT   sig_peptide     196810..196908
FT                   /locus_tag="Smlt0188"
FT                   /note="Signal peptide predicted for Smlt0188 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.991 between residues 33 and 34"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    196846..196905
FT                   /locus_tag="Smlt0188"
FT                   /note="1 probable transmembrane helix predicted for
FT                   Smlt0188 by TMHMM2.0 at aa 13-32"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(197331..197912)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0189"
FT                   /product="putative transmembrane transporter protein"
FT                   /note="similarity:fasta; with=UniProt:P0AFK2
FT                   (EMBL:X12713;); Escherichia coli.; pnuC; Protein pnuC.;
FT                   length=239; id 25.352%; ungapped id 29.189%; E()=0.0016;
FT                   213 aa overlap; query 3-187; subject 19-231"
FT                   /note="similarity:fasta; with=UniProt:Q4KC11
FT                   (EMBL:CP000076;); Pseudomonas fluorescens (strain Pf-5/ATCC
FT                   BAA-477).; Nicotinamide mononucleotide transporter PnuC,
FT                   putative.; length=187; id 47.753%; ungapped id 47.753%;
FT                   E()=5.2e-29; 178 aa overlap; query 6-183; subject 4-181"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0189"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43798"
FT                   /db_xref="GOA:B2FHF5"
FT                   /db_xref="InterPro:IPR006419"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHF5"
FT                   /protein_id="CAQ43798.1"
FT                   /translation="MSGVMLEWTAALCSILGVWLMARRRLAAWPVGLLSVALYGLVFAE
FT                   AKLYSDTLLQVAFGGFLVYGWLNWRQHAADEGSIRIVPLARGTLLRDLSIGLCGGVALG
FT                   AAMHSFTDAALPWLDALLTGLSLVGQWWQARRHVACWWVWIAVDVVYVGAYLFKSLHVT
FT                   AALYVFFLGLAVFGLRAWSAAAREPQVATR"
FT   misc_feature    complement(order(197364..197432,197442..197501,
FT                   197703..197756,197784..197837,197850..197903))
FT                   /locus_tag="Smlt0189"
FT                   /note="5 probable transmembrane helices predicted for
FT                   Smlt0189 by TMHMM2.0 at aa 4-21, 26-43, 53-70, 138-157 and
FT                   161-183"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(197463..197900)
FT                   /locus_tag="Smlt0189"
FT                   /note="HMMPfam hit to PF04973, Nicotinamide mononucleotide
FT                   transport, score 6.4e-09"
FT                   /inference="protein motif:HMMPfam:PF04973"
FT   sig_peptide     complement(197832..197912)
FT                   /locus_tag="Smlt0189"
FT                   /note="Signal peptide predicted for Smlt0189 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.719) with cleavage site
FT                   probability 0.712 between residues 27 and 28"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(197909..200098)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0190"
FT                   /product="putative TonB dependent receptor protein"
FT                   /note="similarity:fasta; with=UniProt:Q25C90
FT                   (EMBL:AB211539;); Sphingomonas sp. A1.; p1;
FT                   Alginate-binding flagellin.; length=742; id 22.589%;
FT                   ungapped id 25.110%; E()=2.7e-23; 757 aa overlap; query
FT                   9-724; subject 16-737"
FT                   /note="similarity:fasta; with=UniProt:Q8PCQ0
FT                   (EMBL:AE012166;); Xanthomonas campestris pv. campestris.;
FT                   Putative siderophore receptor.; length=722; id 49.169%;
FT                   ungapped id 50.355%; E()=5.7e-132; 722 aa overlap; query
FT                   6-725; subject 12-718"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0190"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43799"
FT                   /db_xref="GOA:B2FHF6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR030149"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHF6"
FT                   /protein_id="CAQ43799.1"
FT                   /translation="MNRCLRPTLLSLALCAALPLHASEADASPDAAATGAERSPTELAA
FT                   VRVQAGKPKADTSRVNAFGGGSWKDTPASVNVLERDYLDRRQVRSLSELASNDASLGDA
FT                   YAPVGYYQNVAIRGFALDAATGYRFNGLSIAGEQRLALENVQSVEILKGEAGLAAGVMA
FT                   PGGIINYIGKRPAEVRTATLGTDSEGSRYVAVDVGHWITPRFGLRLNAAWDSSNSYVEH
FT                   ADGRRNFYSLAADWLIGERGKLEVDANYQTSSQRSVSGYQLLGARDLPRGVDREHLLGY
FT                   QPWQRPVDIASTNITALHTYDFNEAWQSRISVGHSRSVIDDNVAFAYGCYYAVLCADGS
FT                   VPGNYFAPNGDYDVYDYRSPDDTRRNQQARAELRGRFETGSVGHELTVGADYFRRTVDK
FT                   RPSVNEYVGTSNIHEAPVPVFAPSPKMPGPSAQRLDSRQTAFFALDRISFGDDWQWLAG
FT                   GRFVRLDERAYDKRGTPQRHSRLSRFLPQTAVVWKATDQLNAYASYVRGISLGQEAPFW
FT                   TSNADTFLPSVQSRQLEVGVKYVPVEALTLGAAVFRISQPYQYAKPDSSDVGYTFVEEG
FT                   TQTHTGLELTANGQLTDALQIVASASVLQARARDTGTPAYEGHQLVNVPKVRASVHLAY
FT                   ALPFVQGLDVTGGWRYAGANVARADGGVRAPDYSVFDAGLRFQHRLRERAVTWNLSVDN
FT                   VFNRFYWRDTGSSGGDYYLFPGAPRQARLSVTFAL"
FT   misc_feature    complement(197912..198646)
FT                   /locus_tag="Smlt0190"
FT                   /note="HMMPfam hit to PF00593, TonB dependent receptor,
FT                   score 4.3e-20"
FT                   /inference="protein motif:HMMPfam:PF00593"
FT   repeat_region   198271..198282
FT                   /rpt_unit_seq="(cg)6"
FT   misc_feature    complement(199598..199900)
FT                   /locus_tag="Smlt0190"
FT                   /note="HMMPfam hit to PF07715, TonB-dependent Receptor Plug
FT                   Domain, score 5e-15"
FT                   /inference="protein motif:HMMPfam:PF07715"
FT   sig_peptide     complement(200033..200098)
FT                   /locus_tag="Smlt0190"
FT                   /note="Signal peptide predicted for Smlt0190 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.936 between residues 22 and 23"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(200389..201555)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0191"
FT                   /product="putative aminoglycoside phosphotransferase"
FT                   /note="similarity:fasta; with=UniProt:Q4BBV8
FT                   (EMBL:AAEH02000045;); Burkholderia vietnamiensis G4.;
FT                   Aminoglycoside phosphotransferase.; length=397; id 42.623%;
FT                   ungapped id 43.333%; E()=1.1e-52; 366 aa overlap; query
FT                   24-384; subject 27-391"
FT                   /note="similarity:fasta; with=UniProt:Q8PGT8
FT                   (EMBL:AE012001;); Xanthomonas axonopodis pv. citri.;
FT                   Hypothetical protein XAC3528.; length=404; id 50.398%;
FT                   ungapped id 51.491%; E()=4e-68; 377 aa overlap; query
FT                   20-388; subject 24-400"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0191"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43800"
FT                   /db_xref="GOA:B2FHF7"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHF7"
FT                   /protein_id="CAQ43800.1"
FT                   /translation="MRSLGCDFPHWGCGMTSSSHRVQGLNNDEVAADWPPISAADIAWL
FT                   RQRYPQLHIGSEPRWHSPRPLSAAAIVNGANGAVFVKRHHHSVRSAACLEEEHHFIAHL
FT                   AAAGVPVVQVLPAADGHTAAEHGEWTFELHAIGVGEDLYRDAVSWSLLTDVAQAREAGR
FT                   TLAQLHRAAASYHAPQRSTHVLVARDDLIRADDPIAAIKAGLHERPGLARYLARIPWEA
FT                   QLQRDVLPWHGGLAERLRDEPRLWAHNDWHVSNLLWRDGQISTVLDFGLASPTSALFDL
FT                   ATAIERNAVAWLELERGMETVRIDIALALLDGYRQVLPLSAARVHLLADLLPMVHFDFA
FT                   LSEVEYFEGVTGSTANADVAWQPFMLGHPAWFHSAPGQALLQALHAAA"
FT   misc_feature    complement(200596..201372)
FT                   /locus_tag="Smlt0191"
FT                   /note="HMMPfam hit to PF01636, Phosphotransferase enzyme
FT                   family, score 1.8e-16"
FT                   /inference="protein motif:HMMPfam:PF01636"
FT   repeat_region   200991..200998
FT                   /rpt_unit_seq="(cg)4"
FT   CDS_pept        complement(201639..202046)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0192"
FT                   /product="putative transmembrane protein"
FT                   /note="similarity:fasta; with=UniProt:Q7WBY7
FT                   (EMBL:BX640424;); Bordetella parapertussis.; Putative
FT                   membrane protein.; length=112; id 42.727%; ungapped id
FT                   47.000%; E()=4.7e-08; 110 aa overlap; query 12-120; subject
FT                   12-112"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0192"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43801"
FT                   /db_xref="GOA:B2FHF8"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHF8"
FT                   /protein_id="CAQ43801.1"
FT                   /translation="MLSTSTLSFRGLAMALALVAGVAVVSDASAMSRKDKRTLVGAVVG
FT                   GVAGNLLSNGDPAATVGGAVAGGAIGNLTTSDRRDRRYYDNHRYDDRYDRRYDRGYYRS
FT                   GYYDRGDDRRWQRERYYDNRYYHDRGRHRGW"
FT   repeat_region   201720..201875
FT                   /rpt_family="(CGG)n"
FT                   /inference="nucleotide motif:RepeatScout"
FT   misc_feature    complement(201822..201947)
FT                   /locus_tag="Smlt0192"
FT                   /note="HMMPfam hit to PF05433, Rickettsia 17 kDa surface
FT                   antigen, score 3.1e-06"
FT                   /inference="protein motif:HMMPfam:PF05433"
FT   misc_feature    complement(201960..202028)
FT                   /locus_tag="Smlt0192"
FT                   /note="1 probable transmembrane helix predicted for
FT                   Smlt0192 by TMHMM2.0 at aa 7-29"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(201972..202046)
FT                   /locus_tag="Smlt0192"
FT                   /note="Signal peptide predicted for Smlt0192 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.657 between residues 25 and 26"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(202292..204283)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0193"
FT                   /product="conserved hypothetical protein"
FT                   /note="Codons 360 to the C-terminus are similar to the
FT                   entire protein of Xanthomonas campestris pv. campestris
FT                   (strain 8004). hypothetical protein. UniProt:Q4UQH2
FT                   (EMBL:CP000050 (308 aa) fasta scores: E()=6.7e-36, 44.051%
FT                   id in 311 aa, and similar to entire protein of Xanthomonas
FT                   campestris pv. vesicatoria (strain 85-10). hypothetical
FT                   protein. UniProt:Q3BP31 (EMBL:AM039952 (630 aa) fasta
FT                   scores: E()=1.9e-33, 43.844% id in 666 aa"
FT                   /note="similarity:fasta; with=UniProt:Q4UQH2
FT                   (EMBL:CP000050;); Xanthomonas campestris pv. campestris
FT                   (strain 8004).; Hypothetical protein.; length=308; id
FT                   44.051%; ungapped id 45.667%; E()=6.7e-36; 311 aa overlap;
FT                   query 359-661; subject 1-308"
FT                   /note="similarity:fasta; with=UniProt:Q3BP31
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; Hypothetical protein.; length=630; id
FT                   43.844%; ungapped id 47.173%; E()=1.9e-33; 666 aa overlap;
FT                   query 5-662; subject 4-630"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0193"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43802"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHF9"
FT                   /protein_id="CAQ43802.1"
FT                   /translation="MAQHDYSRKEVLDIVEQVARQKGLPVDDFMRFAHIETGGTFNERA
FT                   HNTSSGAKGLFQFVPGSARQYHLTGHEFDPTRNTEAAAQMYQDNLDSMARRNERTGHPY
FT                   LSGGSTPTGLDLYLAHQQGSAGYGSVQTAIATGTFGVVRNGHGEEINMRRNVLNQIGSD
FT                   AKALTGHTLAEMRGMNDGDLARTFSSYYIHKYAAISIPEKNIAPQTVAPGQSQAPAAPA
FT                   QASAAVAAGAATLAATAAAATAPKPGIELHAAYEAGVKYDHVKYAINIPGHALYVPGKT
FT                   GKNVEQGYIDCSGWVGTLQNRTMDEINQKAGHAVFSKADRIDLGNLGSGGIVRKAFDQS
FT                   GVLLDRDAILKPGALKEGMIIGLDTARTRHEHWNGIDHIVMVVRDPTTDKLLISQSSGS
FT                   KGVHTMPVEDYLKQVKDHPNWKLYASDPLSKARDLLENRTPSHEQAQGKPAAEHKAAAT
FT                   PHAELYKQGAHSEGVRKVQEQLGHLGYVGADGKPLVEDGRFGRNTDAAVRQLQKDNGLV
FT                   ADGIVGAKTLEAIKEARERPLLNDERHPRNPLFIQASKGLELLPAGTFKDRHALESAAA
FT                   ALTKEAHAAGLQRIDTVVPSPNGERLFAVQGTIGDPAASRVAVEARAASEQSIALSSGA
FT                   VQGAPNVLHQQQDAQQEQARQAQKAMGV"
FT   misc_feature    complement(202682..202879)
FT                   /locus_tag="Smlt0193"
FT                   /note="HMMPfam hit to PF01471, Putative peptidoglycan
FT                   binding domain, score 6.8e-20"
FT                   /inference="protein motif:HMMPfam:PF01471"
FT   CDS_pept        complement(204396..205457)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0194"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q4KE51
FT                   (EMBL:CP000076;); Pseudomonas fluorescens (strain Pf-5/ATCC
FT                   BAA-477).; Hypothetical protein.; length=357; id 48.583%;
FT                   ungapped id 49.180%; E()=3.7e-41; 247 aa overlap; query
FT                   106-352; subject 113-356"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0194"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43803"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHG0"
FT                   /protein_id="CAQ43803.1"
FT                   /translation="MRGRRNRPAHVLAPVPGGWGAVSCRPSGPATLTMERRMHHPPEPC
FT                   WTLPLRPLRAFAACLLVSLSAAACSAADPAPSSSQPGAPVQAADAPRQDVAPMQNTSPD
FT                   TAVTPPDAPTVMYFTYQVDGDGATSYEVQNGSVATFWFGHTFTLDGTTYYTGFSWDTRE
FT                   HYGKPGEQSPAGPDDRANLAEATFVLAGADAKKPWKFRGQEWTIGALGAYDKADDVDTR
FT                   RKPLEHRTADGRLLLAVPTSSFDRGISSTGYALLLFNPKRSEDDVDSKVWRYVGSVRTG
FT                   EDNSAACDEGNVMPCTDSDGELAFAADGNGLPRLTVTFKGTTIEGPGKTRALGAGDAVH
FT                   YTFDSATQQYVAP"
FT   CDS_pept        complement(205545..206183)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0195"
FT                   /product="putative LuxR family two component response
FT                   regulator"
FT                   /note="similarity:fasta; with=UniProt:Q4KHP5
FT                   (EMBL:CP000076;); Pseudomonas fluorescens (strain Pf-5/ATCC
FT                   BAA-477).; DNA-binding response regulator, LuxR family.;
FT                   length=220; id 45.238%; ungapped id 46.341%; E()=2.9e-26;
FT                   210 aa overlap; query 3-209; subject 9-216"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0195"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43804"
FT                   /db_xref="GOA:B2FHG1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHG1"
FT                   /protein_id="CAQ43804.1"
FT                   /translation="MSLRIIIADDHPVVRIGTRAVIESSGVGRVVGEADSAQALMALLG
FT                   SQPCDLLVTDYSMPGSPQADGFAMIGMIRRRFPDLPVLMLSVSNNLAILRMVLDSGVLG
FT                   LVDKSSSMDELPQAIQAVYRGQPYISRSLRERVEAAGSWRMREGDGKPLSPREVEVLRL
FT                   LGTGMTVKEISLQLHKSVSTISRQKGDAMLKLGLKGDAELFDYLRDGKI"
FT   misc_feature    complement(205563..205736)
FT                   /locus_tag="Smlt0195"
FT                   /note="HMMPfam hit to PF00196, Bacterial regulatory
FT                   proteins, luxR fami, score 4.1e-14"
FT                   /inference="protein motif:HMMPfam:PF00196"
FT   misc_feature    complement(205824..206177)
FT                   /locus_tag="Smlt0195"
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 1.7e-26"
FT                   /inference="protein motif:HMMPfam:PF00072"
FT   CDS_pept        206193..209858
FT                   /transl_table=11
FT                   /locus_tag="Smlt0196"
FT                   /product="putative two-component sensor/response regulator
FT                   protein"
FT                   /note="similarity:fasta; with=UniProt:Q1I798
FT                   (EMBL:CT573326;); Pseudomonas entomophila L48.; Putative
FT                   two-component sensor/response regulator protein.;
FT                   length=1210; id 30.435%; ungapped id 32.140%; E()=9.3e-73;
FT                   1150 aa overlap; query 44-1154; subject 34-1161"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0196"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43805"
FT                   /db_xref="GOA:B2FHG2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHG2"
FT                   /protein_id="CAQ43805.1"
FT                   /translation="MATGQAGPRPSRPCQDSRRSTPMRSWAVRGLVLLLAVLVLPVALA
FT                   QAVPGLLPLSPLQREYLAAHPSIVVGQYDSGWPPFESLRDGQQVGLGPDYLALLARQLG
FT                   VKVEARRYSDWTSVLDAACRGEIDVVMNVGLSADRTQCMVYTAAYGEAPLALVGRPGDL
FT                   RASNMPDLDGLRVVIEQDFLTGPQVRARFPRAVQLVANSSLAALQMVRDDKADVYIGNA
FT                   YVATELIARLRLQGVVLLRPSDLPPERMHFGVPNSKQPLAEALDLALAATSQAQRDALA
FT                   QRWLPLPQWSASAQLALSQAEKRVLQQPLKIGFAPNAAPLSFADEDGRPSGLASEYLAR
FT                   LMQAGANLQAQNSHDWYEVREKARRGELQAVMGIPVDSHYLGPDWVYSQPFISVPNVIV
FT                   SRHDSPALLGLSDLQDKRVLLSDPERVRGYVLQQAPQARIVAARSAEQAMQRLIDGEAD
FT                   AYVGNLALVDHLLRTRFPGRLQVAAPAGFNDQLALAVERRHAALATTFDRLLLQMTPRE
FT                   REALRGDWLAVEYHNGIDWRSTLRWGVPLLLVLLTALLVHGIGYWRLRREVAGRRQLEQ
FT                   RLAEVTDNLPAVVYQARREVDGTLSFPFIAGDLQALFGITRQQAEQDATMLLERVEEDD
FT                   RARILQVVEQAAHQFAPLMLEFRLRGDGAGPRWVRTQAQPYAAEAGVVTWSGYWVDASE
FT                   ARAQADALTAAKAEAEQAAEAKSRFLATMSHEIRTPMSGVLGMLEVLAHSPLDAEQKRI
FT                   LGVIEDSAQMLRQILDDILDYSRLEANALRLEPVPQPLRPLLESVCRLLSAQASARGLG
FT                   LHVQIDPQLAAAHEVDGVRLRQIVFNLLSNAIKFTVRGEVRLQLEVLGPTAEDGSQPLC
FT                   LSVTDTGIGIAPEQLQHLFAPFTQAGAYIQRDHGGTGLGLSICQRLVQMMDGELELHST
FT                   LGEGTRAEVRLSLVEAGSSDVEALVAEQEQAALLPPALRQARVLVIEDHPTNQAMMAWR
FT                   LQQLGVPHVLVGDGQQGLDRLASEHFDLVITDCRMPVLDGFAFTRLLREREGRNGQPRL
FT                   TVLALTASVLDDDARRCREAGMDEVLAKPLSLATLRAALLRWLPQAQGQRFEEPLAESA
FT                   AVDDRTLPDLDSLQRRFGSRAVAEQLRDSLLQASAGDLAAVQRALEAGDREAAALHLHR
FT                   QAGGLGAVGATVLAAQANALVERLQDAAETDPVPLFTAVAAFVARLQQRLQRLAH"
FT   sig_peptide     206193..206327
FT                   /locus_tag="Smlt0196"
FT                   /note="Signal peptide predicted for Smlt0196 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.829) with cleavage site
FT                   probability 0.526 between residues 45 and 46"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    206268..206336
FT                   /locus_tag="Smlt0196"
FT                   /note="1 probable transmembrane helix predicted for
FT                   Smlt0196 by TMHMM2.0 at aa 26-48"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    207996..208277
FT                   /locus_tag="Smlt0196"
FT                   /note="HMMPfam hit to PF08447, PAS fold, score 9.4e-05"
FT                   /inference="protein motif:HMMPfam:PF08447"
FT   repeat_region   208098..208105
FT                   /rpt_unit_seq="(cg)4"
FT   misc_feature    208335..208532
FT                   /locus_tag="Smlt0196"
FT                   /note="HMMPfam hit to PF00512, His Kinase A
FT                   (phosphoacceptor) domain, score 4.9e-24"
FT                   /inference="protein motif:HMMPfam:PF00512"
FT   misc_feature    208671..209024
FT                   /locus_tag="Smlt0196"
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HS, score 9.6e-40"
FT                   /inference="protein motif:HMMPfam:PF02518"
FT   misc_feature    209103..209456
FT                   /locus_tag="Smlt0196"
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 2.2e-28"
FT                   /inference="protein motif:HMMPfam:PF00072"
FT   misc_feature    209586..209837
FT                   /locus_tag="Smlt0196"
FT                   /note="HMMPfam hit to PF01627, Hpt domain, score 8.5e-06"
FT                   /inference="protein motif:HMMPfam:PF01627"
FT   repeat_region   209639..209646
FT                   /rpt_unit_seq="(gc)4"
FT   CDS_pept        complement(209852..210253)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0197"
FT                   /product="putative cytochrome c"
FT                   /note="similarity:fasta; with=UniProt:P00038
FT                   (EMBL:AY601642;); Apis mellifera (Honeybee).; cytC;
FT                   Cytochrome c.; length=107; id 40.741%; ungapped id 43.137%;
FT                   E()=9.4e-13; 108 aa overlap; query 26-131; subject 3-106"
FT                   /note="similarity:fasta; with=UniProt:Q2GA61
FT                   (EMBL:CP000248;); Novosphingobium aromaticivorans (strain
FT                   DSM 12444).; Cytochrome c, class I precursor.; length=149;
FT                   id 42.149%; ungapped id 43.590%; E()=1.5e-13; 121 aa
FT                   overlap; query 10-129; subject 29-146"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0197"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43806"
FT                   /db_xref="GOA:B2FHG3"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHG3"
FT                   /protein_id="CAQ43806.1"
FT                   /translation="MRASFLLIAVAVALAATACQRPPAAPAPPEQAQQQAMQRAFELCA
FT                   GCHTVQPGGIHRFGPNLHGVIGRRAGSLPDYGYSDGMRRADITWSAQTLDAFLQSPTHV
FT                   VPGTRMYNAFPSAERRALVIAYLQQQSAQ"
FT   misc_feature    complement(209861..210154)
FT                   /locus_tag="Smlt0197"
FT                   /note="HMMPfam hit to PF00034, Cytochrome c, score 2e-12"
FT                   /inference="protein motif:HMMPfam:PF00034"
FT   sig_peptide     complement(210200..210253)
FT                   /locus_tag="Smlt0197"
FT                   /note="Signal peptide predicted for Smlt0197 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.594 between residues 18 and 19"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(210319..212004)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0198"
FT                   /product="putative electron transfer
FT                   flavoprotein-ubiquinone oxidoreductase"
FT                   /EC_number="1.5.5.1"
FT                   /note="similarity:fasta; with=UniProt:Q9HZP5
FT                   (EMBL:AE004721;); Pseudomonas aeruginosa.; Electron
FT                   transfer flavoprotein-ubiquinone oxidoreductase (EC
FT                   1.5.5.1) (ETF-QO) (ETF-ubiquinone oxidoreductase) (ETF
FT                   dehydrogenase) (Electron-transferring-flavoprotein
FT                   dehydrogenase).; length=551; id 59.058%; ungapped id
FT                   59.817%; E()=7.1e-124; 552 aa overlap; query 14-561;
FT                   subject 3-551"
FT                   /note="similarity:fasta; with=UniProt:Q1LP94
FT                   (EMBL:CP000352;); Ralstonia metallidurans (strain CH34/ATCC
FT                   43123/DSM 2839).; Electron transfer flavoprotein-ubiquinone
FT                   oxidoreductase.; length=561; id 76.545%; ungapped id
FT                   76.685%; E()=6.8e-169; 550 aa overlap; query 13-561;
FT                   subject 12-561"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0198"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43807"
FT                   /db_xref="GOA:B2FHG4"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR040156"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHG4"
FT                   /protein_id="CAQ43807.1"
FT                   /translation="MQSMSAEANALPPREVMEFDVVIVGAGPAGLATAIRLRQRAIEAG
FT                   RELSVCVLEKGSEPGAHVLSGAVMDPRALTELFPDWAERGAPLKQKVTRDEFLFLSETG
FT                   ARSTPNALLPECFHNEGNYIISLGEVTRWLAQQAEALEVAIFPGFAAAEVLYGDNGEVI
FT                   GVATGDMGIEKDGSIGPAFERGMALHARYTIFAEGARGHLGRQLIARYKLDEGKDPQAY
FT                   GIGIKELWQIDPAKHEPGLVVHAAGWPLDSDTYGGAFLYHADGGKVAIGYVVGLDYRNP
FT                   WLSPFEEFQRFKTHPSIRKHLEGGTRIGYGARAITAGGLLSLPKTVFPGGALVGCEAGY
FT                   LNASRIKGSHAAIKTGMLCADAAFDALAADRQHDELSAYPTAFEASWLFTELQQAKNFK
FT                   QWFKKGQTVATLMTGVEQWLLPKLGVRNPPWTLHRTQPDHACLEPAAKHTRIAYPKPDG
FT                   VLTFDRLSSVFLSSTNHDENQPSHLTLKDPSIPVKVNLAEYAGPEARYCPAGVYEFVGE
FT                   ADSARLQINAQNCVHCKTCDIKDPSQNIVWVTPQGGGGPNYSGM"
FT   misc_feature    complement(210322..210792)
FT                   /locus_tag="Smlt0198"
FT                   /note="HMMPfam hit to PF05187, Electron transfer
FT                   flavoprotein-ubiquinone ox, score 7.1e-105"
FT                   /inference="protein motif:HMMPfam:PF05187"
FT   repeat_region   210340..210351
FT                   /rpt_unit_seq="(gcc)4"
FT   repeat_region   210439..210446
FT                   /rpt_unit_seq="(gc)4"
FT   misc_feature    complement(210991..211947)
FT                   /locus_tag="Smlt0198"
FT                   /note="HMMPfam hit to PF01266, FAD dependent
FT                   oxidoreductase, score 9.6e-05"
FT                   /inference="protein motif:HMMPfam:PF01266"
FT   repeat_region   211785..211792
FT                   /rpt_unit_seq="(gc)4"
FT   CDS_pept        212302..213474
FT                   /transl_table=11
FT                   /gene="GCDH"
FT                   /locus_tag="Smlt0199"
FT                   /product="putative glutaryl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.7"
FT                   /note="similarity:fasta; with=UniProt:Q92947
FT                   (EMBL:AD000092;); Homo sapiens (Human).; GCDH; Glutaryl-CoA
FT                   dehydrogenase, mitochondrial precursor (EC 1.3.99.7)
FT                   (GCD).; length=438; id 51.862%; ungapped id 52.419%;
FT                   E()=6.3e-72; 376 aa overlap; query 18-390; subject 60-434"
FT                   /note="similarity:fasta; with=UniProt:Q8PMF7
FT                   (EMBL:AE011779;); Xanthomonas axonopodis pv. citri.; gcdH;
FT                   Glutaryl-CoA dehydrogenase.; length=391; id 76.486%;
FT                   ungapped id 76.486%; E()=4.6e-123; 387 aa overlap; query
FT                   4-390; subject 5-391"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0199"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43808"
FT                   /db_xref="GOA:B2FHG5"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHG5"
FT                   /protein_id="CAQ43808.1"
FT                   /translation="MSAMALHPYDLFDVRSLLNEEERAVQESVARFTNERVLPIIGDAF
FT                   DQARFPDELVPEIASLGLLGATLPTEYGGGGLGAVSYGLICQELERGDSGLRSFVSVQS
FT                   SLCMYPIYAYGSEEQRQQWLPAMARGELIGCFGLTEAHGGSDPASMKTRAVRDGSDWRI
FT                   SGSKMWITSGPVADLAIVWAQTEDGIQGFVLQKGMAGFTTQEIKHKMSLRASLTGALFF
FT                   DDVRVPDSHRLPNVKGLKGPLGCLTQARYGISWGPIGAAIACLDEALGYAKERVLFGRP
FT                   LAATQSAQIKLAEMARRITTAQLLALQLGRLKEAGQLQPQQVSLAKWNNCRMAIDIARE
FT                   CRDLLGGAGITTEHVAIRHALNLESVITYEGTETVHQLVIGRELTGINAF"
FT   misc_feature    212356..212694
FT                   /gene="GCDH"
FT                   /locus_tag="Smlt0199"
FT                   /note="HMMPfam hit to PF02771, Acyl-CoA dehydrogenase,
FT                   N-terminal doma, score 1.2e-20"
FT                   /inference="protein motif:HMMPfam:PF02771"
FT   misc_feature    212704..212859
FT                   /gene="GCDH"
FT                   /locus_tag="Smlt0199"
FT                   /note="HMMPfam hit to PF02770, Acyl-CoA dehydrogenase,
FT                   middle domain, score 1.7e-28"
FT                   /inference="protein motif:HMMPfam:PF02770"
FT   misc_feature    213007..213456
FT                   /gene="GCDH"
FT                   /locus_tag="Smlt0199"
FT                   /note="HMMPfam hit to PF00441, Acyl-CoA dehydrogenase,
FT                   C-terminal doma, score 2.3e-36"
FT                   /inference="protein motif:HMMPfam:PF00441"
FT   misc_feature    213052..213393
FT                   /gene="GCDH"
FT                   /locus_tag="Smlt0199"
FT                   /note="HMMPfam hit to PF08028, Acyl-CoA dehydrogenase,
FT                   C-terminal doma, score 7.4e-06"
FT                   /inference="protein motif:HMMPfam:PF08028"
FT   repeat_region   213630..213827
FT                   /rpt_family="R=9"
FT                   /inference="nucleotide motif:RepeatScout"
FT   CDS_pept        complement(213882..214361)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0200"
FT                   /product="putative tRNA/rRNA methyltransferase"
FT                   /note="similarity:fasta; with=UniProt:Q8PDX5
FT                   (EMBL:AE012116;); Xanthomonas campestris pv. campestris.;
FT                   TRNA/rRNA methyltransferase.; length=158; id 78.205%;
FT                   ungapped id 78.205%; E()=9.2e-46; 156 aa overlap; query
FT                   3-158; subject 2-157"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0200"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43809"
FT                   /db_xref="GOA:B2FHG6"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHG6"
FT                   /protein_id="CAQ43809.1"
FT                   /translation="MNAAPQFHVILFQPEIPPNTGNVIRLCANTGAQLHLVEPLGFALE
FT                   DKQLKRAGLDYHEYSRLQVHPDLDTALARIAPKRLFALSTRASVRYDSVAFEDGDAFLF
FT                   GPESRGLPQDVLDALPDGRRLRLPMRPDNRSLNLSNTVAVVMYEAWRQHGFAGGA"
FT   misc_feature    complement(213921..214346)
FT                   /locus_tag="Smlt0200"
FT                   /note="HMMPfam hit to PF00588, SpoU rRNA Methylase family,
FT                   score 3.8e-45"
FT                   /inference="protein motif:HMMPfam:PF00588"
FT   CDS_pept        complement(214431..214907)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0201"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q8PQU0
FT                   (EMBL:AE011648;); Xanthomonas axonopodis pv. citri.;
FT                   Hypothetical protein XAC0231.; length=153; id 49.655%;
FT                   ungapped id 52.941%; E()=8.8e-15; 145 aa overlap; query
FT                   6-147; subject 8-146"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0201"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43810"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHG7"
FT                   /protein_id="CAQ43810.1"
FT                   /translation="MNAKTIAIAIALIAGTAVVSSVQASESIKTLSTVQVRPAADQLAQ
FT                   RAWEQASGIPTLATVEVRPSADQLAERSGYVAAPVAAAMPITTLASVEVRPSLEQRVAL
FT                   AAELEAQRYAATLAAAATSVANQVIVNLPALQVRPSAADLQALATETAQILLRP"
FT   sig_peptide     complement(214836..214907)
FT                   /locus_tag="Smlt0201"
FT                   /note="Signal peptide predicted for Smlt0201 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.984 between residues 24 and 25"
FT                   /inference="protein motif:SignalP:2.0"
FT   repeat_region   215273..215280
FT                   /rpt_unit_seq="(gc)4"
FT   CDS_pept        215323..218172
FT                   /transl_table=11
FT                   /locus_tag="Smlt0203"
FT                   /product="putative peptidase"
FT                   /note="similarity:fasta; with=UniProt:Q49145
FT                   (EMBL:L43135;); Methylobacterium extorquens.; pqqE;
FT                   Protease.; length=709; id 28.571%; ungapped id 31.894%;
FT                   E()=4e-35; 672 aa overlap; query 26-662; subject 51-687"
FT                   /note="similarity:fasta; with=UniProt:Q3BXW6
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; Putative zinc metalloprotease precursor.;
FT                   length=959; id 51.760%; ungapped id 53.362%; E()=1.6e-180;
FT                   966 aa overlap; query 5-949; subject 2-959"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0203"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43811"
FT                   /db_xref="GOA:B2FHG8"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHG8"
FT                   /protein_id="CAQ43811.1"
FT                   /translation="MSLALRPRTALLAVALSTALGTLVPSHALAAKPAAPAKVDIPYEQ
FT                   FTLPNGLRVIVHTDRKAPIVAVNVWYHVGSKDEPAGRTGFAHLFEHLMFQGSENHDGEF
FT                   FEPFKQVGATNQNGTTNTDRTNYFENVPTTALDMALWMESDRMGHLVGAIDQAALDEQR
FT                   GVVQNEKRQGENQPYGQAWDQLNKALYPVGHPYHHGVIGSMNDLNAASLDDVKTWFRTW
FT                   YGPNNAVLVLAGDIDLATAKEKVGKYFGSIPAGPTMAQPAVNVAKRSADTRETMTDKVP
FT                   QARIYRAWNVPQVGTTEVDQLQLFAQVLGGAKSSRLSQRLQHQDKLVDSIAAGLSTSQL
FT                   GSNFVIMATVKQGQDPAKVEKIIDEELDRLIKQGPTAAELERAKTGARAGFIRGIERIG
FT                   GFGGKADALAECAVFTGDPGCFRTSLANIEKASAADLSRLGAQWLDKGSHTLVIAPGER
FT                   VALKEDPSQAPKPFNVPAVDPKYSTLPEQVDRKAGVPQTREFPQLKFPALQRATLKNGT
FT                   QVILAERHEIPVVQFSYQFPGGFSADQGRKPGTANFTMSLMTEGAGKLGSLAFADAADA
FT                   LGASLDASAGLDSMSVDLSALKENLAPSLALYRDLLREPRFEQGEIDRVKASWIAGIQQ
FT                   EKVNPGAVAMRVLPPLLYGKGHPYAIPFTGSGDEAAINGLTREDLVDFHRDWLRPQNGT
FT                   LIVVGDTTLAEIVPLLDKQLGDWKAAGDAPQVKAATDVALPKGPRVFLIDQPGAVQANL
FT                   FASQVVAPSSAATSTRFDIANGVIGGDFTSRLNMNLREDKHWSYGARSSAINSVGQRPW
FT                   MASAPVQIDKTGPAMAEMRKEIAAFADGSKPATAAEVNRIRNIQTLSLPGAYETASAVA
FT                   STIGSIVQFKRPDDYVLRRKAEIEAMTPAQVQQAAAEIKPQALTWVVVGDLKQTEAAVR
FT                   ALNLGEVTVIDAEGNPVKK"
FT   sig_peptide     215323..215412
FT                   /locus_tag="Smlt0203"
FT                   /note="Signal peptide predicted for Smlt0203 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.837 between residues 30 and 31"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    215479..215922
FT                   /locus_tag="Smlt0203"
FT                   /note="HMMPfam hit to PF00675, Insulinase (Peptidase family
FT                   M16), score 2.6e-06"
FT                   /inference="protein motif:HMMPfam:PF00675"
FT   misc_feature    215947..216483
FT                   /locus_tag="Smlt0203"
FT                   /note="HMMPfam hit to PF05193, Peptidase M16 inactive
FT                   domain, score 4.4e-40"
FT                   /inference="protein motif:HMMPfam:PF05193"
FT   misc_feature    217342..217890
FT                   /locus_tag="Smlt0203"
FT                   /note="HMMPfam hit to PF05193, Peptidase M16 inactive
FT                   domain, score 4.7e-28"
FT                   /inference="protein motif:HMMPfam:PF05193"
FT   CDS_pept        218385..218702
FT                   /transl_table=11
FT                   /locus_tag="Smlt0204"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q3BZ44
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; Putative secreted protein.; length=106; id
FT                   81.132%; ungapped id 81.905%; E()=2.8e-30; 106 aa overlap;
FT                   query 1-105; subject 1-106"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0204"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43812"
FT                   /db_xref="InterPro:IPR025294"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHG9"
FT                   /protein_id="CAQ43812.1"
FT                   /translation="MRVLLLSSLLLTVTACTWVPIEPAGKATRVLPAGPVPAGCIAKGE
FT                   VVVTVKSKVGFYNRNPLRVQEELETLARNEAPSAGANAVQAAAAPADGSQRFAAFQCPP
FT                   R"
FT   sig_peptide     218385..218429
FT                   /locus_tag="Smlt0204"
FT                   /note="Signal peptide predicted for Smlt0204 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.953) with cleavage site
FT                   probability 0.811 between residues 15 and 16"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        218806..219822
FT                   /transl_table=11
FT                   /gene="fabH"
FT                   /locus_tag="Smlt0205"
FT                   /product="putative 3-oxoacyl-[acyl-carrier-protein]
FT                   synthase 3"
FT                   /EC_number="2.3.1.41"
FT                   /note="similarity:fasta; with=UniProt:P30790
FT                   (EMBL:M84030;); Rhodobacter capsulatus (Rhodopseudomonas
FT                   capsulata).; fabH; 3-oxoacyl-[acyl-carrier-protein]
FT                   synthase 3 (EC 2.3.1.41) (3-oxoacyl- [acyl-carrier-protein]
FT                   synthase III) (Beta-ketoacyl-ACP synthase III) (KAS III).;
FT                   length=324; id 26.590%; ungapped id 29.114%; E()=2.5e-10;
FT                   346 aa overlap; query 6-343; subject 1-324"
FT                   /note="similarity:fasta; with=UniProt:Q8PDX2
FT                   (EMBL:AE012117;); Xanthomonas campestris pv. campestris.;
FT                   fabH; 3-oxoacyl-[ACP] synthase III.; length=338; id
FT                   88.462%; ungapped id 88.462%; E()=2.4e-107; 338 aa overlap;
FT                   query 6-343; subject 1-338"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0205"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43813"
FT                   /db_xref="GOA:B2FHH0"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:B2FHH0"
FT                   /protein_id="CAQ43813.1"
FT                   /translation="MLFKNVSIAGLAHVDAPHTLTTKEINERLQPTLDRLGIRTDVLGD
FT                   IAGIHARRLWDNGVLASDAATMAGRKALEDAGINATQVGLLVNTSVSRDYLEPSTASIV
FT                   SGNLGVSDECMTFDVANACLAFINGMDIAARMIERGDIDYALVVDGETANLVYEKTLER
FT                   MTAPDVTADDFRNELAALTTGSGAAAMVMARSELVPDAPRYKGGVTRSATEWNQLCLGN
FT                   LDRMVTDTRLLLIEGIKLAQKTFTAAKIALGWAVEELDQFVIHQVSQPHTAAFIKNFGI
FT                   DPKKVMTIFGEHGNIGPASVPIVLSKLKQLGKLKKGDRIALLGIGSGLNCSMAEVVW"
FT   misc_feature    219547..219819
FT                   /gene="fabH"
FT                   /locus_tag="Smlt0205"
FT                   /note="HMMPfam hit to PF08541,
FT                   3-Oxoacyl-[acyl-carrier-protein (ACP)], score 1.1e-17"
FT                   /inference="protein motif:HMMPfam:PF08541"
FT   CDS_pept        219917..220807
FT                   /transl_table=11
FT                   /gene="dhaA"
FT                   /locus_tag="Smlt0206"
FT                   /product="putative haloalkane dehalogenase"
FT                   /EC_number="3.8.1.5"
FT                   /note="similarity:fasta; with=UniProt:P0A3G3; Rhodococcus
FT                   sp.; dhaA; Haloalkane dehalogenase (EC 3.8.1.5).;
FT                   length=293; id 31.879%; ungapped id 33.569%; E()=3e-22; 298
FT                   aa overlap; query 1-291; subject 1-290"
FT                   /note="similarity:fasta; with=UniProt:Q3BZ41
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; Putative hydrolase of the alpha/beta fold
FT                   superfamily.; length=300; id 80.808%; ungapped id 82.192%;
FT                   E()=2.2e-105; 297 aa overlap; query 5-296; subject 4-300"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0206"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43814"
FT                   /db_xref="GOA:B2FI26"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI26"
FT                   /protein_id="CAQ43814.1"
FT                   /translation="MSQLPGYPAHPQRFEVRPGLSMNYLDEGPRDGEVVVMVHGNPSWS
FT                   YYWRTLVAGLSDTYRCIVPDHIGMGLSDKPDDSRYEYTLQSRVDDLDALLKHLGITGPV
FT                   TLAVHDWGGMIGFGWALSHHDQVKRLVVLNTAAFPMPAAKKMPWQIALGRHWKIGEWII
FT                   RTFNAFSSGASWLGVERKMPADVRRAYVSPYNSWANRISTIRFMQDIPLSPADKAWSLL
FT                   ERAGKALPSFADRPAFLGWGLRDFVFDHHFLKGFQAALPQAQVHAFEDAGHYVLEDKHE
FT                   VLVPEIRAFLDKNPI"
FT   misc_feature    220091..220783
FT                   /gene="dhaA"
FT                   /locus_tag="Smlt0206"
FT                   /note="HMMPfam hit to PF00561, alpha/beta hydrolase fold,
FT                   score 1e-20"
FT                   /inference="protein motif:HMMPfam:PF00561"
FT   repeat_region   220891..220920
FT                   /rpt_family="R=14"
FT                   /inference="nucleotide motif:RepeatScout"
FT   CDS_pept        complement(220922..221353)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0207"
FT                   /product="putative ferredoxin"
FT                   /note="similarity:fasta; with=UniProt:Q3BZ40
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; Putative ferredoxin.; length=127; id
FT                   55.556%; ungapped id 55.556%; E()=5.4e-26; 126 aa overlap;
FT                   query 1-126; subject 1-126"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0207"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43815"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI27"
FT                   /protein_id="CAQ43815.1"
FT                   /translation="MQHPCMTCGACCTQYRVAFHWMESDEVTPGGVPHQLTEVLDPHRL
FT                   CMRGTHSKPVRCVALDAQIGVYSRCTIHPNRPSVCREVDASWEYGKASPQCDKARIAYG
FT                   LDPLTPADWRWRDDADNDDDHPDDNGNSPSSPPQAPVAA"
FT   misc_feature    complement(221051..221347)
FT                   /locus_tag="Smlt0207"
FT                   /note="HMMPfam hit to PF03692, Uncharacterised protein
FT                   family (UPF0153), score 7.9e-20"
FT                   /inference="protein motif:HMMPfam:PF03692"
FT   CDS_pept        221458..223116
FT                   /transl_table=11
FT                   /locus_tag="Smlt0208"
FT                   /product="putative AMP-binding protein"
FT                   /note="similarity:fasta; with=UniProt:Q3BZ39
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; AMP-binding protein.; length=553; id
FT                   77.758%; ungapped id 78.467%; E()=1.2e-156; 553 aa overlap;
FT                   query 1-550; subject 1-551"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0208"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43816"
FT                   /db_xref="GOA:B2FI28"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2FI28"
FT                   /protein_id="CAQ43816.1"
FT                   /translation="MNRPCNIAARLPELARERPDQIAIRCPGRRGAGNGMAAYDVTLDY
FT                   RQLDARSDAMAAGLAGYGIGRGVRTVVMVRPSPEFFLLMFALFKLGAVPVLVDPGIDRR
FT                   ALKQCLDEAQPEAFIGIPLAHVARLVLRWAPSAARLVTVGRRLGWGGTTLAALERAGAK
FT                   GGPMLAATDGEDMAAILFTSGSTGVPKGVVYRHRHFVGQIQLLGSAFGMEAGGVDLPTF
FT                   PPFALFDPALGLTSVIPDMDPTRPAQADPVRLHDAIQRFGVTQLFGSPALMRVLAKHGR
FT                   PLPTVTRVTSAGAPVPPDVVATIRSLLPADAQFWTPYGATECLPVAVVEGRELERTRAA
FT                   TEAGAGTCVGSVVAPNEVRIIAIDDAPLADWSQARVLAVGEVGEITVAGPTATDSYFNR
FT                   PQATAAAKIRETLADGSTRVVHRMGDVGYFDAQGRLWFCGRKTQRVETARGPLYTEQVE
FT                   PVFNTVAGVARTALVGVGAAGAQVPVLCVELLRGQSDSPALQEALRAHAAARTPEAGLQ
FT                   HFLVHPAFPVDIRHNAKIGREKLAVWASAELEKRA"
FT   misc_feature    221587..222873
FT                   /locus_tag="Smlt0208"
FT                   /note="HMMPfam hit to PF00501, AMP-binding enzyme, score
FT                   4e-56"
FT                   /inference="protein motif:HMMPfam:PF00501"
FT   repeat_region   221766..221773
FT                   /rpt_unit_seq="(gc)4"
FT   repeat_region   222798..222805
FT                   /rpt_unit_seq="(cg)4"
FT   CDS_pept        223113..224105
FT                   /transl_table=11
FT                   /locus_tag="Smlt0209"
FT                   /product="putative NAD(P)H dehydrogenase"
FT                   /note="similarity:fasta; with=UniProt:Q9R1J0
FT                   (EMBL:AF100198;); Mus musculus (Mouse).; Nsdhl;
FT                   Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating
FT                   (EC 1.1.1.170).; length=362; id 33.735%; ungapped id
FT                   35.783%; E()=2.4e-28; 332 aa overlap; query 2-323; subject
FT                   28-350"
FT                   /note="similarity:fasta; with=UniProt:Q8PDW5
FT                   (EMBL:AE012118;); Xanthomonas campestris pv. campestris.;
FT                   cdh; NAD(P)H steroid dehydrogenase.; length=337; id
FT                   82.067%; ungapped id 82.067%; E()=1.8e-104; 329 aa overlap;
FT                   query 1-329; subject 2-330"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0209"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43817"
FT                   /db_xref="GOA:B2FI29"
FT                   /db_xref="InterPro:IPR002225"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2FI29"
FT                   /protein_id="CAQ43817.1"
FT                   /translation="MKILVTGGGGFLGQALCRGLVERGHQVLAFNRSHYPELQVMGVGQ
FT                   IRGDLADPQAVLHAVAGVDAVFHNGAKAGAWGSYDSYHQANVIGTDNVIAACRAHGIGR
FT                   LVYTSTPSVTHRATHPVEGLGADEVPYGEDFQAPYAATKAIAEQRVLAANDASLATVAL
FT                   RPRLIWGPGDQQLVPRLAERARQGRLRLVGDGSNKVDTTYIDNAALAHFLAFEALAPGA
FT                   ACAGKAYFISNGEPLPMRELVNQLLAAVGAPRVDKAISFKTAYRIGAICERLWPLLRLR
FT                   GEPPLTRFLAEQLCTPHWYSMEPARRDFGYVPQVSIEEGLRRLKASSAA"
FT   misc_feature    223116..223868
FT                   /locus_tag="Smlt0209"
FT                   /note="HMMPfam hit to PF04321, RmlD substrate binding
FT                   domain, score 4.4e-05"
FT                   /inference="protein motif:HMMPfam:PF04321"
FT   misc_feature    223119..223919
FT                   /locus_tag="Smlt0209"
FT                   /note="HMMPfam hit to PF02719, Polysaccharide biosynthesis
FT                   protein, score 0.00064"
FT                   /inference="protein motif:HMMPfam:PF02719"
FT   misc_feature    223119..223901
FT                   /locus_tag="Smlt0209"
FT                   /note="HMMPfam hit to PF05368, NmrA-like family, score
FT                   0.00041"
FT                   /inference="protein motif:HMMPfam:PF05368"
FT   misc_feature    223119..223808
FT                   /locus_tag="Smlt0209"
FT                   /note="HMMPfam hit to PF01370, NAD dependent
FT                   epimerase/dehydratase f, score 2.2e-26"
FT                   /inference="protein motif:HMMPfam:PF01370"
FT   misc_feature    223122..223901
FT                   /locus_tag="Smlt0209"
FT                   /note="HMMPfam hit to PF01073, 3-beta hydroxysteroid
FT                   dehydrogenase/i, score 1e-60"
FT                   /inference="protein motif:HMMPfam:PF01073"
FT   misc_feature    223125..223745
FT                   /locus_tag="Smlt0209"
FT                   /note="HMMPfam hit to PF07993, Male sterility protein,
FT                   score 2.5e-11"
FT                   /inference="protein motif:HMMPfam:PF07993"
FT   CDS_pept        224187..224342
FT                   /transl_table=11
FT                   /locus_tag="Smlt0210"
FT                   /product="putative transmembrane protein"
FT                   /note="similarity:fasta; with=UniProt:Q8NL44
FT                   (EMBL:AE011648;); Xanthomonas axonopodis pv. citri.;
FT                   Hypothetical protein XAC0239.; length=52; id 97.959%;
FT                   ungapped id 97.959%; E()=6.1e-13; 49 aa overlap; query
FT                   1-49; subject 1-49"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0210"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43818"
FT                   /db_xref="GOA:B2FI30"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI30"
FT                   /protein_id="CAQ43818.1"
FT                   /translation="MLHYAIIFFVIAIIAAVLGFSGIAGAATNIAWILFVVFLILAVIS
FT                   MFRKRG"
FT   sig_peptide     224187..224264
FT                   /locus_tag="Smlt0210"
FT                   /note="Signal peptide predicted for Smlt0210 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.996 between residues 26 and 27"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    224190..224333
FT                   /locus_tag="Smlt0210"
FT                   /note="HMMPfam hit to PF07043, Protein of unknown function
FT                   (DUF1328), score 7.5e-24"
FT                   /inference="protein motif:HMMPfam:PF07043"
FT   misc_feature    order(224190..224258,224268..224327)
FT                   /locus_tag="Smlt0210"
FT                   /note="2 probable transmembrane helices predicted for
FT                   Smlt0210 by TMHMM2.0 at aa 2-24 and 28-47"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(224419..225633)
FT                   /transl_table=11
FT                   /gene="ddlA"
FT                   /locus_tag="Smlt0211"
FT                   /product="putative D-alanine--D-alanine ligase A
FT                   (D-alanylalanine synthetase A) (D-ala-D-ala ligase A)"
FT                   /EC_number="6.3.2.4"
FT                   /note="similarity:fasta; with=UniProt:P0A6J8
FT                   (EMBL:M58467;); Escherichia coli.; ddlA;
FT                   D-alanine--D-alanine ligase A (EC 6.3.2.4) (D-alanylalanine
FT                   synthetase A) (D-Ala-D-Ala ligase A).; length=364; id
FT                   64.286%; ungapped id 64.286%; E()=4.3e-84; 364 aa overlap;
FT                   query 41-404; subject 1-364"
FT                   /note="similarity:fasta; with=UniProt:Q2P8P8
FT                   (EMBL:AP008229;); Xanthomonas oryzae pv. oryzae (strain
FT                   MAFF 311018).; D-alanine-D-alanine ligase A.; length=367;
FT                   id 75.549%; ungapped id 75.549%; E()=1.8e-100; 364 aa
FT                   overlap; query 41-404; subject 1-364"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0211"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43819"
FT                   /db_xref="GOA:B2FI31"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI31"
FT                   /protein_id="CAQ43819.1"
FT                   /translation="MRTVDPRHAWMDFWFICASRGGPMKVHAMGPRNAQDIAFPMARTR
FT                   VGIIFGGKSSEHEVSLQSAKNILDALDRERFEPVLVGIDKQGQWHLSQPDTFLINADDP
FT                   SLIALHRSGQSLAVRPGAEQAQLQPSDAASALGQIDVVLPIVHGPLGEDGALQGLLRMI
FT                   NLPFVGSPVLGSAVAMDKDVTKRLLRDAGLQVAPWLCIRRHEAAEVDADAVIAQLGLPL
FT                   FVKPANQGSSVGVSKVKDAAGFAEALALALRYDHKVLVESAVVGREIECAVLGNEHPQA
FT                   SVCGEVVVHDEFYAYDTKYINANGADVVVPADIDAATQARIRQIARQAYQTLECAGMAR
FT                   VDVFLTADGEIVINEVNTLPGFTRISMYPKLWGASGVDYTTLITRLIELALERHEADRG
FT                   LQSAV"
FT   misc_feature    complement(224470..225096)
FT                   /gene="ddlA"
FT                   /locus_tag="Smlt0211"
FT                   /note="HMMPfam hit to PF07478, D-ala D-ala ligase
FT                   C-terminus, score 2.1e-114"
FT                   /inference="protein motif:HMMPfam:PF07478"
FT   misc_feature    complement(224473..225102)
FT                   /gene="ddlA"
FT                   /locus_tag="Smlt0211"
FT                   /note="HMMPfam hit to PF08443, RimK-like ATP-grasp domain,
FT                   score 0.00041"
FT                   /inference="protein motif:HMMPfam:PF08443"
FT   misc_feature    complement(224545..225102)
FT                   /gene="ddlA"
FT                   /locus_tag="Smlt0211"
FT                   /note="HMMPfam hit to PF02655, ATP-grasp domain, score
FT                   0.0039"
FT                   /inference="protein motif:HMMPfam:PF02655"
FT   misc_feature    complement(224548..225096)
FT                   /gene="ddlA"
FT                   /locus_tag="Smlt0211"
FT                   /note="HMMPfam hit to PF02222, ATP-grasp domain, score
FT                   3.5e-08"
FT                   /inference="protein motif:HMMPfam:PF02222"
FT   misc_feature    complement(225097..225504)
FT                   /gene="ddlA"
FT                   /locus_tag="Smlt0211"
FT                   /note="HMMPfam hit to PF01820, D-ala D-ala ligase
FT                   N-terminus, score 4.3e-59"
FT                   /inference="protein motif:HMMPfam:PF01820"
FT   repeat_region   complement(225680..225847)
FT                   /rpt_family="R=8"
FT                   /inference="nucleotide motif:RepeatScout"
FT   repeat_region   complement(225693..225890)
FT                   /rpt_family="R=3"
FT                   /inference="nucleotide motif:RepeatScout"
FT   repeat_region   225879..225910
FT                   /rpt_unit_seq="(cggcagcc)4"
FT   CDS_pept        225949..226584
FT                   /transl_table=11
FT                   /locus_tag="Smlt0212"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q3BZ35
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; Hypothetical protein.; length=214; id
FT                   71.564%; ungapped id 72.249%; E()=1.8e-47; 211 aa overlap;
FT                   query 1-210; subject 1-210"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0212"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43820"
FT                   /db_xref="GOA:B2FI32"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI32"
FT                   /protein_id="CAQ43820.1"
FT                   /translation="MALSLLKSLKPVAGRALQIALNRALALDPDTRHALASLDGRHIDL
FT                   TLEAPVLAMRISVDGDQLRVGPVDAQEADLAVRSSLAGVLAQLPLLANARRGDNNGKGR
FT                   VRVAGDAELARRLQQLAKGFDPDWQQPFVSVFGEVLGVQVANTLRSALQHARQGAIDLA
FT                   HSAAEFITEESRDVVPRAELDAFHDDVDVLRDDVERLGARVQRLRGAA"
FT   misc_feature    225994..226569
FT                   /locus_tag="Smlt0212"
FT                   /note="HMMPfam hit to PF06843, Protein of unknown function
FT                   (DUF1243), score 7.5e-61"
FT                   /inference="protein motif:HMMPfam:PF06843"
FT   CDS_pept        226581..228236
FT                   /transl_table=11
FT                   /gene="ubiB"
FT                   /locus_tag="Smlt0213"
FT                   /product="putative ubiquinone biosynthesis protein"
FT                   /note="similarity:fasta; with=UniProt:P0A6A0
FT                   (EMBL:M87049;); Escherichia coli.; ubiB; Probable
FT                   ubiquinone biosynthesis protein ubiB.; length=546; id
FT                   45.438%; ungapped id 46.542%; E()=1.8e-83; 548 aa overlap;
FT                   query 4-549; subject 6-542"
FT                   /note="similarity:fasta; with=UniProt:Q3BZ34
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; ubiB; Ubiquinone biosynthesis protein
FT                   UbiB.; length=557; id 84.173%; ungapped id 84.936%;
FT                   E()=1.5e-176; 556 aa overlap; query 1-551; subject 1-556"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0213"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43821"
FT                   /db_xref="GOA:B2FI33"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI33"
FT                   /protein_id="CAQ43821.1"
FT                   /translation="MKAVLRASRIGRVILRYRLDDLLQGTPAERWLRLAKPFVPRASAS
FT                   IASQSRGARLRLALQDLGPIFVKFGQILSTRRDLVPPDVANELTLLQDRVKPFDGETAR
FT                   RIVEDALGLPVSEAFASFDTEPLASASIAQVHAATLADGRQVVVKVLRPGIEKQIDADI
FT                   ALLNSLAALVERTHPRADKIRPREVVAEVENTLAAELDLQREGANASVLRRFWENSDDL
FT                   YVPEVIWSHTAERALTLERVWGIPSDDIAALDKAGIDRKALAAKGVRVFYTQVFRDNFF
FT                   HADAHAGNIWVDTDPARRANPRFIALDFGIMGQLSQEDQYYLAENFMAIFNRDYRRIAE
FT                   LHVQARWMPDHVRIDDLEAAVRSVCEPYFTRPLSQISLAEVLMKLFRVAQRYQLTLQPQ
FT                   LILLQKTLLNIEGVGRQLDPQIDIWAVAKPVLAKILRERYSPRRVVRELGKRLPEIMTH
FT                   APDMPRLVHAWLTQQVEGRHELAMRSRDLVALDASLQRLQKRAVGAITGVGLLAIAALM
FT                   YVLQPPGWYWGDVPAWSWLSGAVGVVALARAWWR"
FT   misc_feature    226905..227264
FT                   /gene="ubiB"
FT                   /locus_tag="Smlt0213"
FT                   /note="HMMPfam hit to PF03109, ABC1 family, score 2.2e-46"
FT                   /inference="protein motif:HMMPfam:PF03109"
FT   repeat_region   227282..227289
FT                   /rpt_unit_seq="(gc)4"
FT   misc_feature    order(228081..228140,228168..228227)
FT                   /gene="ubiB"
FT                   /locus_tag="Smlt0213"
FT                   /note="2 probable transmembrane helices predicted for
FT                   Smlt0213 by TMHMM2.0 at aa 501-520 and 530-549"
FT                   /inference="protein motif:TMHMM:2.0"
FT   repeat_region   228216..228223
FT                   /rpt_unit_seq="(gc)4"
FT   CDS_pept        complement(228289..229074)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0214"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q0TKS5; ; length=257;
FT                   id 31.890%; ungapped id 32.271%; E()=2.1e-26; 254 aa
FT                   overlap; query 4-255; subject 1-253"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0214"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43822"
FT                   /db_xref="InterPro:IPR030887"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI34"
FT                   /protein_id="CAQ43822.1"
FT                   /translation="MRLIIRGALPCALLLAVCSAHAGVDRVTVQLDHADYSDGFGKRDV
FT                   QTVDVAGRSGGSRWHLGLAHGERDYGSRRFSGNRMQGSLHHRWSPRLSTRTAVTASNDD
FT                   PVFVNRQVNQDIQWKVTPQTVLSVGGKYAQYHAGAHVSGWSVGASHYFPRVTASLRHER
FT                   HRQSNGPDGHGTTLSLRLKDGQGRGSTQLWLGSGTSGYTAESDPLLLREHDARRAFLRR
FT                   SQPLGEHLVLDVGIGKTWHRTRLDSFQSVQSHLGLGYHW"
FT   sig_peptide     complement(229009..229074)
FT                   /locus_tag="Smlt0214"
FT                   /note="Signal peptide predicted for Smlt0214 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.995 between residues 22 and 23"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(229079..229660)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0215"
FT                   /product="putative hexapeptide transferase"
FT                   /note="similarity:fasta; with=UniProt:Q0TKS4; ; length=146;
FT                   id 55.714%; ungapped id 55.714%; E()=7e-25; 140 aa overlap;
FT                   query 48-187; subject 2-141"
FT                   /note="similarity:fasta; with=UniProt:Q1RFI3
FT                   (EMBL:CP000243;); Escherichia coli (strain UTI89/UPEC).;
FT                   Putative transferase (EC 2.7.7.-).; length=174; id 58.025%;
FT                   ungapped id 58.025%; E()=2.6e-31; 162 aa overlap; query
FT                   26-187; subject 8-169"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0215"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43823"
FT                   /db_xref="GOA:B2FI35"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI35"
FT                   /protein_id="CAQ43823.1"
FT                   /translation="MAEALSTLAPHTDPDAEVSPRATLHGAVRIGAGSRICDGAHVQGP
FT                   VSIGRDCLIGNNALLRGPLCIGDGTRIGFASELKNARLGNQVSIGPQCFIADSRIDDRV
FT                   YLGALVRTSNHRLDGATVTVHIGDTVIDSQRDKLGAWIGEGAALGVGVIILPGRIVAPG
FT                   SQFGPRITVERNLPPGRYRLLQSLHSQPLE"
FT   misc_feature    complement(229139..229192)
FT                   /locus_tag="Smlt0215"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (three rep, score 1e+02"
FT                   /inference="protein motif:HMMPfam:PF00132"
FT   misc_feature    complement(229193..229246)
FT                   /locus_tag="Smlt0215"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (three rep, score 1.4"
FT                   /inference="protein motif:HMMPfam:PF00132"
FT   misc_feature    complement(229370..229423)
FT                   /locus_tag="Smlt0215"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (three rep, score 0.15"
FT                   /inference="protein motif:HMMPfam:PF00132"
FT   misc_feature    complement(229457..229510)
FT                   /locus_tag="Smlt0215"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (three rep, score 9"
FT                   /inference="protein motif:HMMPfam:PF00132"
FT   misc_feature    complement(229511..229564)
FT                   /locus_tag="Smlt0215"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (three rep, score 41"
FT                   /inference="protein motif:HMMPfam:PF00132"
FT   misc_feature    complement(229565..229618)
FT                   /locus_tag="Smlt0215"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (three rep, score 17"
FT                   /inference="protein motif:HMMPfam:PF00132"
FT   CDS_pept        complement(229671..230810)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0216"
FT                   /product="putative transmembrane glycosyl transferase"
FT                   /note="similarity:fasta; with=UniProt:Q5VJB2
FT                   (EMBL:AY438014;); actinomycetemcomitans).; aagC; AagC.;
FT                   length=411; id 30.178%; ungapped id 32.692%; E()=6.3e-14;
FT                   338 aa overlap; query 1-322; subject 18-345"
FT                   /note="similarity:fasta; with=UniProt:Q0TGD1; ; length=398;
FT                   id 62.533%; ungapped id 62.533%; E()=1.7e-92; 379 aa
FT                   overlap; query 1-379; subject 1-379"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0216"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43824"
FT                   /db_xref="GOA:B2FI36"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI36"
FT                   /protein_id="CAQ43824.1"
FT                   /translation="MKTLLFLAMCAFILVRICVQASRRPSTRLYSIDAIVPAYNEAPCL
FT                   ERSLASLLENPYVARVICVNDGSTDNTAQVLDALQARWPGRLVAVHQANTGKGGALMHG
FT                   LQHATAEQVFLTDADTHIDPRSHGLGHLLAEIERGADAVGGVPSSSLQGAGFLPHVRAS
FT                   LKLPMIVIKRSFQQWLGGAPFIVSGSCGLFRTSVLRKVGFSDRTRVEDLDMSWSLVAQG
FT                   YRVRQSIRCVVYPQECNTLVEEWRRWRRWIVGYAVCMRLHRRLLLTRFGIFSILPMMLL
FT                   ALAGIMLSLQVWFGAARLHGPGGLALSVMPLFWTGIVMLLAVISAIHHRRAWLVPAAAF
FT                   SMLYVLLAYAIWLFHGLAGLFTGREPVRDKPTRYPHVVE"
FT   misc_feature    complement(order(229749..229817,229836..229904,
FT                   229947..230015,230217..230285))
FT                   /locus_tag="Smlt0216"
FT                   /note="4 probable transmembrane helices predicted for
FT                   Smlt0216 by TMHMM2.0 at aa 176-198, 266-288, 303-325 and
FT                   332-354"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(230205..230714)
FT                   /locus_tag="Smlt0216"
FT                   /note="HMMPfam hit to PF00535, Glycosyl transferase family,
FT                   score 6.8e-26"
FT                   /inference="protein motif:HMMPfam:PF00535"
FT   sig_peptide     complement(230742..230810)
FT                   /locus_tag="Smlt0216"
FT                   /note="Signal peptide predicted for Smlt0216 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.974) with cleavage site
FT                   probability 0.486 between residues 23 and 24"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(230810..231421)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0217"
FT                   /product="putative N-acetyl glucosamine deacetylase
FT                   (LmbE-like)"
FT                   /note="similarity:fasta; with=UniProt:Q0TKS2; ; length=223;
FT                   id 48.780%; ungapped id 50.251%; E()=2.9e-33; 205 aa
FT                   overlap; query 5-203; subject 19-223"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0217"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43825"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI37"
FT                   /protein_id="CAQ43825.1"
FT                   /translation="MTLNILAIGAHPDDIELGCGGSLAKLARAGSRIHALVLSRGGRGC
FT                   HAGIDRSDESHRALHRLGVAEVIQQDFPDTRFPTCRNDIIASIEQVCTLIEPDRIYTMC
FT                   GEDHHQDHRTVHEASIIACRHIPQILCYESPSTLPQFAPQVFEDISAQLELKIHALREH
FT                   ASQGDRHYMQESHLRCHAQFRGQQIGIGPSEGFLPYRLVL"
FT   misc_feature    complement(231053..231406)
FT                   /locus_tag="Smlt0217"
FT                   /note="HMMPfam hit to PF02585, GlcNAc-PI de-N-acetylase,
FT                   score 3.8e-32"
FT                   /inference="protein motif:HMMPfam:PF02585"
FT   CDS_pept        231554..232174
FT                   /transl_table=11
FT                   /locus_tag="Smlt0218"
FT                   /product="putative o-methyltransferase"
FT                   /note="similarity:fasta; with=UniProt:Q00719
FT                   (EMBL:M93958;); Streptomyces mycarofaciens.; mdmC;
FT                   O-methyltransferase mdmC (EC 2.1.1.-).; length=221; id
FT                   33.880%; ungapped id 37.349%; E()=2.4e-09; 183 aa overlap;
FT                   query 38-204; subject 38-219"
FT                   /note="similarity:fasta; with=UniProt:Q1JXV1
FT                   (EMBL:AAEW02000014;); Desulfuromonas acetoxidans DSM 684.;
FT                   O-methyltransferase, family 3.; length=195; id 61.538%;
FT                   ungapped id 61.538%; E()=4.3e-41; 195 aa overlap; query
FT                   12-206; subject 1-195"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0218"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43826"
FT                   /db_xref="GOA:B2FI38"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI38"
FT                   /protein_id="CAQ43826.1"
FT                   /translation="MDAASWRAQRKMALELSELKNELAHFGAENDAREVERGRRMLNIT
FT                   PDTGEFLAVLVRFGTARRVLEIGTSNGYSTLWLAESAAAIDGHVTTLEYAEDKAAMARD
FT                   TFARSGLADRITLVHDDAGPWLAEAADASIDLLFLDSDRGQYAGWWPQLRRVLRPGGLL
FT                   VVDNATSHAGEMEPLRTLLESDANFSTSLVPVGNGELLAVRNA"
FT   misc_feature    231581..232168
FT                   /locus_tag="Smlt0218"
FT                   /note="HMMPfam hit to PF01596, O-methyltransferase, score
FT                   1.2e-13"
FT                   /inference="protein motif:HMMPfam:PF01596"
FT   CDS_pept        232351..233091
FT                   /transl_table=11
FT                   /gene="truC"
FT                   /locus_tag="Smlt0219"
FT                   /product="putative tRNA pseudouridine synthase C"
FT                   /EC_number="5.4.99.-"
FT                   /note="similarity:fasta; with=UniProt:P0AA41
FT                   (EMBL:U29581;); Escherichia coli.; truC; tRNA pseudouridine
FT                   synthase C (EC 5.4.99.-) (tRNA-uridine isomerase C) (tRNA
FT                   pseudouridylate synthase C).; length=260; id 39.407%;
FT                   ungapped id 41.150%; E()=5.5e-29; 236 aa overlap; query
FT                   18-243; subject 2-237"
FT                   /note="similarity:fasta; with=UniProt:Q3BZ32
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; truC; Pseudouridylate synthase (EC
FT                   4.2.1.70).; length=238; id 82.895%; ungapped id 83.260%;
FT                   E()=5.4e-78; 228 aa overlap; query 18-244; subject 8-235"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0219"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43827"
FT                   /db_xref="GOA:B2FI39"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI39"
FT                   /protein_id="CAQ43827.1"
FT                   /translation="MSTEPDTLAAVETETAPLQLLHLDERLAVVNKPAGLMVHDSKLAR
FT                   GEDDFLADRLREQLGRPIFLVHRLDRATSGCLLLAFDRETASALGKALMGGEVLKDYLT
FT                   VCRGWPAELAWQVDHDLDGGPGKPVKKPAVTDFQRLATGELSVPVGEFTRSRYALLRCQ
FT                   PQTGRFRQIRRHLKHLSHHMIGDTSHGDGRHNRIFRMQGVHRMLLHAERLRFPHPEGGN
FT                   VDVSAPLDREFQKALDLFGWQVDL"
FT   misc_feature    232426..232884
FT                   /gene="truC"
FT                   /locus_tag="Smlt0219"
FT                   /note="HMMPfam hit to PF00849, RNA pseudouridylate
FT                   synthase, score 5.1e-26"
FT                   /inference="protein motif:HMMPfam:PF00849"
FT   CDS_pept        complement(233168..233716)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0220"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q2P8Q3
FT                   (EMBL:AP008229;); Xanthomonas oryzae pv. oryzae (strain
FT                   MAFF 311018).; Hypothetical protein XOO0319.; length=192;
FT                   id 72.515%; ungapped id 72.515%; E()=8.8e-41; 171 aa
FT                   overlap; query 9-179; subject 16-186"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0220"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43828"
FT                   /db_xref="InterPro:IPR018637"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI40"
FT                   /protein_id="CAQ43828.1"
FT                   /translation="MYRRKLRMTRSAPALPSLLRRAALLLALAVASVPALAAPPTDGDI
FT                   NRLLSASRAQSMIDTMLPQIEAMQQQQFQQVAAQRQLNAQQQEQLKRIQARTSQTLRQA
FT                   LSWQQLRPMYVDLYKKTFSKEDVLAMAEFYESAAGQSLLDKTPALMQNVMVAIQARMQP
FT                   LFADLQKDLEAIVNEPEKK"
FT   repeat_region   233501..233512
FT                   /rpt_unit_seq="(ctg)4"
FT   sig_peptide     complement(233606..233716)
FT                   /locus_tag="Smlt0220"
FT                   /note="Signal peptide predicted for Smlt0220 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 1.000 between residues 37 and 38"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        233715..234260
FT                   /transl_table=11
FT                   /locus_tag="Smlt0221"
FT                   /product="putative peptidyl-tRNA hydrolase"
FT                   /note="similarity:fasta; with=UniProt:Q4V049
FT                   (EMBL:CP000050;); Xanthomonas campestris pv. campestris
FT                   (strain 8004).; Peptidyl-tRNA hydrolase.; length=143; id
FT                   80.420%; ungapped id 80.420%; E()=1.2e-37; 143 aa overlap;
FT                   query 39-181; subject 1-143"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0221"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43829"
FT                   /db_xref="GOA:B2FI41"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI41"
FT                   /protein_id="CAQ43829.1"
FT                   /translation="MGRPAYPQPRRRRRVRYLIGGIRRAMRTPTRGCRYNARMGSGPVT
FT                   INAQLEIPDGEIVERFVRASGAGGQNVNKVSTAVELRFDVANSPSLPEPLRTRLLARRD
FT                   RRMTGEGVLVIDAQRFRTQDRNREDARERLAAFIQAGLSVPKPRKATKPTLGSKLRRLD
FT                   AKRGRAQIKRGRSSRDWE"
FT   misc_feature    233841..234239
FT                   /locus_tag="Smlt0221"
FT                   /note="HMMPfam hit to PF00472, Peptidyl-tRNA hydrolase
FT                   domain, score 3.2e-28"
FT                   /inference="protein motif:HMMPfam:PF00472"
FT   repeat_region   234215..234222
FT                   /rpt_unit_seq="(gc)4"
FT   CDS_pept        234307..234867
FT                   /transl_table=11
FT                   /locus_tag="Smlt0222"
FT                   /product="putative acyltransferase"
FT                   /note="similarity:fasta; with=UniProt:Q3BZ29
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; Putative acyltransferase.; length=209; id
FT                   65.591%; ungapped id 65.946%; E()=5.9e-49; 186 aa overlap;
FT                   query 1-186; subject 25-209"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0222"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43830"
FT                   /db_xref="GOA:B2FI42"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI42"
FT                   /protein_id="CAQ43830.1"
FT                   /translation="MPQVKPNAFLRWLARCTLRMGGWKVTGTLPDIPRLVFIIAPHSSN
FT                   WDGLWGMAAKIALGMKVKVLGKASLFWWPLGPLLHKLGVIPLDRSSPQGTVGQAVDLLR
FT                   NNEKMWFAITPEGTRKAVKEWKAGFLKIARMADVPILAAYFHYPEKTIGIGPLFQPTGD
FT                   DAADMAAIREFYRPWIGKTRGTV"
FT   misc_feature    234370..234744
FT                   /locus_tag="Smlt0222"
FT                   /note="HMMPfam hit to PF01553, Acyltransferase, score
FT                   3.7e-07"
FT                   /inference="protein motif:HMMPfam:PF01553"
FT   CDS_pept        234979..237135
FT                   /transl_table=11
FT                   /gene="dcp"
FT                   /locus_tag="Smlt0223"
FT                   /product="putative peptidyl-dipeptidase Dcp (dipeptidyl
FT                   carboxypeptidase)"
FT                   /EC_number="3.4.15.5"
FT                   /note="From codon 40, similar to Escherichia coli. Dcp
FT                   UniProt:P24171 (EMBL:X57947 (680 aa) fasta scores:
FT                   E()=5.1e-144, 54.357% id in 677 aa, and entire protein is
FT                   similar to Xanthomonas oryzae pv. oryzae. Dcp
FT                   UniProt:Q5H622 (EMBL:AE013598 (722 aa) fasta scores: E()=0,
FT                   82.361% id in 720 aa"
FT                   /note="similarity:fasta; with=UniProt:P24171
FT                   (EMBL:X57947;); Escherichia coli.; dcp;
FT                   Peptidyl-dipeptidase dcp (EC 3.4.15.5) (Dipeptidyl
FT                   carboxypeptidase).; length=680; id 54.357%; ungapped id
FT                   54.357%; E()=5.1e-144; 677 aa overlap; query 41-717;
FT                   subject 2-678"
FT                   /note="similarity:fasta; with=UniProt:Q5H622
FT                   (EMBL:AE013598;); Xanthomonas oryzae pv. oryzae.; dcp;
FT                   Peptidyl-dipeptidase.; length=722; id 82.361%; ungapped id
FT                   82.706%; E()=0; 720 aa overlap; query 1-717; subject 1-720"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0223"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43831"
FT                   /db_xref="GOA:B2FI43"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI43"
FT                   /protein_id="CAQ43831.1"
FT                   /translation="MSRTVVLAAAISLALAACSGKESTPVSDAQKAPAQQPAEASTNPL
FT                   LSASTLPFQAPQFDKIKDSDYLPAFEEGMRQHLADVRKIADSSEPATFDNTIVAMERSG
FT                   ETLTRVSRIFFGLVQADTNDARQKIQEEVAPKLAAHQDEINLDPKLFARVKSIYDQRDT
FT                   LELDPVQKRLVEHYYDGLVRAGAQLSDADKASLRKLNVEETTLSTQFHTRLVAATAAAA
FT                   VVVDDKAKLAGLDEDAINNAANAAKERKLDGKFLLPLQNTTQQPVLGSLSDRDQRAAVL
FT                   KASETRAERGDANDTRQTVQRLAQLRAQKAKLLGFDTFADYQLGDQMAKTPAAALKLLT
FT                   DTVPAATAKARAEAGEIQKVIDAQKGGFQVAASDWDFYAEQVRKAKYDLDESQIKPYFE
FT                   LDNVLQNGVFYAATQLYGITFKPRTDIPTYNPDMKVYEVFDKDGTSLALFYTDYFKRDS
FT                   KSGGAWMDVFVEQDGLTGAKPVVYNVCNFTKPAAGQPALISFDDVTTMFHEFGHALHGM
FT                   FSNVKYPSIAGTATSRDFVEFPSQFNEHWALDPKVFANYAKHYKTGEAMPQELVDKILK
FT                   ARSFNQGYATTEYLSAALLDLAWHTQKADAPLQDVGAFEASALKKFKVDLPQVPPRYRT
FT                   TYFDHIWGGGYSAGYYAYFWAEVLDHDAYQWFTEHGGLTAANGQEFRDKILSRGNSVEL
FT                   STLYRDFRGKDPSVEPLLKFRGLK"
FT   sig_peptide     234979..235038
FT                   /gene="dcp"
FT                   /locus_tag="Smlt0223"
FT                   /note="Signal peptide predicted for Smlt0223 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.372 between residues 20 and 21"
FT                   /inference="protein motif:SignalP:2.0"
FT   repeat_region   235431..235438
FT                   /rpt_unit_seq="(cg)4"
FT   misc_feature    235777..237129
FT                   /gene="dcp"
FT                   /locus_tag="Smlt0223"
FT                   /note="HMMPfam hit to PF01432, Peptidase family M3, score
FT                   1.3e-163"
FT                   /inference="protein motif:HMMPfam:PF01432"
FT   repeat_region   236026..236033
FT                   /rpt_unit_seq="(gc)4"
FT   repeat_region   237251..237463
FT                   /rpt_family="R=8"
FT                   /inference="nucleotide motif:RepeatScout"
FT   repeat_region   complement(237297..237463)
FT                   /rpt_family="R=8"
FT                   /inference="nucleotide motif:RepeatScout"
FT   repeat_region   237445..237462
FT                   /rpt_unit_seq="(gctgtt)3"
FT   repeat_region   237451..237502
FT                   /rpt_family="R=14"
FT                   /inference="nucleotide motif:RepeatScout"
FT   CDS_pept        complement(237515..237961)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0224"
FT                   /product="putative 3-dehydroquinate dehydratase"
FT                   /note="similarity:fasta; with=UniProt:P96750
FT                   (EMBL:U88628;); Corynebacterium pseudotuberculosis.; aroQ;
FT                   3-dehydroquinate dehydratase (EC 4.2.1.10)
FT                   (3-dehydroquinase) (Type II DHQase).; length=146; id
FT                   31.298%; ungapped id 35.965%; E()=0.67; 131 aa overlap;
FT                   query 7-129; subject 17-138"
FT                   /note="similarity:fasta; with=UniProt:Q4UP12
FT                   (EMBL:CP000050;); Xanthomonas campestris pv. campestris
FT                   (strain 8004).; 3-dehydroquinate dehydratase.; length=146;
FT                   id 59.310%; ungapped id 59.722%; E()=2e-27; 145 aa overlap;
FT                   query 5-148; subject 2-146"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0224"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43832"
FT                   /db_xref="GOA:B2FI44"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI44"
FT                   /protein_id="CAQ43832.1"
FT                   /translation="MSIFIIRGPEAAGALIRTAMPLPAPVLKSLVHRAIDAGTSVAIRA
FT                   CGSEQELLDALRVADHSRGEVTLLDPGACANSLRLQRLLPYLHNAYVEVHDDGAVAESC
FT                   LPAGVGQRLGIAAGYGAQSYVLALDIALDHLGLAEQANRVHVGT"
FT   CDS_pept        complement(237965..238366)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0225"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q2P8S4
FT                   (EMBL:AP008229;); Xanthomonas oryzae pv. oryzae (strain
FT                   MAFF 311018).; Hypothetical protein XOO0298.; length=142;
FT                   id 34.815%; ungapped id 37.600%; E()=0.00011; 135 aa
FT                   overlap; query 1-129; subject 1-131"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0225"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43833"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI45"
FT                   /protein_id="CAQ43833.1"
FT                   /translation="MTLLVIRHASSSVPRPQLPAQLNGHRVLCSDCASLSEVRQCLCQS
FT                   QARSADWVLLDVGVADEAQWQAEGGALQAALERLPAQYIELQAPSEPGLESRLQLQHGP
FT                   AAVVIDQRSQQAGYPLSLAIVGRRLAQEG"
FT   repeat_region   238412..238419
FT                   /rpt_unit_seq="(gc)4"
FT   CDS_pept        238543..239169
FT                   /transl_table=11
FT                   /locus_tag="Smlt0226"
FT                   /product="putative peptidase"
FT                   /note="similarity:fasta; with=UniProt:Q6AS39
FT                   (EMBL:CR522870;); Desulfotalea psychrophila.; Related to
FT                   signal peptidase I.; length=214; id 33.520%; ungapped id
FT                   35.088%; E()=3.3e-15; 179 aa overlap; query 20-197; subject
FT                   16-187"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0226"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43834"
FT                   /db_xref="GOA:B2FI46"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI46"
FT                   /protein_id="CAQ43834.1"
FT                   /translation="MDAVARPPFSDRALAWLKKEALPLLVMLGLLAAARDTLANHYVVP
FT                   SGSMQPTLQPGDRVVVDMRAYGLRLPFTSRELMSTGTPQRGEVAVFDSPADGTRLIKRV
FT                   AAVAGDHVQLYEGHLTINGQPLQTADLQDVEAFGERRASLDLDMGGGPDIADLVVPDGK
FT                   VLVLGDHRGNSFDGRFFGFVDADKVYGRAVAVYYRRGDGFEWQRL"
FT   misc_feature    238669..238914
FT                   /locus_tag="Smlt0226"
FT                   /note="HMMPfam hit to PF00717, Peptidase S24-like, score
FT                   2e-19"
FT                   /inference="protein motif:HMMPfam:PF00717"
FT   CDS_pept        239294..240550
FT                   /transl_table=11
FT                   /locus_tag="Smlt0227"
FT                   /product="putative MFS family transporter"
FT                   /note="similarity:fasta; with=UniProt:Q146V4
FT                   (EMBL:CP000270;); Burkholderia xenovorans (strain LB400).;
FT                   Major facilitator superfamily (MFS) transporter.;
FT                   length=406; id 50.254%; ungapped id 50.510%; E()=4.9e-59;
FT                   394 aa overlap; query 24-416; subject 13-405"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0227"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43835"
FT                   /db_xref="GOA:B2FI47"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI47"
FT                   /protein_id="CAQ43835.1"
FT                   /translation="MTGETAAAVEGRPSTLDTGTDTRIQQGTPAFRRTALALFLAGFST
FT                   FGLLYTVQPLLPEFSRHFGVSAAGSAMSLSLTTGTLAVAMLLAGLLSDAVGRRPLMIVA
FT                   LLASAMLSLCTALVDDWTTLLVLRTLLGLALSGVPAVAMTYLVEEMDSRALGLAMGLYI
FT                   GGNAIGGMSGRLLAGIIADHWGWRWGIGVVSIIAVASTVLLWLQLPPSRHFHARRGGLR
FT                   QLPSRWRTLFADPGLPWLFATSFVLMGVFVTLYNYLGYHLLAPPYHLSQTVVGLIFSVY
FT                   LVGTFSSAWMGQQATRYGRGRILSISFALIGAGIALLAMPWLSTMALGIALVTFGFFGG
FT                   HSVASSWVGSRAGAMRAEASALYLFAYYLGSSVLGGVGGLAYAAWDWLGVCAFAAVLTL
FT                   IGGGIVWALQQRAPQPVTA"
FT   misc_feature    order(239396..239464,239501..239569,239588..239656,
FT                   239666..239734,239753..239821,239849..239917,
FT                   239999..240067,240095..240163,240200..240259,
FT                   240269..240337,240374..240442,240452..240520)
FT                   /locus_tag="Smlt0227"
FT                   /note="12 probable transmembrane helices predicted for
FT                   Smlt0227 by TMHMM2.0 at aa 35-57, 70-92, 99-121, 125-147,
FT                   154-176, 186-208, 236-258, 268-290, 303-322, 326-348,
FT                   361-383 and 387-409"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    239405..240442
FT                   /locus_tag="Smlt0227"
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 1.2e-44"
FT                   /inference="protein motif:HMMPfam:PF07690"
FT   repeat_region   240523..240530
FT                   /rpt_unit_seq="(gc)4"
FT   repeat_region   complement(240609..240697)
FT                   /rpt_family="R=0"
FT                   /inference="nucleotide motif:RepeatScout"
FT   CDS_pept        complement(240680..241513)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0228"
FT                   /product="putative LysR family transcriptional regulator"
FT                   /note="similarity:fasta; with=UniProt:Q4IUJ4
FT                   (EMBL:AAAU03000012;); Azotobacter vinelandii AvOP.;
FT                   Regulatory protein, LysR:LysR substrate binding domain.;
FT                   length=308; id 46.642%; ungapped id 47.170%; E()=2.8e-39;
FT                   268 aa overlap; query 1-267; subject 27-292"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0228"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43836"
FT                   /db_xref="GOA:B2FI48"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI48"
FT                   /protein_id="CAQ43836.1"
FT                   /translation="MSQPPLSQQIRQLEDLIGARLFVRSHRRVQLTPAGELLQERARAI
FT                   VQQVEAAVDEVQRAQRGEQGELHIGLTRATPLSPQIPRSILHYRQQYPQVRLQLSEMNT
FT                   LQQIDALLDGSLDVGIIRKRALPPELVAHSLFVDPLALIVHAGHPALHRLSKQGTLSLR
FT                   DFAQEPFVAFRRSAGAGIHDHMIALCAAAGFTPRIVQEAGEASTLISLAAAGLGAAILP
FT                   SSCDHIRVEGSRFVALADAGAHSEVQLAWHRERVTPLIRNFATLLRGAFADRVDC"
FT   misc_feature    complement(240698..241336)
FT                   /locus_tag="Smlt0228"
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 1.1e-47"
FT                   /inference="protein motif:HMMPfam:PF03466"
FT   repeat_region   241336..241343
FT                   /rpt_unit_seq="(gc)4"
FT   misc_feature    complement(241406..241513)
FT                   /locus_tag="Smlt0228"
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix, score 2.3e-09"
FT                   /inference="protein motif:HMMPfam:PF00126"
FT   repeat_region   complement(241707..241868)
FT                   /rpt_family="R=8"
FT                   /inference="nucleotide motif:RepeatScout"
FT   repeat_region   241847..241901
FT                   /rpt_family="R=14"
FT                   /inference="nucleotide motif:RepeatScout"
FT   CDS_pept        complement(241927..242895)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0230"
FT                   /product="putative LysR family transcriptional regulator"
FT                   /note="similarity:fasta; with=UniProt:Q8PQR7
FT                   (EMBL:AE011650;); Xanthomonas axonopodis pv. citri.; rbcR;
FT                   Transcriptional regulator.; length=318; id 80.126%;
FT                   ungapped id 80.126%; E()=4e-96; 317 aa overlap; query
FT                   6-322; subject 2-318"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0230"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43837"
FT                   /db_xref="GOA:B2FI49"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI49"
FT                   /protein_id="CAQ43837.1"
FT                   /translation="MTTRPSPSPRFSYKSDRLKPLRAFCQTVRLGSVSRAAEALFVSQP
FT                   AISLQLQALERELGVPLFERSGRRLVPSREGQLLYEMAQPLVENLDGLEARFRDKVRGL
FT                   DAGELNIAANSSTILYLLPKIVERFRLHHPDVRLTLHNAISADGTDLLREDAADLAIGS
FT                   MTDVPADLSYAPAYRFEQVLIAPHDHPLASGGELELADIARYPLVLPPKRQITYRLVDQ
FT                   VFQRHRIAYTVALEVGGWEVIKQYVAMGMGISIVPALCLNEADHERLAARSMKRWFPER
FT                   SYGVIVRRGKALSAQARAFIELIQPELFSPRDYDQSGHSER"
FT   misc_feature    complement(241969..242592)
FT                   /locus_tag="Smlt0230"
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 9.7e-55"
FT                   /inference="protein motif:HMMPfam:PF03466"
FT   misc_feature    complement(242665..242844)
FT                   /locus_tag="Smlt0230"
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix, score 5.3e-22"
FT                   /inference="protein motif:HMMPfam:PF00126"
FT   CDS_pept        243005..244627
FT                   /transl_table=11
FT                   /gene="mls"
FT                   /locus_tag="Smlt0231"
FT                   /product="putative malate synthase"
FT                   /EC_number="2.3.3.9"
FT                   /note="similarity:fasta; with=UniProt:P95329
FT                   (EMBL:AF013216;); Myxococcus xanthus.; mls; Malate synthase
FT                   (EC 2.3.3.9).; length=541; id 55.288%; ungapped id 56.121%;
FT                   E()=1.1e-112; 539 aa overlap; query 1-536; subject 1-534"
FT                   /note="similarity:fasta; with=UniProt:Q8PDU8
FT                   (EMBL:AE012119;); Xanthomonas campestris pv. campestris.;
FT                   mls; Malate synthase.; length=540; id 82.810%; ungapped id
FT                   83.117%; E()=1.2e-181; 541 aa overlap; query 1-540; subject
FT                   1-540"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0231"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43838"
FT                   /db_xref="GOA:B2FI50"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006252"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI50"
FT                   /protein_id="CAQ43838.1"
FT                   /translation="MSAVASAVPTPASKATPGIALATRVAGQDTVLPAPLLALLVSLHR
FT                   AVEPGRQARLQARRERQAFFDQGGLPDFREDTTAIRSGDWRVAPLPAALQDRRVEITGP
FT                   TDPKMVINALNSGAKVFMADFEDSTSPTWRNLLAGQQSLAAAVRGDLEFTAANGKHYTL
FT                   RPYDEQAVLIVRPRGWHLDEKHVRIDGQFIAGGLFDAAVFAFHNARTLQAKDRGPYFYL
FT                   PKLQSMEEAALWETALSHIEGMLGLPHGQIKVTVLIETLPAVFEMDEILHALRDRIVGL
FT                   NCGRWDYIFSYLKTFRRHADRVLPERGQVTMTQPFLKAYSELLIQTCHRRGAHAMGGMA
FT                   AQIPINNDAAANEQAMARVRADKLREVTAGHDGTWVAHPALIPVAMAIFDEHMPGANQH
FT                   SVLRQDVRVGRDELIARPPGTITRAGFEGNVEVCVRYLAAWLDGNGCVPIHHLMEDAAT
FT                   AEISRSQLWQWLHTPGQQLDDGTAIDLALLDSTLSQLPARLGDTAALPGGTRIGEAITL
FT                   LGELSRSDELTDFLTLPAYARID"
FT   misc_feature    243056..244624
FT                   /gene="mls"
FT                   /locus_tag="Smlt0231"
FT                   /note="HMMPfam hit to PF01274, Malate synthase, score
FT                   8.3e-262"
FT                   /inference="protein motif:HMMPfam:PF01274"
FT   CDS_pept        244693..245994
FT                   /transl_table=11
FT                   /gene="aceA"
FT                   /locus_tag="Smlt0232"
FT                   /product="putative isocitrate lyase"
FT                   /EC_number="4.1.3.1"
FT                   /note="similarity:fasta; with=UniProt:P51066
FT                   (EMBL:AE008895;); Salmonella typhimurium.; aceA; Isocitrate
FT                   lyase (EC 4.1.3.1) (Isocitrase) (Isocitratase) (ICL).;
FT                   length=434; id 69.746%; ungapped id 71.564%; E()=2.4e-112;
FT                   433 aa overlap; query 2-424; subject 3-434"
FT                   /note="similarity:fasta; with=UniProt:Q3BZ17
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; aceA; Isocitrate lyase (EC 4.1.3.1).;
FT                   length=431; id 90.741%; ungapped id 91.375%; E()=3.3e-151;
FT                   432 aa overlap; query 2-433; subject 3-431"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0232"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43839"
FT                   /db_xref="GOA:B2FI51"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI51"
FT                   /protein_id="CAQ43839.1"
FT                   /translation="MSKLPTAEQIQHDWDTNPRWEGIQRNYSAADVVRLRGTVHIEHSL
FT                   ARLGAEKLWASLHEREFVNALGALTGNQAMQQVKAGLKAIYLSGWQVAADANLAGQMYP
FT                   DQSLYPADSVPAVVKRINNTLLRADQLHHAEGKDDIDFLQPIVADAEAGFGGVLNAFEL
FT                   MKAMIEAGAAGVHFEDQLASVKKCGHMGGKVLVPTREAIEKLNAARLAADVLGVPTLLV
FT                   ARTDAEAADLLTSDIDGNDRPFTTGERTVEGFYKTRNGLDQAISRGLAYAPYADLVWCE
FT                   TGKPDLEFARRFAEAIHAKFPGKLLAYNCSPSFNWKKNLDDATIAKFQRELGSYGYKFQ
FT                   FITLAGFHALNYGMFNLAHGYARRQMSAFVELQEAEFEAAERGFTAVKHQREVGTGYFD
FT                   AVTQAIQQGQSSTTALTGSTEEEQFHGGRSERAA"
FT   misc_feature    244711..245964
FT                   /gene="aceA"
FT                   /locus_tag="Smlt0232"
FT                   /note="HMMPfam hit to PF00463, Isocitrate lyase family,
FT                   score 4.1e-237"
FT                   /inference="protein motif:HMMPfam:PF00463"
FT   CDS_pept        246412..247452
FT                   /transl_table=11
FT                   /locus_tag="Smlt0233"
FT                   /product="putative cyclic nucleotide-binding and GGDEF
FT                   domain regulator"
FT                   /note="similarity:fasta; with=UniProt:Q3BZ16
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; Putative cyclic nucleotide-binding
FT                   protein.; length=352; id 56.897%; ungapped id 57.558%;
FT                   E()=1.2e-75; 348 aa overlap; query 1-346; subject 1-346"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0233"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43840"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI52"
FT                   /protein_id="CAQ43840.1"
FT                   /translation="MTGRGAAENSDVTSGIARVAMAEIVHALLSDAEVALFARFARPRK
FT                   LHAGQWLFQRGHRGERMYVILEGQIELDFGEDLVIKTLGQQEFFGELGLLVGDHPRSAS
FT                   ARALVDCEVLELGPADFHRLVESDPGLVAYFLRRTIMRVLTNEQALISQLRRRNHDLET
FT                   ALDNLYITTHQLTHTRELVRTDELTGLHNRRGLTLYLQECRADGSGLPQALLLIDCDRF
FT                   KQINDRHGHQAGDRVLQSMGNILRSMAGEQDLACRLGGDEFCLILRRGNYEIVQHAAEF
FT                   ILSAVHGLLERSHGTPHVSLVSIGASLLDPDAGWSEWYASADRALYQAKRDGGNCLRWA
FT                   DAVDSP"
FT   misc_feature    246538..246801
FT                   /locus_tag="Smlt0233"
FT                   /note="HMMPfam hit to PF00027, Cyclic nucleotide-binding
FT                   domain, score 5.1e-22"
FT                   /inference="protein motif:HMMPfam:PF00027"
FT   repeat_region   246724..246731
FT                   /rpt_unit_seq="(gc)4"
FT   misc_feature    246943..247419
FT                   /locus_tag="Smlt0233"
FT                   /note="HMMPfam hit to PF00990, GGDEF domain, score 1.1e-45"
FT                   /inference="protein motif:HMMPfam:PF00990"
FT   CDS_pept        247470..250007
FT                   /transl_table=11
FT                   /locus_tag="Smlt0234"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q3BZ15
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; Putative membrane protein.; length=837; id
FT                   50.613%; ungapped id 50.988%; E()=4e-144; 816 aa overlap;
FT                   query 7-819; subject 13-825"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0234"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43841"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR030966"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI53"
FT                   /protein_id="CAQ43841.1"
FT                   /translation="MNGDNGTSAPHNQQLRALLFTDLCDSLLLVERIGDVAAAELFQEH
FT                   DRLVLALQQRWNGQLIDRSDGLFMLFERPIDALGFALDYQRGLQPLGQRHEIHLQARAG
FT                   LHVGDVLTWENSAEAVRAGAKAIEVEGLAKPTAARLMQLARPGQILLSAVAESIVRRSS
FT                   GSLGAMAEGLQWRSFGRWRFKGVSQPAEVYGVQAAGMPAPGRLRHTAKARRDLPLWRRP
FT                   LAMAAQAAVLLAAVLGVWLLTRPQPAIAFAERDWVVLGGLHNLTGNRLLDDALDQAFRI
FT                   SLEQSRYVNVVSDDRVSRTLEMMRKPPDRGVRERGDAAAVAVRTGARLVFVPSATDVGG
FT                   RTRFSVEVLEPSTLRTLAVVSADAKAGAVLAAVDDVSRQLRDRLGEEPALIQRDSQSLP
FT                   EVTTGSMDALRAFALGQKRYSRGDFNGAMAFFGQAIEVDPEFALAWLGQARCRFAMMNY
FT                   RDARRLLAEADRRSGHLTPRERLYVQNWALQISDPDRATDGWARMAELYPDYMPASYNA
FT                   GLNLFHENRLAEALALSRRVAQSRVELPEIAQDQYGRALLASERYAEADIAFSRAAGNG
FT                   WEGALMRQATVAAARSEFEKANALLARIDPGNFHAGNFATTIALDQGDVEGAIKLAEQG
FT                   RMLAGQRQGMDRYNFDMPLAVAYMMAGRRSKALMVARVAATAPFAELSGEPAVEVVDRL
FT                   VAAHAAALLALRLGDAAPAKAVQARMNALQDLPDSSVLRQYVTLLAGRMMQHEGRPQAG
FT                   LDLLVPLLKKQPRLQVRLAVRDLALEAGLKDVAQEQTRWLRDRPGFAYAEAQCSFCLQA
FT                   LNVVDVRRLMAAPAIEAADTMASMPQRSVRGEP"
FT   repeat_region   248028..248039
FT                   /rpt_unit_seq="(agcc)3"
FT   misc_feature    248691..248792
FT                   /locus_tag="Smlt0234"
FT                   /note="HMMPfam hit to PF07719, Tetratricopeptide repeat,
FT                   score 0.0027"
FT                   /inference="protein motif:HMMPfam:PF07719"
FT   CDS_pept        250456..251598
FT                   /transl_table=11
FT                   /locus_tag="Smlt0236"
FT                   /product="putative processing protein"
FT                   /note="Codons 70 to 355 are similar to codons 75 to 365 of
FT                   Rhizobium leguminosarum bv. trifolii. tfxb UniProt:P42724
FT                   (EMBL:L06719 (373 aa) fasta scores: E()=5e-06, 24.579% id
FT                   in 297 aa, and similar to entire protein of Xanthomonas
FT                   campestris pv. vesicatoria (strain 85-10). hypothetical
FT                   protein. UniProt:Q3BZ13 (EMBL:AM039952 (386 aa) fasta
FT                   scores: E()=1.6e-90, 61.538% id in 377 aa"
FT                   /note="similarity:fasta; with=UniProt:P42724
FT                   (EMBL:L06719;); Rhizobium leguminosarum bv. trifolii.;
FT                   tfxB; Trifolitoxin-processing protein tfxB.; length=373; id
FT                   24.579%; ungapped id 26.740%; E()=5e-06; 297 aa overlap;
FT                   query 69-350; subject 74-361"
FT                   /note="similarity:fasta; with=UniProt:Q3BZ13
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; Hypothetical protein.; length=386; id
FT                   61.538%; ungapped id 62.534%; E()=1.6e-90; 377 aa overlap;
FT                   query 1-374; subject 10-383"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0236"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43842"
FT                   /db_xref="GOA:B2FI54"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR020051"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR030965"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI54"
FT                   /protein_id="CAQ43842.1"
FT                   /translation="MVQPTEQIRFEFEGLLRGGDGLVRTLAWEALAPHLDGPVVLDAAA
FT                   QALLGSLSPSAWTTLEAGEACSPAMDLLIASGLVLTRGQDDDVAARDERLRATHWHPLA
FT                   AVMHAFSRWEDVDAVRNMRESQIETASQMRRTLGPPPPHAAAADAGLVPLPPQQSNDFD
FT                   ALLARRVTCRNFDVTRSLPLSLLSQMLQRAFGSSSCQREGDDLVFLKKNVPSGGGLHPV
FT                   EAYVLVRNVDGLAAGMYLYRAQGHGLMPVDCPVAIDRDFVMSMVGQQHWFADAHVLVVL
FT                   APRFNRTYWKYRQHGKSYRVVAMEAGHLSQTLYLAATDAGLGAFITAAINEKPIERALG
FT                   LDTINEGVLAVCGFGWRASRMTTSELDPAGTIWNLEDRAG"
FT   CDS_pept        complement(251620..253635)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0237"
FT                   /product="putative biotin carboxylase"
FT                   /note="similarity:fasta; with=UniProt:Q3BZ11
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; accC; Biotin carboxylase (EC 6.3.4.14).;
FT                   length=675; id 70.118%; ungapped id 70.958%; E()=8.5e-169;
FT                   676 aa overlap; query 1-671; subject 1-673"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0237"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43843"
FT                   /db_xref="GOA:B2FI55"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI55"
FT                   /protein_id="CAQ43843.1"
FT                   /translation="MTEHAPMKPVAMFTKVLIANRGEIACRVIATCRRLGIATVAVYSD
FT                   ADRNARHVRLADEAIHIGPAAARESYLRGDALLDAARTTGAQAIHPGYGFLSENADFAD
FT                   ACAAAGITFIGPPASAIRAMGDKSAAKALMAKAGVPLPPGYHGDQQAPDFLRTQADAIG
FT                   YPVLIKASAGGGGKGMRKVERSEDFVDALASCQREAASAFGNDHVLVEKYVERPRHIEI
FT                   QVFGDSHGDAVYLFERDCSVQRRHQKVLEEAPAPGMSAERRAAMGKAAVDAARAVGYEG
FT                   AGTVEFIAGPDGDFYFMEMNTRLQVEHPVTEYITGTDLVEWQLRVASGQPLPLRQEQLA
FT                   IHGHAIEARLYAEDADRGFLPSTGTLRRLRLPIPSAHVRVDTGVEEGDSITPYYDPMIA
FT                   KLIVWDVDRDAALRRMSQALADCQVVGVTTNAGFLRRLVNTDSFAHARLDTALIEREQA
FT                   ALSAVGDTDDALWQLAAVAAVAGTAGASTDARDPHSPWQAQDGWRLGASAPRVLPLQQG
FT                   ERKHTLKVWAQADGWRVQRDDAAPVQVIGTADAQHLTVQLGERRWSLQLLRDGDQLYLF
FT                   GADGQHRFTLHDPVGESDHAVADAGSLLAPMPGKIVATLVAAGTEVKRGTPLVVLEAMK
FT                   MEHTLQAPADGTVKGYRAKAGDQVGDGAVLVDFEAA"
FT   misc_feature    complement(251632..251835)
FT                   /locus_tag="Smlt0237"
FT                   /note="HMMPfam hit to PF00364, Biotin-requiring enzyme,
FT                   score 1.7e-18"
FT                   /inference="protein motif:HMMPfam:PF00364"
FT   repeat_region   252165..252172
FT                   /rpt_unit_seq="(cg)4"
FT   misc_feature    complement(252274..252597)
FT                   /locus_tag="Smlt0237"
FT                   /note="HMMPfam hit to PF02785, Biotin carboxylase
FT                   C-terminal domain, score 5.6e-47"
FT                   /inference="protein motif:HMMPfam:PF02785"
FT   misc_feature    complement(252616..253260)
FT                   /locus_tag="Smlt0237"
FT                   /note="HMMPfam hit to PF02786, Carbamoyl-phosphate synthase
FT                   L chain,, score 1.8e-101"
FT                   /inference="protein motif:HMMPfam:PF02786"
FT   misc_feature    complement(252727..253263)
FT                   /locus_tag="Smlt0237"
FT                   /note="HMMPfam hit to PF01071, Phosphoribosylglycinamide
FT                   synthetase,, score 0.0012"
FT                   /inference="protein motif:HMMPfam:PF01071"
FT   misc_feature    complement(252727..253260)
FT                   /locus_tag="Smlt0237"
FT                   /note="HMMPfam hit to PF02222, ATP-grasp domain, score
FT                   0.0025"
FT                   /inference="protein motif:HMMPfam:PF02222"
FT   repeat_region   252808..252817
FT                   /rpt_unit_seq="(cg)5"
FT   misc_feature    complement(253264..253602)
FT                   /locus_tag="Smlt0237"
FT                   /note="HMMPfam hit to PF00289, Carbamoyl-phosphate synthase
FT                   L chain,, score 2.8e-48"
FT                   /inference="protein motif:HMMPfam:PF00289"
FT   CDS_pept        complement(253644..255254)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0238"
FT                   /product="putative acyl CoA carboxyltransferase"
FT                   /note="similarity:fasta; with=UniProt:Q8PDU0
FT                   (EMBL:AE012121;); Xanthomonas campestris pv. campestris.;
FT                   accD; Acyl-CoA carboxyltransferase beta chain.; length=536;
FT                   id 88.806%; ungapped id 88.806%; E()=3.7e-186; 536 aa
FT                   overlap; query 1-536; subject 1-536"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0238"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43844"
FT                   /db_xref="GOA:B2FI56"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI56"
FT                   /protein_id="CAQ43844.1"
FT                   /translation="MTVLNSQLQPGSDTFEANRAAMQAVVDDLHATLARTALGGSEAAR
FT                   AKHTARGKLLVRDRIDALLDPGSAFLEIAPLAAHGMYEDAVPAAGVVAGIGRVSGVECV
FT                   IVANDATVKGGTYYPMTVKKHLRAQEIAEQNHLPCIYLVDSGGAFLPLQDEVFPDRDHF
FT                   GRIFYNQANLSAQGIPQIACVMGSCTAGGAYVPAMSDETVIVREQGTIFLGGPPLVKAA
FT                   TGEVVTAEELGGADVHTRISGVADHMADNDLQALARVRAIIAQLNWRKPEPAMAVQASE
FT                   EPLLPAHELYGVIPADTRKPYDVREVIARLVDGSRFDEFKPRYGATLVTGFAHLNGYPI
FT                   GIIANNGILFSESALKGAHFIELCTQRNIPLVFLQNITGFMVGRKYEQGGIAKDGAKLV
FT                   MAVACARVPKFTVVIGGSFGAGNYGMCGRAYSPNFLWMWPNARIGVMGGEQAASVLATV
FT                   KRDGIEAKGGQWPAAEEDAFKAPIRDQFEQQGHPYYASARLWDDGVIDPADTRRVLALA
FT                   LSASLNAAPQQTRFGVFRM"
FT   misc_feature    complement(253653..255131)
FT                   /locus_tag="Smlt0238"
FT                   /note="HMMPfam hit to PF01039, Carboxyl transferase domain,
FT                   score 1.5e-221"
FT                   /inference="protein motif:HMMPfam:PF01039"
FT   repeat_region   253761..253768
FT                   /rpt_unit_seq="(gc)4"
FT   repeat_region   254870..254877
FT                   /rpt_unit_seq="(gc)4"
FT   repeat_region   255118..255125
FT                   /rpt_unit_seq="(gc)4"
FT   CDS_pept        complement(255265..256428)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0239"
FT                   /product="putative acyl CoA dehydrogenase"
FT                   /note="similarity:fasta; with=UniProt:Q3BZ09
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; acdA; Acyl-CoA dehydrogenase.; length=387;
FT                   id 84.974%; ungapped id 84.974%; E()=1e-127; 386 aa
FT                   overlap; query 1-386; subject 1-386"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0239"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43845"
FT                   /db_xref="GOA:B2FI57"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR034183"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI57"
FT                   /protein_id="CAQ43845.1"
FT                   /translation="MHVPSLNFDLGEDIDLLRQSVAHFAAAEVAPLAAEADASNQFPLA
FT                   LWPKLGEQGLLGLTVEEAYGGTGMGYLAHVVAMEEISRASGGIGLSYGAHSNLCVNQLR
FT                   KNGNEEQKQRFLPGLCDGSLVGALAMSEPGAGSDVVSMKLRADKRGDRYVLNGNKMWIT
FT                   NGPDADVLVVYAKTDMDAGAKGITAFLVEKGMKGFSTSQKLDKLGMRSSPTCELVFQDC
FT                   EVPEENVLGQVGGGVRVLMSGLDYERVVLSGGPLGLMAAAMDVVMPYVHERHQFGEAIG
FT                   SFQLIQAKIADMYVGLGACRAYVYAVARACDQGRTTRQDAAGAILYAAEKATWLTGQAI
FT                   QILGGNGYINEYPTGRLWRDAKLYEIGAGTSEIRRMLIGRELFQRTL"
FT   misc_feature    complement(255280..255729)
FT                   /locus_tag="Smlt0239"
FT                   /note="HMMPfam hit to PF00441, Acyl-CoA dehydrogenase,
FT                   C-terminal doma, score 1.8e-53"
FT                   /inference="protein motif:HMMPfam:PF00441"
FT   misc_feature    complement(255313..255684)
FT                   /locus_tag="Smlt0239"
FT                   /note="HMMPfam hit to PF08028, Acyl-CoA dehydrogenase,
FT                   C-terminal doma, score 1.6e-06"
FT                   /inference="protein motif:HMMPfam:PF08028"
FT   repeat_region   255500..255507
FT                   /rpt_unit_seq="(gc)4"
FT   misc_feature    complement(255895..256050)
FT                   /locus_tag="Smlt0239"
FT                   /note="HMMPfam hit to PF02770, Acyl-CoA dehydrogenase,
FT                   middle domain, score 2.4e-28"
FT                   /inference="protein motif:HMMPfam:PF02770"
FT   misc_feature    complement(256060..256398)
FT                   /locus_tag="Smlt0239"
FT                   /note="HMMPfam hit to PF02771, Acyl-CoA dehydrogenase,
FT                   N-terminal doma, score 1e-41"
FT                   /inference="protein motif:HMMPfam:PF02771"
FT   CDS_pept        256589..257197
FT                   /transl_table=11
FT                   /locus_tag="Smlt0240"
FT                   /product="putative TetR family transcriptional regulator"
FT                   /note="similarity:fasta; with=UniProt:Q4V029
FT                   (EMBL:CP000050;); Xanthomonas campestris pv. campestris
FT                   (strain 8004).; Transcriptional regulator acrR family.;
FT                   length=205; id 70.297%; ungapped id 70.297%; E()=7.8e-48;
FT                   202 aa overlap; query 1-202; subject 1-202"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0240"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43846"
FT                   /db_xref="GOA:B2FI58"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI58"
FT                   /protein_id="CAQ43846.1"
FT                   /translation="MAYKRSALMEERLAGARERILLATRELVATGGWRNAPVTAVATQA
FT                   GVSTGLIYRHFPSKAELFVEVLNAAVAHEVAIMERIASGPEVASERLRLAITAFVRRAL
FT                   AGPGLAHAFIVEPVDPDVEAERMRGRRAFGDVFLRLVEEGVAAGELPAQDAHVAAACLV
FT                   GAFTEAMVGPTAPSREAHRDEDALVDAICSFCLRAIGAR"
FT   misc_feature    256646..256786
FT                   /locus_tag="Smlt0240"
FT                   /note="HMMPfam hit to PF00440, Bacterial regulatory
FT                   proteins, tetR family, score 3.5e-14"
FT                   /inference="protein motif:HMMPfam:PF00440"
FT   repeat_region   complement(257233..257275)
FT                   /rpt_family="R=8"
FT                   /inference="nucleotide motif:RepeatScout"
FT   CDS_pept        257402..257920
FT                   /transl_table=11
FT                   /locus_tag="Smlt0241"
FT                   /product="putative transmembrane-anchored cytochrome c"
FT                   /note="similarity:fasta; with=UniProt:P00123; Chlorobium
FT                   limicola f.sp. thiosulfatophilum.; Cytochrome c-555
FT                   (Cytochrome c555).; length=86; id 41.463%; ungapped id
FT                   42.500%; E()=2.9e-07; 82 aa overlap; query 92-172; subject
FT                   6-86"
FT                   /note="similarity:fasta; with=UniProt:Q3BZ01
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; Putative cytochrome c precursor.;
FT                   length=172; id 84.884%; ungapped id 84.884%; E()=4.4e-54;
FT                   172 aa overlap; query 1-172; subject 1-172"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0241"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43847"
FT                   /db_xref="GOA:B2FI59"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI59"
FT                   /protein_id="CAQ43847.1"
FT                   /translation="MRNYDLEFLKRFSMVIALLATITLGLILLAAYIHTRIPPEVSPTA
FT                   AKRTEQRISPTGAVYAGSTGAAAQAAAKAAALAKAASQVAYGGTKDGKVIFDNLCTACH
FT                   TTGVGMAPTLDHSHWDKRIAQGKDTLYKHAIEGYTGPDGGIMPPKGGNPALTEEQIHAT
FT                   VDWMLGNLK"
FT   sig_peptide     257402..257491
FT                   /locus_tag="Smlt0241"
FT                   /note="Signal peptide predicted for Smlt0241 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.912) with cleavage site
FT                   probability 0.509 between residues 30 and 31"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    257435..257503
FT                   /locus_tag="Smlt0241"
FT                   /note="1 probable transmembrane helix predicted for
FT                   Smlt0241 by TMHMM2.0 at aa 12-34"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    257666..257914
FT                   /locus_tag="Smlt0241"
FT                   /note="HMMPfam hit to PF00034, Cytochrome c, score 2.9e-06"
FT                   /inference="protein motif:HMMPfam:PF00034"
FT   CDS_pept        257964..259676
FT                   /transl_table=11
FT                   /locus_tag="Smlt0242"
FT                   /note="C-terminus is similar to the C-terminus of
FT                   Xanthomonas axonopodis pv. citri. nuclease. UniProt:Q8PQP8
FT                   (EMBL:AE011652 (609 aa) fasta scores: E()=2.4e-110, 64.155%
FT                   id in 438 aa"
FT                   /note="similarity:fasta; with=UniProt:Q8PQP8
FT                   (EMBL:AE011652;); Xanthomonas axonopodis pv. citri.;
FT                   Nuclease.; length=609; id 64.155%; ungapped id 64.450%;
FT                   E()=2.4e-110; 438 aa overlap; query 131-568; subject
FT                   172-607"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0242"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43848"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI60"
FT                   /protein_id="CAQ43848.1"
FT                   /translation="MERPNGMAEPREGGRVDCWSTALPNATEKARAARDSRLTVDSTRR
FT                   SPQSPRSFSVCRRRLCRPRPKPRASLGFRISRLVCAPLPWSRPSMRRRSLALALSLLLP
FT                   AGAFAQAQPQAAPAASPSAARSSATVVLTAAPADWRALDGQRVRIAAPLTLAGTDGLER
FT                   FGQLTVAFDGRLWQPTEVATPGTAGYEQVRADNQRRRLVLEDGSDARDPASVAYLPGNP
FT                   VLRTGMQLRDVQGIVRMDAQGHPRLQVEGALKLPELKRPAVPTVPGNLHVAAFNLENFF
FT                   NGDGQGGGFPTLRGARTLEEHKAQVAKLVTTVNALGADVAALMELENDGYGPQSAIAEL
FT                   VDALNRDRGAQGDWRFVDAGNGPGDNPIRVGIIYRSARLQPVGKPATLTGGPFVEHSRV
FT                   PLAQAFQGKQGAPFVVVANHFKSKGCRDAAGADADHNDNQGCWNATRVTSAQQLHAWLQ
FT                   TDPTGTGAKDAVLLGDFNAYAMEDPIRTLHDLGWQDAFKVAKVEHPYSYVYNGYTGRLD
FT                   HALLSPGMAKRLRGAAEWHSNADEQDASGYQGRNVQGPWRSSDHDPLLLGFDR"
FT   repeat_region   complement(258003..258092)
FT                   /rpt_family="R=0"
FT                   /inference="nucleotide motif:RepeatScout"
FT   repeat_region   258163..258170
FT                   /rpt_unit_seq="(cg)4"
FT   misc_feature    258771..259667
FT                   /locus_tag="Smlt0242"
FT                   /note="HMMPfam hit to PF03372,
FT                   Endonuclease/Exonuclease/phosphatase fa, score 5.5e-17"
FT                   /inference="protein motif:HMMPfam:PF03372"
FT   repeat_region   259090..259097
FT                   /rpt_unit_seq="(gc)4"
FT   repeat_region   259747..259940
FT                   /rpt_family="R=9"
FT                   /inference="nucleotide motif:RepeatScout"
FT   CDS_pept        complement(259979..260839)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0244"
FT                   /product="putative transmembrane protein"
FT                   /note="similarity:fasta; with=UniProt:Q4V017
FT                   (EMBL:CP000050;); Xanthomonas campestris pv. campestris
FT                   (strain 8004).; Integral membrane protein.; length=293; id
FT                   59.375%; ungapped id 60.000%; E()=1.5e-51; 288 aa overlap;
FT                   query 1-286; subject 3-289"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0244"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43849"
FT                   /db_xref="GOA:B2FI61"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI61"
FT                   /protein_id="CAQ43849.1"
FT                   /translation="MLYLSLAVICSVLVSVLLKVAGRRQLDVSQMVTWNYLVAATLTAL
FT                   VLRPPLDALRAPHAPWLSLLALAAVLPSIFLVLGRAVAVAGIVRSDVAQRLSLLLSLAA
FT                   AFLFFGQTATPWKLAGLGLGLLAMMAISLRPPRGPAVASSPGGWGWLLAVWAGFAVVDV
FT                   LLKQVALSGTPSMAAVLASFSVAFVLMLALQLWRHASGRSRLAWRNLGAGALLGLLNGG
FT                   NILFYVHAHQSMPDNPATVFAGMNIGVVVLGALVGVFAFGEATTRWNRAGLALAVLAIG
FT                   LIAWG"
FT   misc_feature    complement(order(259985..260038,260057..260125,
FT                   260153..260212,260249..260317,260345..260398,
FT                   260435..260488,260501..260554,260591..260659,
FT                   260687..260740,260777..260830))
FT                   /locus_tag="Smlt0244"
FT                   /note="10 probable transmembrane helices predicted for
FT                   Smlt0244 by TMHMM2.0 at aa 4-21, 34-51, 61-83, 96-113,
FT                   118-135, 148-165, 175-197, 210-229, 239-261 and 268-285"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(260441..260815)
FT                   /locus_tag="Smlt0244"
FT                   /note="HMMPfam hit to PF00892, Integral membrane protein
FT                   DUF6, score 0.0021"
FT                   /inference="protein motif:HMMPfam:PF00892"
FT   repeat_region   260671..260678
FT                   /rpt_unit_seq="(gc)4"
FT   CDS_pept        260883..261554
FT                   /transl_table=11
FT                   /locus_tag="Smlt0245"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q8PDS5
FT                   (EMBL:AE012122;); Xanthomonas campestris pv. campestris.;
FT                   Hypothetical protein XCC0260.; length=220; id 73.733%;
FT                   ungapped id 73.733%; E()=2e-64; 217 aa overlap; query
FT                   5-221; subject 2-218"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0245"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43850"
FT                   /db_xref="GOA:B2FI62"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI62"
FT                   /protein_id="CAQ43850.1"
FT                   /translation="MHKHSFPVAPGETACLELDGPAGPLEVVVDLPKADAPVQPIVAII
FT                   CHPLSTEGGTLHNKVVTMTATTLRELGIATVRFNFRSVGGSAGEFDHGVGEQDDLKAVA
FT                   AWVRSQRPDDRLWLAGFSFGAFVSLKAAAELQPEALISIAPPAGRWDFDGIAPPARWLV
FT                   IQGEQDEIVDPQAVYQWLDSLDFPHELVRMPETSHFFHRKLIDLRGALTHGVKHWLGAA
FT                   A"
FT   repeat_region   261317..261328
FT                   /rpt_unit_seq="(gccg)3"
FT   CDS_pept        261560..262651
FT                   /transl_table=11
FT                   /locus_tag="Smlt0246"
FT                   /product="putative ATPase"
FT                   /note="similarity:fasta; with=UniProt:Q3BYZ4
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; Putative ATPase.; length=364; id 86.464%;
FT                   ungapped id 86.464%; E()=3.2e-128; 362 aa overlap; query
FT                   2-363; subject 3-364"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0246"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43851"
FT                   /db_xref="GOA:B2FI63"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI63"
FT                   /protein_id="CAQ43851.1"
FT                   /translation="MELTPSQRYAEGVARGDWQNDPAQHAALAELDRIHLGLLDSAEDG
FT                   WLDRLSSFWKKPEPVKGLYFWGGVGRGKTFLVDLFYDGLPIKQKYRTHFHRFMRSVHER
FT                   LREHQGQSDPLAKIAQEWRSNLRVLVLDEFFVTDIGDAMLLARLLERLFAEGVTLVTTS
FT                   NTAVENLYLNGLQRESFLPAIGLLQRFCVELYAEGTEDYRMRALTRSPVYRAPLAADSD
FT                   EWLATRWNELSGGQPAKPGNIEIEGRKIPVRGRGKSIAWFDFAALCEGPRGPSDYIEIA
FT                   HEFNTVLLGGIPAFDRLNEDAARRFVNLIDELYDRHVNLVCTASTSPVELYTGQRLQGA
FT                   FERTASRLIEMQSAEYLGTPHRA"
FT   misc_feature    261566..262639
FT                   /locus_tag="Smlt0246"
FT                   /note="HMMPfam hit to PF03969, AFG1-like ATPase, score
FT                   2.3e-146"
FT                   /inference="protein motif:HMMPfam:PF03969"
FT   repeat_region   262171..262178
FT                   /rpt_unit_seq="(gc)4"
FT   CDS_pept        263359..265686
FT                   /transl_table=11
FT                   /gene="RRM1"
FT                   /locus_tag="Smlt0247"
FT                   /product="putative ribonucleoside-diphosphate reductase
FT                   large subunit"
FT                   /EC_number="1.17.4.1"
FT                   /note="similarity:fasta; with=UniProt:P23921
FT                   (EMBL:AF107045;); Homo sapiens (Human).; RRM1;
FT                   Ribonucleoside-diphosphate reductase large subunit (EC
FT                   1.17.4.1) (Ribonucleoside-diphosphate reductase M1 subunit)
FT                   (Ribonucleotide reductase large chain).; length=792; id
FT                   42.642%; ungapped id 44.083%; E()=1.4e-126; 795 aa overlap;
FT                   query 1-774; subject 1-790"
FT                   /note="similarity:fasta; with=UniProt:Q1D2B1
FT                   (EMBL:CP000113;); Myxococcus xanthus (strain DK 1622).;
FT                   Ribonucleoside-diphosphate reductase, alpha subunit (EC
FT                   1.17.4.1).; length=785; id 74.427%; ungapped id 75.581%;
FT                   E()=0; 786 aa overlap; query 1-775; subject 1-785"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0247"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43852"
FT                   /db_xref="GOA:B2FI64"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI64"
FT                   /protein_id="CAQ43852.1"
FT                   /translation="MSVTKRNGTTELVDLNKIVRAVQRSSEGLHAVDPMRVATRTISGL
FT                   YNGATTRELDELSIRTAALLIGEEPEYGRLAARLLANYIAKEVSGQEIYAFSQSVSRGH
FT                   EVGLINDRLLNFVQTNARKLNDAIDISLDLNFDYFGLRTLYDRYLLRHPHTRKVIETPQ
FT                   QFFLRIASALSEDVSETLALYKRMGNLDYLPSSPTLFNSGTTHEQLSSCFLLDSPQDSL
FT                   ESIYSKYGDIAQLSKFSGGIGVSYTRVRSRGSLIKSTNGHSNGIVPWLKTMDSSVAAVN
FT                   QGGKRKGAACVYLETWHADIEDFLELRDNTGDEARRAHNLNLANWVPDLFMKRVEADQE
FT                   WSLFDPRVVPEFTDLFGEAFEAAYLQAEAQGKANRTISARKLYARMMRTLAETGNGWMT
FT                   FKDKCNRASNQTLRPGNVIHLSNLCTEILEVTSNDETAVCNLGSINLGNHFDEHNEFDF
FT                   EKLAETVRLAVRQLDRVIDLNFYPIETARRANLRWRPVGLGCMGLQDVFFRKRLPFDSA
FT                   EARALSKKIAEAIYFHALETSCELAQERGKHPSFNDTRAASGELQFDAWNVVPEDTARW
FT                   DALRSRIKEHGLRNSLMIAIAPTATIASIAGCYECVEPQVSNLFKRETLSGDFLQVNRY
FT                   LVNELKKLGLWTPEMRDAIKLAEGSIAGVAQIPETLREVYRTAWELPMRSLIDMAAERG
FT                   AFIDQSASLNLFMESPNIGAMSSMYMYAWKQGIKTTYYLRSRPATKIAKTTVSAAAPAK
FT                   VFSPDEAIACSLENPEACEACQ"
FT   misc_feature    263359..263625
FT                   /gene="RRM1"
FT                   /locus_tag="Smlt0247"
FT                   /note="HMMPfam hit to PF03477, ATP cone domain, score
FT                   4.4e-08"
FT                   /inference="protein motif:HMMPfam:PF03477"
FT   misc_feature    263758..263979
FT                   /gene="RRM1"
FT                   /locus_tag="Smlt0247"
FT                   /note="HMMPfam hit to PF00317, Ribonucleotide reductase,
FT                   all-alpha d, score 1.6e-23"
FT                   /inference="protein motif:HMMPfam:PF00317"
FT   misc_feature    263983..265569
FT                   /gene="RRM1"
FT                   /locus_tag="Smlt0247"
FT                   /note="HMMPfam hit to PF02867, Ribonucleotide reductase,
FT                   barrel doma, score 1.3e-226"
FT                   /inference="protein motif:HMMPfam:PF02867"
FT   CDS_pept        265830..266849
FT                   /transl_table=11
FT                   /locus_tag="Smlt0248"
FT                   /product="putative ribonucleotide diphosphate reductase,
FT                   small chain"
FT                   /note="similarity:fasta; with=UniProt:Q6MLM4
FT                   (EMBL:BX842651;); Bdellovibrio bacteriovorus.; nrdB;
FT                   Ribonucleotide-diphosphate reductase small chain (EC
FT                   1.17.4.1).; length=336; id 71.084%; ungapped id 71.084%;
FT                   E()=2.1e-97; 332 aa overlap; query 8-339; subject 5-336"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0248"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43853"
FT                   /db_xref="GOA:B2FI65"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI65"
FT                   /protein_id="CAQ43853.1"
FT                   /translation="MADKPKQMLLDPGFELTLRPMRYPQFYDMYRNAIKNTWTVEEINF
FT                   QIDITDLHSKMSPGERHLIHRLVAFFATGDSIVSNNLVLNLYQHLNAPEARMYLSRQLY
FT                   EEALHVQFYLTLLDNYLPDPEERAKAFSAVENIDSIKKKADFCFKWIDSIQSLTRIETR
FT                   EQRRQFLLNQICFAACIEGLFFFAAFAYVYYFRSRGLLPGLASGTNWVFRDESAHMEFA
FT                   FESVRVVREEEPDLFDEEMKQQVYDMLAEAIECEVQFAEDVLSGGVAGISTRDMRQYLQ
FT                   HCADQHFAKLGMEKKYNVRNPLPFMELQDVQELTNFFERRVSAYQVGVQGEVAFDMNF"
FT   misc_feature    265845..266750
FT                   /locus_tag="Smlt0248"
FT                   /note="HMMPfam hit to PF00268, Ribonucleotide reductase,
FT                   small chain, score 2.4e-48"
FT                   /inference="protein motif:HMMPfam:PF00268"
FT   misc_feature    266334..266402
FT                   /locus_tag="Smlt0248"
FT                   /note="1 probable transmembrane helix predicted for
FT                   Smlt0248 by TMHMM2.0 at aa 169-191"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        267092..267472
FT                   /transl_table=11
FT                   /locus_tag="Smlt0249"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to the N-terminus to codon 130 of Vibrio
FT                   vulnificus (strain yj016). proton/glutamate symporter.
FT                   UniProt:Q7MFU9 (EMBL:BA000038 (434 aa) fasta scores:
FT                   E()=3.2, 26.154% id in 130 aa"
FT                   /note="similarity:fasta; with=UniProt:Q7MFU9
FT                   (EMBL:BA000038;); Vibrio vulnificus (strain YJ016).;
FT                   Proton/glutamate symporter.; length=434; id 26.154%;
FT                   ungapped id 27.642%; E()=3.2; 130 aa overlap; query 1-124;
FT                   subject 1-129"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0249"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43854"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI66"
FT                   /protein_id="CAQ43854.1"
FT                   /translation="METAVPGTATRRTVFRGWTGGLFAVLVACPSLAHGTNCDSKVTNV
FT                   SIDASGKVFVATTVSPIHAVCNIVSKGDFSMPPEVCKATYAMLMSAKVSAIPIRLYYTS
FT                   VPQCGDIKAWSAQPSFYHAELF"
FT   CDS_pept        complement(267512..268147)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0250"
FT                   /product="putative transmembrane LysE family efflux
FT                   transporter"
FT                   /note="similarity:fasta; with=UniProt:Q1IBV7
FT                   (EMBL:CT573326;); Pseudomonas entomophila L48.; Putative
FT                   transporter, LysE family.; length=210; id 79.147%; ungapped
FT                   id 79.524%; E()=1.4e-56; 211 aa overlap; query 1-211;
FT                   subject 1-210"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0250"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43855"
FT                   /db_xref="GOA:B2FI67"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI67"
FT                   /protein_id="CAQ43855.1"
FT                   /translation="MPATSDLLAFALVSLAMVLTPGPNMIYVISRSICQGPMAGLISLG
FT                   GVALGFVFYMLCAALGITALLMTVPFAYDALRIGGALYLLYLAWQALKPGGRSPFAVRE
FT                   LPQDSPRKLFTMGFLTNLLNPKVAVMYLSLLPQFLHPDSEGSVLMQSIVLGSTQILVSV
FT                   SVNGMIALTAGSIAGFLAARPTWQMVQRWLMGAVLAGLAVRMAVEGRR"
FT   misc_feature    complement(267521..268105)
FT                   /locus_tag="Smlt0250"
FT                   /note="HMMPfam hit to PF01810, LysE type translocator,
FT                   score 2.7e-29"
FT                   /inference="protein motif:HMMPfam:PF01810"
FT   misc_feature    complement(order(267605..267673,267731..267799,
FT                   267950..268018,268061..268129))
FT                   /locus_tag="Smlt0250"
FT                   /note="4 probable transmembrane helices predicted for
FT                   Smlt0250 by TMHMM2.0 at aa 7-29, 44-66, 117-139 and
FT                   159-181"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        268300..268701
FT                   /transl_table=11
FT                   /locus_tag="Smlt0251"
FT                   /product="putative thioesterase"
FT                   /note="similarity:fasta; with=UniProt:Q8P3T7
FT                   (EMBL:AE012518;); Xanthomonas campestris pv. campestris.;
FT                   Hypothetical protein XCC3982.; length=133; id 81.203%;
FT                   ungapped id 81.203%; E()=3.3e-39; 133 aa overlap; query
FT                   1-133; subject 1-133"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0251"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43856"
FT                   /db_xref="GOA:B2FI68"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI68"
FT                   /protein_id="CAQ43856.1"
FT                   /translation="MTPIPETVPPIEVRMAEIVFPNHTNHLGTLFGGQALAWMDKAAFL
FT                   AAARYSRRTVVTARSDQVDFKLPIRIGQMVETIGRIVEVGRSSMKVEVELVAEDLHSGE
FT                   RKLCTRGHFVMIALDEEGHPIAVPPLPAA"
FT   misc_feature    268378..268611
FT                   /locus_tag="Smlt0251"
FT                   /note="HMMPfam hit to PF03061, Thioesterase superfamily,
FT                   score 7e-20"
FT                   /inference="protein motif:HMMPfam:PF03061"
FT   CDS_pept        268757..269572
FT                   /transl_table=11
FT                   /locus_tag="Smlt0252"
FT                   /product="putative SIR2 family regulatory protein"
FT                   /note="similarity:fasta; with=UniProt:Q4UZX0
FT                   (EMBL:CP000050;); Xanthomonas campestris pv. campestris
FT                   (strain 8004).; SIR2-like regulatory protein.; length=293;
FT                   id 74.717%; ungapped id 75.000%; E()=5e-74; 265 aa overlap;
FT                   query 5-268; subject 12-276"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0252"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43857"
FT                   /db_xref="GOA:B2FI69"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026587"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI69"
FT                   /protein_id="CAQ43857.1"
FT                   /translation="MSLPLTDFIDRAQRLFVLTGAGCSTASGIPDYRDSDGQWKRTPPV
FT                   TYQAFMGEAATRQRYWARSLLGWPRFGLARPNGTHQALAALESRGKLQVLLTQNVDGLH
FT                   QRAGSRNVIDLHGRLDLVRCMGCERRSGREDFQQRLLDANPGWDALEAGVAPDGDADLE
FT                   TDFSSFVVPGCPHCGGVLKPDVVFFGENVPRERVEAVHEHLQQADAVLVVGSSLMVYSG
FT                   FRFVQAAAKAGLPVAALNRGRTRADDLLQFKDERDCAEALASVIEPSAG"
FT   misc_feature    268814..269419
FT                   /locus_tag="Smlt0252"
FT                   /note="HMMPfam hit to PF02146, Sir2 family, score 1.4e-55"
FT                   /inference="protein motif:HMMPfam:PF02146"
FT   CDS_pept        269694..270794
FT                   /transl_table=11
FT                   /locus_tag="Smlt0253"
FT                   /product="putative NADH/FMN oxidoreductase"
FT                   /note="similarity:fasta; with=UniProt:Q8PQK2
FT                   (EMBL:AE011657;); Xanthomonas axonopodis pv. citri.; frp;
FT                   FMN oxidoreductase.; length=365; id 73.278%; ungapped id
FT                   73.278%; E()=7.4e-106; 363 aa overlap; query 1-363; subject
FT                   1-363"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0253"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43858"
FT                   /db_xref="GOA:B2FI70"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI70"
FT                   /protein_id="CAQ43858.1"
FT                   /translation="MSQLFSPISFGPLTLSNRIVVAPMCQYSAEDGRASDWHAMHLGNL
FT                   AQSGAGLLILEATAVEPRGRISWADLGLWDDGTEAALAQVLASVRRWSPMPLGIQLGHA
FT                   GRKASVNRPWDGGGQLPADDARGWATVAPSPLPFHAADPAPQELDEAGIAEVIAAFAAS
FT                   AVRAERLGFELIELHAAHGYLLHQFLSPLSNRRTDGYGGSLPNRLRLLVEVFDAVRAAV
FT                   SDKVAVGVRISASDWVDGGWDLVQSEALAQVLDARGCNFLHVSSGGLDERQKITVGPGY
FT                   QVPFAAAIKAKVRMPVIAVGMITEPEQAESILRHRHADAVALARGILYDPRWPWHAAAA
FT                   LRDSVEPAPQYLRCEPRDARGVFKTR"
FT   misc_feature    269700..270725
FT                   /locus_tag="Smlt0253"
FT                   /note="HMMPfam hit to PF00724, NADH:flavin oxidoreductase /
FT                   NADH oxidas, score 4.1e-68"
FT                   /inference="protein motif:HMMPfam:PF00724"
FT   repeat_region   complement(270078..270179)
FT                   /rpt_family="(CGG)n"
FT                   /inference="nucleotide motif:RepeatScout"
FT   repeat_region   270458..270465
FT                   /rpt_unit_seq="(cg)4"
FT   CDS_pept        complement(270798..271709)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0254"
FT                   /product="putative LysR family transcriptional regulator"
FT                   /note="similarity:fasta; with=UniProt:Q8PBD2
FT                   (EMBL:AE012218;); Xanthomonas campestris pv. campestris.;
FT                   Transcriptional regulator.; length=335; id 57.143%;
FT                   ungapped id 58.086%; E()=4.1e-62; 308 aa overlap; query
FT                   1-303; subject 1-308"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0254"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43859"
FT                   /db_xref="GOA:B2FI71"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI71"
FT                   /protein_id="CAQ43859.1"
FT                   /translation="MNLLQLIRSFTRTAETGSIAAAARILGISATAVGQNINRLEAHLG
FT                   VRLLNRSTRQLALSEAGALYLAQVRHIEADLARAQAMVTAGDIEPAGPLRIASSSAFGR
FT                   HVLAPLLPSLQQRYPQLQLELRLTDRAVQHGPEAVDASIRIGAQLEDGVVARQLARVPF
FT                   VFCASPAYLKAHGVPQQPSDLGGHRGLLHRFPTDGRPLRWGLLKDGQRVDAALPPSMVC
FT                   DDIDALATLAAAGAGITRLAAFVAEPYLRDGRLQAVFGADTAWRPEPMEVYFCVSDRRD
FT                   FTAKIRALFEHLQAGIAPAWRV"
FT   misc_feature    complement(270816..271451)
FT                   /locus_tag="Smlt0254"
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 3.4e-39"
FT                   /inference="protein motif:HMMPfam:PF03466"
FT   repeat_region   271472..271481
FT                   /rpt_unit_seq="(gc)5"
FT   misc_feature    complement(271521..271700)
FT                   /locus_tag="Smlt0254"
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix, score 4.3e-17"
FT                   /inference="protein motif:HMMPfam:PF00126"
FT   sig_peptide     complement(271608..271709)
FT                   /locus_tag="Smlt0254"
FT                   /note="Signal peptide predicted for Smlt0254 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.892) with cleavage site
FT                   probability 0.756 between residues 34 and 35"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        271824..272675
FT                   /transl_table=11
FT                   /locus_tag="Smlt0255"
FT                   /product="putative formyl transferase"
FT                   /note="similarity:fasta; with=UniProt:Q8PDM5
FT                   (EMBL:AE012127;); Xanthomonas campestris pv. campestris.;
FT                   purU; Formyltetrahydrofolate deformylase.; length=289; id
FT                   83.039%; ungapped id 83.039%; E()=1.1e-92; 283 aa overlap;
FT                   query 1-283; subject 7-289"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0255"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43860"
FT                   /db_xref="GOA:B2FI72"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI72"
FT                   /protein_id="CAQ43860.1"
FT                   /translation="MRPDSILTLSCPDRTGIVYRVSGLLFDHGCNILDAQQFGDEESGR
FT                   FFLRVHFDRDAGLPLETVHAAMATLAEGFGMDWQLHDGRRRARLLVLVSKQGHCLNDLL
FT                   FRAHSGQLKVDIAAVASNHADFAPLAASYQVPFHHLPVTADTRAVQEQQIIDLVERERI
FT                   DLVVLARYMQILSPTLCRALAGRAINIHHSFLPSFKGAQPYHQAHARGVKIIGATAHYV
FT                   TEDLDEGPIIEQDVARVDHAMAPRELVRLGSDTESLVLARAVRRHVEHRILLNGHRTVV
FT                   FR"
FT   misc_feature    271836..272057
FT                   /locus_tag="Smlt0255"
FT                   /note="HMMPfam hit to PF01842, ACT domain, score 1.4e-09"
FT                   /inference="protein motif:HMMPfam:PF01842"
FT   misc_feature    272082..272615
FT                   /locus_tag="Smlt0255"
FT                   /note="HMMPfam hit to PF00551, Formyl transferase, score
FT                   1.3e-41"
FT                   /inference="protein motif:HMMPfam:PF00551"
FT   repeat_region   complement(272768..272810)
FT                   /rpt_family="R=6"
FT                   /inference="nucleotide motif:RepeatScout"
FT   CDS_pept        complement(272963..273589)
FT                   /transl_table=11
FT                   /gene="pncA"
FT                   /locus_tag="Smlt0257"
FT                   /product="putative pyrazinamidase/nicotinamidase"
FT                   /EC_number="3.5.1.-"
FT                   /note="similarity:fasta; with=UniProt:P21369
FT                   (EMBL:M26934;); Escherichia coli.; pncA;
FT                   Pyrazinamidase/nicotinamidase (EC 3.5.1.-) (EC 3.5.1.19)
FT                   (PZAase) (Nicotine deamidase) (NAMase).; length=213; id
FT                   47.429%; ungapped id 49.405%; E()=9.2e-27; 175 aa overlap;
FT                   query 9-181; subject 5-174"
FT                   /note="similarity:fasta; with=UniProt:Q3R5A8
FT                   (EMBL:AAAM03000031;); Xylella fastidiosa Ann-1.;
FT                   Isochorismatase hydrolase.; length=208; id 70.936%;
FT                   ungapped id 70.936%; E()=1.4e-61; 203 aa overlap; query
FT                   5-207; subject 3-205"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0257"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43861"
FT                   /db_xref="GOA:B2FI73"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI73"
FT                   /protein_id="CAQ43861.1"
FT                   /translation="MTALPADVALLVIDLQPDFMPGGALACDQGDALVAPIADLLAQRR
FT                   YRTVVATQDWHPADHASFASQHPGQRPFETILLHAQPQTLWPDHCVQGSAGAALHPGVD
FT                   WTVADLILRKGTRQQVDSYSAFRENHGPDGERPATGLAGWLHERRIREVHVCGLARDYC
FT                   VLWSAQDAVKSGFRVKFLWELTKPVTEANDVMVREALGKAGIAIV"
FT   misc_feature    complement(272966..273577)
FT                   /gene="pncA"
FT                   /locus_tag="Smlt0257"
FT                   /note="HMMPfam hit to PF00857, Isochorismatase family,
FT                   score 9.8e-11"
FT                   /inference="protein motif:HMMPfam:PF00857"
FT   CDS_pept        complement(273645..274331)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0258"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q3BYU1
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; Hypothetical protein.; length=221; id
FT                   79.817%; ungapped id 80.556%; E()=2.2e-78; 218 aa overlap;
FT                   query 10-227; subject 6-221"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0258"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43862"
FT                   /db_xref="GOA:B2FI74"
FT                   /db_xref="InterPro:IPR003828"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI74"
FT                   /protein_id="CAQ43862.1"
FT                   /translation="MRYLTMTELQRPTLTLPAGGKRLLLHSCCAPCSGEVMEAITASGI
FT                   DYAIFFYNPNIHPVKEYELRKQENIRFAEQHGIPFIDCDYDTDNWFSRARGMENEPERG
FT                   IRCTMCFDMRFERTALYAHEHGYDTISSSLGISRWKNMAQINDCGIRAASRYEGLQYWD
FT                   YNWRKGGGASRMIEISKREQFYQQEYCGCVYSLRDANRHRRENGRERIKIGLLYYGQDA
FT                   GTPQDD"
FT   misc_feature    complement(273678..274265)
FT                   /locus_tag="Smlt0258"
FT                   /note="HMMPfam hit to PF02677, Uncharacterized BCR,
FT                   COG1636, score 2.1e-125"
FT                   /inference="protein motif:HMMPfam:PF02677"
FT   repeat_region   274406..274413
FT                   /rpt_unit_seq="(cg)4"
FT   CDS_pept        complement(274607..274822)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0259"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0259"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43863"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI75"
FT                   /protein_id="CAQ43863.1"
FT                   /translation="MAAGSDPFLPLGSDPVAAQRVLTPALLTGATNRSTLHTPKVSLPS
FT                   LRRGEGFKRESGEGASRVHSGAAPQR"
FT   CDS_pept        complement(274856..276265)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0260"
FT                   /product="putative nicotinamide phosphoribosyltransferase"
FT                   /EC_number="2.4.2.12"
FT                   /note="similarity:fasta; with=UniProt:Q99KQ4
FT                   (EMBL:AK086415;); Mus musculus (Mouse).; Nampt;
FT                   Nicotinamide phosphoribosyltransferase (EC 2.4.2.12)
FT                   (NAmPRTase) (Nampt) (Pre-B-cell colony-enhancing factor 1
FT                   homolog) (PBEF) (Visfatin).; length=491; id 43.215%;
FT                   ungapped id 45.796%; E()=1.7e-61; 479 aa overlap; query
FT                   6-465; subject 10-480"
FT                   /note="similarity:fasta; with=UniProt:Q3BXP7
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; Nicotinate phosphoribosyltransferase (EC
FT                   2.4.2.11).; length=467; id 79.140%; ungapped id 79.654%;
FT                   E()=3.2e-141; 465 aa overlap; query 1-465; subject 1-462"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0260"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43864"
FT                   /db_xref="GOA:B2FI76"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016471"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="InterPro:IPR041529"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI76"
FT                   /protein_id="CAQ43864.1"
FT                   /translation="MHYLDNLLLNTDSYKASHWLQYPPGTDATFFYVESRGGLHDRTVF
FT                   FGLQAILKDALARPVTHADIDDAAAVFAAHGEPFNEAGWRDIVDRLGGHLPVRIRAVPE
FT                   GSVVPTHQALMTIESTDPAAFWVPSYLETLLLRVWYPVTVATISWHARQTIAAFLQQTS
FT                   DDPQGQLPFKLHDFGARGVSSLESAALGGAAHLVNFLGTDTVSALCLARAHYHAPMAGY
FT                   SIPAAEHSTITSWGREREVDAYRNMLRQFGKPGSIVAVVSDSYDIYRAISEHWGTTLRD
FT                   DVIASGATLVIRPDSGDPVEVVAESLRRLDEAFGHAINGKGYRVLNHVRVIQGDGINPD
FT                   TIRAILQRITDDGYAADNVAFGMGGALLQRLDRDTQKFALKCSAARVEGEWIDVYKDPV
FT                   TDAGKASKRGRMRLLRRLDDGSLHTVPLPANGDDTLPDGFEDAMVTVWENGHLLYDQRL
FT                   DDIRTRAAVGH"
FT   misc_feature    complement(274913..275752)
FT                   /locus_tag="Smlt0260"
FT                   /note="HMMPfam hit to PF04095, Nicotinate
FT                   phosphoribosyltransferase (NAPRTa, score 2.4e-113"
FT                   /inference="protein motif:HMMPfam:PF04095"
FT   repeat_region   275725..275732
FT                   /rpt_unit_seq="(cg)4"
FT   CDS_pept        complement(276330..277379)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0261"
FT                   /product="putative bifunctional NMN
FT                   adenylyltransferase/nudix hydrolase"
FT                   /EC_number="3.6.1.-"
FT                   /note="similarity:fasta; with=UniProt:Q55928
FT                   (EMBL:BA000022;); Synechocystis sp. (strain PCC 6803).;
FT                   Bifunctional NMN adenylyltransferase/Nudix hydrolase
FT                   [Includes: Nicotinamide-nucleotide adenylyltransferase (EC
FT                   2.7.7.1) (NAD(+) pyrophosphorylase) (NAD(+)
FT                   diphosphorylase) (NMN adenylyltransferase); ADP compounds
FT                   hydrolase (EC 3.6.1.-)].; length=339; id 45.690%; ungapped
FT                   id 47.605%; E()=4e-43; 348 aa overlap; query 2-348; subject
FT                   4-338"
FT                   /note="similarity:fasta; with=UniProt:Q3BXP8
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; Bifunctional NMN adenylyltransferase/NUDIX
FT                   hydrolase.; length=351; id 82.997%; ungapped id 82.997%;
FT                   E()=2.1e-121; 347 aa overlap; query 3-349; subject 5-351"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0261"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43865"
FT                   /db_xref="GOA:B2FI77"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI77"
FT                   /protein_id="CAQ43865.1"
FT                   /translation="MEFDYLVFIGRFEPFHNGHAAVARLALSRARKLIFLVGSADTPRS
FT                   LRNPWTVAERAVMIQAALDGHTDRLLIRPLRDHLYNEAQWIANVQRQVAEALRNDGAAA
FT                   DAKVGLIGMDKDASSYYLREFPQWPLVDVQHTATLSATELRRYLFEAGDVDFHGALLML
FT                   RGNVPAPVYDMLEAFRKSAPAYGQLVAEYRFIEQYKAAWKDAPYAPTFVTTDAVVVHSG
FT                   HVLLVRRRSEPGKGLWALPGGFVGQEQSLLDSCLRELREETRLKIPLPVLKGSLKGQQV
FT                   FDHPDRSQRGRTITHGFHFEFPAGDLPPVRGGDDADKARWIPVSEALDMGPQLFEDHLH
FT                   ILEYFLGRG"
FT   misc_feature    complement(276336..276752)
FT                   /locus_tag="Smlt0261"
FT                   /note="HMMPfam hit to PF00293, NUDIX domain, score 6e-26"
FT                   /inference="protein motif:HMMPfam:PF00293"
FT   misc_feature    complement(277005..277361)
FT                   /locus_tag="Smlt0261"
FT                   /note="HMMPfam hit to PF01467, Cytidylyltransferase, score
FT                   5.8e-06"
FT                   /inference="protein motif:HMMPfam:PF01467"
FT   CDS_pept        277573..279465
FT                   /transl_table=11
FT                   /locus_tag="Smlt0262"
FT                   /product="putative suhR-like regulator"
FT                   /note="similarity:fasta; with=UniProt:P15715
FT                   (EMBL:AL591789;); Rhizobium meliloti (Sinorhizobium
FT                   meliloti).; suhR; RpoH suppressor.; length=633; id 57.233%;
FT                   ungapped id 59.477%; E()=1e-116; 636 aa overlap; query
FT                   10-630; subject 7-633"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0262"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43866"
FT                   /db_xref="GOA:B2FI78"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI78"
FT                   /protein_id="CAQ43866.1"
FT                   /translation="MLGGKTVADKYCDLVMKGGITSGIVYPNAVLALAREYRFKSIGGT
FT                   SAGAIAAAVAAAAACGDRRQQAGEHLPGDAGYGGLSAVSAQLSRRGFIYSLFQPARGAR
FT                   AAYRLLVVLTGNASLPHKLLCLAVAVFEIAPLEVLVSLALLLGLGWWGGGWSGVAATLL
FT                   PSLLCAYGAGVAGAALRVARVARRNLLGLCSGLGRDARTPALTEWLHECLQQLSGKPLD
FT                   APLTFADLHDAPRYAGEPDSPHAISLQMITTCVSHNEPRTLPLGGAQFWFLREEFEQLF
FT                   PASVVQWLVTQAGPPLEVEGRQYYHLPPGPKLPVLVATRMSLSFPLLISAVPLHEPSRR
FT                   ERRCEPTAPAADPEHNVADSMEGLTSAGQACGPVITAFRICWFSDGGISSNFPIHLFDA
FT                   ALPRWPTFAINLVYPQHAEEVNHGSNGRQSLEHAVFLPTENRHGWQRTYQSIATPLAAA
FT                   ELGRFLFAVVATMQNWRDLLQARAPGYRDRIVHVSLQGDEGGMNLDMPQEVLTRIADKG
FT                   SLAGARFCSFSFENHYWIRWRNLASAYQRYTLEVARTDDPAQQVLAYRAAYSMVARGEP
FT                   APPSYKLGSEDKRLASQQLWGLMVEQGRTWEDLGPDLTDGAPRPLPQMKVTPIY"
FT   misc_feature    277612..278766
FT                   /locus_tag="Smlt0262"
FT                   /note="HMMPfam hit to PF01734, Patatin-like phospholipase,
FT                   score 0.00031"
FT                   /inference="protein motif:HMMPfam:PF01734"
FT   repeat_region   279010..279019
FT                   /rpt_unit_seq="(gc)5"
FT   repeat_region   279518..279539
FT                   /rpt_family="R=8"
FT                   /inference="nucleotide motif:RepeatScout"
FT   repeat_region   279540..279619
FT                   /rpt_family="(CACCAT)n"
FT                   /inference="nucleotide motif:RepeatScout"
FT   repeat_region   279555..279572
FT                   /rpt_unit_seq="(catcac)3"
FT   repeat_region   279573..279620
FT                   /rpt_unit_seq="(catcagcatcag)4"
FT   repeat_region   279620..279786
FT                   /rpt_family="R=8"
FT                   /inference="nucleotide motif:RepeatScout"
FT   repeat_region   complement(279633..279841)
FT                   /rpt_family="R=3"
FT                   /inference="nucleotide motif:RepeatScout"
FT   repeat_region   complement(279633..279788)
FT                   /rpt_family="R=8"
FT                   /inference="nucleotide motif:RepeatScout"
FT   CDS_pept        complement(279841..281208)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0263"
FT                   /product="putative HTH transcriptional regulator"
FT                   /note="similarity:fasta; with=UniProt:Q4USE3
FT                   (EMBL:CP000050;); Xanthomonas campestris pv. campestris
FT                   (strain 8004).; Transcriptional regulator.; length=460; id
FT                   65.487%; ungapped id 66.071%; E()=1.6e-105; 452 aa overlap;
FT                   query 4-453; subject 5-454"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0263"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43867"
FT                   /db_xref="GOA:B2FI79"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR018653"
FT                   /db_xref="InterPro:IPR026281"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI79"
FT                   /protein_id="CAQ43867.1"
FT                   /translation="MNYSATQRQLGLRLLRLREQRGYSQVDLARALGLSASYLNQIERN
FT                   KRPLTPAVQKKLGEVLGDVSSLFDEDEPAALQEALGETLRDLGLAEVSATELRALAGNL
FT                   PQVSRALLDLHRRHLALREHAAALEFQLGEPGAGSTLPAGDQVREFFNRMHNHIPELDE
FT                   LAEQLFAEWGLSPGHVAPRLRQLLADRHGVLVEVAALQAGREKRQYDAGARRLWLPDYL
FT                   EPGQQAFQMAAELALHGYLPQIDAVVARAGFTDEARIAQARIGLSNYFAGALVMPYMRF
FT                   LRAAEASSYDIELLAHQFGVGFEAVCHRLSTLARRSAPGLPFFFIRVDRAGNVSKRHSA
FT                   TDFHFSQVGGSCPLWIVYEAFNQPGRILTQTARMPDGRRHFWLARQVSSGPVGHGQPRK
FT                   TFAVALGCDLQHAERLVYSLGLDVQSPGNSVSIGPGCRVCPREDCMQRAFAQLPGR"
FT   misc_feature    complement(280276..280647)
FT                   /locus_tag="Smlt0263"
FT                   /note="HMMPfam hit to PF06114, Domain of unknown function
FT                   (DUF955), score 2.3e-21"
FT                   /inference="protein motif:HMMPfam:PF06114"
FT   repeat_region   280457..280464
FT                   /rpt_unit_seq="(gc)4"
FT   misc_feature    complement(281002..281169)
FT                   /locus_tag="Smlt0263"
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix, score
FT                   2.4e-11"
FT                   /inference="protein motif:HMMPfam:PF01381"
FT   CDS_pept        281324..282829
FT                   /transl_table=11
FT                   /locus_tag="Smlt0264"
FT                   /product="DntE"
FT                   /note="similarity:fasta; with=UniProt:Q8VUC5
FT                   (EMBL:AF169302;); Burkholderia cepacia (Pseudomonas
FT                   cepacia).; DntE.; length=508; id 76.566%; ungapped id
FT                   76.566%; E()=1.4e-146; 495 aa overlap; query 6-500; subject
FT                   13-507"
FT                   /note="similarity:fasta; with=UniProt:Q8PB64
FT                   (EMBL:AE012225;); Xanthomonas campestris pv. campestris.;
FT                   mmsA; Methylmalonate-semialdehyde dehydrogenase.;
FT                   length=501; id 86.627%; ungapped id 86.627%; E()=1.2e-165;
FT                   501 aa overlap; query 1-501; subject 1-501"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0264"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43868"
FT                   /db_xref="GOA:B2FI80"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI80"
FT                   /protein_id="CAQ43868.1"
FT                   /translation="MTVAAPRIRMLIDGQFVESATSHWQDVINPATQDVLAKVPFATTG
FT                   EVDAAVAAAKEAFKTWRKTPIGTRARIFLKYQQLIRENMSELAHILTAEQGKTLPDAEG
FT                   DVFRGLEVVEHAAAIGNLQLGELANNVANGVDTYTIMQPLGVCAGITPFNFPAMIPLWM
FT                   FPMAIATGNTFILKPSEQDPMVTMRLVELALEAGIPKGVLNVVHGGEEVVNAICDHPDI
FT                   KAVSFVGSTRVGTHVYNRASLAGKRVQCMMGAKNHAVVLPDANKEQTLNAMVGAAFGAA
FT                   GQRCMAASTLVLVGEARNWVQDLVEKAKTLKVSAGTVSGTDVGPVISCSARERVEGLIA
FT                   SGVEQGAKLVLDGRKPQVDGFEKGNFVGPTIFAGVTTDMRIYQEEIFGPVLVILEAETL
FT                   EDAIAMVNSNPNGNGTALFTQSGAAARKFQEDIDVGQVGINVPIPVPVPLFSFTGSRAS
FT                   KLGDLGPYGKQVVLFYTQTKTVTARWFDDETLSHGVNTTISLK"
FT   misc_feature    281369..282763
FT                   /locus_tag="Smlt0264"
FT                   /note="HMMPfam hit to PF00171, Aldehyde dehydrogenase
FT                   family, score 1.3e-181"
FT                   /inference="protein motif:HMMPfam:PF00171"
FT   repeat_region   281528..281535
FT                   /rpt_unit_seq="(cg)4"
FT   CDS_pept        282844..284010
FT                   /transl_table=11
FT                   /locus_tag="Smlt0265"
FT                   /product="putative acyl CoA dehydrogenase"
FT                   /note="similarity:fasta; with=UniProt:Q3BVW8
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; Acyl-CoA dehydrogenase.; length=407; id
FT                   78.238%; ungapped id 78.238%; E()=1.5e-116; 386 aa overlap;
FT                   query 3-388; subject 22-407"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0265"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43869"
FT                   /db_xref="GOA:B2FI81"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI81"
FT                   /protein_id="CAQ43869.1"
FT                   /translation="MSHSMTTELEEAQQAYREAARDFAQAELAPHAARWDAEGIFPREA
FT                   IAKAGELGFCGLYMDPEVGGSGLSRLDAAVVIEELANVDPSTAAYISIHNMASWMVSKW
FT                   GQPALRDAWGTDLSSGLKLASYCLTEPGAGSDAASLKTTAVRDGDFYVLNGSKAFISGA
FT                   GATELLVVMARTGGAGAGGVSAIAVPSDLPGISFGRKEEKMGWNSQPTRGITFENVRVP
FT                   VSHLLGEEGGGFKLAMKGLDGGRINIAACSLGAAQGALDAARRYMGERRQFGKALAEFQ
FT                   ALQFKLADMVTQLVAARQMVHTAARKLDAGASDANVWCAMAKRFATDAGFNVCNEALQI
FT                   HGGYGYIREYPIERLLRDCRVHQILEGTNEIMRVIVARHLLNTEEELR"
FT   misc_feature    282871..283206
FT                   /locus_tag="Smlt0265"
FT                   /note="HMMPfam hit to PF02771, Acyl-CoA dehydrogenase,
FT                   N-terminal doma, score 2.8e-21"
FT                   /inference="protein motif:HMMPfam:PF02771"
FT   misc_feature    283216..283371
FT                   /locus_tag="Smlt0265"
FT                   /note="HMMPfam hit to PF02770, Acyl-CoA dehydrogenase,
FT                   middle domain, score 4.1e-28"
FT                   /inference="protein motif:HMMPfam:PF02770"
FT   misc_feature    283534..283986
FT                   /locus_tag="Smlt0265"
FT                   /note="HMMPfam hit to PF00441, Acyl-CoA dehydrogenase,
FT                   C-terminal doma, score 3.1e-66"
FT                   /inference="protein motif:HMMPfam:PF00441"
FT   misc_feature    283579..283953
FT                   /locus_tag="Smlt0265"
FT                   /note="HMMPfam hit to PF08028, Acyl-CoA dehydrogenase,
FT                   C-terminal doma, score 8.1e-22"
FT                   /inference="protein motif:HMMPfam:PF08028"
FT   CDS_pept        284007..284804
FT                   /transl_table=11
FT                   /locus_tag="Smlt0266"
FT                   /product="putative enoyl CoA hydratase/isomerase"
FT                   /note="similarity:fasta; with=UniProt:Q3BVW7
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; Enoyl-CoA hydratase/isomerase family
FT                   protein (EC 4.2.1.17).; length=265; id 80.682%; ungapped id
FT                   80.682%; E()=6.3e-81; 264 aa overlap; query 1-264; subject
FT                   1-264"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0266"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43870"
FT                   /db_xref="GOA:B2FI82"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI82"
FT                   /protein_id="CAQ43870.1"
FT                   /translation="MKDWRTQEHVGLKVEVDGHTAVVTLNNPPAHTWTVHSLSALRDLV
FT                   GALNADRDIYALVITGDGEKFFSAGADLNQFASGDKAAAREAARRFGEAFEALSGFRGV
FT                   SIAAINGYAMGGGLECALACDLRIIEDHAQVALPEATVGLLPCAGGTQNLPRLVGEGWA
FT                   KRMILLGERINAETALRIGLAEEKVGKGEAKALALEWAKKAGKQSPTSIAACKTLVQST
FT                   RTGTHASALVAEREAFVDLFDTADQVEGVTAFLEKRTAQWKNA"
FT   misc_feature    284067..284573
FT                   /locus_tag="Smlt0266"
FT                   /note="HMMPfam hit to PF00378, Enoyl-CoA
FT                   hydratase/isomerase family, score 2.7e-41"
FT                   /inference="protein motif:HMMPfam:PF00378"
FT   CDS_pept        284801..285976
FT                   /transl_table=11
FT                   /locus_tag="Smlt0267"
FT                   /product="putative enoyl CoA hydratase"
FT                   /note="similarity:fasta; with=UniProt:Q2P4N1
FT                   (EMBL:AP008229;); Xanthomonas oryzae pv. oryzae (strain
FT                   MAFF 311018).; Enoyl-CoA hydratase.; length=390; id
FT                   61.697%; ungapped id 62.663%; E()=5.4e-89; 389 aa overlap;
FT                   query 1-383; subject 1-389"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0267"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43871"
FT                   /db_xref="GOA:B2FI83"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR032259"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI83"
FT                   /protein_id="CAQ43871.1"
FT                   /translation="MSTDTVADDAPVLFEERVAGNGARIGIATLNAPRTLNGFSLPMAH
FT                   LLLKQLNAWADDDGIAMVVLQGAGEKAFCAGGDLHSLYKSMVAFREAGCSDIRENDYAA
FT                   EFFDVEYRVDHLIHTYAKPILCWGHGIVMGGGIGLMSGASHRVVSERSKLAFPEITVGL
FT                   FPDVGGSWLLPRVPGKGGLFLALTGALLNPGDAIYAGLADVHVAEERRSAVFDALLQVA
FT                   WSGDAAHNHERLTHLLQSHASDAATGPLLANAAQVEALCEGDDLQAIVARIAGLQTDDA
FT                   WLQAAQKTLAAGAPGSARLAYELQRRSAGQDLAAIYRLEYIVALHCAAHGDFAEGIRAL
FT                   LVDKDRNPQWNPATLAEATGAWADTFFASPWAAAAHPLADLGTPLVERSLA"
FT   repeat_region   284865..284872
FT                   /rpt_unit_seq="(gc)4"
FT   misc_feature    284876..285421
FT                   /locus_tag="Smlt0267"
FT                   /note="HMMPfam hit to PF00378, Enoyl-CoA
FT                   hydratase/isomerase family, score 7.5e-11"
FT                   /inference="protein motif:HMMPfam:PF00378"
FT   CDS_pept        285973..286863
FT                   /transl_table=11
FT                   /gene="mmsB"
FT                   /locus_tag="Smlt0268"
FT                   /product="putative 3-hydroxyisobutyrate dehydrogenase"
FT                   /EC_number="1.1.1.31"
FT                   /note="similarity:fasta; with=UniProt:P28811
FT                   (EMBL:AE004778;); Pseudomonas aeruginosa.; mmsB;
FT                   3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31) (HIBADH).;
FT                   length=298; id 62.116%; ungapped id 62.543%; E()=2.7e-59;
FT                   293 aa overlap; query 1-291; subject 1-293"
FT                   /note="similarity:fasta; with=UniProt:Q3BVW5
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; 3-hydroxyisobutyrate dehydrogenase (EC
FT                   1.1.1.31).; length=295; id 83.219%; ungapped id 83.219%;
FT                   E()=1.5e-82; 292 aa overlap; query 1-292; subject 1-292"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0268"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43872"
FT                   /db_xref="GOA:B2FI84"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011548"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI84"
FT                   /protein_id="CAQ43872.1"
FT                   /translation="MSRIAFIGLGNMGGPMAANLVKNGHSVRVFDLVPAAVQAAVDAGA
FT                   SAASSARDTLADAEVVISMLPASRHVEGVYLGDDGILAAIPAGALVIDCSTIAPASARK
FT                   VSEAAAARGLQMIDAPVSGGTAGAQAGTLTFIVGGEEDALERARPVLQAMGKNIFHVGA
FT                   SGAGQVAKLCNNMALGVIMAVTGEAIALGVAHGLDPKVLSQMMAVSTGRSWATEVCNPW
FT                   PGVLENAPASRGYSGGFGSDLMLKDMGLAVEAAMSVGASIPLGEVARNLYSMNHQAGRG
FT                   KLDFSSVVQLITSEK"
FT   misc_feature    285973..286461
FT                   /gene="mmsB"
FT                   /locus_tag="Smlt0268"
FT                   /note="HMMPfam hit to PF03446, NAD binding domain of
FT                   6-phosphogluconat, score 3.6e-83"
FT                   /inference="protein motif:HMMPfam:PF03446"
FT   repeat_region   286274..286281
FT                   /rpt_unit_seq="(gc)4"
FT   repeat_region   286408..286415
FT                   /rpt_unit_seq="(cg)4"
FT   repeat_region   complement(286867..286896)
FT                   /rpt_family="R=14"
FT                   /inference="nucleotide motif:RepeatScout"
FT   CDS_pept        complement(287012..287437)
FT                   /transl_table=11
FT                   /gene="ohr"
FT                   /locus_tag="Smlt0269"
FT                   /product="putative organic hydroperoxide resistance
FT                   protein"
FT                   /note="similarity:fasta; with=UniProt:P0A0V5
FT                   (EMBL:AF036166;); Xanthomonas campestris pv. phaseoli.;
FT                   ohr; Organic hydroperoxide resistance protein.; length=142;
FT                   id 70.000%; ungapped id 70.000%; E()=2.3e-33; 140 aa
FT                   overlap; query 2-141; subject 3-142"
FT                   /note="similarity:fasta; with=UniProt:Q6D2C9
FT                   (EMBL:BX950851;); Erwinia carotovora subsp. atroseptica
FT                   (Pectobacterium atrosepticum).; ohr; Organic hydroperoxide
FT                   resistance protein.; length=141; id 77.143%; ungapped id
FT                   77.143%; E()=7e-38; 140 aa overlap; query 1-140; subject
FT                   1-140"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0269"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43873"
FT                   /db_xref="GOA:B2FI85"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI85"
FT                   /protein_id="CAQ43873.1"
FT                   /translation="MSIEKVLYTAQATSTGGREGRSVSSDNVLDIQLSTPRELGGAGGP
FT                   GTNPEQLFAAGYSACFLGALKFVAGQAKVALPADTTVTGKVGIGQIPTGFGIEAELTIN
FT                   VPGVPREQVEELVQKAHIVCPYSNATRGNIDVTLIVA"
FT   misc_feature    complement(287021..287374)
FT                   /gene="ohr"
FT                   /locus_tag="Smlt0269"
FT                   /note="HMMPfam hit to PF02566, OsmC-like protein, score
FT                   2.2e-33"
FT                   /inference="protein motif:HMMPfam:PF02566"
FT   CDS_pept        complement(287549..288505)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0270"
FT                   /product="putative cation efflux protein"
FT                   /note="similarity:fasta; with=UniProt:Q37CA6
FT                   (EMBL:CP000283;); Rhodopseudomonas palustris BisB5.; Cation
FT                   efflux protein precursor (Cation diffusion facilitator
FT                   family transporter precursor).; length=308; id 54.276%;
FT                   ungapped id 54.276%; E()=1.8e-58; 304 aa overlap; query
FT                   13-316; subject 3-306"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0270"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43874"
FT                   /db_xref="GOA:B2FI86"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI86"
FT                   /protein_id="CAQ43874.1"
FT                   /translation="MATHRPQFFDPATEQGVLRLSIAASLLLAAAAVVFGLLANSSLII
FT                   FDGIYGLIDVVMTWLSLLVARLIALSTQTDALQSRLNQRFTMGFWHLEPIVLGVSGTLM
FT                   IGAALYALVNAVDALMSGGRHIALGPAIAFAGLSIVGEGALAWFILRANRRIGSEFIAL
FT                   DAKNWVIAASMSACYLLAFLGGVLVQGTSWAWVGPYIDPAILAFVCVLVMIAPLGTVRR
FT                   ALAGILLVTPPELQAHVDAVARAIVAKHGFVEHRSYVAQVGRGEQIELFFVVPENDPPR
FT                   PLVEWDQLRDEIGDALGEASPDRWLTIMFTTDREWTI"
FT   misc_feature    complement(287555..288454)
FT                   /locus_tag="Smlt0270"
FT                   /note="HMMPfam hit to PF01545, Cation efflux family, score
FT                   1.3e-08"
FT                   /inference="protein motif:HMMPfam:PF01545"
FT   misc_feature    complement(order(287855..287923,287936..288004,
FT                   288062..288130,288173..288241,288296..288364,
FT                   288392..288460))
FT                   /locus_tag="Smlt0270"
FT                   /note="6 probable transmembrane helices predicted for
FT                   Smlt0270 by TMHMM2.0 at aa 16-38, 48-70, 89-111, 126-148,
FT                   168-190 and 195-217"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(288389..288505)
FT                   /locus_tag="Smlt0270"
FT                   /note="Signal peptide predicted for Smlt0270 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.648) with cleavage site
FT                   probability 0.469 between residues 39 and 40"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        288609..288812
FT                   /transl_table=11
FT                   /locus_tag="Smlt0271"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0271"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43875"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI87"
FT                   /protein_id="CAQ43875.1"
FT                   /translation="MRRPGRGQHGHRFLGRMLDMQRYDAGDTQVYRVRGQVFLASAGHL
FT                   GAVFDYQHVTPRVQIDLRDAHP"
FT   CDS_pept        288862..289068
FT                   /transl_table=11
FT                   /locus_tag="Smlt0272"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0272"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43876"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI88"
FT                   /protein_id="CAQ43876.1"
FT                   /translation="MAGTDHLGKAPDGLICRQSVDAIKPDRLHLEADSLEAWARSGGRK
FT                   TSHLRQSSTHLNQRPRRPQADEG"
FT   CDS_pept        complement(289108..290889)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0273"
FT                   /product="putative peptidoglycan-binding motif protein"
FT                   /note="similarity:fasta; with=UniProt:Q3BM71
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; Hypothetical protein.; length=615; id
FT                   57.443%; ungapped id 60.169%; E()=7.5e-105; 618 aa overlap;
FT                   query 1-593; subject 1-615"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0273"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43877"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI89"
FT                   /protein_id="CAQ43877.1"
FT                   /translation="MPTNIDTHDLDATSGAVYFAVGRGTEGGPASYHLAIAGITQGVTE
FT                   PHWGTVNKVAQNSGYSLGAIQVDFGQRGEWALGAIDGHALKAGETTYVDAVIDQASTYA
FT                   KAHNLPFTQDHADLRRDLLSHGNGLSGRSSIQFIDTNTRDSINAWAGSAEGKQWIHANI
FT                   DYPQVRNATRIGMAMVDAHGSGIAEENRFEAISLIAKTANQLPSQLPKLQKVLEEGGDY
FT                   EALRAKAGQIRETYQYFDAPKAGDIAVRYENAYANNKDAMDRAHAKVSSRDYSPAGEHN
FT                   DADIKVALDQIGAPRQQAGSQTLKEGSSGRDVLKLESNLVTLGYASAGGQQTLNPDRRF
FT                   DATTRKAVEDFQRAHNLDPVDGKAGPATLAAIDRDARELQGNLAALGLTDAKGQAIGSD
FT                   GYLGGGSRHAINAFQQQHGLPATGIADAETRQALANEVQQRAQAQGSTPEQQAAAEPAR
FT                   ETVYPMSDPRSPQNWLYTETLVQVKFAEEARGLPSGEHSEKLAAALTVEAARAGLYRVD
FT                   RVELNQDGSMARAVQANALHDESALNRNTAPVSTADAMRQSVQENSERALQVSDQQREQ
FT                   QKIDQQTQQHGPRAMMA"
FT   repeat_region   289300..289307
FT                   /rpt_unit_seq="(cg)4"
FT   misc_feature    complement(289579..289761)
FT                   /locus_tag="Smlt0273"
FT                   /note="HMMPfam hit to PF01471, Putative peptidoglycan
FT                   binding domain, score 6.6e-11"
FT                   /inference="protein motif:HMMPfam:PF01471"
FT   repeat_region   289758..289765
FT                   /rpt_unit_seq="(cg)4"
FT   misc_feature    complement(289762..289965)
FT                   /locus_tag="Smlt0273"
FT                   /note="HMMPfam hit to PF01471, Putative peptidoglycan
FT                   binding domain, score 1.6e-16"
FT                   /inference="protein motif:HMMPfam:PF01471"
FT   repeat_region   289827..289834
FT                   /rpt_unit_seq="(gc)4"
FT   CDS_pept        complement(290932..291363)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0274"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q3BM72
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; Putative secreted protein precursor.;
FT                   length=146; id 45.385%; ungapped id 45.385%; E()=7.5e-18;
FT                   130 aa overlap; query 14-143; subject 17-146"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0274"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43878"
FT                   /db_xref="InterPro:IPR009739"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI90"
FT                   /protein_id="CAQ43878.1"
FT                   /translation="MEQMMQHKRLSRTLATALAVAVLAIGTATAAPAATGLSPTFTTCR
FT                   DKAQGAIEQAACLTSESARQDQRLNQAYRQLQAKLSGAKKTKLVNAQRAWLQSRSRDSE
FT                   LDTALYDDSQPGNLQGELNDVMRLSARADQLQKYLQLLD"
FT   misc_feature    complement(290953..291237)
FT                   /locus_tag="Smlt0274"
FT                   /note="HMMPfam hit to PF07007, Protein of unknown function
FT                   (DUF1311), score 3.2e-05"
FT                   /inference="protein motif:HMMPfam:PF07007"
FT   misc_feature    complement(291259..291327)
FT                   /locus_tag="Smlt0274"
FT                   /note="1 probable transmembrane helix predicted for
FT                   Smlt0274 by TMHMM2.0 at aa 13-35"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(291274..291363)
FT                   /locus_tag="Smlt0274"
FT                   /note="Signal peptide predicted for Smlt0274 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.831 between residues 30 and 31"
FT                   /inference="protein motif:SignalP:2.0"
FT   repeat_region   complement(291464..291508)
FT                   /rpt_family="GC_rich"
FT                   /inference="nucleotide motif:RepeatScout"
FT   CDS_pept        291596..292600
FT                   /transl_table=11
FT                   /gene="dusA"
FT                   /locus_tag="Smlt0275"
FT                   /product="putative tRNA-dihydrouridine synthase A"
FT                   /note="similarity:fasta; with=UniProt:P32695
FT                   (EMBL:U00006;); Escherichia coli.; dusA;
FT                   tRNA-dihydrouridine synthase A (EC 1.-.-.-).; length=330;
FT                   id 53.165%; ungapped id 54.194%; E()=1.2e-59; 316 aa
FT                   overlap; query 11-322; subject 10-323"
FT                   /note="similarity:fasta; with=UniProt:Q8P3X4
FT                   (EMBL:AE012515;); Xanthomonas campestris pv. campestris.;
FT                   dusA; tRNA-dihydrouridine synthase A (EC 1.-.-.-).;
FT                   length=335; id 79.939%; ungapped id 79.939%; E()=1.5e-104;
FT                   329 aa overlap; query 6-334; subject 7-335"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0275"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43879"
FT                   /db_xref="GOA:B2FI91"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004653"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI91"
FT                   /protein_id="CAQ43879.1"
FT                   /translation="MTSATARYADSLRLSVAPMMDWTDRHCRVFHRVLAPGARLYTEMV
FT                   HANAVIHGDRERLLGFDRSEQPLALQLGGSDPALLAQAARIAAEWGYDEVNLNCGCPSD
FT                   RVQAGRFGACLMREPVLVAECVAAMVDAVDIPVTVKCRLGVDEDNDYDVFASFVDRQVA
FT                   AGAAMVVVHARNAWLKGLSPKENREVPPLKYDWAYRLKQERPALPVVINGGLASIEAVQ
FT                   AQAAHVDGVMLGRAAYHDPYLLHQLEALHTGAPLQARGDLLRAMRPYIEARLREGLALK
FT                   HITRHLLGLFHGQPGGRAFRQVLSEGAHRPGAGWSLIEQALAVTEREADRAAA"
FT   misc_feature    291638..292561
FT                   /gene="dusA"
FT                   /locus_tag="Smlt0275"
FT                   /note="HMMPfam hit to PF01207, Dihydrouridine synthase
FT                   (Dus), score 3e-101"
FT                   /inference="protein motif:HMMPfam:PF01207"
FT   CDS_pept        292814..293188
FT                   /transl_table=11
FT                   /locus_tag="Smlt0276"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q5H5U4
FT                   (EMBL:AE013598;); Xanthomonas oryzae pv. oryzae.;
FT                   Hypothetical protein.; length=119; id 45.238%; ungapped id
FT                   49.565%; E()=2.3e-10; 126 aa overlap; query 1-123; subject
FT                   1-118"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0276"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43880"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI92"
FT                   /protein_id="CAQ43880.1"
FT                   /translation="MSSAPFHRRIALATCVVLAAAPLSSALAQQPPRGDQGRAEMMERG
FT                   ERGGRGDERSLSDAVRRVQRTTGGHILGAERVPFDGRDINRVKYMDDRGRVRYMDDPAP
FT                   SRSQPRTPRSDMSSLRGDNP"
FT   sig_peptide     292814..292897
FT                   /locus_tag="Smlt0276"
FT                   /note="Signal peptide predicted for Smlt0276 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.988 between residues 28 and 29"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        293262..293945
FT                   /transl_table=11
FT                   /locus_tag="Smlt0277"
FT                   /product="putative two-component transcriptional regulator
FT                   response regulatory protein"
FT                   /note="similarity:fasta; with=UniProt:Q5H5U3
FT                   (EMBL:AE013598;); Xanthomonas oryzae pv. oryzae.; phoP;
FT                   Two-component system regulatory protein.; length=227; id
FT                   98.678%; ungapped id 98.678%; E()=7.7e-80; 227 aa overlap;
FT                   query 1-227; subject 1-227"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0277"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43881"
FT                   /db_xref="GOA:B2FI93"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI93"
FT                   /protein_id="CAQ43881.1"
FT                   /translation="MRILLVEDEAPLRETLAARLKREGFAVDAAQDGEEGLYMGREVPF
FT                   DVGIIDLGLPKMSGMELIKALRDEGKKFPVLILTARSSWQDKVEGLKQGADDYLVKPFH
FT                   VEELLARVNALLRRAAGWSKPTLECGPVALDLAAQTVSVAGSNVDLTSYEYKVLEYLMM
FT                   HAGELVSKADLTEHIYQQDFDRDSNVLEVFIGRLRKKLDPDGELKPIETVRGRGYRFAI
FT                   PRNEG"
FT   misc_feature    293262..293600
FT                   /locus_tag="Smlt0277"
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 2.6e-35"
FT                   /inference="protein motif:HMMPfam:PF00072"
FT   misc_feature    293694..293921
FT                   /locus_tag="Smlt0277"
FT                   /note="HMMPfam hit to PF00486, Transcriptional regulatory
FT                   protein, C te, score 2.6e-23"
FT                   /inference="protein motif:HMMPfam:PF00486"
FT   CDS_pept        293968..295395
FT                   /transl_table=11
FT                   /locus_tag="Smlt0278"
FT                   /product="putative two component regulator sensor histidine
FT                   kinase transmembrane transcriptional regulatory protein"
FT                   /note="similarity:fasta; with=UniProt:Q8PFG0
FT                   (EMBL:AE012050;); Xanthomonas axonopodis pv. citri.; phoQ;
FT                   Two-component system sensor protein.; length=471; id
FT                   77.167%; ungapped id 77.660%; E()=3.8e-134; 473 aa overlap;
FT                   query 2-474; subject 1-470"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0278"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43882"
FT                   /db_xref="GOA:B2FI94"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI94"
FT                   /protein_id="CAQ43882.1"
FT                   /translation="MMSGRLWFFRRWRPRSLQARQMLAASVGLVAFLALAGYALDAAFA
FT                   DTAKANLRERLKNYATAYAAGIDFTRDRSLYIREQPPDSRFDVPGSGLYLQVVMPHGKG
FT                   NSMSAEGPMLPTVGGGLLAPRQEVFEGPLPMIQIDGSQGSVYRYGLGLVWDADADPATE
FT                   FPYTIYVMEDSRALGAQLRVFRGRVWFYLGGIGLILLLLQTVILQWSLRPLRRVITELT
FT                   KVQRGETERMSERHPRELEPLTDSINAFIESERENLERQRNTLADLAHSLKTPIAVLRT
FT                   QMDSGAGDGALREELDVQLQRMNNLVSYQLARAASSGHKLFSAPLPIESNAEEIVRGLE
FT                   KVYASKGVLCEFDIDPAARFHGEPGDLQELLGNLLENAFKWANRRVLLTAQPLPAPNAR
FT                   RAGLLLAVDDDGPGIAPDDIGKVLQRGVRGDERVQGHGIGLSIVQDLIKDYRGELAVGR
FT                   SSELGGARFEVRLPPGP"
FT   sig_peptide     293968..294084
FT                   /locus_tag="Smlt0278"
FT                   /note="Signal peptide predicted for Smlt0278 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.741 between residues 39 and 40"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(294034..294102,294532..294600)
FT                   /locus_tag="Smlt0278"
FT                   /note="2 probable transmembrane helices predicted for
FT                   Smlt0278 by TMHMM2.0 at aa 23-45 and 189-211"
FT                   /inference="protein motif:TMHMM:2.0"
FT   repeat_region   294488..294495
FT                   /rpt_unit_seq="(cg)4"
FT   misc_feature    294529..294735
FT                   /locus_tag="Smlt0278"
FT                   /note="HMMPfam hit to PF00672, HAMP domain, score 1.3e-05"
FT                   /inference="protein motif:HMMPfam:PF00672"
FT   repeat_region   294562..294573
FT                   /rpt_unit_seq="(ctg)4"
FT   misc_feature    294745..294918
FT                   /locus_tag="Smlt0278"
FT                   /note="HMMPfam hit to PF00512, His Kinase A
FT                   (phosphoacceptor) domain, score 0.0015"
FT                   /inference="protein motif:HMMPfam:PF00512"
FT   misc_feature    295051..295389
FT                   /locus_tag="Smlt0278"
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HSP90, score 1.3e-25"
FT                   /inference="protein motif:HMMPfam:PF02518"
FT   CDS_pept        complement(295625..295996)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0279"
FT                   /product="conserved hypothetical protein"
FT                   /note="Codons 23 to C-terminus are similar to codons 60 to
FT                   165 of Oryza sativa (japonica cultivar-group). p0734c01.13
FT                   UniProt:Q5Z4A7 (EMBL:AP005805 (217 aa) fasta scores:
FT                   E()=0.024, 37.143% id in 105 aa"
FT                   /note="similarity:fasta; with=UniProt:Q5Z4A7
FT                   (EMBL:AP005805;); Oryza sativa (japonica cultivar-group).;
FT                   P0734C01.13; Hypothetical protein P0734C01.13 (Hypothetical
FT                   protein OSJNBb0006M19.40).; length=217; id 37.143%;
FT                   ungapped id 39.796%; E()=0.024; 105 aa overlap; query
FT                   22-123; subject 61-161"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0279"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43883"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI95"
FT                   /protein_id="CAQ43883.1"
FT                   /translation="MPAAGRQPGNATEDHEGAGQRPALPDYARVIASGDVRRTGTRGCG
FT                   SLRRAAKDRNAVVPAAGRQPGNATEDHEGAGQRPALPDYARVIASGDARRTGTRSCGGS
FT                   TANRRRSKHGSAGRWPATW"
FT   repeat_region   295802..295832
FT                   /rpt_family="R=14"
FT                   /inference="nucleotide motif:RepeatScout"
FT   repeat_region   295973..296003
FT                   /rpt_family="R=14"
FT                   /inference="nucleotide motif:RepeatScout"
FT   CDS_pept        complement(295996..296745)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0280"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q4UPF7
FT                   (EMBL:CP000050;); Xanthomonas campestris pv. campestris
FT                   (strain 8004).; Hypothetical protein.; length=251; id
FT                   65.164%; ungapped id 65.164%; E()=3.3e-67; 244 aa overlap;
FT                   query 1-244; subject 1-244"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0280"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43884"
FT                   /db_xref="GOA:B2FI96"
FT                   /db_xref="InterPro:IPR010384"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR042252"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI96"
FT                   /protein_id="CAQ43884.1"
FT                   /translation="MLQWLRSAPRPIDDALWDEACRRAAWLHGLDDDRRARLRLLATRF
FT                   LHEKTITPIGELQLHAGDGVLLAALCCLPLLEFGEVGLEGWSQLIVYPDAFRVHRSHMD
FT                   AAGVLHEWDDELIGESWDSGPLILSWADVQADLATPHEGYCVAVHEMVHKLDALDGAMD
FT                   GTPPLPREWQREWAATFQRSYDAFCAQVDAGEETLIDPYAAEAPEEFFAVASEYHFSAP
FT                   DLLQQALPEVAAQLRRFYGEPPKIETR"
FT   misc_feature    complement(295999..296745)
FT                   /locus_tag="Smlt0280"
FT                   /note="HMMPfam hit to PF06167, Protein of unknown function
FT                   (DUF980), score 2.3e-112"
FT                   /inference="protein motif:HMMPfam:PF06167"
FT   CDS_pept        complement(296754..297041)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0281"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q3BN21
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; Putative secreted protein precursor.;
FT                   length=104; id 44.898%; ungapped id 48.352%; E()=1.8e-10;
FT                   98 aa overlap; query 1-95; subject 11-104"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0281"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43885"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI97"
FT                   /protein_id="CAQ43885.1"
FT                   /translation="MSSMRRYAHCLILLTMPFAASATAALDDSRGACVSSNGDAASQRA
FT                   PTATASTATTKPAPVRPAASTSTGGGGSDDDVLQRIRAPKWHSYLPGMFR"
FT   misc_feature    complement(296964..297023)
FT                   /locus_tag="Smlt0281"
FT                   /note="1 probable transmembrane helix predicted for
FT                   Smlt0281 by TMHMM2.0 at aa 7-26"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(296970..297041)
FT                   /locus_tag="Smlt0281"
FT                   /note="Signal peptide predicted for Smlt0281 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.842 between residues 24 and 25"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        297177..298145
FT                   /transl_table=11
FT                   /gene="birA"
FT                   /locus_tag="Smlt0282"
FT                   /product="putative bifunctional protein BirA"
FT                   /EC_number="6.3.4.15"
FT                   /note="similarity:fasta; with=UniProt:Q4UPF8
FT                   (EMBL:CP000050;); Xanthomonas campestris pv. campestris
FT                   (strain 8004).; Biotin acetyl-CoA-carboxylase synthetase.;
FT                   length=321; id 68.323%; ungapped id 68.536%; E()=5.5e-76;
FT                   322 aa overlap; query 1-322; subject 1-321"
FT                   /note="similarity:fasta; with=UniProt:P06709
FT                   (EMBL:L14557;); Escherichia coli.; birA; Bifunctional
FT                   protein birA [Includes: Biotin operon repressor;
FT                   Biotin--[acetyl-CoA-carboxylase] synthetase (EC 6.3.4.15)
FT                   (Biotin--protein ligase)].; length=321; id 39.812%;
FT                   ungapped id 40.968%; E()=2e-32; 319 aa overlap; query
FT                   5-322; subject 9-319"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0282"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43886"
FT                   /db_xref="GOA:B2FI98"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2FI98"
FT                   /protein_id="CAQ43886.1"
FT                   /translation="MDDRQLLAKLAAGRLSGDALARELGQTRAAIWKRIQGLRAAGVDI
FT                   EGRAGEGYGLTRPVDLLDPAAIRAGLPGDAQALLHDLQVAWTVDSTNAELLRCSAPQRG
FT                   VSVLLAERQTGGRGRRGRTWASPLAAHIYLSVLRLFSGGLGRLAGLSLVAGIAVAEALH
FT                   DLGYTQAQLKWPNDLIVDGKRKLVGLLAEGGGEYAGPARAVIGIGINTHMPPSFAEQIT
FT                   QPWVDLDTLAGKPVDRNVVVAAVLARLLPALEEFDREGLAPFLPRYAAFDMLAGREVRV
FT                   ELEGQWQRGTALGLADDGALRVRIDGRERLLHAGEVSVRAA"
FT   misc_feature    297180..297338
FT                   /gene="birA"
FT                   /locus_tag="Smlt0282"
FT                   /note="HMMPfam hit to PF08279, HTH domain, score 2.6e-11"
FT                   /inference="protein motif:HMMPfam:PF08279"
FT   misc_feature    297429..297719
FT                   /gene="birA"
FT                   /locus_tag="Smlt0282"
FT                   /note="HMMPfam hit to PF03099, Biotin/lipoate A/B protein
FT                   ligase famil, score 4e-13"
FT                   /inference="protein motif:HMMPfam:PF03099"
FT   repeat_region   297777..297784
FT                   /rpt_unit_seq="(gc)4"
FT   misc_feature    297996..298136
FT                   /gene="birA"
FT                   /locus_tag="Smlt0282"
FT                   /note="HMMPfam hit to PF02237, Biotin protein ligase C
FT                   terminal domain, score 3.5e-08"
FT                   /inference="protein motif:HMMPfam:PF02237"
FT   CDS_pept        298142..298873
FT                   /transl_table=11
FT                   /locus_tag="Smlt0283"
FT                   /product="putative Bvg accessory factor-like
FT                   transcriptional regulator"
FT                   /note="similarity:fasta; with=UniProt:Q45338
FT                   (EMBL:AF016461;); Bordetella pertussis.; baf; Bvg accessory
FT                   factor.; length=267; id 29.730%; ungapped id 32.766%;
FT                   E()=7.4e-07; 259 aa overlap; query 5-239; subject 4-262"
FT                   /note="similarity:fasta; with=UniProt:Q3BN23
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; Putative transcriptional regulator, Bvg
FT                   accessory factor family.; length=242; id 72.574%; ungapped
FT                   id 72.881%; E()=1e-60; 237 aa overlap; query 1-237; subject
FT                   1-236"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0283"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43887"
FT                   /db_xref="GOA:B2FIV8"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2FIV8"
FT                   /protein_id="CAQ43887.1"
FT                   /translation="MSDWLFDLGNSRFKFAPLQGDRAGDVQAWAHGAEGMAGQPPHSLP
FT                   SGTTAFVASVAAPSLTSAMLDQLQRRFEHVHVVRTSAECAGVRIAYAKPEKFGVDRFLA
FT                   LLAAAKAQRPVLVVGVGTALTIDLLDADGQHHGGRISASPTTMREALHARAVQLPATGG
FT                   DYSEFANDTADALASGCDGAAVALIERSAQQAHTLLGVAPSLLVHGGGAPALMPLLPGA
FT                   DYHPSLVLDGLARWAVHQPAG"
FT   misc_feature    298154..298723
FT                   /locus_tag="Smlt0283"
FT                   /note="HMMPfam hit to PF03309, Bordetella pertussis Bvg
FT                   accessory fac, score 1.7e-18"
FT                   /inference="protein motif:HMMPfam:PF03309"
FT   CDS_pept        298883..299731
FT                   /transl_table=11
FT                   /locus_tag="Smlt0284"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q3BN24
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; Hypothetical protein.; length=285; id
FT                   44.521%; ungapped id 50.980%; E()=5.1e-24; 292 aa overlap;
FT                   query 20-282; subject 2-285"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0284"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43888"
FT                   /db_xref="GOA:B2FIV9"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:B2FIV9"
FT                   /protein_id="CAQ43888.1"
FT                   /translation="MLTRALIVVLAILNLGVACWWLLRDAPQKPAPPPQPAGVAELRWV
FT                   PGGVDAAAAAEATAAAPTAPLMEREPAEKTAVAVTPAPAAPAKPEIAKPQAAEATPVAA
FT                   AAKPVAPSAHVPAPEKPATPPAAAEPPRCVALGPFADRAAATSAQGKASTLLSQVRLRE
FT                   QPAASGSARYRVMLPAAANREEAQATVKRIVAAGLSDYYIISQGEEANAVALGQYRNRE
FT                   GAERRMAAVQAAGFQPRLVASGDAGQWWLEGQLAAGTQPAQAQQRSGATQSRSLECARL
FT                   R"
FT   misc_feature    298895..298954
FT                   /locus_tag="Smlt0284"
FT                   /note="1 probable transmembrane helix predicted for
FT                   Smlt0284 by TMHMM2.0 at aa 5-24"
FT                   /inference="protein motif:TMHMM:2.0"
FT   repeat_region   298974..298985
FT                   /rpt_unit_seq="(cgc)4"
FT   repeat_region   complement(299121..299143)
FT                   /rpt_family="GC_rich"
FT                   /inference="nucleotide motif:RepeatScout"
FT   repeat_region   299250..299278
FT                   /rpt_family="GC_rich"
FT                   /inference="nucleotide motif:RepeatScout"
FT   misc_feature    299387..299608
FT                   /locus_tag="Smlt0284"
FT                   /note="HMMPfam hit to PF05036, Sporulation related domain,
FT                   score 7.1e-07"
FT                   /inference="protein motif:HMMPfam:PF05036"
FT   repeat_region   299775..299855
FT                   /rpt_family="R=18"
FT                   /inference="nucleotide motif:RepeatScout"
FT   CDS_pept        complement(299949..301127)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0285"
FT                   /product="putative phage integrase"
FT                   /note="similarity:fasta; with=UniProt:Q8PJA9
FT                   (EMBL:AE011903;); Xanthomonas axonopodis pv. citri.; int;
FT                   Phage-related integrase.; length=413; id 55.216%; ungapped
FT                   id 55.928%; E()=7.2e-85; 393 aa overlap; query 1-388;
FT                   subject 1-393"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0285"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43889"
FT                   /db_xref="GOA:B2FIW0"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B2FIW0"
FT                   /protein_id="CAQ43889.1"
FT                   /translation="MTRGRRRKFNPEIPGHIDQGSLPRGLYWEDGRWYVLSPHPEGVGR
FT                   IKMTVANGNARLSDLHAIMEARGGGSLRGSLDHLTEIFKKSSEYLDLSAKSREGYDYCA
FT                   AKACGYLLRDGRLLGQQRVEYLSVPVLQRVVETLATGRPAIGKLPGIPATPAAANRVAS
FT                   YLRRLFAWGIRHGHCTTNPADGIRKVREKRDARMPDHDSFDAVLRFARTCAGRQAHTAG
FT                   SCPPYLPAVMVLAYAVRLRGIEVDTLTDAHLQHEGIRSNRRKGSRDNVTLWTKELRAAV
FT                   KWLQGYRDERMQAHGRPIPIKPEQRRLLVSESGTPLTKSALDSAWQRMVRRAIAEGVIE
FT                   KDQRFALHGLKHRGITDSEDKGAGGHVTEAMRQLYDHSVPVVKAAVKPKKSR"
FT   misc_feature    complement(299973..300509)
FT                   /locus_tag="Smlt0285"
FT                   /note="HMMPfam hit to PF00589, Phage integrase family,
FT                   score 0.042"
FT                   /inference="protein motif:HMMPfam:PF00589"
FT   CDS_pept        complement(301127..301351)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0286"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q8P6F8
FT                   (EMBL:AE012414;); Xanthomonas campestris pv. campestris.;
FT                   Hypothetical protein XCC3011.; length=86; id 56.944%;
FT                   ungapped id 58.571%; E()=7.3e-14; 72 aa overlap; query
FT                   3-74; subject 17-86"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0286"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43890"
FT                   /db_xref="UniProtKB/TrEMBL:B2FIW1"
FT                   /protein_id="CAQ43890.1"
FT                   /translation="MAQILHFNDLQRICAPDGPPPTPSTVERWADAQGILYKYDRRGRI
FT                   WTTVEAINAALGLPGATTHPHETTLLELV"
FT   CDS_pept        complement(301699..302004)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0287"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q2P808
FT                   (EMBL:AP008229;); Xanthomonas oryzae pv. oryzae (strain
FT                   MAFF 311018).; Hypothetical protein XOO0564.; length=81; id
FT                   73.611%; ungapped id 74.648%; E()=3.1e-14; 72 aa overlap;
FT                   query 1-72; subject 1-71"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0287"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43891"
FT                   /db_xref="UniProtKB/TrEMBL:B2FIW2"
FT                   /protein_id="CAQ43891.1"
FT                   /translation="MNLDRVIQVALQAKRMGGTGPLSTGEALTAALVLNRHDWLADMDY
FT                   TSAQALDRIDADTIQHLGDAARCVIGNEEDSFGPVAHVYDAMGEWPGTKEGGCRHG"
FT   CDS_pept        complement(302179..302604)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0288"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q8P6G4; Xanthomonas
FT                   campestris pv. campestris.; Hypothetical protein XCC3005.;
FT                   length=136; id 42.105%; ungapped id 44.444%; E()=9.9e-12;
FT                   133 aa overlap; query 12-140; subject 6-135"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0288"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43892"
FT                   /db_xref="UniProtKB/TrEMBL:B2FIW3"
FT                   /protein_id="CAQ43892.1"
FT                   /translation="MQQMTGKAMTTLAKSLDSSTGPGAEAITGVHNRVIAGSGGESEAS
FT                   ATITLHVTHNRVIATAMLNMGPAKVAQCVFERRKGSSKGWELVKGTDFNDETSCISPEL
FT                   ADLASRVPFPYEVANMLPGKRATAAAMAQAAQEVANG"
FT   CDS_pept        complement(302681..302959)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0289"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0289"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43893"
FT                   /db_xref="UniProtKB/TrEMBL:B2FIW4"
FT                   /protein_id="CAQ43893.1"
FT                   /translation="MTRPNNAAVRAAFWQVVEAGLVSRGVGNHTSDPSQLAVCMPEVRT
FT                   EAKRLGVRLPAGKSLLDAMRTCHRLVDVTPIRSRVRHSTVTCWIFRK"
FT   CDS_pept        complement(302956..305652)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0290"
FT                   /product="putative phage-related protein"
FT                   /note="similarity:fasta; with=UniProt:Q9ZXI8
FT                   (EMBL:AB008550;); Pseudomonas phage phi CTX.; Orf37.;
FT                   length=895; id 54.273%; ungapped id 55.442%; E()=6.4e-188;
FT                   901 aa overlap; query 9-897; subject 1-894"
FT                   /note="similarity:fasta; with=UniProt:Q2P543
FT                   (EMBL:AP008229;); Xanthomonas oryzae pv. oryzae (strain
FT                   MAFF 311018).; Phage-related protein.; length=898; id
FT                   70.333%; ungapped id 70.647%; E()=0; 900 aa overlap; query
FT                   1-898; subject 1-898"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0290"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43894"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="UniProtKB/TrEMBL:B2FIW5"
FT                   /protein_id="CAQ43894.1"
FT                   /translation="MQEEIRQQVLSRIERDYGLKHRSGTEYMRGGKCPHCGKKELYTSF
FT                   LKPWVLRCGRQAKCGQEVRVRDLYDDLFDDYSKHNPQTPQAPHAAADAYLATGRGFNVK
FT                   PLQGLYTQEDYYDRDKRQGTATVRFPLVKGGWWERLIDRPHRFGKMKARFAPGESYAGV
FT                   WWGAAARDQLRTAREVWIVEGIFDAIALLQRGICAVAAMSSNAFPELSLKELCTARPND
FT                   LPMLVWALDNEPGARGFTAKHIRRAEKLGYRCKAAQIEQTGEKKTDWNDLHLRAQAAED
FT                   GDSQWQADIDLALHNGALLMARTAMDKGLIMYEREKHTEFHLEHNSRLYWFEFDALRYE
FT                   KLCRERAVDRDLASEDELEAEELAKIQRASASIRQIANCYPEALYFQKHEATDESWYFF
FT                   RVDFPHDAPSVKGTFTGAQIASATEFKKRLLSLAQGALFSGTGKHLDKVMDAQTFGIKD
FT                   VATVDFVGYSPDHKAYIFGDLAVRNGEVTLANAEDYFEFPKLRIKTTQRSIRMDIQRDH
FT                   EVYRAEWLQWLWTCFGTNGMVALTFWFGSLFANQIRSAHKSFPFLEATGEAGAGKTTLL
FT                   TFLWKLLARSDYEGFDPAKSSKAGRARAMGQTSGMPVVLLEADRDAPDKAHAKSFEWDE
FT                   LKDYYGGGTLATRGVRNGGNETYEPPFRGTIVISQNAAVDASEAIMTRIVKLHFRKPNA
FT                   TTESRLAADNLNALQVEDLSHFLIKAVRAEAQVMEKFAERVRFYEAKLRENKDLRMERL
FT                   IKNHSQMLALLDGLRLVIDIPEDLVTATRKALVGMAMERQSAVSADHPLVNEFWEAYEY
FT                   LESIGNGERPVVNHSRDSQRIAINLNDFIAKAAHHSQPVAELKLLRAYLRDSRRYKLVD
FT                   TNLTVNSAIKTNSTGAGVAVRCWVFKK"
FT   CDS_pept        complement(306023..306484)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0291"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0291"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43895"
FT                   /db_xref="UniProtKB/TrEMBL:B2FIW6"
FT                   /protein_id="CAQ43895.1"
FT                   /translation="MAQRRLSGVHRPAGRRRCVSAHHHPGRRADGLHRAVRCPPGRAYC
FT                   RRQGGALMAPTNVIMPAEALRPVIVLETQIPGFGLRASFDQRRVLYLALIHIDSDAAAT
FT                   VSAHNSRNVQRAATEGIQTGTVVYLLAKGEADRFFDWLRTGDSYPGGVN"
FT   CDS_pept        complement(306894..307100)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0293"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q8P6G8; Xanthomonas
FT                   campestris pv. campestris.; Hypothetical protein XCC3001.;
FT                   length=79; id 44.643%; ungapped id 46.296%; E()=0.0001; 56
FT                   aa overlap; query 6-59; subject 2-57"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0293"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43896"
FT                   /db_xref="UniProtKB/TrEMBL:B2FIW7"
FT                   /protein_id="CAQ43896.1"
FT                   /translation="MMRHKTQFDGWSSAMEPSFVTAPVRIEYVTYAQKQRDAAELRALV
FT                   EAHIAAGGAYVVLSATTAAQVSA"
FT   CDS_pept        complement(307169..307486)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0294"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar, but extended at the N-terminus, to
FT                   Xanthomonas campestris pv. campestris hypothetical protein
FT                   xcc2999. hypothetical protein xcc2999. UniProt:Q8P6H0 (67
FT                   aa) fasta scores: E()=3.3e-08, 49.231% id in 65 aa, and
FT                   similar, to entire protein of Burkholderia pseudomallei
FT                   (Pseudomonas pseudomallei) putative phage protein.
FT                   UniProt:Q63YP9 (82 aa) fasta scores: E()=0.0039, 38.889% id
FT                   in 72 aa"
FT                   /note="similarity:fasta; with=UniProt:Q8P6H0; Xanthomonas
FT                   campestris pv. campestris.; Hypothetical protein XCC2999.
FT                   Hypothetical protein XCC2999.; length=67; id 49.231%;
FT                   ungapped id 50.000%; E()=3.3e-08; 65 aa overlap; query
FT                   28-92; subject 2-65"
FT                   /note="similarity:fasta; with=UniProt:Q63YP9; Burkholderia
FT                   pseudomallei (Pseudomonas pseudomallei).; Putative phage
FT                   protein.; length=82; id 38.889%; ungapped id 39.437%;
FT                   E()=0.0039; 72 aa overlap; query 4-75; subject 7-77"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0294"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43897"
FT                   /db_xref="InterPro:IPR007684"
FT                   /db_xref="UniProtKB/TrEMBL:B2FIW8"
FT                   /protein_id="CAQ43897.1"
FT                   /translation="MFTCDACGTPLTKRTSALQHRHLRTDAYVCQNPMCGATYTGMSEL
FT                   TSIASPSGLPNAPACELPPTPGYERSLLQQRWRLERGEVQMDWIESSEFNQQDSGALPA
FT                   P"
FT   misc_feature    complement(307340..307480)
FT                   /locus_tag="Smlt0294"
FT                   /note="HMMPfam hit to PF04606, Ogr/Delta-like zinc finger,
FT                   score 1.3e-10"
FT                   /inference="protein motif:HMMPfam:PF04606"
FT   CDS_pept        complement(307510..307842)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0295"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q8P6H1
FT                   (EMBL:AE012413;); Xanthomonas campestris pv. campestris.;
FT                   Hypothetical protein XCC2998.; length=84; id 48.193%;
FT                   ungapped id 48.780%; E()=3.1e-10; 83 aa overlap; query
FT                   1-82; subject 1-83"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0295"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43898"
FT                   /db_xref="InterPro:IPR026365"
FT                   /db_xref="UniProtKB/TrEMBL:B2FIW9"
FT                   /protein_id="CAQ43898.1"
FT                   /translation="MNAKRRTTAPTLRTAEQARQWLIDNGLSVTAFAEANGLSRDAVNN
FT                   ALRSDSKCRIGKTHAAAVALGMKAAPDSHTELPKTTRIHANKGKAGTASARKTVAKKAP
FT                   KRGAKA"
FT   CDS_pept        307912..308343
FT                   /transl_table=11
FT                   /gene="Gp17"
FT                   /locus_tag="Smlt0296"
FT                   /product="putative phage-related protein"
FT                   /note="similarity:fasta; with=UniProt:Q6QID2; Burkholderia
FT                   cenocepacia phage BcepMu.; Gp17.; length=138; id 34.043%;
FT                   ungapped id 36.090%; E()=3.6e-08; 141 aa overlap; query
FT                   2-140; subject 3-137"
FT                   /note="similarity:fasta; with=UniProt:Q8P6H2; Xanthomonas
FT                   campestris pv. campestris.; Z2969; Phage-related protein.;
FT                   length=142; id 43.056%; ungapped id 44.286%; E()=8.2e-15;
FT                   144 aa overlap; query 1-142; subject 1-142"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0296"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43899"
FT                   /db_xref="GOA:B2FIX0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B2FIX0"
FT                   /protein_id="CAQ43899.1"
FT                   /translation="MSVGNRLKEERKRLGLTQEAIGLACGVAKRTQILFEQDAHVPGGA
FT                   YFAAADELGMDVAYVLVGRRDRLSESDADLLNAWRTASPSARVAAMAALTGVAPAAAGT
FT                   APRTLFQNATIGQQISADADLRAQKIVVKAPKGSKKATP"
FT   repeat_region   308286..308293
FT                   /rpt_unit_seq="(gc)4"
FT   CDS_pept        308630..309400
FT                   /transl_table=11
FT                   /locus_tag="Smlt0297"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q6AL85
FT                   (EMBL:CR522870;); Desulfotalea psychrophila.; Hypothetical
FT                   protein.; length=258; id 44.195%; ungapped id 48.560%;
FT                   E()=1.3e-33; 267 aa overlap; query 1-253; subject 1-257"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0297"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43900"
FT                   /db_xref="InterPro:IPR019302"
FT                   /db_xref="UniProtKB/TrEMBL:B2FIX1"
FT                   /protein_id="CAQ43900.1"
FT                   /translation="MQRGTEFPGARFSLQTIRSAIETYREVLSEIGEPLLDEALKVDLA
FT                   DGQWEFDDENEFFAAVPQGTGYSVYLSGRSVRLQVNQLRQRAVVYVKAPTRANVQRIFG
FT                   PFDSKQGTEVVPAASPVVFIGHGRSPAWKDLRDHLRDQHDYRIESYESGARAGHSIRDI
FT                   LESMAAKSSFALLVMTGEDMDASGEMRARQNVIHEAGIFQGRLGFSRAIMLLEEDVVEF
FT                   SNVDGVQYIPFSKGRIREAYGDVLATLRREFGPG"
FT   CDS_pept        309586..310977
FT                   /transl_table=11
FT                   /locus_tag="Smlt0298"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q9CLW5
FT                   (EMBL:AE006149;); Pasteurella multocida.; Hypothetical
FT                   protein PM1084.; length=428; id 27.019%; ungapped id
FT                   29.592%; E()=1.1e-19; 322 aa overlap; query 1-304; subject
FT                   1-312"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0298"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43901"
FT                   /db_xref="InterPro:IPR041578"
FT                   /db_xref="UniProtKB/TrEMBL:B2FIX2"
FT                   /protein_id="CAQ43901.1"
FT                   /translation="MRAEFLGYFEPSARDIARMWKGATIALDTNVLLGLYRMPRKSREE
FT                   IFEVLKSVRDRLWVPYHVLVEYHSNRLNTLRDEFEAAEKMERDFRGSFVDFKAIVTEEK
FT                   VTKRACWPELSEKFVEIEAKAKELYAIARKERSNYIAPSDDDEIRDFLEKLLEGRIGAR
FT                   PSDQSVVDAAEEIAAKRYASGLGPGHLDEKKIGTHLVDGLVYQRQYGDYMVWAGLIEHC
FT                   QREKPEGVIFVTSDVKDDWWLDTRGKAGKKPQPELVMEMQRVARVRDFGMYTLSTFAAN
FT                   AKSRLKLKVDDQTITDALQAEHVAPKFAVQRGWMIARGASHKNGEPLGVFHSHLEGLDY
FT                   KNLLESLGAKTRLLGSVGTFGIRNNDDGTTELVLVAGLRMMTSSLESEGKLILRRMADW
FT                   DEASAWHIYLVPDSDEKLVGRASFKKRVGELIAPYVPAGTSVTIHIGDHTGPGKLAYAF
FT                   TSEDG"
FT   CDS_pept        complement(310974..311966)
FT                   /transl_table=11
FT                   /gene="D"
FT                   /locus_tag="Smlt0299"
FT                   /product="putative phage-related protein"
FT                   /note="similarity:fasta; with=UniProt:P10312; Bacteriophage
FT                   P2.; D; Gene D protein (GpD).; length=387; id 44.444%;
FT                   ungapped id 50.157%; E()=7.6e-39; 360 aa overlap; query
FT                   9-328; subject 15-373"
FT                   /note="similarity:fasta; with=UniProt:Q8P6H5; Xanthomonas
FT                   campestris pv. campestris.; D; Phage-related tail protein.;
FT                   length=328; id 65.944%; ungapped id 66.149%; E()=8.7e-82;
FT                   323 aa overlap; query 6-328; subject 3-324"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0299"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43902"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:B2FIX3"
FT                   /protein_id="CAQ43902.1"
FT                   /translation="MRASPYPIPAWRVMLDGQDLTDRMAPRLLDLSLTESRGDEADEVS
FT                   LRLHDHDGMLALPRRGVTLQVAIGWRDSGLFDKGTFKVDDVEHSGAPDIVSIRARSADL
FT                   TGAVRSRRERSWHDTTLGDILTAIAGEHSLRPSIAADLASVRIPHLDQANESDINLLTR
FT                   LGKRFDAVATVKAGALIFAPIGAGTTASGAPLPGVQITRASGDQHRYTVADRDSYTGVR
FT                   AYWGDRKAARRTGVLVGTSDNEKKLQATYSTADEARQHAEAEFKRLERGTAQLSYRLAL
FT                   GRADIYPEQTVTVSGFKPQIDGTDWLVAKTTHTIDGSGGFVTALELERG"
FT   misc_feature    complement(310977..311948)
FT                   /gene="D"
FT                   /locus_tag="Smlt0299"
FT                   /note="HMMPfam hit to PF05954, Phage late control gene D
FT                   protein (GPD), score 6.2e-167"
FT                   /inference="protein motif:HMMPfam:PF05954"
FT   repeat_region   311297..311308
FT                   /rpt_unit_seq="(acgc)3"
FT   CDS_pept        complement(311963..312361)
FT                   /transl_table=11
FT                   /gene="GpU"
FT                   /locus_tag="Smlt0300"
FT                   /product="putative phage tail protein"
FT                   /note="similarity:fasta; with=UniProt:O64315; Bacteriophage
FT                   P2.; GpU.; length=159; id 39.062%; ungapped id 39.062%;
FT                   E()=1.2e-13; 128 aa overlap; query 1-128; subject 1-128"
FT                   /note="similarity:fasta; with=UniProt:Q8P6H6; Xanthomonas
FT                   campestris pv. campestris.; U; Phage-related tail protein.;
FT                   length=133; id 58.333%; ungapped id 58.333%; E()=4.9e-26;
FT                   132 aa overlap; query 1-132; subject 1-132"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0300"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43903"
FT                   /db_xref="InterPro:IPR009734"
FT                   /db_xref="InterPro:IPR016912"
FT                   /db_xref="UniProtKB/TrEMBL:B2FIX4"
FT                   /protein_id="CAQ43903.1"
FT                   /translation="MMMTYGTFVFSLSTAAYEQLQRQMTWRHASSERLGARPARQYVGP
FT                   GDDSISLQGTISAELVDNLQVLDELRELADQGKPQALVEGSGRVYGAYLLVSLSETRKE
FT                   FFPDGTPRLIEFQLQLERDDDGAAEAVA"
FT   misc_feature    complement(311984..312346)
FT                   /gene="GpU"
FT                   /locus_tag="Smlt0300"
FT                   /note="HMMPfam hit to PF06995, Phage P2 GpU, score 6.4e-54"
FT                   /inference="protein motif:HMMPfam:PF06995"
FT   repeat_region   312251..312258
FT                   /rpt_unit_seq="(gc)4"
FT   CDS_pept        complement(312373..315237)
FT                   /transl_table=11
FT                   /gene="GpT"
FT                   /locus_tag="Smlt0301"
FT                   /product="putative phage tail protein"
FT                   /note="similarity:fasta; with=UniProt:O64314; Bacteriophage
FT                   P2.; GpT.; length=815; id 27.273%; ungapped id 30.131%;
FT                   E()=1.4e-19; 759 aa overlap; query 5-735; subject 4-718"
FT                   /note="similarity:fasta; with=UniProt:Q8P6H7; Xanthomonas
FT                   campestris pv. campestris.; T; Phage-related tail protein.;
FT                   length=956; id 64.811%; ungapped id 65.084%; E()=1e-189;
FT                   952 aa overlap; query 5-954; subject 6-955"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0301"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43904"
FT                   /db_xref="GOA:B2FIX5"
FT                   /db_xref="InterPro:IPR010090"
FT                   /db_xref="UniProtKB/TrEMBL:B2FIX5"
FT                   /protein_id="CAQ43904.1"
FT                   /translation="MSGGNLRLQVVLQALDQATAPFRKVMAGSKGLSSALQEQQATLRR
FT                   LNAAQRDVGAYRQAQAATRSLQSAHEAATAKVRQLAGEIARSNAPTRAMSKALNEAKRS
FT                   AASLKTQHQQSAVELQRLRTGLDRAGISTQQLGSHERKLRTDIAATSAKMDEQRTRLAS
FT                   LDAAMARSRKIHSAGMTAAATGTGMALAAATALRVQAFPIAQAMTFESAMADVKKVVDF
FT                   DSPEQFKQMSRDVEDLSQRLPMVPADIAKIVAAAGQASIPRQELVRFAEDAAKMGVAFD
FT                   STAEEAGQMMATWRTAFRMGQDDVVVLADKINYLGNTGPASVQKISDVVNRIGALGEVA
FT                   GLGSGPLAALGATVAGMGIESEVSATGIKNMLLTLSSGDAATKRQVESFKKLGLNAGDM
FT                   AQAMQKDAGGAIMQVLEKLKQLPKAEQAATMTQLFGRESIGAIAPLLTNLELLKDNFGK
FT                   VADEQKYGGSMNNEYAARVATSENALQLLKNTGLVLSQSIGQTLLPTFKELAEKTAAVV
FT                   GKVTGWVRENPQLTASIAKLAIGGTALATALGGLLVAGGVGAMALTQIHKATTLLSGGG
FT                   GIGKLIGQVLSLGGRAFPMLFNVGRMLLPLLGGISLPVLAIGVAIGVVAALVWKYWEPI
FT                   KAFMIGVWQGILDVVNPIMAELMTALEPLGPVWDMISGAMSQAWDWVKKLFTPFEATSE
FT                   QLQGATDAGRGFGQILGNVLTVNLRMAVKAIGWLVDAFTTILPVIQNAVGGAWTYLQGA
FT                   WDLIVGLFTLDGGKIRAGLTAMWEGANQILLSWPAKMMQAGVDMIAGLINGVKSMGGAA
FT                   FDAIAGIAEGVTIKFKSMLGIHSPSRVFAQFGDFTMQGLAGGLDRSQGEPLQQVASLGD
FT                   RMKQAGAGIALGAAALPALAAGGPVVAPGAAPGAAGATGAASYTINITAPAGSDGQAIA
FT                   DLVRQTIEQIERDRASRRGSRLSD"
FT   misc_feature    complement(order(313351..313419,313561..313629))
FT                   /gene="GpT"
FT                   /locus_tag="Smlt0301"
FT                   /note="2 probable transmembrane helices predicted for
FT                   Smlt0301 by TMHMM2.0 at aa 537-559 and 607-629"
FT                   /inference="protein motif:TMHMM:2.0"
FT   repeat_region   313809..313816
FT                   /rpt_unit_seq="(cg)4"
FT   CDS_pept        complement(315263..315379)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0302"
FT                   /product="putative phage protein"
FT                   /note="similarity:fasta; with=UniProt:Q63LC2; Burkholderia
FT                   pseudomallei (Pseudomonas pseudomallei).; Hypothetical
FT                   phage protein.; length=37; id 62.162%; ungapped id 62.162%;
FT                   E()=5e-08; 37 aa overlap; query 1-37; subject 1-37"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0302"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43905"
FT                   /db_xref="InterPro:IPR009493"
FT                   /db_xref="UniProtKB/TrEMBL:B2FIX6"
FT                   /protein_id="CAQ43905.1"
FT                   /translation="MADIAAIFGFTLTELSALSLSELVQWRERARVRSGAEQ"
FT   misc_feature    complement(315269..315379)
FT                   /locus_tag="Smlt0302"
FT                   /note="HMMPfam hit to PF06528, Phage P2 GpE, score 3.5e-13"
FT                   /inference="protein motif:HMMPfam:PF06528"
FT   CDS_pept        complement(315388..315714)
FT                   /transl_table=11
FT                   /gene="GpE+E'"
FT                   /locus_tag="Smlt0303"
FT                   /product="putative phage tail protein"
FT                   /note="similarity:fasta; with=UniProt:O64312; Bacteriophage
FT                   P2.; E+E'; GpE+E'.; length=142; id 39.286%; ungapped id
FT                   39.286%; E()=2.4e-07; 84 aa overlap; query 17-100; subject
FT                   5-88"
FT                   /note="similarity:fasta; with=UniProt:Q8P6H9; Xanthomonas
FT                   campestris pv. campestris.; E; Phage-related tail protein.;
FT                   length=100; id 62.791%; ungapped id 62.791%; E()=1.1e-16;
FT                   86 aa overlap; query 19-104; subject 9-94"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0303"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43906"
FT                   /db_xref="InterPro:IPR019289"
FT                   /db_xref="UniProtKB/TrEMBL:B2FIX7"
FT                   /protein_id="CAQ43906.1"
FT                   /translation="MNDSTNPTAAAETADPNTVVLETPLQRGDQQITSIHLRKPNSGEL
FT                   RGLKLQDLLQTEVTSLATLLPRISTPTLTAADVNNLDPVDLVSVATVVVHFFLSKAQRE
FT                   FLPA"
FT   misc_feature    complement(315409..315666)
FT                   /gene="GpE+E'"
FT                   /locus_tag="Smlt0303"
FT                   /note="HMMPfam hit to PF06158, Phage tail protein E, score
FT                   2.5e-44"
FT                   /inference="protein motif:HMMPfam:PF06158"
FT   repeat_region   315681..315692
FT                   /rpt_unit_seq="(cgg)4"
FT   CDS_pept        complement(315770..316279)
FT                   /transl_table=11
FT                   /gene="FII"
FT                   /locus_tag="Smlt0304"
FT                   /product="putative major tail tube protein"
FT                   /note="similarity:fasta; with=UniProt:P22502; Bacteriophage
FT                   P2.; FII; Major tail tube protein (Protein FII).;
FT                   length=171; id 45.294%; ungapped id 46.108%; E()=1e-26; 170
FT                   aa overlap; query 2-168; subject 1-170"
FT                   /note="similarity:fasta; with=UniProt:Q8P6I0; Xanthomonas
FT                   campestris pv. campestris.; FII; Phage-related tail
FT                   protein.; length=169; id 77.515%; ungapped id 77.515%;
FT                   E()=5.5e-51; 169 aa overlap; query 1-169; subject 1-169"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0304"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43907"
FT                   /db_xref="InterPro:IPR006498"
FT                   /db_xref="UniProtKB/TrEMBL:B2FIX8"
FT                   /protein_id="CAQ43907.1"
FT                   /translation="MSLPSKLKNLNLFNDGASYLGQVVEVKLPTLTRKMEEFRAGGMLG
FT                   PIDIDLGQEKIELEWKCGGLMRDVLRQYGAVRHNAVQLRFAGAYQREDTADVDAVEIVI
FT                   RGRHSEIDAGTGKVGDDTEFSVKTTASYYKLSINGRTEIEIDMVGMVFIVNGVDQLAAQ
FT                   RRAIGA"
FT   misc_feature    complement(315773..316276)
FT                   /gene="FII"
FT                   /locus_tag="Smlt0304"
FT                   /note="HMMPfam hit to PF04985, Phage tail tube protein FII,
FT                   score 9e-86"
FT                   /inference="protein motif:HMMPfam:PF04985"
FT   CDS_pept        complement(316300..317469)
FT                   /transl_table=11
FT                   /gene="FI"
FT                   /locus_tag="Smlt0305"
FT                   /product="putative major tail sheath protein (protein fi)"
FT                   /note="similarity:fasta; with=UniProt:P22501; Bacteriophage
FT                   P2.; FI; Major tail sheath protein (Protein FI).;
FT                   length=395; id 61.069%; ungapped id 62.176%; E()=1.1e-89;
FT                   393 aa overlap; query 4-389; subject 2-394"
FT                   /note="similarity:fasta; with=UniProt:Q7NAB9; Photorhabdus
FT                   luminescens subsp. laumondii.; Similar to protein FI.;
FT                   length=390; id 66.838%; ungapped id 67.010%; E()=1.8e-98;
FT                   389 aa overlap; query 1-388; subject 1-389"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0305"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43908"
FT                   /db_xref="InterPro:IPR020287"
FT                   /db_xref="InterPro:IPR035089"
FT                   /db_xref="UniProtKB/TrEMBL:B2FIX9"
FT                   /protein_id="CAQ43908.1"
FT                   /translation="MAQDYHHGVRVIELDGGIRPIRTVATAIVGIVCTASDADDTTFPI
FT                   DTPVLLTDVRGAIAKAGTTGTLAGVLSAIADQSNPVTVVVRVDEGEDAAATTSNVIGTV
FT                   AGGRYTGLQALLVAESKLGVKPRIIGAPGLDVEAVATSLASICKKLRAIAYVGVGEAKT
FT                   VSEILLYRKKFGDRELMMMWPDFLTWDTTANKAAVSFATARAIGLRALIDQQTGWHKTL
FT                   SNVKVQGVTGISADVTWDLQDPQTDAGLLNAAQVTTLINSQGYRFWGSRTCSDDPLFSF
FT                   ESATRTAQILADTIAEAQLIYIDKPLHPSLVKDMIETINAKFRELKAGGYVIDASAWYD
FT                   EAANLPTQLSDGKLAIDYDYTPVPPLENLNLRQRITDRYFADFATRINT"
FT   misc_feature    complement(316324..317463)
FT                   /gene="FI"
FT                   /locus_tag="Smlt0305"
FT                   /note="HMMPfam hit to PF04984, Phage tail sheath protein,
FT                   score 1.6e-132"
FT                   /inference="protein motif:HMMPfam:PF04984"
FT   CDS_pept        complement(317485..317835)
FT                   /transl_table=11
FT                   /gene="W"
FT                   /locus_tag="Smlt0306"
FT                   /product="putative baseplate assembly protein W (gpw)"
FT                   /note="similarity:fasta; with=UniProt:P51768; Bacteriophage
FT                   P2.; W; Baseplate assembly protein W (GpW).; length=115; id
FT                   40.909%; ungapped id 41.284%; E()=5.1e-11; 110 aa overlap;
FT                   query 2-111; subject 6-114"
FT                   /note="similarity:fasta; with=UniProt:Q8P6I2; Xanthomonas
FT                   campestris pv. campestris.; W; Phage-related baseplate
FT                   protein.; length=119; id 60.169%; ungapped id 61.739%;
FT                   E()=3.1e-24; 118 aa overlap; query 1-115; subject 1-118"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0306"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43909"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:B2FIY0"
FT                   /protein_id="CAQ43909.1"
FT                   /translation="MIGMDSITGGSAEGTAHLVQSIRDVLTTPIGSRIQRRDYGSLLPE
FT                   LIDQPFNDHTRLQLFGATATALMRWEPRMRLTRVALTPGDTPGAFLLDLDFQLPGAGQQ
FT                   NTLSIPLRFQAP"
FT   misc_feature    complement(317503..317793)
FT                   /gene="W"
FT                   /locus_tag="Smlt0306"
FT                   /note="HMMPfam hit to PF04965, GPW / gp25 family, score
FT                   8.2e-42"
FT                   /inference="protein motif:HMMPfam:PF04965"
FT   CDS_pept        complement(317832..318380)
FT                   /transl_table=11
FT                   /gene="V"
FT                   /locus_tag="Smlt0307"
FT                   /product="putative baseplate assembly protein v (gpv)"
FT                   /note="similarity:fasta; with=UniProt:P31340
FT                   (EMBL:AF063097;); Bacteriophage P2.; V; Baseplate assembly
FT                   protein V (GpV).; length=211; id 36.453%; ungapped id
FT                   42.286%; E()=1.3e-13; 203 aa overlap; query 5-181; subject
FT                   10-210"
FT                   /note="similarity:fasta; with=UniProt:Q8P6I3
FT                   (EMBL:AE012413;); Xanthomonas campestris pv. campestris.;
FT                   V; Phage-related baseplate protein.; length=187; id
FT                   49.162%; ungapped id 50.867%; E()=1.2e-25; 179 aa overlap;
FT                   query 9-181; subject 8-186"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0307"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43910"
FT                   /db_xref="InterPro:IPR006531"
FT                   /db_xref="InterPro:IPR013046"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:B2FIY1"
FT                   /protein_id="CAQ43910.1"
FT                   /translation="MDSGLPQKVSNMMRDGVVTEVDHAAALCRVRSGEMQTDFIPWMTP
FT                   AAGKVRVWLPPSVGEQVQLLCIDGDLANAVALPGLFSATVPAPSSNPDLTLIQFADSAT
FT                   VAYDSAAHALTANLPAGGTVSIVADGGVRISGPVSIDGDVIITGKAEVSEDVTGGGISL
FT                   KQHKHGGVQAGGGTSGPPA"
FT   misc_feature    complement(318033..318335)
FT                   /gene="V"
FT                   /locus_tag="Smlt0307"
FT                   /note="HMMPfam hit to PF04717, Phage-related baseplate
FT                   assembly protein, score 6.7e-48"
FT                   /inference="protein motif:HMMPfam:PF04717"
FT   repeat_region   318405..318412
FT                   /rpt_unit_seq="(cg)4"
FT   CDS_pept        complement(318467..318748)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0308"
FT                   /note="N-terminus is similar to N-terminus of Bordetella
FT                   bronchiseptica (Alcaligenes bronchisepticus) putative tail
FT                   fiber assembly protein. UniProt:Q7WDH0 (117 aa) fasta
FT                   scores: E()=0.004, 44.444% id in 63 aa"
FT                   /note="similarity:fasta; with=UniProt:Q7WDH0; Bordetella
FT                   bronchiseptica (Alcaligenes bronchisepticus).; Putative
FT                   tail fiber assembly protein.; length=117; id 44.444%;
FT                   ungapped id 45.902%; E()=0.004; 63 aa overlap; query 1-63;
FT                   subject 1-61"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0308"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43911"
FT                   /db_xref="UniProtKB/TrEMBL:B2FIY2"
FT                   /protein_id="CAQ43911.1"
FT                   /translation="MKTKLVWQCDDAGYLIGRAAADESPLEPGVFLIPFGAVATKPPHS
FT                   LTAKQEWRWLAGAWKVVDARPTPAPSPPEQRLADFLKANPDITALLSR"
FT   CDS_pept        complement(318758..319990)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0309"
FT                   /product="putative phage collar protein"
FT                   /note="Codons 255 to 410 are similar to codons 65 to the
FT                   C-terminus of Rhizobium leguminosarum bv. viciae protein
FT                   rhib. UniProt:Q03314 (219 aa) fasta scores: E()=1.1e-05,
FT                   32.927% id in 164 aa, and similar to codons 100 to the
FT                   C-terminus of Xylella fastidiosa (strain Temecula1/ATCC
FT                   700964) phage-related protein. UniProt:Q87EE7 (421 aa)
FT                   fasta scores: E()=4e-33, 43.561% id in 264 aa"
FT                   /note="similarity:fasta; with=UniProt:Q03314; Rhizobium
FT                   leguminosarum bv. viciae.; rhiB; Protein rhiB.; length=219;
FT                   id 32.927%; ungapped id 36.986%; E()=1.1e-05; 164 aa
FT                   overlap; query 256-410; subject 64-218"
FT                   /note="similarity:fasta; with=UniProt:Q87EE7; Xylella
FT                   fastidiosa (strain Temecula1/ATCC 700964).; Phage-related
FT                   protein.; length=421; id 43.561%; ungapped id 46.559%;
FT                   E()=4e-33; 264 aa overlap; query 1-251; subject 102-361"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0309"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43912"
FT                   /db_xref="InterPro:IPR011083"
FT                   /db_xref="InterPro:IPR037053"
FT                   /db_xref="UniProtKB/TrEMBL:B2FIY3"
FT                   /protein_id="CAQ43912.1"
FT                   /translation="MRLKFTTRGRAALVNAAHTGTKAVTVTQVGVTERAFTPDPNGGDL
FT                   TLPGERKRLTTFGGKAVADDVVHLTVRDETTDSYQLRGIGLYLDDGTLLAVYGSDAVLL
FT                   EKSTQAMMMLAIDWLMADMDAKQIQFGSTDFLNPPATVETQGVVELATDSEAIAGTDRQ
FT                   RALSPAAFRAGLNDRLGSGAPTLLTKTMLGRETAAEVRKDLGVKGAALKDEGTGNGLDA
FT                   DTVDGKHATDFAAKQHRHSIADITDLHSERLLPAGMVAHFPTGGPPPGWLRCNGADVSR
FT                   TTYADLFAVIGTLFGSANDMTFRLPDLRGEFVRGWDDGRGVDGGRALGSLQAATEVLSS
FT                   WGASAGGLVSGQYQYSLADFGVHTTNADSSRQVNNVGSGRLSRMDSINGGGLTLIGVRP
FT                   RNVALLACIKY"
FT   misc_feature    complement(319052..319222)
FT                   /locus_tag="Smlt0309"
FT                   /note="HMMPfam hit to PF07484, Phage Tail Collar Domain,
FT                   score 2.4e-17"
FT                   /inference="protein motif:HMMPfam:PF07484"
FT   CDS_pept        complement(319995..320546)
FT                   /transl_table=11
FT                   /gene="I"
FT                   /locus_tag="Smlt0310"
FT                   /product="putative tail protein I (gpi)"
FT                   /note="similarity:fasta; with=UniProt:P26701; Bacteriophage
FT                   P2.; I; Tail protein I (GpI).; length=176; id 38.158%;
FT                   ungapped id 40.000%; E()=4.3e-16; 152 aa overlap; query
FT                   1-151; subject 1-146"
FT                   /note="similarity:fasta; with=UniProt:Q877T4; Xylella
FT                   fastidiosa (strain Temecula1/ATCC 700964).; I;
FT                   Phage-related tail protein.; length=185; id 56.818%;
FT                   ungapped id 56.818%; E()=1.3e-38; 176 aa overlap; query
FT                   5-180; subject 7-182"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0310"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43913"
FT                   /db_xref="InterPro:IPR006521"
FT                   /db_xref="UniProtKB/TrEMBL:B2FIY4"
FT                   /protein_id="CAQ43913.1"
FT                   /translation="MSSASLLPPNASALERALEAADATVLGMPMRHGRIKDPWSCPAEY
FT                   LPWLAWELSLDTWDSAWPENIKRQRIASAINIQRHKGTAGSVREVIESFGGSVTIREWW
FT                   QQEPPGQPHTFELVLTLSGRPGVDPSAKYVEDVIAEVNRTKPVRSHFTFTQGAEFAEQL
FT                   GLIAAVKAVAYRRMQMTTEE"
FT   CDS_pept        complement(320539..321429)
FT                   /transl_table=11
FT                   /gene="J"
FT                   /locus_tag="Smlt0311"
FT                   /product="putative baseplate assembly protein J (gpj)"
FT                   /note="similarity:fasta; with=UniProt:P51767; Bacteriophage
FT                   P2.; J; Baseplate assembly protein J (GpJ).; length=302; id
FT                   45.485%; ungapped id 46.897%; E()=1.1e-35; 299 aa overlap;
FT                   query 7-296; subject 4-302"
FT                   /note="similarity:fasta; with=UniProt:Q8P6I7; Xanthomonas
FT                   campestris pv. campestris.; J; Phage-related baseplate
FT                   assembly protein.; length=296; id 55.743%; ungapped id
FT                   55.743%; E()=7e-57; 296 aa overlap; query 1-296; subject
FT                   1-296"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0311"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43914"
FT                   /db_xref="InterPro:IPR006949"
FT                   /db_xref="InterPro:IPR014507"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:B2FIY5"
FT                   /protein_id="CAQ43914.1"
FT                   /translation="MSTFTAVDLSRLPLPDVFEQLDFERLLAQRVVEFKRFMPDYDALV
FT                   ESDPVYKVLQASAYRELMLREQFNQRARSLFLAYAQGADLDNLAAPFGVTRKQLAPADP
FT                   EAGTPARFETDAEFRRRIQLAPEGVSVAGPEGAYIFHTLSADTGVLDASATSPAPGDVV
FT                   VTVLGRDGDGTPSAELLAKVDTLLQSGQVRPLTDRVTVAPAQIISYTVDADLTTFNGPD
FT                   GALVIAEARRRLTAYMAEAHRLGRDIAVSAIYAQLHTDGVQRVRLHSPLADLSIDRTQA
FT                   AHCVLVTINHVGADE"
FT   misc_feature    complement(320662..321285)
FT                   /gene="J"
FT                   /locus_tag="Smlt0311"
FT                   /note="HMMPfam hit to PF04865, Baseplate J-like protein,
FT                   score 1.6e-76"
FT                   /inference="protein motif:HMMPfam:PF04865"
FT   repeat_region   321467..321478
FT                   /rpt_unit_seq="(cg)6"
FT   CDS_pept        complement(321516..321977)
FT                   /transl_table=11
FT                   /gene="S"
FT                   /locus_tag="Smlt0312"
FT                   /product="putative tail completion protein S (gps)"
FT                   /note="similarity:fasta; with=UniProt:P36934; Bacteriophage
FT                   P2.; S; Tail completion protein S (GpS).; length=150; id
FT                   41.060%; ungapped id 42.177%; E()=7.9e-17; 151 aa overlap;
FT                   query 1-150; subject 1-148"
FT                   /note="similarity:fasta; with=UniProt:Q8PJ88; Xanthomonas
FT                   axonopodis pv. citri.; S; Phage-related tail protein.;
FT                   length=148; id 54.054%; ungapped id 54.795%; E()=1.9e-26;
FT                   148 aa overlap; query 3-150; subject 2-147"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0312"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43915"
FT                   /db_xref="InterPro:IPR006522"
FT                   /db_xref="UniProtKB/TrEMBL:B2FIY6"
FT                   /protein_id="CAQ43915.1"
FT                   /translation="MNEDLQRLETWVAPLLQQLQPAQRGNLARRVGMALRRAQQQRITA
FT                   QRNPDGSPFAPRRNAPPRRAKAGRIKRGAMFVKIRQTRYLRARSNANEATVGFSGRVSR
FT                   IALIHQEGRAAAVSKDGPRITYPKRRLLGFTPADEQLVRDLILDHLRDL"
FT   misc_feature    complement(321525..321971)
FT                   /gene="S"
FT                   /locus_tag="Smlt0312"
FT                   /note="HMMPfam hit to PF05069, Phage virion morphogenesis
FT                   family, score 8.3e-41"
FT                   /inference="protein motif:HMMPfam:PF05069"
FT   CDS_pept        complement(321974..322459)
FT                   /transl_table=11
FT                   /gene="R"
FT                   /locus_tag="Smlt0313"
FT                   /product="putative tail completion protein R (gpr)"
FT                   /note="similarity:fasta; with=UniProt:P36933; Bacteriophage
FT                   P2.; R; Tail completion protein R (GpR).; length=155; id
FT                   41.353%; ungapped id 41.985%; E()=2.8e-15; 133 aa overlap;
FT                   query 1-132; subject 1-132"
FT                   /note="similarity:fasta; with=UniProt:Q8PJ89; Xanthomonas
FT                   axonopodis pv. citri.; R; Phage-related tail protein.;
FT                   length=139; id 56.489%; ungapped id 56.489%; E()=4.8e-26;
FT                   131 aa overlap; query 1-131; subject 1-131"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0313"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43916"
FT                   /db_xref="InterPro:IPR009678"
FT                   /db_xref="UniProtKB/TrEMBL:B2FIY7"
FT                   /protein_id="CAQ43916.1"
FT                   /translation="MKKPQLLRDHLVAAIPALHADPERLLIFVDNGGLAGTYRPGASFE
FT                   YRYTLDLVLTDFAGSPEAVMVPLLQWLTRHQSELLANPANRDKLTFEVDVLADNLVDLA
FT                   IKLTLTERVCVSRADDGTLVLEHLAEPPTEGEHADTLAGGTLVADGRVIATLPSIAQ"
FT   misc_feature    complement(322067..322456)
FT                   /gene="R"
FT                   /locus_tag="Smlt0313"
FT                   /note="HMMPfam hit to PF06891, P2 phage tail completion
FT                   protein R (GpR), score 5.2e-63"
FT                   /inference="protein motif:HMMPfam:PF06891"
FT   CDS_pept        complement(322456..322980)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0314"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q8P6J0; Xanthomonas
FT                   campestris pv. campestris.; Hypothetical protein XCC2979.;
FT                   length=162; id 53.459%; ungapped id 57.432%; E()=1.1e-22;
FT                   159 aa overlap; query 1-157; subject 1-150"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0314"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43917"
FT                   /db_xref="UniProtKB/TrEMBL:B2FIY8"
FT                   /protein_id="CAQ43917.1"
FT                   /translation="MLYRVLALSALVLATAGLFSCQQARVGRATAALDRANDSLAAANA
FT                   EKAELASKLQLAEGTTQVVTEYVDRVQLVHERGATIVKEVPVYVTATADAACTVPAGFV
FT                   HIHDAAASGHPPTGPAGDPDAPAAGVTLSAVAETTAANYATCHATAAQVTGLQALVRQL
FT                   HDALARQASTP"
FT   sig_peptide     complement(322921..322980)
FT                   /locus_tag="Smlt0314"
FT                   /note="Signal peptide predicted for Smlt0314 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.499 between residues 20 and 21"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(322980..323615)
FT                   /transl_table=11
FT                   /gene="lys"
FT                   /locus_tag="Smlt0315"
FT                   /product="putative phage lytic enzyme"
FT                   /note="similarity:fasta; with=UniProt:Q9S558
FT                   (EMBL:AB030826;); Pseudomonas aeruginosa.; lys; Lytic
FT                   enzyme.; length=209; id 41.784%; ungapped id 44.500%;
FT                   E()=3e-21; 213 aa overlap; query 2-208; subject 3-208"
FT                   /note="similarity:fasta; with=UniProt:Q8P6J1
FT                   (EMBL:AE012412;); Xanthomonas campestris pv. campestris.;
FT                   lys; Phage-related lytic enzyme.; length=213; id 59.524%;
FT                   ungapped id 59.809%; E()=2.7e-44; 210 aa overlap; query
FT                   1-209; subject 2-211"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0315"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43918"
FT                   /db_xref="GOA:B2FIY9"
FT                   /db_xref="InterPro:IPR000726"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B2FIY9"
FT                   /protein_id="CAQ43918.1"
FT                   /translation="MLTAALLAQIMQCPLPRAQRWAEALNAAMQRFGINTPVRAAYFLA
FT                   QLGHESLSLSRTEESLSYSRERLLEVFGKYVTPAEAAAFVHQPAMLGNRVYANRNGNGS
FT                   EASGDGYRFRGRGPMQHTGRGNYRSMGQLIGQLLEDQPSLLIEPEIGAMAAAAFWHVNG
FT                   LNTYADQRDVLAVSRIINLGNVRSRATPNGMADRTARTSRALAALGAR"
FT   CDS_pept        complement(323617..323892)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0316"
FT                   /product="putative phage protein"
FT                   /note="similarity:fasta; with=UniProt:Q7CLQ7; Xanthomonas
FT                   campestris pv. campestris.; orf90; Phage-related protein.;
FT                   length=91; id 56.180%; ungapped id 57.471%; E()=1e-16; 89
FT                   aa overlap; query 1-88; subject 1-88"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0316"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43919"
FT                   /db_xref="GOA:B2FIZ0"
FT                   /db_xref="InterPro:IPR008473"
FT                   /db_xref="UniProtKB/TrEMBL:B2FIZ0"
FT                   /protein_id="CAQ43919.1"
FT                   /translation="MAEFLSTATLLCCVAICVRLLTYRPAPNANHRHGIAWCAWLLIVA
FT                   TGGQALQIILQGARANVTAWQLVLLVVLLVATYRARGNVAHLFGSN"
FT   misc_feature    complement(323620..323877)
FT                   /locus_tag="Smlt0316"
FT                   /note="HMMPfam hit to PF05449, Protein of unknown function
FT                   (DUF754), score 1e-23"
FT                   /inference="protein motif:HMMPfam:PF05449"
FT   misc_feature    complement(order(323656..323709,323719..323787,
FT                   323824..323883))
FT                   /locus_tag="Smlt0316"
FT                   /note="3 probable transmembrane helices predicted for
FT                   Smlt0316 by TMHMM2.0 at aa 4-23, 36-58 and 62-79"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(323885..324238)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0317"
FT                   /product="putative phage protein"
FT                   /note="similarity:fasta; with=UniProt:Q8P6J2
FT                   (EMBL:AE012412;); Xanthomonas campestris pv. campestris.;
FT                   orf89; Phage-related protein.; length=118; id 58.772%;
FT                   ungapped id 58.772%; E()=1.9e-17; 114 aa overlap; query
FT                   1-114; subject 1-114"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0317"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43920"
FT                   /db_xref="GOA:B2FIZ1"
FT                   /db_xref="InterPro:IPR032637"
FT                   /db_xref="UniProtKB/TrEMBL:B2FIZ1"
FT                   /protein_id="CAQ43920.1"
FT                   /translation="MTEPTSTGSMAALATGVGLASLLPGIETDAFIGAFAGATLFVVSA
FT                   KDLSIWKRLIYLAISVVAGYMGGTEVMRRFDVASSGLAAFLCAATIITLTLALIERSRS
FT                   ADPSRLPRGGTDG"
FT   misc_feature    complement(order(323942..324010,324023..324079,
FT                   324113..324181))
FT                   /locus_tag="Smlt0317"
FT                   /note="3 probable transmembrane helices predicted for
FT                   Smlt0317 by TMHMM2.0 at aa 20-42, 54-72 and 77-99"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(324179..324238)
FT                   /locus_tag="Smlt0317"
FT                   /note="Signal peptide predicted for Smlt0317 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.880) with cleavage site
FT                   probability 0.609 between residues 20 and 21"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(324241..324456)
FT                   /transl_table=11
FT                   /gene="X"
FT                   /locus_tag="Smlt0318"
FT                   /product="putative tail protein X (gpx)"
FT                   /note="similarity:fasta; with=UniProt:P51772; Bacteriophage
FT                   P2.; X; Tail protein X (GpX).; length=67; id 50.704%;
FT                   ungapped id 53.731%; E()=1.8e-08; 71 aa overlap; query
FT                   1-71; subject 1-67"
FT                   /note="similarity:fasta; with=UniProt:Q8NKY5; Xanthomonas
FT                   axonopodis pv. citri.; X; Phage-related tail protein.;
FT                   length=69; id 61.972%; ungapped id 63.768%; E()=4.3e-13; 71
FT                   aa overlap; query 1-71; subject 1-69"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0318"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43921"
FT                   /db_xref="InterPro:IPR008861"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:B2FIZ2"
FT                   /protein_id="CAQ43921.1"
FT                   /translation="MRVVALQGDTIDALCHRHLGTTAGMTEKVMALNYGISLHGPVLPM
FT                   GTVVELPDVPTTSTGAVMRPLVQLWD"
FT   misc_feature    complement(324277..324456)
FT                   /gene="X"
FT                   /locus_tag="Smlt0318"
FT                   /note="HMMPfam hit to PF05489, Phage Tail Protein X, score
FT                   2.8e-25"
FT                   /inference="protein motif:HMMPfam:PF05489"
FT   CDS_pept        complement(324456..324923)
FT                   /transl_table=11
FT                   /gene="L"
FT                   /locus_tag="Smlt0319"
FT                   /product="putative head completion/stabilization protein
FT                   (gpl)"
FT                   /note="similarity:fasta; with=UniProt:P25475
FT                   (EMBL:AF063097;); Bacteriophage P2.; L; Head
FT                   completion/stabilization protein (GpL).; length=169; id
FT                   38.776%; ungapped id 39.310%; E()=4.2e-13; 147 aa overlap;
FT                   query 10-155; subject 24-169"
FT                   /note="similarity:fasta; with=UniProt:Q8PJ93
FT                   (EMBL:AE011905;); Xanthomonas axonopodis pv. citri.; L;
FT                   Phage-related capsid completion protein.; length=155; id
FT                   52.903%; ungapped id 52.903%; E()=7e-27; 155 aa overlap;
FT                   query 1-155; subject 1-155"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0319"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43922"
FT                   /db_xref="GOA:B2FIZ3"
FT                   /db_xref="InterPro:IPR009225"
FT                   /db_xref="UniProtKB/TrEMBL:B2FIZ3"
FT                   /protein_id="CAQ43922.1"
FT                   /translation="MSSFTANASPVATQPPVTAGAFWPEIDVAVLREAIRVPGDVTQQR
FT                   MRATVVMAVMSVTGELEQWQADKEAAGYATLAEVPARLIDDTSRLVQLYLRAVYCATAV
FT                   ELHERYRAYDATAQGNQRADDLSPTIDEMRRDQRNAISDLLGTRRVTVELI"
FT   misc_feature    complement(324459..324878)
FT                   /gene="L"
FT                   /locus_tag="Smlt0319"
FT                   /note="HMMPfam hit to PF05926, Phage head completion
FT                   protein (GPL), score 1.2e-60"
FT                   /inference="protein motif:HMMPfam:PF05926"
FT   CDS_pept        complement(325028..325735)
FT                   /transl_table=11
FT                   /gene="M"
FT                   /locus_tag="Smlt0320"
FT                   /product="putative terminase, endonuclease subunit (gpm)"
FT                   /note="similarity:fasta; with=UniProt:P25476; Bacteriophage
FT                   P2.; M; Terminase, endonuclease subunit (GpM).; length=247;
FT                   id 40.969%; ungapped id 43.256%; E()=4.2e-19; 227 aa
FT                   overlap; query 4-229; subject 3-218"
FT                   /note="similarity:fasta; with=UniProt:Q8P6J4; Xanthomonas
FT                   campestris pv. campestris.; M; Phage-related terminase.;
FT                   length=239; id 60.435%; ungapped id 60.965%; E()=2.6e-43;
FT                   230 aa overlap; query 1-228; subject 1-230"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0320"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43923"
FT                   /db_xref="GOA:B2FIZ4"
FT                   /db_xref="InterPro:IPR010270"
FT                   /db_xref="UniProtKB/TrEMBL:B2FIZ4"
FT                   /protein_id="CAQ43923.1"
FT                   /translation="MADTPASRHLKRVLAEQSAAAVAGSNLMEGTTIYQQMQLRLAHDR
FT                   ARLKQIQSTQAKATLKVTLLPDYAPYVEGVLAANQGGEDQIVSTVMLWSMDAGEYHRAL
FT                   DIAEYVLAHGLSMPDEFSRTAGCVVAEEIGVAALNALKTGVEFDPAVLTRAMELTEGQD
FT                   MPDQVRARLLLARARGLLPPDTEATPLDAEGVAQAVEDLRRAIQLHDSCGGKEDLKRAE
FT                   RLQKKFEASQSND"
FT   repeat_region   325206..325213
FT                   /rpt_unit_seq="(gc)4"
FT   misc_feature    complement(325232..325627)
FT                   /gene="M"
FT                   /locus_tag="Smlt0320"
FT                   /note="HMMPfam hit to PF05944, Phage small terminase
FT                   subunit, score 7.2e-65"
FT                   /inference="protein motif:HMMPfam:PF05944"
FT   CDS_pept        complement(325739..326755)
FT                   /transl_table=11
FT                   /gene="N"
FT                   /locus_tag="Smlt0321"
FT                   /product="putative capsid proteins precursor (gpn)
FT                   [contains: minor capsid protein h1; minor capsid protein
FT                   h2; major capsid protein n*]"
FT                   /note="similarity:fasta; with=UniProt:P25477; Bacteriophage
FT                   P2.; N; Capsid proteins precursor (GpN) [Contains: Minor
FT                   capsid protein H1; Minor capsid protein H2; Major capsid
FT                   protein N*].; length=357; id 49.565%; ungapped id 50.742%;
FT                   E()=3.2e-59; 345 aa overlap; query 1-338; subject 1-344"
FT                   /note="similarity:fasta; with=UniProt:Q9ZXM3; Pseudomonas
FT                   phage phi CTX.; Pseudomonas aeruginosa phage phi CTX,
FT                   complete genome sequence.; length=338; id 64.897%; ungapped
FT                   id 65.282%; E()=7e-84; 339 aa overlap; query 1-338; subject
FT                   1-338"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0321"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43924"
FT                   /db_xref="InterPro:IPR006441"
FT                   /db_xref="UniProtKB/TrEMBL:B2FIZ5"
FT                   /protein_id="CAQ43924.1"
FT                   /translation="MRTETRRLFDGFTQQIATLNNVSGVVNTFAVEPTVQQALEARMQE
FT                   NSTFLQAINMPGVAELKGEKIGVGINGTIAGRTDTSGNGERNPSDPTALDAQGYECQKT
FT                   DFDTALPYARLDAWAHRPEFQTLIRDAIIQRQALDRIMIGWNGTSIAKNTDRVANPLLQ
FT                   DVNKGWLQKYREHAPERVMKEGAAGSGKIKVGGTDADYGNIDALVMDLVANLIDPWHQD
FT                   DTSLVVICGRSLVHDKYFPIVNGNNTPTEKVAAELILGTKRIGGLQPVIVPFFPAKSLM
FT                   VTSLSNLSLYWQIGGRRRHIMEQPNKNRVANFESSNDDYVIEDYGLGAIAENIEFGE"
FT   misc_feature    complement(325748..326740)
FT                   /gene="N"
FT                   /locus_tag="Smlt0321"
FT                   /note="HMMPfam hit to PF05125, Phage major capsid protein,
FT                   P2 family, score 4.1e-195"
FT                   /inference="protein motif:HMMPfam:PF05125"
FT   CDS_pept        complement(326789..327652)
FT                   /transl_table=11
FT                   /gene="O"
FT                   /locus_tag="Smlt0322"
FT                   /product="presumed capsid scaffolding protein (gpo)"
FT                   /note="similarity:fasta; with=UniProt:P25478
FT                   (EMBL:AF063097;); Bacteriophage P2.; O; Presumed capsid
FT                   scaffolding protein (GpO).; length=284; id 41.781%;
FT                   ungapped id 44.853%; E()=5.4e-29; 292 aa overlap; query
FT                   6-287; subject 3-284"
FT                   /note="similarity:fasta; with=UniProt:Q8PJ96
FT                   (EMBL:AE011905;); Xanthomonas axonopodis pv. citri.; O;
FT                   Phage-related capsid scaffold protein.; length=280; id
FT                   53.103%; ungapped id 55.596%; E()=9.2e-45; 290 aa overlap;
FT                   query 1-287; subject 1-280"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0322"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43925"
FT                   /db_xref="GOA:B2FIZ6"
FT                   /db_xref="InterPro:IPR009228"
FT                   /db_xref="UniProtKB/TrEMBL:B2FIZ6"
FT                   /protein_id="CAQ43925.1"
FT                   /translation="MATKNKKRSEFFRVAVEGATTDGRVIDRQQIVEIAETYNPEVYGA
FT                   RIWMEHIRSSLPDSPFRAYGDVVAVKAEEVDIAGKKKLALFAQVEPTDDLVEIVNSRKQ
FT                   KVFTSIEIAPEFADSGKAYLFGLAVTDSPASLGTSMLAFSAKHPEDSPLKDRKQAPENL
FT                   FTEAAETTINFTTAEPASARPGPVATLLSTLGIGKKPAPVPPAKDEIDFDVGAFADQLM
FT                   EAVGEQDAAMARLAQDNRALREQVQALSTQVASFRKKLDETPQGFTQRPVITGGKDVDA
FT                   KNVTDC"
FT   misc_feature    complement(326792..327628)
FT                   /gene="O"
FT                   /locus_tag="Smlt0322"
FT                   /note="HMMPfam hit to PF05929, Phage capsid scaffolding
FT                   protein (GPO), score 7.7e-114"
FT                   /inference="protein motif:HMMPfam:PF05929"
FT   CDS_pept        327771..329564
FT                   /transl_table=11
FT                   /gene="P"
FT                   /locus_tag="Smlt0323"
FT                   /product="putative phage terminase, ATPase subunit (gpp)"
FT                   /note="similarity:fasta; with=UniProt:P25479; Bacteriophage
FT                   P2.; P; Terminase, ATPase subunit (GpP).; length=590; id
FT                   59.170%; ungapped id 59.790%; E()=1.1e-134; 578 aa overlap;
FT                   query 13-587; subject 3-577"
FT                   /note="similarity:fasta; with=UniProt:Q8PJ97; Xanthomonas
FT                   axonopodis pv. citri.; P; Phage-related terminase.;
FT                   length=594; id 78.912%; ungapped id 79.181%; E()=1.3e-197;
FT                   588 aa overlap; query 11-596; subject 6-593"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0323"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43926"
FT                   /db_xref="GOA:B2FIZ7"
FT                   /db_xref="InterPro:IPR004921"
FT                   /db_xref="InterPro:IPR010332"
FT                   /db_xref="InterPro:IPR035421"
FT                   /db_xref="UniProtKB/TrEMBL:B2FIZ7"
FT                   /protein_id="CAQ43926.1"
FT                   /translation="MSRTRDPGQPVHVTSVAEQLHVDPRRQAKFLYWMGWRVCDIASLI
FT                   GEKERTVHSWKARDEWDRADTVERIGGALEARLAILIHKEGKTGGDFKEIDLLHRQLER
FT                   QARIQRYQGGGNESDLNPAVANRNAKPKKKARKNEFSEEEIERLQTAFVDGCFDYQRDW
FT                   YRAGNERTRVILKSRQIGATFYFAREALIDALTTGRNQIFLSASKSQAHIFLGYMRGFV
FT                   REVLDRDLTGDPITLANGAELFFLGTNARTAQGYHGNFYFDEFFWTYGFNQLNKVASGM
FT                   AMHKKWRKTYFSTPSTMAHEAFDFWTGDRFNKGRPVSQQIQLDVSHARLMGGRRCEDAI
FT                   WRQIVTVLDAAGRGCDLFDIEELRRDYSAEEFANLLMCEFVDDSASIFPLTMLQPCQVD
FT                   SWVEWVDDFKPLAIRPYGDRAVWIGYDPAETGDSAGIVVVAPPLVPGGKFRVLERHQFK
FT                   GMDFAAQAAFIQQVTLRYWVTYIGIDATGMGTGVAQLVRQFFPGVTIFNYSPEVKTRLV
FT                   LKAFDVIKNERLEYDAGWTDLTQSLLAIQKTITPSGRQVTYTAGRSRTTGHADLAWALM
FT                   HALQNEPLEGGTAARGSMEIF"
FT   misc_feature    327837..328010
FT                   /gene="P"
FT                   /locus_tag="Smlt0323"
FT                   /note="HMMPfam hit to PF06056, Putative ATPase subunit of
FT                   terminase (gpP, score 6.1e-31"
FT                   /inference="protein motif:HMMPfam:PF06056"
FT   misc_feature    328287..329516
FT                   /gene="P"
FT                   /locus_tag="Smlt0323"
FT                   /note="HMMPfam hit to PF03237, Terminase-like family, score
FT                   1.4e-156"
FT                   /inference="protein motif:HMMPfam:PF03237"
FT   CDS_pept        329564..330574
FT                   /transl_table=11
FT                   /gene="Q"
FT                   /locus_tag="Smlt0324"
FT                   /product="putative presumed portal vertex protein (gpq)"
FT                   /note="similarity:fasta; with=UniProt:P25480
FT                   (EMBL:AF063097;); Bacteriophage P2.; Q; Presumed portal
FT                   vertex protein (GpQ).; length=344; id 48.101%; ungapped id
FT                   48.101%; E()=1.6e-57; 316 aa overlap; query 17-332; subject
FT                   24-339"
FT                   /note="similarity:fasta; with=UniProt:Q5H252
FT                   (EMBL:AE013598;); Xanthomonas oryzae pv. oryzae.;
FT                   Phage-related capsid packaging protein.; length=341; id
FT                   70.968%; ungapped id 72.455%; E()=9.7e-98; 341 aa overlap;
FT                   query 1-336; subject 1-339"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0324"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43927"
FT                   /db_xref="InterPro:IPR006430"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="InterPro:IPR030935"
FT                   /db_xref="UniProtKB/TrEMBL:B2FIZ8"
FT                   /protein_id="CAQ43927.1"
FT                   /translation="MADTDQGASVAPPATTEVFTFGDPTPVLESRGIFDYLECWRNGRY
FT                   YEPPVDLHGLSRTTRANPYLQSGLTFKRNMLVRTFRPHKLLTREAFAQLALDYITFGMA
FT                   YVERRRAMSGNAHSLAVPLAQYMRRGVEAGEFFQVRAGRIEHEFKPGEVFQLREADPDQ
FT                   EVYGLPEWMPAVQSALLNESATLFRRKYYNNGSHAGFILYLTDPQPEDGDVSKLREALR
FT                   QSRGPGNFRNLFVHSPNGKKDGLQLIPVSEVAAKDEFTGIKSVTRDDMLASLRTPPQLL
FT                   GIVPQNSGGFGSIREAAMVWSAMELAPLQTRMTAINEWLGQDVIAFDPFELAPAA"
FT   misc_feature    329657..330565
FT                   /gene="Q"
FT                   /locus_tag="Smlt0324"
FT                   /note="HMMPfam hit to PF04860, Phage portal protein, score
FT                   2.3e-57"
FT                   /inference="protein motif:HMMPfam:PF04860"
FT   CDS_pept        330746..331456
FT                   /transl_table=11
FT                   /locus_tag="Smlt0325"
FT                   /product="putative site-specific DNA-methyltransferase"
FT                   /note="similarity:fasta; with=UniProt:P94454
FT                   (EMBL:X97069;); Bacillus stearothermophilus (Geobacillus
FT                   stearothermophilus).; F5IM1; Site-specific
FT                   DNA-methyltransferase (EC 2.1.1.72).; length=226; id
FT                   26.147%; ungapped id 28.643%; E()=8.5e-09; 218 aa overlap;
FT                   query 23-233; subject 13-218"
FT                   /note="similarity:fasta; with=UniProt:Q8P6K0
FT                   (EMBL:AE012411;); Xanthomonas campestris pv. campestris.;
FT                   Site-specific DNA-methyltransferase.; length=234; id
FT                   80.687%; ungapped id 80.687%; E()=2.5e-78; 233 aa overlap;
FT                   query 1-233; subject 1-233"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0325"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43928"
FT                   /db_xref="GOA:B2FIZ9"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2FIZ9"
FT                   /protein_id="CAQ43928.1"
FT                   /translation="MNNELIQGDALTILPTLPANSFDALITDPPYASGGTHASARQRGP
FT                   NEKYMQSGGPRLHADFPSDERDQRSHLAWMHLWLAQCNRVLRDGAPVLLFTDWRQLPLT
FT                   TDALQCAGFTWRGVAVWDKTGGVRPQRGRFSNQAEYVVWGSKGGMPLGRAAPTLPGVFR
FT                   EAVRKADKHHLTGKPTDLMRQLVRICEQGGRILDPFAGSGTTLVAAEAEGYSWTGIEMT
FT                   GHYFDVAKSRLPSP"
FT   misc_feature    330809..331438
FT                   /locus_tag="Smlt0325"
FT                   /note="HMMPfam hit to PF01555, DNA methylase, score
FT                   1.8e-20"
FT                   /inference="protein motif:HMMPfam:PF01555"
FT   repeat_region   331457..331464
FT                   /rpt_unit_seq="(cg)4"
FT   CDS_pept        332227..332523
FT                   /transl_table=11
FT                   /locus_tag="Smlt0327"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q7Y3Z4; Bacteriophage
FT                   PY54.; Hypothetical protein.; length=80; id 29.688%;
FT                   ungapped id 31.148%; E()=0.83; 64 aa overlap; query 12-75;
FT                   subject 7-67"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0327"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43929"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ00"
FT                   /protein_id="CAQ43929.1"
FT                   /translation="MRVRFCRLDPDARTRLPATPAHFMGCFSCTPCSNHPARPCMAFSG
FT                   VSECLPTLRFPARKGASLRALGGERRRRVRLGGGGGPERSNICNRPSSTRVSH"
FT   repeat_region   332461..332469
FT                   /rpt_unit_seq="(g)9"
FT   CDS_pept        332777..333241
FT                   /transl_table=11
FT                   /locus_tag="Smlt0328"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0328"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43930"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ01"
FT                   /protein_id="CAQ43930.1"
FT                   /translation="MQLKGRKVALASPAASARALSLDARRVVAAFATASRILPPMPLPP
FT                   DFYWTTRSASWPGDPLTVIACDSVWVVAMSQRFDDGIWIALLDRHRNGPGGPARRCTSY
FT                   EQACAGAELWVARHEARLREDVAAINRWREVVRANRLAKLNTPPPFGWMG"
FT   sig_peptide     332777..332839
FT                   /locus_tag="Smlt0328"
FT                   /note="Signal peptide predicted for Smlt0328 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.979) with cleavage site
FT                   probability 0.431 between residues 21 and 22"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(333316..334077)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0329"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q9JQX9; Neisseria
FT                   meningitidis serogroup A.; Hypothetical protein NMA2192.;
FT                   length=219; id 53.394%; ungapped id 54.884%; E()=5.2e-42;
FT                   221 aa overlap; query 1-217; subject 1-219"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0329"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43931"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ02"
FT                   /protein_id="CAQ43931.1"
FT                   /translation="MPTAILIDGGYFVKRFRRIEPHNALNANRAAELAHRWALAHLKSP
FT                   SGDKRDLYRIFFYDCPPLTKKMHNPISGKCIDYSQSSEAVFRTALHDKLRHMRKVALRL
FT                   GHLTEFSSWTAAPETLDALLKGRKSFADLTPDDLYPNVRQKGVDMRIGIDISSLALKRQ
FT                   VRQIILMAGDADFVPAAKLARREGVDFVLDPMWSKTPKGLIEHVDGMRSVCPKPPARAA
FT                   KAVAPNAPGVENLPVVAEVAGAGAAANQPQA"
FT   repeat_region   334105..334112
FT                   /rpt_unit_seq="(a)8"
FT   CDS_pept        complement(334344..334940)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0330"
FT                   /product="putative DNA recombinase"
FT                   /note="Codons 100 to the C-terminus are similar to codons
FT                   210 to 300 of Escherichia coli Rci shufflon-specific DNA
FT                   recombinase. UniProt:P10487 (384 aa) fasta scores:
FT                   E()=0.054, 40.000% id in 85 aa, and codons 100 to 160 are
FT                   similar to codons 160 to 220 of Pseudomonas syringae pv.
FT                   pisi hypothetical protein. UniProt:Q9K515 (253 aa) fasta
FT                   scores: E()=1.9e-05, 50.000% id in 62 aa"
FT                   /note="similarity:fasta; with=UniProt:P10487; Escherichia
FT                   coli.; rci; Shufflon-specific DNA recombinase.; length=384;
FT                   id 40.000%; ungapped id 40.476%; E()=0.054; 85 aa overlap;
FT                   query 100-183; subject 211-295"
FT                   /note="similarity:fasta; with=UniProt:Q9K515; Pseudomonas
FT                   syringae pv. pisi.; Hypothetical protein.; length=253; id
FT                   50.000%; ungapped id 50.000%; E()=1.9e-05; 62 aa overlap;
FT                   query 98-159; subject 159-220"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0330"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43932"
FT                   /db_xref="GOA:B2FJ03"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ03"
FT                   /protein_id="CAQ43932.1"
FT                   /translation="MRCRTTRSDSPTSRDSSLPSYTRQRRWTPPASRRLRSIRPTTPRP
FT                   RLRPAIAGRPRASVDRDPALAIQDRQPPDVPSAGRSLGPSAATATDCRREPNLPYNSKS
FT                   AGTSFTRACSALKIEDLCFHNLRHEATSRLFEQGCDIPEVAAVALPSSWNELKRYCDQN
FT                   PCISRSLATKERRVTKPFAANNLRSRGTDFHLYQC"
FT   CDS_pept        complement(334915..335202)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0331"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0331"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43933"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ04"
FT                   /protein_id="CAQ43933.1"
FT                   /translation="MTVSVIVFEPFKNDDKLAGFEHELELRTESHHRFADNVIFAKHEG
FT                   STRGLYDALKAAGQMTGLVLIEAKEVQDSSWIVDGQAFDWLNGALPNYKV"
FT   repeat_region   335211..335220
FT                   /rpt_unit_seq="(ct)5"
FT   CDS_pept        complement(335568..336692)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0332"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q4UPS4
FT                   (EMBL:CP000050;); Xanthomonas campestris pv. campestris
FT                   (strain 8004).; Hypothetical protein.; length=363; id
FT                   56.630%; ungapped id 58.239%; E()=7.8e-70; 362 aa overlap;
FT                   query 23-374; subject 2-363"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0332"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43934"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ05"
FT                   /protein_id="CAQ43934.1"
FT                   /translation="MERTEDAGLPQPQEGGRPGAARRPASPLDDPSLAPLLAKSPTLQA
FT                   GLAQARREGIVVQWGTAGEGTYLVPGVKIVIDENAIGQGTRLARSLSHEVGHHLFTEPS
FT                   NRASKQAYVDSELRGEAAATLSNVQVQREIVAGGGPDIGVSGTGSRPQQYGTIAAELQA
FT                   GRINRSQALGQIAEVFKTEAPSVGPHATYELYYGDFYDREIAPTQRRRRPDPEFDAERT
FT                   AVAASLSSTTDDSLSLQRATFSVAELGNADRSLYMQIRAGVERLDAESGKQWDESSQRM
FT                   SASLLVLAKEQGLSRVDHVVLNNPTESLARGEKVFIVEGAMDDPAQRRGTMSTMDALRA
FT                   PEAESLHRAEALAADLEQQPAQQVHAQDGLSFSR"
FT   repeat_region   335927..335934
FT                   /rpt_unit_seq="(ag)4"
FT   CDS_pept        complement(336720..337319)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0333"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q8P4Y0
FT                   (EMBL:AE012477;); Xanthomonas campestris pv. campestris.;
FT                   Hypothetical protein XCC3568.; length=199; id 33.889%;
FT                   ungapped id 34.857%; E()=5.7e-14; 180 aa overlap; query
FT                   21-198; subject 22-198"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0333"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43935"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ06"
FT                   /protein_id="CAQ43935.1"
FT                   /translation="MNAWVEKCATSSERGLRRRLWIAARRRLAIAIPALVLAACSTAAP
FT                   PRPSDHLNQRQAVESGSEIGMERFKNSIERLSTVRFDDVDALSELLHTRLGEPARQDLM
FT                   DERIAERGMLGDLEVRNIRLRSAADNPALANLIFDIAPPSIALEEMIWENSTKHPPRPD
FT                   APGSRPYWTAQVNDAQVVLGLAADSVTLTYISIRQH"
FT   sig_peptide     complement(337191..337319)
FT                   /locus_tag="Smlt0333"
FT                   /note="Signal peptide predicted for Smlt0333 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.956) with cleavage site
FT                   probability 0.902 between residues 43 and 44"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        337553..337840
FT                   /transl_table=11
FT                   /locus_tag="Smlt0334"
FT                   /product="putative phage-related protein"
FT                   /note="similarity:fasta; with=UniProt:Q39SM0
FT                   (EMBL:CP000148;); Geobacter metallireducens (strain
FT                   GS-15/ATCC 53774/DSM 7210).; Hypothetical protein.;
FT                   length=96; id 54.737%; ungapped id 54.737%; E()=4.1e-18; 95
FT                   aa overlap; query 1-95; subject 2-96"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0334"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43936"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="InterPro:IPR014056"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ07"
FT                   /protein_id="CAQ43936.1"
FT                   /translation="MKIQRTRQFATWIDALKDVTARARILARIGRLAEGHPGDHRYLGD
FT                   GISELRIDAGPGYRLYYTQRGRQLLILLVGGDKSSQQRDIEKAREIARAL"
FT   misc_feature    337682..337837
FT                   /locus_tag="Smlt0334"
FT                   /note="HMMPfam hit to PF05973, Phage derived protein
FT                   Gp49-like (DUF891), score 5.7e-22"
FT                   /inference="protein motif:HMMPfam:PF05973"
FT   CDS_pept        337899..338201
FT                   /transl_table=11
FT                   /locus_tag="Smlt0335"
FT                   /product="putative HTH family transcriptional regulator"
FT                   /note="similarity:fasta; with=UniProt:Q3JDK7
FT                   (EMBL:CP000127;); Nitrosococcus oceani (strain ATCC
FT                   19707/NCIMB 11848).; Transcriptional regulator, Cro/CI
FT                   family.; length=117; id 77.895%; ungapped id 77.895%;
FT                   E()=4.6e-23; 95 aa overlap; query 6-100; subject 3-97"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0335"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43937"
FT                   /db_xref="GOA:B2FJ08"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR014057"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ08"
FT                   /protein_id="CAQ43937.1"
FT                   /translation="MATKKKVELKSFDVAEHLRTPEEMAAYLDACIEESDGDSAFIAKA
FT                   LGDIARAQGMSKVARAAGLSRESLYRALSGERSPDFATILKVTRALGVRLHASAV"
FT   misc_feature    338034..338192
FT                   /locus_tag="Smlt0335"
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix, score
FT                   3.9e-06"
FT                   /inference="protein motif:HMMPfam:PF01381"
FT   repeat_region   338045..338052
FT                   /rpt_unit_seq="(cg)4"
FT   repeat_region   338073..338080
FT                   /rpt_unit_seq="(gc)4"
FT   CDS_pept        complement(338259..338582)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0336"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0336"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43938"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ09"
FT                   /protein_id="CAQ43938.1"
FT                   /translation="MSTPYPDLKPFLVELRLDEVDSRGGTVAEMIASTARPRALSISPG
FT                   VMWYSFVLNDRVVTRITPGTRAHCTISFVNHDGAKEVFPCGTVAAFGDGSSTRGLIRII
FT                   RFD"
FT   CDS_pept        complement(338662..339174)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0337"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0337"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43939"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ10"
FT                   /protein_id="CAQ43939.1"
FT                   /translation="MGALCPPAHRFPVLEATHRPPPSSGGTSVADEDARMPKTHHPYLT
FT                   ATLGEAALRLPPELAQPLEAAFAAANEAPAPINLPGCLQRIQAGDAADGQPWPGPSTTP
FT                   GQAVAAARRDRAAVGLVSLLELYHAAERVRVDGEEKDDIGDGTREGLMLACRGLAEYVA
FT                   LQMGGTQ"
FT   CDS_pept        339663..340433
FT                   /transl_table=11
FT                   /locus_tag="Smlt0339"
FT                   /product="conserved hypothetical protein"
FT                   /note="N-terminus is similar to entire protein of
FT                   Pseudomonas putida f1. hypothetical protein precursor.
FT                   UniProt:Q2XIR2 (EMBL:AALM01000005 (95 aa) fasta scores:
FT                   E()=5.5e-17, 59.140% id in 93 aa"
FT                   /note="similarity:fasta; with=UniProt:Q2XIR2
FT                   (EMBL:AALM01000005;); Pseudomonas putida F1.; Hypothetical
FT                   protein precursor.; length=95; id 59.140%; ungapped id
FT                   61.111%; E()=5.5e-17; 93 aa overlap; query 8-100; subject
FT                   4-93"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0339"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43940"
FT                   /db_xref="InterPro:IPR021381"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ11"
FT                   /protein_id="CAQ43940.1"
FT                   /translation="MRRHALPLTVALLSAAFAAPAMAAVPFFNASCPGGIDVHADDGGP
FT                   VYVQGREATLKRFNDRYFEARDANSGITLSISRNDDGAPQVSYTGRGGANGICQVSASG
FT                   TSALTANSARPRDAAAGDAALPREVTCESTDQQQVSCDLNTRGNVEIVRQLSRTRCEEG
FT                   KNWGLSRHSVWVNGGCRAVFRNTSRMSYSAPTGDSALGACNLRKGAQGAVVTQVPVGSD
FT                   YQELIIDYPDGRYLCMMRNNGEVQSVTPLRRRGG"
FT   sig_peptide     339663..339731
FT                   /locus_tag="Smlt0339"
FT                   /note="Signal peptide predicted for Smlt0339 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.999 between residues 23 and 24"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    339675..339743
FT                   /locus_tag="Smlt0339"
FT                   /note="1 probable transmembrane helix predicted for
FT                   Smlt0339 by TMHMM2.0 at aa 5-27"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        340493..341437
FT                   /transl_table=11
FT                   /locus_tag="Smlt0340"
FT                   /product="putative ankyrin repeat protein"
FT                   /note="similarity:fasta; with=UniProt:Q4KDY6
FT                   (EMBL:CP000076;); Pseudomonas fluorescens (strain Pf-5/ATCC
FT                   BAA-477).; Ankyrin repeat protein.; length=311; id 49.686%;
FT                   ungapped id 51.466%; E()=5.9e-50; 318 aa overlap; query
FT                   1-314; subject 1-311"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0340"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43941"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR028049"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ12"
FT                   /protein_id="CAQ43941.1"
FT                   /translation="MSHLLAKAAEKADLDRIDALLDAGADIEWQHKGTGRTPLLSAVIA
FT                   GKCDAAARLLDRGANIEHACRALGYTALGWAAAHGDTDIGDLLIARGAMLDPASPEQRR
FT                   TPLMLACARGHLAMVERLLDSGASVAPLDFEGCNALAMADERGYAEVVALLHAAGATPP
FT                   PALMEAPPLEWPQPDAGGEPASVVRGYLLAYHEWETRGYKDSRAGGGLLLSSGFQQEKA
FT                   DILAAWCTDRKRVYSTGVSVGNPPRYVPEDLLVSVAMPTVSRAEVLVRDDPQKARSLRY
FT                   EHLFVLKRVGGRWRIDLRKKRVFHIETWAAAIL"
FT   misc_feature    340592..340690
FT                   /locus_tag="Smlt0340"
FT                   /note="HMMPfam hit to PF00023, Ankyrin repeat, score 0.012"
FT                   /inference="protein motif:HMMPfam:PF00023"
FT   misc_feature    340694..340792
FT                   /locus_tag="Smlt0340"
FT                   /note="HMMPfam hit to PF00023, Ankyrin repeat, score 0.16"
FT                   /inference="protein motif:HMMPfam:PF00023"
FT   misc_feature    340796..340894
FT                   /locus_tag="Smlt0340"
FT                   /note="HMMPfam hit to PF00023, Ankyrin repeat, score
FT                   5.2e-07"
FT                   /inference="protein motif:HMMPfam:PF00023"
FT   misc_feature    340895..340993
FT                   /locus_tag="Smlt0340"
FT                   /note="HMMPfam hit to PF00023, Ankyrin repeat, score 28"
FT                   /inference="protein motif:HMMPfam:PF00023"
FT   CDS_pept        341542..342462
FT                   /transl_table=11
FT                   /gene="argI"
FT                   /gene_synonym="arcA"
FT                   /locus_tag="Smlt0341"
FT                   /product="putative arginase"
FT                   /EC_number="3.5.3.1"
FT                   /note="similarity:fasta; with=UniProt:P14012
FT                   (EMBL:AE007928;); Agrobacterium tumefaciens (strain
FT                   C58/ATCC 33970).; arcA; Arginase (EC 3.5.3.1).; length=324;
FT                   id 44.554%; ungapped id 45.455%; E()=9.2e-43; 303 aa
FT                   overlap; query 6-305; subject 20-319"
FT                   /note="similarity:fasta; with=UniProt:Q3BN30
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; argi; Arginase (EC 3.5.3.1).; length=307;
FT                   id 86.093%; ungapped id 86.093%; E()=3.5e-101; 302 aa
FT                   overlap; query 5-306; subject 6-307"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0341"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43942"
FT                   /db_xref="GOA:B2FJ13"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR014033"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ13"
FT                   /protein_id="CAQ43942.1"
FT                   /translation="MAHPISVSLIGVPTDVGAGHRGARLGPEALRVAGLPEALEARGVD
FT                   VRDLGNLDGPRNPWTAPVEGYRHLDEVVAWNHALMEASYAELQAGRMPIMLGGDHCLGI
FT                   GSITAVARWCREQGKTLRVLWLDAHSDFNTSDVTPSGNIHGMPVACLCGLGPKALTHLG
FT                   GSAPAITPIQVHQIGIRSVDPEEKRLIKTHKVDVYDMRYIDENGMKRAVEAALAGIDEN
FT                   THLHVSFDVDFLDPSIAPGVGTTVPGGVNYREAQLVMEMIADTGRMGSLDIVELNPLLD
FT                   KQNATAELAVDLVESLFGKSTLMRD"
FT   misc_feature    341548..342447
FT                   /gene="argI"
FT                   /gene_synonym="arcA"
FT                   /locus_tag="Smlt0341"
FT                   /note="HMMPfam hit to PF00491, Arginase family, score
FT                   5.4e-98"
FT                   /inference="protein motif:HMMPfam:PF00491"
FT   CDS_pept        342623..342760
FT                   /transl_table=11
FT                   /gene="ecnA"
FT                   /locus_tag="Smlt0342"
FT                   /product="putative entericidin A precursor"
FT                   /note="similarity:fasta; with=UniProt:P56551
FT                   (EMBL:U21727;); Citrobacter freundii.; ecnA; Entericidin A
FT                   precursor.; length=44; id 42.857%; ungapped id 42.857%;
FT                   E()=0.0032; 42 aa overlap; query 1-42; subject 2-43"
FT                   /note="similarity:fasta; with=UniProt:Q4UPH1
FT                   (EMBL:CP000050;); Xanthomonas campestris pv. campestris
FT                   (strain 8004).; Putative entericidin A.; length=44; id
FT                   79.070%; ungapped id 79.070%; E()=3.5e-10; 43 aa overlap;
FT                   query 1-43; subject 1-43"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0342"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43943"
FT                   /db_xref="GOA:B2FJ14"
FT                   /db_xref="InterPro:IPR012556"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ14"
FT                   /protein_id="CAQ43943.1"
FT                   /translation="MKRVVALMLLSMFSVALLAGCNTVAGAGKDVQKAGEKVEDAAKGR
FT                   "
FT   misc_feature    342623..342748
FT                   /gene="ecnA"
FT                   /locus_tag="Smlt0342"
FT                   /note="HMMPfam hit to PF08085, Entericidin EcnA/B family,
FT                   score 8.2e-17"
FT                   /inference="protein motif:HMMPfam:PF08085"
FT   sig_peptide     342623..342700
FT                   /gene="ecnA"
FT                   /locus_tag="Smlt0342"
FT                   /note="Signal peptide predicted for Smlt0342 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.415 between residues 26 and 27"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    342635..342703
FT                   /gene="ecnA"
FT                   /locus_tag="Smlt0342"
FT                   /note="1 probable transmembrane helix predicted for
FT                   Smlt0342 by TMHMM2.0 at aa 5-27"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        342968..343189
FT                   /transl_table=11
FT                   /locus_tag="Smlt0343"
FT                   /product="putative CsbD-like stress-related protein"
FT                   /note="similarity:fasta; with=UniProt:Q3BN33
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; Hypothetical protein.; length=69; id
FT                   75.000%; ungapped id 75.000%; E()=4.9e-18; 68 aa overlap;
FT                   query 1-68; subject 1-68"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0343"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43944"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR026042"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ15"
FT                   /protein_id="CAQ43944.1"
FT                   /translation="MNKDIISGKWSQLKGKAQAKWGDLTNDDFDVAEGNAEYLAGRLQE
FT                   RYGWAKDRAEKEVREFQDAVSKDYPDYK"
FT   misc_feature    342977..343135
FT                   /locus_tag="Smlt0343"
FT                   /note="HMMPfam hit to PF05532, CsbD-like, score 3.8e-11"
FT                   /inference="protein motif:HMMPfam:PF05532"
FT   CDS_pept        complement(343263..344072)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0344"
FT                   /product="conserved hypothetical protein"
FT                   /note="N-terminus to codon 180 is similar to codons 100 to
FT                   the C-terminus of )/ncib 9086/r18194)). Hypothetical
FT                   protein. UniProt:Q39PD7 (EMBL:CP000150 (256 aa) fasta
FT                   scores: E()=6.3e-12, 40.506% id in 158 aa, and to similar
FT                   to the entire protein of Geobacter uraniumreducens rf4.
FT                   hypothetical protein precursor. UniProt:Q2DIX3
FT                   (EMBL:AAON01000077 (259 aa) fasta scores: E()=3e-11,
FT                   31.765% id in 255 aa"
FT                   /note="similarity:fasta; with=UniProt:Q39PD7
FT                   (EMBL:CP000150;);/NCIB 9086/R18194)).; Hypothetical
FT                   protein.; length=256; id 40.506%; ungapped id 44.444%;
FT                   E()=6.3e-12; 158 aa overlap; query 25-172; subject 98-251"
FT                   /note="similarity:fasta; with=UniProt:Q2DIX3
FT                   (EMBL:AAON01000077;); Geobacter uraniumreducens Rf4.;
FT                   Hypothetical protein precursor.; length=259; id 31.765%;
FT                   ungapped id 36.323%; E()=3e-11; 255 aa overlap; query
FT                   28-269; subject 23-258"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0344"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43945"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ16"
FT                   /protein_id="CAQ43945.1"
FT                   /translation="MKRLLPLLLILPLAGFRPAPMPPPAYEGGPVRMSLVDRDRGTELR
FT                   SYPAEGQRWVAGERGHRYAVRLYNDSPRRVLVVLSVDGVNAISGEDADPSQTGYVLNPG
FT                   QRADITGWRKSQDEVAQFVFSSPSGSYASRTGRPDNIGVVGVAVFEEARRWRPDPILRR
FT                   SLPLPAPAPTAEAAADASASNSRIEGYASKSQAPALGTGHGAREQSSVRDTDFERASRS
FT                   PAQVLQLRYDSARNLRARGILVDTPPSRLPREPQAFPNRYVPDPPAR"
FT   repeat_region   343352..343361
FT                   /rpt_unit_seq="(cg)5"
FT   sig_peptide     complement(343992..344072)
FT                   /locus_tag="Smlt0344"
FT                   /note="Signal peptide predicted for Smlt0344 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.958) with cleavage site
FT                   probability 0.654 between residues 27 and 28"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        344181..345473
FT                   /transl_table=11
FT                   /locus_tag="Smlt0345"
FT                   /product="putative tryptophanyl-tRNA synthetase"
FT                   /note="similarity:fasta; with=UniProt:Q8P3Z4
FT                   (EMBL:AE012513;); Xanthomonas campestris pv. campestris.;
FT                   trpS; Tryptophanyl-tRNA synthetase (EC 6.1.1.2)
FT                   (Tryptophan--tRNA ligase) (TrpRS).; length=431; id 76.279%;
FT                   ungapped id 76.457%; E()=4e-120; 430 aa overlap; query
FT                   1-430; subject 3-431"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0345"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43946"
FT                   /db_xref="GOA:B2FJ17"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR010879"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="InterPro:IPR036913"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ17"
FT                   /protein_id="CAQ43946.1"
FT                   /translation="MTTRVLTGITPSGTPHLGNYVGAIRPAIAASRAPGIESFFFLADL
FT                   HSLIKSQDPQRTQRATLEIAASWLACGLDPEHVWFYRQSDIRETTELMWFLTAIASKGI
FT                   LNRAHAYKAAVDKNREEGVDEDAGVSAGLFMYPVLMAADILIFKANQVPVGRDQIQHIE
FT                   MARDFAQRFNHVYGKEYFPLPDVVIDEQVATLAGLDGRKMSKSYHNTIPLFVPREELKK
FT                   LVFSILTDSRAPGEPKDTEGSALFQMYQAFATPEQTAEFARAFAAGISWGDAKQQLFER
FT                   IDSELSPLRERYNALMAEPEKIEALLKRRGQQLREQLAAPLLDELRHAVGLRDLSTAGD
FT                   IASEDAGVARVAPPLFKQYREKDGRFYFKLTAGDGTLLIQSEGFDSPRDAGQLIAVIKQ
FT                   AEQGDQLQSELFKLEAEVDAVLAALAMLREA"
FT   misc_feature    344184..345041
FT                   /locus_tag="Smlt0345"
FT                   /note="HMMPfam hit to PF00579, tRNA synthetases class I (W
FT                   and Y), score 2.5e-61"
FT                   /inference="protein motif:HMMPfam:PF00579"
FT   CDS_pept        345641..345979
FT                   /transl_table=11
FT                   /locus_tag="Smlt0346"
FT                   /product="putative transmembrane protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0346"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43947"
FT                   /db_xref="GOA:B2FJ18"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ18"
FT                   /protein_id="CAQ43947.1"
FT                   /translation="MMSARLRRDDMESAMAWLSLLLFLPWFLLLGSLYWLFPRQPRTPR
FT                   RRLFDGTTLLLAFALSVASMLWGYRLGMAQPGAGPIWPQVLAVLYAYGAFLAVLVLALL
FT                   LRPRFALR"
FT   misc_feature    order(345683..345751,345785..345853,345881..345949)
FT                   /locus_tag="Smlt0346"
FT                   /note="3 probable transmembrane helices predicted for
FT                   Smlt0346 by TMHMM2.0 at aa 15-37, 49-71 and 81-103"
FT                   /inference="protein motif:TMHMM:2.0"
FT   repeat_region   complement(346051..346128)
FT                   /rpt_family="R=0"
FT                   /inference="nucleotide motif:RepeatScout"
FT   CDS_pept        346229..347161
FT                   /transl_table=11
FT                   /locus_tag="Smlt0347"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /note="similarity:fasta; with=UniProt:Q4UPH4
FT                   (EMBL:CP000050;); Xanthomonas campestris pv. campestris
FT                   (strain 8004).; Beta-lactamase related protein.;
FT                   length=317; id 68.421%; ungapped id 68.421%; E()=1.2e-76;
FT                   304 aa overlap; query 7-310; subject 12-315"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0347"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43948"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR037482"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ19"
FT                   /protein_id="CAQ43948.1"
FT                   /translation="MIADPSIHTIDTGFQRPDFDAAYLIVENDRAAFVDCGTGLSVPAM
FT                   LQALANAGLAVDAVDWLLLTHVHLDHAGGAGLLMQQLPNAKAVLHPRGAPHMIDPTRLI
FT                   AGATAVYGAEEIARSYGRIEAIPEHRVVVAEDGHRIDLAGRELVLLHTPGHALHHYCVW
FT                   DARGRSWFTGDTFGISYRELDSAQGAFIFPTSSPVQFDPEAMKASIQRMLGYGPQAMYL
FT                   THYGRVEQVQKLANDLFEQIDAMATIGRQCDGRPDRHRCLLAALQALYLERAQLHGCAL
FT                   DDAAVIAVLAMDIELNAQGLACWLDRISR"
FT   misc_feature    346283..346900
FT                   /locus_tag="Smlt0347"
FT                   /note="HMMPfam hit to PF00753, Metallo-beta-lactamase
FT                   superfamily, score 3.8e-22"
FT                   /inference="protein motif:HMMPfam:PF00753"
FT   CDS_pept        347267..348919
FT                   /transl_table=11
FT                   /locus_tag="Smlt0348"
FT                   /product="putative peptidase"
FT                   /note="similarity:fasta; with=UniProt:Q3BN36
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; Putative peptidase precursor.; length=550;
FT                   id 76.909%; ungapped id 76.909%; E()=4.4e-171; 550 aa
FT                   overlap; query 1-550; subject 1-550"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0348"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43949"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ20"
FT                   /protein_id="CAQ43949.1"
FT                   /translation="MRVLLLSSCLFVGGLAHAANDLPGGGIDPQALSRHVRVLASDEFE
FT                   GRAPATEGEERTVQYLIEQFRSYGLQPGGVDGSWVQPVPLVRAQLDGPAKASLSLKQGK
FT                   RALANGVDVTLQSLQPRKRVQIKDAPLVFVGYGIDAPERHWNDYKDVDLHGKIAVVLIN
FT                   DADFEADAPGAFDGKAVTYYGRWTYKFEEAARRGAEGVLIVHETAPAAYGWATVKSSGT
FT                   SPLFDIERGQAEAMAQHTPLRGWMQRELAEAIFADAGLDFDAEKRKAMRADFRPVALDN
FT                   AKLSVDFALKREQVVTRNVVAKLPGGEHADEAVIFSAHWDAFGIGEADAKGDRIRRGAI
FT                   DNATGVATVLELGRVFAAGPQPQRTLYFVALTAEEKGLLGASYYAAHPLAPLDKTAAVL
FT                   NIEMFSPDGATRDIASWGKGRVSLEGDLERVAKARGRSYSPDPNLEAGFFYRADHFAFA
FT                   RLGVPAITIGPGLDKLDGGVEAGRALREKYFADCYHQACDAWTPSWDPSGHAADTLLVY
FT                   DLGAELANSRRWPTWEKESEFRGARDKSEAARR"
FT   sig_peptide     347267..347320
FT                   /locus_tag="Smlt0348"
FT                   /note="Signal peptide predicted for Smlt0348 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 1.000 between residues 18 and 19"
FT                   /inference="protein motif:SignalP:2.0"
FT   repeat_region   347524..347531
FT                   /rpt_unit_seq="(gc)4"
FT   repeat_region   347578..347585
FT                   /rpt_unit_seq="(gc)4"
FT   misc_feature    348200..348796
FT                   /locus_tag="Smlt0348"
FT                   /note="HMMPfam hit to PF04389, Peptidase family M28, score
FT                   3.7e-64"
FT                   /inference="protein motif:HMMPfam:PF04389"
FT   repeat_region   348959..349047
FT                   /rpt_family="R=0"
FT                   /inference="nucleotide motif:RepeatScout"
FT   repeat_region   349015..349022
FT                   /rpt_unit_seq="(ag)4"
FT   repeat_region   349046..349066
FT                   /rpt_unit_seq="(ccgattg)3"
FT   CDS_pept        complement(349091..349420)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0349"
FT                   /product="putative transmembrane protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0349"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43950"
FT                   /db_xref="GOA:B2FJ21"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ21"
FT                   /protein_id="CAQ43950.1"
FT                   /translation="MAAASPATPLMWIAATLAAATALAWLLRRPNAQVAWPRIGFGMAL
FT                   LVFCAALALQLAVDLGSGHSSLQLRLHRGINAGSPVGLRTMVACYLAALAAGGWGAWTL
FT                   LRRRR"
FT   misc_feature    complement(order(349106..349174,349253..349321,
FT                   349340..349393))
FT                   /locus_tag="Smlt0349"
FT                   /note="3 probable transmembrane helices predicted for
FT                   Smlt0349 by TMHMM2.0 at aa 10-27, 34-56 and 83-105"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(349349..349420)
FT                   /locus_tag="Smlt0349"
FT                   /note="Signal peptide predicted for Smlt0349 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.963) with cleavage site
FT                   probability 0.550 between residues 24 and 25"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(349458..350792)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0350"
FT                   /product="putative MFS family transmembrane transporter
FT                   protein"
FT                   /note="similarity:fasta; with=UniProt:Q4UNS6
FT                   (EMBL:CP000050;); Xanthomonas campestris pv. campestris
FT                   (strain 8004).; Dicarboxylate transport protein.;
FT                   length=453; id 77.652%; ungapped id 78.182%; E()=2.7e-123;
FT                   443 aa overlap; query 1-440; subject 1-443"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0350"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43951"
FT                   /db_xref="GOA:B2FJ22"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ22"
FT                   /protein_id="CAQ43951.1"
FT                   /translation="MSTTSQSAVTRTDGAALRRSISNTLKGSAGNLVEWYDVYVYSVFA
FT                   VYFESQFFSPDDKNSTMYVWAIFAATFLMRPIGAWFFGRFADRHGRRLALTVSVTLMAL
FT                   CSFLIAITPTAASIGIWAAVILLFARLLQGFATGGEYGASATYMSEAAIPGRRGFLSSF
FT                   HYVTLVGGHVLAQLTLLLMLTFWGKPEISEWGWRIAFGIGGIAAVVVFWLRRGMDESLS
FT                   ESSIEAARVGKAQKSGSMYELFVHQWRPLLLCFLITAGGTVAFYTYSVNGPKMIQSAFA
FT                   GNDPMTGTLINLGVLAFLMVLQPVGGWLSDIIGRKTLLVFFGVGGVLYSWYLITQLPHQ
FT                   HDATLAFLTLALAFVILTGYTSINAVVKAELFPTHVRALGVGLGYALANSLFGGTAPLL
FT                   YQGALKTGHVDWFAIYVTATIAVSLVVYVFFLTNKGPNWLDGTRN"
FT   misc_feature    complement(349479..350729)
FT                   /locus_tag="Smlt0350"
FT                   /note="HMMPfam hit to PF00083, Sugar (and other)
FT                   transporter, score 2.9e-20"
FT                   /inference="protein motif:HMMPfam:PF00083"
FT   misc_feature    complement(order(349494..349562,349590..349658,
FT                   349692..349760,349788..349841,349866..349934,
FT                   349977..350045,350154..350213,350241..350309,
FT                   350367..350435,350448..350516,350535..350603,
FT                   350646..350714))
FT                   /locus_tag="Smlt0350"
FT                   /note="12 probable transmembrane helices predicted for
FT                   Smlt0350 by TMHMM2.0 at aa 27-49, 64-86, 93-115, 120-142,
FT                   162-184, 194-213, 250-272, 287-309, 318-335, 345-367,
FT                   379-401 and 411-433"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(349578..350714)
FT                   /locus_tag="Smlt0350"
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 2.6e-14"
FT                   /inference="protein motif:HMMPfam:PF07690"
FT   repeat_region   350846..350853
FT                   /rpt_unit_seq="(cg)4"
FT   CDS_pept        complement(351014..352120)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0351"
FT                   /product="putative transmembrane protein"
FT                   /note="similarity:fasta; with=UniProt:Q5QUN2
FT                   (EMBL:AE017340;); Idiomarina loihiensis.; natB_1; ABC-type
FT                   Na+ efflux pump, permease component.; length=401; id
FT                   25.132%; ungapped id 27.536%; E()=3.8e-14; 378 aa overlap;
FT                   query 2-356; subject 15-382"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0351"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43952"
FT                   /db_xref="GOA:B2FJ23"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ23"
FT                   /protein_id="CAQ43952.1"
FT                   /translation="MISLFEFRRHLDIRGEVAGLLLLAVIALVKLGGDAILARESAAVV
FT                   HLDARGTPVAGLSEGRFHFSDALGDGVSGDPPILSSVAGDYILHTEQPPGWLGELQRSL
FT                   DTLHRQHSLSLLGVTRDQLRKVDSPVSLRVIDSRGTGVFADTSLTAVSIAMVVLTTLAI
FT                   LGCLGMIFQGLLGERFGHATEMILSAAPPGLWLDCKVAASILHGLKTVAVYGVYGAIGW
FT                   TLMSGSASGDATFAEGSWKVMLGLLVFCLLGLMLWNWFFAACATAIRSPHSAFRNTLPA
FT                   FPLTMIMIGFAGLRTPDGAFMHVMSLFPFTSMAAMPVRLLYVNVPIWEIALSLSLLAFT
FT                   AALLRKWARSNFRTAIVSPVEPTHTSSD"
FT   misc_feature    complement(order(351089..351157,351233..351301,
FT                   351338..351397,351440..351508,351596..351664))
FT                   /locus_tag="Smlt0351"
FT                   /note="5 probable transmembrane helices predicted for
FT                   Smlt0351 by TMHMM2.0 at aa 153-175, 205-227, 242-261,
FT                   274-296 and 322-344"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(352132..352869)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0352"
FT                   /product="putative ATP-binding component of ABC
FT                   transporter"
FT                   /note="similarity:fasta; with=UniProt:Q0S6N7; ; length=298;
FT                   id 42.523%; ungapped id 42.723%; E()=9.2e-24; 214 aa
FT                   overlap; query 2-215; subject 5-217"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0352"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43953"
FT                   /db_xref="GOA:B2FJ24"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ24"
FT                   /protein_id="CAQ43953.1"
FT                   /translation="MLLAEQVCKRFGERIVLRDLDLCVPPGEIVGIIGANGVGKTTLFR
FT                   ILCHLIPADSGTVAFGTEADTASVPYVDIGYLPESRSLFSEVTVGRTLEFWARLRGMSG
FT                   KQAVKARDVWLEEIGLLARASNRVSSLSKGNLQKLQLAACMLHDPGVLILDEPFSGLDP
FT                   VNQIAVADLINRAARQGTAVVLSAHHIELLQRLARRILMLRDGQLHPATSQDLHPTRIV
FT                   ALSHPLHCESSPHDLRPEKSLCE"
FT   misc_feature    complement(352252..352791)
FT                   /locus_tag="Smlt0352"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   8.6e-52"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   repeat_region   352499..352506
FT                   /rpt_unit_seq="(gc)4"
FT   CDS_pept        complement(352856..353737)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0353"
FT                   /product="putative transposase"
FT                   /note="N-terminus is similar to ) Sphingomonas sp. ska58.
FT                   putative isxo8 transposase. UniProt:Q1N9M6
FT                   (EMBL:AAQG01000017 (300 aa) fasta scores: E()=3.8e-33,
FT                   40.891% id in 247 aa"
FT                   /note="similarity:fasta; with=UniProt:Q1N9M6
FT                   (EMBL:AAQG01000017;); Sphingomonas sp. SKA58.; Putative
FT                   ISXo8 transposase.; length=300; id 40.891%; ungapped id
FT                   41.564%; E()=3.8e-33; 247 aa overlap; query 3-248; subject
FT                   19-262"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0353"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43954"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ25"
FT                   /protein_id="CAQ43954.1"
FT                   /translation="MELVDYLHDSAFDPRDQESMISVAPVLRKLGNNQTFLSEIICKEL
FT                   KDSKSIQVDNDYTPQVLMLHAPQVSGQSYFIRACFWPGHEDEILAASGHSTFFYGIPHD
FT                   HNFNFLTIGYQGPGYISDYFEYDYASVCGIPGESVDLRFMERSQLNKGSMLLYRAFQDV
FT                   HQQMAPESFSVSINIMEHSLRSVTMDQYEFEPGTGTISQIINRSSAAAIFMIAAATEDG
FT                   ESQQLLRDIFRSHPMDRVRMAALEALIANSPTPEAALQLTTMVQSRHSLFMRSRARQLA
FT                   DGFEERSRHASR"
FT   CDS_pept        complement(353789..354553)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0354"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0354"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43955"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ26"
FT                   /protein_id="CAQ43955.1"
FT                   /translation="MLSICREFDQVILRDFFHDECRSHMGSPLYATPGKFFVKPPLAGM
FT                   VIYKDEFVDVHYMQSSPLQAAAAFQAGVETGITINGTDSLVFFTDTPGVEYQVYPVHTG
FT                   DESDPRLGPPSRGQSASGDHLFLEGGRQGMHLLHGSSPTSMIVCLSSRSRSEVTQHFSL
FT                   PSGKLVGCTATSVTDSRLQIIATALSYLRGSDNTGALLDMSRHPTTFVRWNALRSLYRV
FT                   DPAAASERLKEMRENDVNEEIRKLATRSLEQG"
FT   CDS_pept        354682..355002
FT                   /transl_table=11
FT                   /locus_tag="Smlt0355"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0355"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43956"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ27"
FT                   /protein_id="CAQ43956.1"
FT                   /translation="MQTVLQDHPRVPTFELDLSYCLRRVGRMIRPTRVGYHFGWMPRLM
FT                   RMPTTMPTAAQPAPVVSIKMHEPCIPTDLACLGSAFGSTGCSSDGQDGNDDCNGNQDRF
FT                   NG"
FT   CDS_pept        355359..356264
FT                   /transl_table=11
FT                   /locus_tag="Smlt0357"
FT                   /product="putative transmembrane protein"
FT                   /note="similarity:fasta; with=UniProt:Q4UPH9
FT                   (EMBL:CP000050;); Xanthomonas campestris pv. campestris
FT                   (strain 8004).; Integral membrane protein.; length=300; id
FT                   75.166%; ungapped id 76.174%; E()=1.1e-69; 302 aa overlap;
FT                   query 1-300; subject 1-300"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0357"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43957"
FT                   /db_xref="GOA:B2FJ28"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ28"
FT                   /protein_id="CAQ43957.1"
FT                   /translation="MSASPVPFAAAPRGGLVALALLLVYVVWGSTYLGIAKALHGGALP
FT                   LTMVSGSRFIIAGGLMFLALRLFWKMPNPTLRQWRNLVVMGVTMLVLGNGMVVLAEREV
FT                   SSGLAATAVASVPLWMALFSALRGQHASRGEWLGIAIGFLGVVWLNAGSSLTASPTGLV
FT                   LLLIAPIGWAFGSVWARGLDLPGPFMTAAGQMICGGVLLVLIGLAVGERPTTLPDTGGL
FT                   LAMAYLCVFGSIVAFTAYVWLLQNVRPALAGSYAYVNPVIAVLLGALLNGERFGWRDLL
FT                   AMAVILLGVVVLTMARTRKK"
FT   misc_feature    order(355395..355463,355506..355565,355599..355658,
FT                   355668..355736,355755..355814,355824..355892,
FT                   355911..355979,356022..356090,356109..356168,
FT                   356196..356249)
FT                   /locus_tag="Smlt0357"
FT                   /note="10 probable transmembrane helices predicted for
FT                   Smlt0357 by TMHMM2.0 at aa 13-35, 50-69, 81-100, 104-126,
FT                   133-152, 156-178, 185-207, 222-244, 251-270 and 280-297"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    355434..355811
FT                   /locus_tag="Smlt0357"
FT                   /note="HMMPfam hit to PF00892, Integral membrane protein
FT                   DUF6, score 8.9e-18"
FT                   /inference="protein motif:HMMPfam:PF00892"
FT   misc_feature    355866..356243
FT                   /locus_tag="Smlt0357"
FT                   /note="HMMPfam hit to PF00892, Integral membrane protein
FT                   DUF6, score 1.8e-19"
FT                   /inference="protein motif:HMMPfam:PF00892"
FT   CDS_pept        356261..357157
FT                   /transl_table=11
FT                   /locus_tag="Smlt0358"
FT                   /product="putative drug/metabolite transmembrane
FT                   transporter protein"
FT                   /note="similarity:fasta; with=UniProt:P83936
FT                   (EMBL:AY335438;); Streptomyces exfoliatus (Streptomyces
FT                   hydrogenans).; rarD; Protein rarD.; length=315; id 45.918%;
FT                   ungapped id 46.075%; E()=9.4e-45; 294 aa overlap; query
FT                   5-298; subject 4-296"
FT                   /note="similarity:fasta; with=UniProt:Q3BN39
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; rarD; Drug/metabolite transporter
FT                   superfamily protein.; length=302; id 76.531%; ungapped id
FT                   76.531%; E()=5.4e-83; 294 aa overlap; query 2-295; subject
FT                   3-296"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0358"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43958"
FT                   /db_xref="GOA:B2FJ29"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ29"
FT                   /protein_id="CAQ43958.1"
FT                   /translation="MSMDEKEQRRGLLVTASTFVIWGLVPVYWHLLNEVPSFQIIAHRI
FT                   IWSTVMVLGWLLISSRLGWWQKIAAQPRALPILLVSSLTIAFNWGLYIWAVNAGHVIET
FT                   SLGYFINPLVNVLLGVLVLKERLRRLQWVAVAMAAVGVAWLTIDAGTPPWIALGLACSF
FT                   GLYGLLRKLVSVDPVAGLGVESMYLFLPALAFAIWAENGHGGAFFHGWGWRNDLLLVFG
FT                   GAVTAVPLIGFAYGVKRIPLSLVGILQYIAPSLQLLLGVFFFHEGFDTAKAIGFAAIWA
FT                   GLILFVGDNIRTMRAKR"
FT   misc_feature    order(356294..356350,356378..356446,356480..356548,
FT                   356561..356629,356648..356701,356714..356767,
FT                   356792..356860,356903..356971,356984..357052,
FT                   357080..357133)
FT                   /locus_tag="Smlt0358"
FT                   /note="10 probable transmembrane helices predicted for
FT                   Smlt0358 by TMHMM2.0 at aa 12-30, 40-62, 74-96, 101-123,
FT                   130-147, 152-169, 178-200, 215-237, 242-264 and 274-291"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    356318..356701
FT                   /locus_tag="Smlt0358"
FT                   /note="HMMPfam hit to PF00892, Integral membrane protein
FT                   DUF6, score 2e-07"
FT                   /inference="protein motif:HMMPfam:PF00892"
FT   repeat_region   356475..356482
FT                   /rpt_unit_seq="(cg)4"
FT   misc_feature    356555..357052
FT                   /locus_tag="Smlt0358"
FT                   /note="HMMPfam hit to PF04142, Nucleotide-sugar
FT                   transporter, score 0.0044"
FT                   /inference="protein motif:HMMPfam:PF04142"
FT   repeat_region   356635..356681
FT                   /rpt_family="(CGG)n"
FT                   /inference="nucleotide motif:RepeatScout"
FT   misc_feature    356741..357124
FT                   /locus_tag="Smlt0358"
FT                   /note="HMMPfam hit to PF00892, Integral membrane protein
FT                   DUF6, score 5.9e-08"
FT                   /inference="protein motif:HMMPfam:PF00892"
FT   repeat_region   357327..357336
FT                   /rpt_unit_seq="(ga)5"
FT   CDS_pept        complement(357365..360223)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0359"
FT                   /product="putative TonB dependent receptor protein"
FT                   /note="similarity:fasta; with=UniProt:Q8PH16
FT                   (EMBL:AE011990;); Xanthomonas axonopodis pv. citri.; btuB;
FT                   TonB-dependent receptor.; length=948; id 46.536%; ungapped
FT                   id 48.283%; E()=4.8e-155; 967 aa overlap; query 1-952;
FT                   subject 2-948"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0359"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43959"
FT                   /db_xref="GOA:B2FJ30"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ30"
FT                   /protein_id="CAQ43959.1"
FT                   /translation="MSLKTNPLRNAIVIALAASCTTPAFAQSAGDTPTNLDRIEITGSR
FT                   IRQASVETAQPVVALSRAEIEKKGYINVADILQDVTAAGAPSLSRSSSLSSSRDFGGTY
FT                   VSLRNLGPERSLVLIDGRRMGVSAGGYSDLASIPSAIVERVEVLTDGASALYGSDAIAG
FT                   VVNIITRKNFDGGEASVYVGQYGEGDGQKRSYSATFGKTFDRGWFSVGAERTKEDEILG
FT                   SEREFSRYPGGPRHPDDVKALNQTTQWGSVTVDGKSLTVGPGGDPSQKGNFHTPNPADG
FT                   ANTKTNMSLLSGLERTSVFANGGFSITDDLRIVADALYSKRESTKHLAGYPYSVSTAQA
FT                   RNGSRAALSKDSAFNHWGQDVLFSHRTEEMPRATENNLDTKRASIGLEGSFETGSRYWD
FT                   WNVSYMYNRNEGERIGTGSMYQPHVDLAVGPSFMDGTVARCGRPGAVIAGCVPWNPAAP
FT                   MGYAGPGSLSNQDVQDYLFTRFVDKMKSTTKVASANISGSVFTLPAGDVMAAMGFEHRN
FT                   EEASYTPDLMVQKGQIAGTTGQPTRGDYSLNEVYLELQVPLLADMPFARELSLDLAGRY
FT                   TDYNTFGSTTNSKFGLKWKPIDSLLVRATYGTGFRAPTVDDLYGGAVKSRDSFTDPCDT
FT                   SFGIAASSATVAARCQALKVPADFRQQTASEGNVANRPGQQGIADFDSGSNANLKPETA
FT                   KTWTVGLVYSPEFVPGLDVSLDWWKIRIDNAIVGESATDILNQCYVQGVDSACGRFTRS
FT                   TSAKTLGQVTSLDRSLVNAGYRETAGYDFSLRYRLPETAFGRFAATWNTTYTDYLEQRN
FT                   DSAATTPVEQKTGWQGNFRVRSTFNLDWQYGDLGIGWTARYYSGMKEACSYDLAGGPDC
FT                   NMAGFVSPYTDAQPSRKVGSNTFHDLQVRYSLPWDGTVSLGVNNVFDHQGPIMYSQPNS
FT                   SFTYYGGFDIGRFMYMKYQQRF"
FT   misc_feature    complement(357368..358465)
FT                   /locus_tag="Smlt0359"
FT                   /note="HMMPfam hit to PF00593, TonB dependent receptor,
FT                   score 1.7e-25"
FT                   /inference="protein motif:HMMPfam:PF00593"
FT   repeat_region   359698..359800
FT                   /rpt_family="R=20"
FT                   /inference="nucleotide motif:RepeatScout"
FT   misc_feature    complement(359732..360079)
FT                   /locus_tag="Smlt0359"
FT                   /note="HMMPfam hit to PF07715, TonB-dependent Receptor Plug
FT                   Domain, score 6.9e-19"
FT                   /inference="protein motif:HMMPfam:PF07715"
FT   sig_peptide     complement(360146..360223)
FT                   /locus_tag="Smlt0359"
FT                   /note="Signal peptide predicted for Smlt0359 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.974 between residues 26 and 27"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(360617..361939)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0360"
FT                   /product="putative transmembrane permease component of ABC
FT                   transporter"
FT                   /note="similarity:fasta; with=UniProt:Q2P984
FT                   (EMBL:AP008229;); Xanthomonas oryzae pv. oryzae (strain
FT                   MAFF 311018).; Hypothetical protein XOO0138.; length=436;
FT                   id 82.217%; ungapped id 82.217%; E()=1.6e-123; 433 aa
FT                   overlap; query 7-439; subject 3-435"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0360"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43960"
FT                   /db_xref="GOA:B2FJ31"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ31"
FT                   /protein_id="CAQ43960.1"
FT                   /translation="MFKSKLKKWLGNGLTVLLLVIGLVLWISLPWFGVLAVAVLVALWL
FT                   LLTRGGRLALAATRIGVASLPQRWGASSVIVVGIAGVVGVLVAMLAMGEGFQATLNNTG
FT                   DDTTAIVLRGGSQAETNSVITREQVPTLSTLPGISRDGEGRPLLSPELSQVVNLVSKSD
FT                   GTDVNAQFRGVGPQAWAVHDKVKIIEGRKFAAGLREIVVGQGAKGQFRDMDVGRTLTLG
FT                   NQTWTVVGVFATGDAHDSELWTDADTLATTYQRSAWQSISVRTDGKAGFEQFKAAVAAD
FT                   PRLKLDVETTRVYYSKQGGGLTKLIDILGKVIGTIMAVGAVFGALNTMYAAVATRAREI
FT                   ATMRAIGFRGLPVVTAVMLETMLLALLGGLLGCAVAWLLFNGYSVSTIGSNFSAVVFKF
FT                   HVSPELLWTGLKWALGIGLVGGLFPALRAARLPITTALRET"
FT   misc_feature    complement(360641..361168)
FT                   /locus_tag="Smlt0360"
FT                   /note="HMMPfam hit to PF02687, Predicted permease, score
FT                   1.2e-22"
FT                   /inference="protein motif:HMMPfam:PF02687"
FT   misc_feature    complement(order(360659..360727,360785..360853,
FT                   360938..361006,361667..361735,361796..361849,
FT                   361859..361915))
FT                   /locus_tag="Smlt0360"
FT                   /note="6 probable transmembrane helices predicted for
FT                   Smlt0360 by TMHMM2.0 at aa 9-27, 31-48, 69-91, 312-334,
FT                   363-385 and 405-427"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(361832..361939)
FT                   /locus_tag="Smlt0360"
FT                   /note="Signal peptide predicted for Smlt0360 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.507 between residues 36 and 37"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(361953..363110)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0361"
FT                   /product="putative transmembrane permease protein"
FT                   /note="similarity:fasta; with=UniProt:Q5H6K8
FT                   (EMBL:AE013598;); Xanthomonas oryzae pv. oryzae.;
FT                   Hypothetical protein.; length=385; id 86.494%; ungapped id
FT                   86.494%; E()=2.7e-117; 385 aa overlap; query 1-385; subject
FT                   1-385"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0361"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43961"
FT                   /db_xref="GOA:B2FJ32"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ32"
FT                   /protein_id="CAQ43961.1"
FT                   /translation="MKYFSLVWAQLFRSRTRTLLTLLSVVAAFLLFGMLDSVRVAFSSG
FT                   GSVEGANRLVVASRLSITQSLPIRLETQIRQVAGVRDVAYGMWFGGIYQDPKNFFPNFS
FT                   VSPNYFDVYRELQIDPAQLEDWKQTRTGAIVGESLAKQFGWKIGDTIPLQATIFPRGGS
FT                   NDWPLELKGIYRSKDRALAANEERQLMMNWKYFDESNDYIKNQVSWYTVTLDNPDHSSR
FT                   VAQAIDAISANSDHETKTQTESAFQQAFVKQFADIGMIVTSIMGAVFFTLLLLTGNTMA
FT                   QAVRERVPELATLKTLGFKDSTVLTLVMVESVLLIGLGGLIGMGLAALILPAIGPKSMG
FT                   MLPPHVPTPTWLMGLGLIVVIGIIVGLLPALRAKRLKIVDALAGR"
FT   misc_feature    complement(361977..362492)
FT                   /locus_tag="Smlt0361"
FT                   /note="HMMPfam hit to PF02687, Predicted permease, score
FT                   3.7e-28"
FT                   /inference="protein motif:HMMPfam:PF02687"
FT   misc_feature    complement(order(361998..362066,362109..362177,
FT                   362280..362348,362985..363053))
FT                   /locus_tag="Smlt0361"
FT                   /note="4 probable transmembrane helices predicted for
FT                   Smlt0361 by TMHMM2.0 at aa 20-42, 255-277, 312-334 and
FT                   349-371"
FT                   /inference="protein motif:TMHMM:2.0"
FT   repeat_region   362286..362297
FT                   /rpt_unit_seq="(cag)4"
FT   sig_peptide     complement(362982..363110)
FT                   /locus_tag="Smlt0361"
FT                   /note="Signal peptide predicted for Smlt0361 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.554 between residues 43 and 44"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(363125..363814)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0362"
FT                   /product="putative ATP-binding component of ABC
FT                   transporter"
FT                   /note="similarity:fasta; with=UniProt:Q3BN43
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; ABC transporter ATP-binding protein.;
FT                   length=229; id 91.228%; ungapped id 91.228%; E()=5.1e-69;
FT                   228 aa overlap; query 1-228; subject 1-228"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0362"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43962"
FT                   /db_xref="GOA:B2FJ33"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ33"
FT                   /protein_id="CAQ43962.1"
FT                   /translation="MSTLVSLRNITKTYQRGPEKVQVLHGIDLDIASGDFVALMGPSGS
FT                   GKTTLLNLIGGLDSPSGGEISIEGERIDQMSGGQLSTWRSHHVGFVFQFYNLMPMLTAQ
FT                   KNVELPLLLTHLNAAQRRRNAEIALTLVGLADRRSHRPNELSGGQQQRVAIARAIVSDP
FT                   TFLICDEPTGDLDRQSAEEILGLLQQLNREHGKTIIMVTHDPKAAEYATHTVHLDKGEL
FT                   ADAPLAH"
FT   misc_feature    complement(363155..363715)
FT                   /locus_tag="Smlt0362"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   5.1e-68"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   CDS_pept        complement(363917..365170)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0363"
FT                   /product="putative HlyD secretion family protein"
FT                   /note="similarity:fasta; with=UniProt:Q3BN44
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; Membrane fusion protein.; length=414; id
FT                   73.558%; ungapped id 75.743%; E()=1.3e-97; 416 aa overlap;
FT                   query 1-413; subject 1-407"
FT                   /note="similarity:fasta; with=UniProt:Q8PFI6
FT                   (EMBL:AE012048;); Xanthomonas axonopodis pv. citri.; acrE;
FT                   Acriflavin resistance protein.; length=375; id 76.152%;
FT                   ungapped id 76.152%; E()=3.3e-91; 369 aa overlap; query
FT                   47-415; subject 2-370"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0363"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43963"
FT                   /db_xref="GOA:B2FJ34"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ34"
FT                   /protein_id="CAQ43963.1"
FT                   /translation="MNASAELLKELRIDRKSPPPASGGGSNGGGRRWLWIAIIVVVLLI
FT                   AAAVAFLFGRAPAVEVETAPAVAIQQGSASSSVLDASGYVVARRMATVSAKITGKVREV
FT                   MIEEGMRVEAGQVMATLDPIDADAQRSLYASQLQAARSQVAGLEAQQKQAAAEASRLQA
FT                   LVGQQLVSRSQYDQAVAQRDSLRAQLETAQRNVKVANDQLAIADLGVDNNIVRAPFSGV
FT                   VTAKAAQPGEIVSPLSAGGGFTRTGIGTIVDMDSLEIEVEVGEAFIGRVQPKMPVEATL
FT                   NAYPEWKIPGEVIAIIPTADRGKATVKVRVALKVKDPRIVPEMGVRVSFLEQAQPQAAA
FT                   KPQGVRVPAGAVVQREGASVAFVLGDQSRVQQRTVEAGQAMGKDRQILKGVSAGESVVV
FT                   NPPDTLRDGAKVQQKQAQ"
FT   misc_feature    complement(363974..364906)
FT                   /locus_tag="Smlt0363"
FT                   /note="HMMPfam hit to PF00529, HlyD family secretion
FT                   protein, score 2.7e-05"
FT                   /inference="protein motif:HMMPfam:PF00529"
FT   repeat_region   364519..364526
FT                   /rpt_unit_seq="(gc)4"
FT   misc_feature    complement(365006..365074)
FT                   /locus_tag="Smlt0363"
FT                   /note="1 probable transmembrane helix predicted for
FT                   Smlt0363 by TMHMM2.0 at aa 33-55"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        365373..366269
FT                   /transl_table=11
FT                   /locus_tag="Smlt0364"
FT                   /product="putative ATP binding component of ABC
FT                   transporter"
FT                   /note="similarity:fasta; with=UniProt:Q9A947
FT                   (EMBL:AE005793;); Caulobacter crescentus (Caulobacter
FT                   vibrioides).; ABC transporter, ATP-binding protein.;
FT                   length=328; id 47.719%; ungapped id 47.719%; E()=3.9e-32;
FT                   285 aa overlap; query 5-289; subject 24-308"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0364"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43964"
FT                   /db_xref="GOA:B2FJ35"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ35"
FT                   /protein_id="CAQ43964.1"
FT                   /translation="MDPIAPSLARLQQVQVRYRDHTALQGIDLQVRAGQVLALLGRNGA
FT                   GKSTAISVLLGLRRADAGQVELLGGDPQQRSSRLGLGVMLQSTSLPPMLQVDELVAQAS
FT                   ACYPDPMPLQEVLQRAGLQALAGRRYGQLSGGQQRAVQFAIALCGRPRVLFLDEPTTGL
FT                   DIQARQAMWQAIRQLVAEGCGVLLTTHYLEEAEALAQQVVVLEQGRVLADAPLSELRLA
FT                   DRPRRIRCRSVLTVEDVQQWPGVQQVQRDGEHLQLMASPAEPVVARLLAADAQLRELEV
FT                   QGAALVDAFLDMTREAA"
FT   misc_feature    365472..365996
FT                   /locus_tag="Smlt0364"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   9.1e-48"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   CDS_pept        366266..367048
FT                   /transl_table=11
FT                   /locus_tag="Smlt0365"
FT                   /product="putative permease component of ABC transporter"
FT                   /note="similarity:fasta; with=UniProt:Q5QW70
FT                   (EMBL:AE017340;); Idiomarina loihiensis.; ABC-type
FT                   multidrug transport system, permease component.;
FT                   length=245; id 40.506%; ungapped id 40.678%; E()=3.8e-22;
FT                   237 aa overlap; query 24-259; subject 7-243"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0365"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43965"
FT                   /db_xref="GOA:B2FJ36"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ36"
FT                   /protein_id="CAQ43965.1"
FT                   /translation="MNTMARTGTTPAPVSAWRQALRPYGAELVAELRRAWRTPAFAVPS
FT                   LLFPVLFYLLFGVLLGRGHAPLYLLATYCVFGAMAPALFGFGVQLALDREGGLLTLKRA
FT                   LPMPAAAPLLARLAMAVMFALLVAALLIGVARALGGVQLQAVQMLQLLAVAGLAALPLG
FT                   AIGLLIGSHVSASAAPAMVNLVYLPLALLSGLWLPLSALPKVFSMMAPLWPTWHLAQLA
FT                   LPVVGLPSVGSMAGHLLVLLAVTVVALLLARRRLRRIG"
FT   misc_feature    366329..366946
FT                   /locus_tag="Smlt0365"
FT                   /note="HMMPfam hit to PF01061, ABC-2 type transporter,
FT                   score 0.00027"
FT                   /inference="protein motif:HMMPfam:PF01061"
FT   misc_feature    order(366386..366445,366473..366541,366602..366670,
FT                   366707..366775,366794..366862,366953..367021)
FT                   /locus_tag="Smlt0365"
FT                   /note="6 probable transmembrane helices predicted for
FT                   Smlt0365 by TMHMM2.0 at aa 41-60, 70-92, 113-135, 148-170,
FT                   177-199 and 230-252"
FT                   /inference="protein motif:TMHMM:2.0"
FT   repeat_region   366668..366677
FT                   /rpt_unit_seq="(gc)5"
FT   CDS_pept        367055..368269
FT                   /transl_table=11
FT                   /locus_tag="Smlt0366"
FT                   /product="putative transmembrane sensor histidine kinase
FT                   transcriptional regulatory protein"
FT                   /note="similarity:fasta; with=UniProt:Q3BN45
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; Two-component system sensor kinase.;
FT                   length=423; id 51.436%; ungapped id 52.255%; E()=6.8e-64;
FT                   383 aa overlap; query 22-398; subject 41-423"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0366"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43966"
FT                   /db_xref="GOA:B2FJ37"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ37"
FT                   /protein_id="CAQ43966.1"
FT                   /translation="MIGSDHSRLDSSVSSSWLASLLRPAPDSAVADLLRRGKSPWSGAI
FT                   HLLWSVWIFLTPVLGNGFTVRWLLLTVASYPLFLLLYAKVMLAPRHHAWRYALGMILMA
FT                   LVLLPWYPSGLSYFVFGCVMIRMSSRGGWWVYLLQLTGLNLLFCGAALYVGYPWQAMVW
FT                   MPAVSFIVGLVVNVEALSHQRDVALQLSQDEVRRLATTAERERIGRDLHDLLGHTLSLI
FT                   TLKLELARKLYDRDDARARQEIGEAEAIAREALAQVRSAVTGIRASDLAGELASARLLL
FT                   ECQQVHLQYTPPPPMPVDVERGLALVLREAATNIVRHAQATRVQVDFMLEERQLVMQIR
FT                   DDGRGGVQAEGNGLCGMRERAMALGGQLSLQSSRGEGTVVTVRVPLVAATTPLSPASLA
FT                   RDGAA"
FT   misc_feature    order(367181..367249,367253..367321,367349..367417,
FT                   367451..367519,367532..367585)
FT                   /locus_tag="Smlt0366"
FT                   /note="5 probable transmembrane helices predicted for
FT                   Smlt0366 by TMHMM2.0 at aa 31-53, 55-77, 87-109, 121-143
FT                   and 148-165"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    367661..367864
FT                   /locus_tag="Smlt0366"
FT                   /note="HMMPfam hit to PF07730, Histidine kinase, score
FT                   1.3e-24"
FT                   /inference="protein motif:HMMPfam:PF07730"
FT   repeat_region   367765..367776
FT                   /rpt_unit_seq="(cg)6"
FT   repeat_region   367928..367939
FT                   /rpt_unit_seq="(ccg)4"
FT   misc_feature    367949..368215
FT                   /locus_tag="Smlt0366"
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HSP90, score 2.7e-17"
FT                   /inference="protein motif:HMMPfam:PF02518"
FT   CDS_pept        368266..368868
FT                   /transl_table=11
FT                   /locus_tag="Smlt0367"
FT                   /product="putative two-component response regulator
FT                   transcriptional regulatory protein"
FT                   /note="similarity:fasta; with=UniProt:Q3BN46
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; Two-component system response regulator,
FT                   LuxR family.; length=205; id 81.000%; ungapped id 81.000%;
FT                   E()=3.8e-51; 200 aa overlap; query 1-200; subject 6-205"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0367"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43967"
FT                   /db_xref="GOA:B2FJ38"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ38"
FT                   /protein_id="CAQ43967.1"
FT                   /translation="MIRILLAEDQAMVRGALSALLGLEPDIEVLGSAADGEAAWRMLQQ
FT                   LQPDILVTDIEMPGLSGLELAQRIARHELPIKVVIVTTFARAGFLRRALEAGVLGYLLK
FT                   DAPAENLADALRKVKQGIRAIDPQLALDAWSQADPLTDRERRVLRLAGEGRTASEIAEQ
FT                   LGLSHGTVRNYLSECIGKLGVANRIEAYRMARQKGWL"
FT   misc_feature    368269..368613
FT                   /locus_tag="Smlt0367"
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 5.6e-33"
FT                   /inference="protein motif:HMMPfam:PF00072"
FT   misc_feature    368653..368811
FT                   /locus_tag="Smlt0367"
FT                   /note="HMMPfam hit to PF08281, Sigma-70, region, score
FT                   0.00081"
FT                   /inference="protein motif:HMMPfam:PF08281"
FT   misc_feature    368671..368817
FT                   /locus_tag="Smlt0367"
FT                   /note="HMMPfam hit to PF04545, Sigma-70, region, score
FT                   1.5e-06"
FT                   /inference="protein motif:HMMPfam:PF04545"
FT   misc_feature    368674..368847
FT                   /locus_tag="Smlt0367"
FT                   /note="HMMPfam hit to PF00196, Bacterial regulatory
FT                   proteins, luxR fami, score 3.4e-19"
FT                   /inference="protein motif:HMMPfam:PF00196"
FT   misc_feature    368683..368817
FT                   /locus_tag="Smlt0367"
FT                   /note="HMMPfam hit to PF04967, HTH DNA binding domain,
FT                   score 9.3e-05"
FT                   /inference="protein motif:HMMPfam:PF04967"
FT   repeat_region   complement(368935..369128)
FT                   /rpt_family="R=9"
FT                   /inference="nucleotide motif:RepeatScout"
FT   CDS_pept        complement(369168..369359)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0368"
FT                   /product="putative transposase"
FT                   /note="similarity:fasta; CAL1017; bcenocepacia; putative
FT                   transposase; length 321 aa; id=68.0%; ; E()=1e-10; 50 aa
FT                   overlap; query 2-51 aa; subject 257-306 aa"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0368"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43968"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ39"
FT                   /protein_id="CAQ43968.1"
FT                   /translation="MVREALYMAALTAIRYEPRLRAFYAGLKAKGKASKVALVAVMRKM
FT                   LVILNARKRDAEVALGCP"
FT   repeat_region   369190..370291
FT                   /rpt_family="R=6"
FT                   /inference="nucleotide motif:RepeatScout"
FT   CDS_pept        complement(369384..370082)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0369"
FT                   /product="putative transposase"
FT                   /note="similarity:fasta; CAM2606; bcenocepacia; putative
FT                   transposase; length 321 aa; id=40.5%; ; E()=5.1e-23; 242 aa
FT                   overlap; query 4-232 aa; subject 9-246 aa"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0369"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43969"
FT                   /db_xref="GOA:B2FJ40"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ40"
FT                   /protein_id="CAQ43969.1"
FT                   /translation="MFGIGIDVSKATLDVAVHGEQFRQFSNDKRGFVRLIRWLKTWPIK
FT                   QVVLEASGGYERAALDVLHAAGLPMVRINPARARRFAQGTGRAAKTDRLDATVLAQMAH
FT                   LLPLTRYVPPAPWQQRLAEFAQCRRQLVQMRVSEMQRLRRLVDPDLIAMKQRHIAQLSD
FT                   DLKQLDKAIAEQLEGQPGWKNIGALKGVGPILISTLACELPELGSLGSKAIASLVGLAP
FT                   MNRESGTWQG"
FT   misc_feature    complement(369600..369896)
FT                   /locus_tag="Smlt0369"
FT                   /note="HMMPfam hit to PF01548, Transposase, score 2.6e-10"
FT                   /inference="protein motif:HMMPfam:PF01548"
FT   CDS_pept        complement(370206..370550)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0370"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0370"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43970"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ41"
FT                   /protein_id="CAQ43970.1"
FT                   /translation="MFPRLRRGVTFFARKESNQRNAPPAASRRASHAGTLRSSARRGTA
FT                   RELAALRHPHLFALAGPAVLSSLKADWKVKINGKSIHAWRGSYLLPIWHLGCREPGVGD
FT                   RVDPGLATEK"
FT   repeat_region   370338..370530
FT                   /rpt_family="R=9"
FT                   /inference="nucleotide motif:RepeatScout"
FT   CDS_pept        complement(370578..371114)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0371"
FT                   /product="putative cytochrome b-like protein"
FT                   /note="similarity:fasta; with=UniProt:Q9F3R0
FT                   (EMBL:AJ002398;); Rhodobacter sphaeroides (Rhodopseudomonas
FT                   sphaeroides).; cytb-like; Cytochrome b-like protein.;
FT                   length=178; id 43.636%; ungapped id 44.720%; E()=4.8e-20;
FT                   165 aa overlap; query 12-173; subject 9-172"
FT                   /note="similarity:fasta; with=UniProt:Q8PFJ0
FT                   (EMBL:AE012047;); Xanthomonas axonopodis pv. citri.; yodB;
FT                   Cytochrome B561.; length=180; id 77.193%; ungapped id
FT                   77.193%; E()=1e-48; 171 aa overlap; query 7-177; subject
FT                   6-176"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0371"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43971"
FT                   /db_xref="GOA:B2FJ42"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ42"
FT                   /protein_id="CAQ43971.1"
FT                   /translation="MNTHNGHFNLLARVLHWTMALMIIAMLFIGVTMVASLHLRPLLID
FT                   LHRPLGIAILLLVLLRLYNRLRHRPPPLPADLPVWQVMAAKASHWMLYALMLAMPLIGW
FT                   AMLSAGGYPIVLWGGLHLPPIVPHTPALYAALRNAHSLLAYVLFATVLMHVGAALFHLW
FT                   VRRDGVFQAMARGKD"
FT   misc_feature    complement(370587..371075)
FT                   /locus_tag="Smlt0371"
FT                   /note="HMMPfam hit to PF01292, Cytochrome b561 family,
FT                   score 3.1e-33"
FT                   /inference="protein motif:HMMPfam:PF01292"
FT   misc_feature    complement(order(370623..370691,370779..370847,
FT                   370998..371066))
FT                   /locus_tag="Smlt0371"
FT                   /note="3 probable transmembrane helices predicted for
FT                   Smlt0371 by TMHMM2.0 at aa 4-26, 77-99 and 129-151"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(371013..371114)
FT                   /locus_tag="Smlt0371"
FT                   /note="Signal peptide predicted for Smlt0371 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.830) with cleavage site
FT                   probability 0.769 between residues 34 and 35"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(371111..372214)
FT                   /transl_table=11
FT                   /gene="katA"
FT                   /locus_tag="Smlt0372"
FT                   /product="putative catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="similarity:fasta; with=UniProt:Q59337
FT                   (EMBL:AE000513;); Deinococcus radiodurans.; katA; Catalase
FT                   (EC 1.11.1.6).; length=536; id 24.534%; ungapped id
FT                   27.336%; E()=4.4e-07; 322 aa overlap; query 70-367; subject
FT                   78-390"
FT                   /note="similarity:fasta; with=UniProt:Q8PFJ1
FT                   (EMBL:AE012047;); Xanthomonas axonopodis pv. citri.; srpA;
FT                   Catalase.; length=363; id 61.561%; ungapped id 61.739%;
FT                   E()=4.4e-87; 346 aa overlap; query 13-357; subject 6-351"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0372"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43972"
FT                   /db_xref="GOA:B2FJ43"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024168"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ43"
FT                   /protein_id="CAQ43972.1"
FT                   /translation="MSLFRYTRAGQTPGAPRKHSPLLWIALIALILGAVALAFAWLAGW
FT                   IGGRLTAQRFTDTIEATGPAHPGFRRAHSKGICVSGWFEPSAQAPTLSSARVFSQRRVP
FT                   VMGRLSIGGGDPYGADNTARVRSLAVQMVSDDGQEWRMAMNSFPFFAVPDAEAFYEQTR
FT                   ASIPDPTTGKPDPQKMAAVLAKYPSAQAFQQWAKTAPWTSSWADTTFNSVNSFWFTNAQ
FT                   GQKRAVRWRWQPQAPVVEMDAETRKQASVDFLSQELQQRLASGPVRWNLVVTTAAPGDA
FT                   IDDPSVPWPESRDQVVAGVLSLDRMQSQEKGACGQINFDPLILPSGVRGSDDPILAARS
FT                   AVYSQSFNRRERERASGNVEQPKEAAR"
FT   misc_feature    complement(371132..372091)
FT                   /gene="katA"
FT                   /locus_tag="Smlt0372"
FT                   /note="HMMPfam hit to PF00199, Catalase, score 5.9e-07"
FT                   /inference="protein motif:HMMPfam:PF00199"
FT   repeat_region   371842..371849
FT                   /rpt_unit_seq="(cg)4"
FT   misc_feature    complement(372080..372148)
FT                   /gene="katA"
FT                   /locus_tag="Smlt0372"
FT                   /note="1 probable transmembrane helix predicted for
FT                   Smlt0372 by TMHMM2.0 at aa 39-61"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(372095..372214)
FT                   /gene="katA"
FT                   /locus_tag="Smlt0372"
FT                   /note="Signal peptide predicted for Smlt0372 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.956) with cleavage site
FT                   probability 0.476 between residues 40 and 41"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(372351..373718)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0373"
FT                   /product="putative leucine aminopeptidase"
FT                   /note="similarity:fasta; with=UniProt:Q4UPJ2
FT                   (EMBL:CP000050;); Xanthomonas campestris pv. campestris
FT                   (strain 8004).; Leucine aminopeptidase.; length=456; id
FT                   76.211%; ungapped id 76.211%; E()=2.6e-135; 454 aa overlap;
FT                   query 1-454; subject 1-454"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0373"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43973"
FT                   /db_xref="GOA:B2FJ44"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ44"
FT                   /protein_id="CAQ43973.1"
FT                   /translation="MSEITGFTADTAAALPLYVLDREQFAAWKDSQPAATQAWLASQGF
FT                   NAGAHSVALLPGADGLAGAVMGVGDRADAYSYAHAPHALPEGSVWQLANELPAAELALL
FT                   QLGWGLGSYRFDRYRKRNRAPAQLVASPTGEVADLIAASLRVRDWVNTPTEDMGPQQLE
FT                   DAARALAHAHGAQVEAITGDELLKQNFPAIHAVGRASHRAPRLVVLRWGRETDPALVLV
FT                   GKGVCFDTGGLDIKPADGMRNMKKDMGGAAHALALAGLVMARGLPVRLTLLVPAVENAI
FT                   GPDAFRPGEVIATRKGLSVEIDNTDAEGRVILCDALTFAGEQKPDLVLDFATLTGAARI
FT                   ALGPDLPALFSNDDTVAQQWLQAGDATRDPVWRMPLWRPYLRYLSSGIADLANAGSRMA
FT                   GSVTAALYLERFLEDGQRWAHLDVYAWNDGERPGRPAGGEALALRSAWAMLKQRYS"
FT   misc_feature    complement(372381..373283)
FT                   /locus_tag="Smlt0373"
FT                   /note="HMMPfam hit to PF00883, Cytosol aminopeptidase
FT                   family, cataly, score 5.4e-100"
FT                   /inference="protein motif:HMMPfam:PF00883"
FT   repeat_region   373214..373223
FT                   /rpt_unit_seq="(gc)5"
FT   misc_feature    complement(373353..373679)
FT                   /locus_tag="Smlt0373"
FT                   /note="HMMPfam hit to PF02789, Cytosol aminopeptidase
FT                   family, N-term, score 0.0001"
FT                   /inference="protein motif:HMMPfam:PF02789"
FT   CDS_pept        complement(373722..374441)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0374"
FT                   /product="putative haloacid dehalogenase hydrolase"
FT                   /note="similarity:fasta; with=UniProt:Q8P413
FT                   (EMBL:AE012511;); Xanthomonas campestris pv. campestris.;
FT                   Hydrolase.; length=243; id 76.170%; ungapped id 76.170%;
FT                   E()=1.5e-71; 235 aa overlap; query 1-235; subject 1-235"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0374"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43974"
FT                   /db_xref="GOA:B2FJ45"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ45"
FT                   /protein_id="CAQ43974.1"
FT                   /translation="MNFPVQAITLDLDDTLWPFAPIGARIEQVLHAWMCEHSPATAAMY
FT                   PVEAMRELRERLYHAHPHLHHDLSALRRLTLHEALHTSGASLDLLEPAYEVFYAARNQV
FT                   ECYPDAIAALARIAARVPVAALSNGNADLERIGLAHHFAFQLGSREHGAAKPEASIFHA
FT                   ACTRLGVAPAQVLHVGDHADMDVAGAIAAGLRGCWINRDAATWTHPQLQPDLQFDTLTG
FT                   LADWLDANLDAAARRST"
FT   misc_feature    complement(373836..374429)
FT                   /locus_tag="Smlt0374"
FT                   /note="HMMPfam hit to PF00702, haloacid dehalogenase-like
FT                   hydrolase, score 8.3e-25"
FT                   /inference="protein motif:HMMPfam:PF00702"
FT   CDS_pept        complement(374516..374653)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0375"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0375"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43975"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ46"
FT                   /protein_id="CAQ43975.1"
FT                   /translation="MEQVAALAKMSDPVAGTYTKEVGRHNLDVQQFDGQTTIACSYNLR
FT                   "
FT   CDS_pept        complement(374720..375049)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0376"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0376"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43976"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ47"
FT                   /protein_id="CAQ43976.1"
FT                   /translation="MAEPETGTKWQTMAPYPDGSARMNSLATRCLALACIAAPAFAATP
FT                   PTADQARTQLAEAVTCKRHLTPIQFDAMARMLTPAPARVQDGESSGEFRLTTPLMVLGQ
FT                   PVNRL"
FT   sig_peptide     complement(374924..375049)
FT                   /locus_tag="Smlt0376"
FT                   /note="Signal peptide predicted for Smlt0376 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.862) with cleavage site
FT                   probability 0.860 between residues 42 and 43"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(375075..376184)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0377"
FT                   /product="putative transport protein"
FT                   /note="similarity:fasta; with=UniProt:Q8PFJ6
FT                   (EMBL:AE012047;); Xanthomonas axonopodis pv. citri.; yhhT;
FT                   Transport protein.; length=389; id 74.728%; ungapped id
FT                   75.549%; E()=6.2e-88; 368 aa overlap; query 6-369; subject
FT                   22-389"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0377"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43977"
FT                   /db_xref="GOA:B2FJ48"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ48"
FT                   /protein_id="CAQ43977.1"
FT                   /translation="MSESLLSPPPAGPDEPEAALPPPSRPRGPMSLVVLATLAVGYTLW
FT                   AAQDIILPVLLAMFFALVGNPILRLLQKLWIPRALGALLILGAGLGVTGSLAVQLIGPA
FT                   MEWAQEAPQQLRKVARQVQDLTKPVQQANQAAENFARVAGGDSNHKVQVIRTQLDDPYR
FT                   MLTRAPRLAASVLAVVLLTLFFMIYGQSLQRAAIALFPNRQQQRFTTDILRSIEREVSR
FT                   YVLTISVINTLVGLVFAGVLMLLGIGLQEALLWGTVAALLNFAPYVGPLIGVALMLLMG
FT                   FVEFRDPLQALLPAAAYLGLHTLEGQMVTPIVLGRRMKLSPLVLILALMVFGWAWGMIG
FT                   LLLAVPLLVCIKLVLARLDGMQGWARLLE"
FT   misc_feature    complement(375108..376094)
FT                   /locus_tag="Smlt0377"
FT                   /note="HMMPfam hit to PF01594, Domain of unknown function
FT                   DUF20, score 5.7e-27"
FT                   /inference="protein motif:HMMPfam:PF01594"
FT   misc_feature    complement(order(375150..375218,375336..375404,
FT                   375447..375515,375621..375674,375882..375950,
FT                   375969..376037))
FT                   /locus_tag="Smlt0377"
FT                   /note="6 probable transmembrane helices predicted for
FT                   Smlt0377 by TMHMM2.0 at aa 50-72, 79-101, 171-188, 224-246,
FT                   261-283 and 323-345"
FT                   /inference="protein motif:TMHMM:2.0"
FT   repeat_region   375947..375954
FT                   /rpt_unit_seq="(gc)4"
FT   CDS_pept        complement(376252..376713)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0378"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q4UPJ5
FT                   (EMBL:CP000050;); Xanthomonas campestris pv. campestris
FT                   (strain 8004).; Hypothetical protein.; length=159; id
FT                   39.752%; ungapped id 42.953%; E()=5.8e-12; 161 aa overlap;
FT                   query 1-152; subject 1-158"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0378"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43978"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ49"
FT                   /protein_id="CAQ43978.1"
FT                   /translation="MKFGALQRRVKRCEQVVTVRLGETQDHWSTLGQVWRQGWSPLRIV
FT                   VVGLAGGFIAGKLEVPGKVNGARWLQMVGSVSNLFASAQAAFATAMAAQAAATADDAAE
FT                   EADDASEQAQAAASAAGARPAPAPRSVPEPEPDLRGPRPAEAATELSER"
FT   CDS_pept        complement(376710..377180)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0379"
FT                   /product="putative transmembrane protein"
FT                   /note="similarity:fasta; with=UniProt:Q3BN56
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; Putative membrane protein.; length=161; id
FT                   65.132%; ungapped id 66.000%; E()=1.2e-31; 152 aa overlap;
FT                   query 6-156; subject 11-161"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0379"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43979"
FT                   /db_xref="GOA:B2FJ50"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ50"
FT                   /protein_id="CAQ43979.1"
FT                   /translation="MSEDNTQAPDPAATPPLDESIRQVGAAGRAAADSAKHTLRSLRRL
FT                   ASADFALARSAFGRALAWAGVAIVFGASAWLLMAATLIALLQSWGLSWLQALLITSLLS
FT                   LAVTGYAIWRVSYFFHHTGMHATRRQLSRLGLFDEPSEDDPDAGVQLPEGKP"
FT   misc_feature    complement(order(376827..376895,376923..376991))
FT                   /locus_tag="Smlt0379"
FT                   /note="2 probable transmembrane helices predicted for
FT                   Smlt0379 by TMHMM2.0 at aa 64-86 and 96-118"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(377189..377554)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0380"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q8P417
FT                   (EMBL:AE012511;); Xanthomonas campestris pv. campestris.;
FT                   Hypothetical protein XCC3899.; length=120; id 75.000%;
FT                   ungapped id 75.000%; E()=2.3e-28; 120 aa overlap; query
FT                   1-120; subject 1-120"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0380"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43980"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ51"
FT                   /protein_id="CAQ43980.1"
FT                   /translation="MSPTNTENLKEHLGEAGSHLKQAATAAGGAIKGATGAATDELRIG
FT                   KANVKAELSDSALSGLAAAEFGGAAAKEQVDALMDKGKDLIDSAAELIRERPLASFGVA
FT                   FAAGWIIAKLARGSSDK"
FT   CDS_pept        complement(377656..379089)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0381"
FT                   /product="putative protease"
FT                   /note="similarity:fasta; with=UniProt:P39099
FT                   (EMBL:U15661;); Escherichia coli.; degQ; Protease degQ
FT                   precursor (EC 3.4.21.-).; length=455; id 43.624%; ungapped
FT                   id 45.244%; E()=1.9e-55; 447 aa overlap; query 37-477;
FT                   subject 19-455"
FT                   /note="similarity:fasta; with=UniProt:Q8P418
FT                   (EMBL:AE012510;); Xanthomonas campestris pv. campestris.;
FT                   htrA; Protease Do.; length=478; id 80.720%; ungapped id
FT                   81.237%; E()=4.4e-129; 472 aa overlap; query 1-469; subject
FT                   1-472"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0381"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43981"
FT                   /db_xref="GOA:B2FJ52"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ52"
FT                   /protein_id="CAQ43981.1"
FT                   /translation="MRPLPTLLTLAIAAAFGGFVATGINAHLDNRADAAPLPAVVPTMA
FT                   ALPAAVAGQQVPSLAPMLEKAMPAVVSVNTKQVVRVRNPFFNDPFFRRLFPDIPQERIN
FT                   ESLGSGVIIDAREGLVLTNHHVIDNADDVQVTLADGRTVKAEFLGSDRDTDIALIRIPA
FT                   QNLTDIKLGNSDQLRVGDFVVAIGNPFGFSQTVTSGIVSAVGRSGIRGLGYQNFIQTDA
FT                   SINPGNSGGALVDLQGQLVGINTASFNPQGSMAGNIGLGLAIPSNLARSVVDQLVKHGV
FT                   VVRGTLGVESQNLTAQIAQGLGLGETRGALITRVLAGSAAAAAGLKPGDVVVSANGQRV
FT                   DSAEALHNVEGLAAVGSPMTLDVRREGKPLQIKATLKEQARAVTGDSLDPRLGGATFVD
FT                   LPESLRQSGASGVLVSEVKRGSRAASNGLQQGDIITDATVGEFADLASWRANFQQRPPT
FT                   LVLRVLRNNGQQQGQLVMR"
FT   misc_feature    complement(377998..378267)
FT                   /locus_tag="Smlt0381"
FT                   /note="HMMPfam hit to PF00595, PDZ domain (Also known as
FT                   DHR or GLGF), score 1.4e-11"
FT                   /inference="protein motif:HMMPfam:PF00595"
FT   repeat_region   complement(378114..378134)
FT                   /rpt_family="GC_rich"
FT                   /inference="nucleotide motif:RepeatScout"
FT   repeat_region   378117..378128
FT                   /rpt_unit_seq="(cgg)4"
FT   misc_feature    complement(378271..378819)
FT                   /locus_tag="Smlt0381"
FT                   /note="HMMPfam hit to PF00089, Trypsin, score 4.2e-17"
FT                   /inference="protein motif:HMMPfam:PF00089"
FT   sig_peptide     complement(379012..379089)
FT                   /locus_tag="Smlt0381"
FT                   /note="Signal peptide predicted for Smlt0381 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.996) with cleavage site
FT                   probability 0.252 between residues 26 and 27"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        379172..379555
FT                   /transl_table=11
FT                   /locus_tag="Smlt0382"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0382"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43982"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ53"
FT                   /protein_id="CAQ43982.1"
FT                   /translation="MRHENRAPGTRIATTSAGPVTTAAAARGSVRTSAAGRADTGRYLR
FT                   SSAHPGAATRHIACLPRHPGGCTQPMPVTTRIMRRSTEKKGFPVNTVCLQGWSTTPSPS
FT                   QQMRLVAHAPFHDRQCRYSIAPF"
FT   sig_peptide     379172..379249
FT                   /locus_tag="Smlt0382"
FT                   /note="Signal peptide predicted for Smlt0382 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.627) with cleavage site
FT                   probability 0.166 between residues 26 and 27"
FT                   /inference="protein motif:SignalP:2.0"
FT   repeat_region   379238..379249
FT                   /rpt_unit_seq="(gcg)4"
FT   CDS_pept        379581..380474
FT                   /transl_table=11
FT                   /locus_tag="Smlt0383"
FT                   /product="putative histone H1-like protein"
FT                   /note="similarity:fasta; with=UniProt:Q46397
FT                   (EMBL:L10193;); Chlamydia trachomatis.; hctB; Histone
FT                   H1-like protein HC2 (HC2 nucleoprotein).; length=221; id
FT                   49.029%; ungapped id 54.891%; E()=1.2e-12; 206 aa overlap;
FT                   query 104-297; subject 4-199"
FT                   /note="similarity:fasta; with=UniProt:Q2P9A6
FT                   (EMBL:AP008229;); Xanthomonas oryzae pv. oryzae (strain
FT                   MAFF 311018).; Histone H1 homolog.; length=283; id 43.894%;
FT                   ungapped id 48.718%; E()=1.1e-19; 303 aa overlap; query
FT                   1-296; subject 1-280"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0383"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43983"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJ54"
FT                   /protein_id="CAQ43983.1"
FT                   /translation="MSNGNGVSVVTDAVENVKEAATNVGETIAHAAEDAVKSVKKTVKR
FT                   ATKAAGTRVAKAKKAVAKVEKTVAKKAEKAAKSVGKTVANAKKKLEAAKKNAKAEAAAL
FT                   KKEVAKKKAAAGKAVTKKAAAAKKTTKAATKAAGKKVATVKKAATKKAAVAKKTVAKKT
FT                   AATKKVVGKKVATAKKAVAKKTVAAKKVAGKKAVAAKKVVGKKVAATRKVATKKTAAAK
FT                   KVVGKKAAVAKKAVGKKTAAARKVVGKKTAVAKKAVGKKVAATRKTVAKKAAPLKKVAA
FT                   KKAPAKKAVRKAAKRK"
FT   misc_feature    380121..380183
FT                   /locus_tag="Smlt0383"
FT                   /note="HMMPfam hit to PF06392, no description, score 19"
FT                   /inference="protein motif:HMMPfam:PF06392"
FT   misc_feature    380253..380315
FT                   /locus_tag="Smlt0383"
FT                   /note="HMMPfam hit to PF06392, no description, score 18"
FT                   /inference="protein motif:HMMPfam:PF06392"
FT   CDS_pept        380552..381274
FT                   /transl_table=11
FT                   /locus_tag="Smlt0384"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q3PHS3
FT                   (EMBL:AAIT01000003;); Paracoccus denitrificans PD1222.;
FT                   Hypothetical protein.; length=227; id 68.584%; ungapped id
FT                   70.776%; E()=2.6e-47; 226 aa overlap; query 8-231; subject
FT                   2-222"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0384"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43984"
FT                   /db_xref="GOA:B2FJU7"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJU7"
FT                   /protein_id="CAQ43984.1"
FT                   /translation="MQVLSAGGPGMRGIDFSSWQGVLSTLAGLVLITLLGVGIRLLVMQ
FT                   TLQQRRERENRQINERLRTLMAAYKTLGGSFTGELGVDPSHRRDLRQREDAEGIAEPRS
FT                   DRARRIRDAVEAALSDILLLGTDEQVRLAARAANDLAQGRPVHTHELVVSLRDFVREAL
FT                   DLAPIPADLQIPPQGPTRPGSASGKGRNDGDAKGGRAGGGGGGGGGGMGAGMGGVGLGA
FT                   GAALGAGHASASDGTDAR"
FT   misc_feature    380609..380677
FT                   /locus_tag="Smlt0384"
FT                   /note="1 probable transmembrane helix predicted for
FT                   Smlt0384 by TMHMM2.0 at aa 20-42"
FT                   /inference="protein motif:TMHMM:2.0"
FT   repeat_region   380867..380874
FT                   /rpt_unit_seq="(cg)4"
FT   repeat_region   380951..380958
FT                   /rpt_unit_seq="(gc)4"
FT   repeat_region   381098..381224
FT                   /rpt_family="(CGG)n"
FT                   /inference="nucleotide motif:RepeatScout"
FT   CDS_pept        complement(381290..381649)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0385"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q4US64
FT                   (EMBL:CP000050;); Xanthomonas campestris pv. campestris
FT                   (strain 8004).; Hypothetical protein.; length=122; id
FT                   78.151%; ungapped id 78.151%; E()=3.9e-38; 119 aa overlap;
FT                   query 1-119; subject 1-119"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0385"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43985"
FT                   /db_xref="InterPro:IPR009874"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJU8"
FT                   /protein_id="CAQ43985.1"
FT                   /translation="MSYIDGFVLAVPTANKEKFLAHARTGDPVFIEYGALRVVECWGDD
FT                   VPHGKTSDFFGAVKATPDETVVFSWIEWPDKPTRDAGMKKMMEDPRFDPATNPMPFDGA
FT                   RMIYGGFVPIYELTR"
FT   misc_feature    complement(381299..381646)
FT                   /locus_tag="Smlt0385"
FT                   /note="HMMPfam hit to PF07237, Protein of unknown function
FT                   (DUF1428), score 3.6e-78"
FT                   /inference="protein motif:HMMPfam:PF07237"
FT   CDS_pept        complement(381741..384143)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0386"
FT                   /product="putative exported dipeptidyl peptidase IV"
FT                   /note="similarity:fasta; BF0097; bfragilisNCTC9343;
FT                   putative exported dipeptidyl peptidase IV; length 719 aa;
FT                   id=26.3%; ; E()=9.5e-14; 575 aa overlap; query 226-788 aa;
FT                   subject 200-719 aa"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0386"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43986"
FT                   /db_xref="GOA:B2FJU9"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002469"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR038554"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJU9"
FT                   /protein_id="CAQ43986.1"
FT                   /translation="MLVSDPLRTCVRAAVFACVALLSPHTAHALQAADYQRAERVHDSH
FT                   LRGALRNASVLPHWLADGRFWYEREDTQGRRQAVLVDPVQATRQTLFEPTALDAAVAPL
FT                   GASGPRLRLASVQQADDGLRLRFSGEVPVDCQWPRWQCARSPDARPPADALPSPVGDAW
FT                   LQVRDNNLWLQSPGTAPRALTHGGEAGNGYGVLPDFALRGIPRRQGRMAVRPFAVGWSA
FT                   DGRYVAGIRYDERALQDYPYLESSPTHSARPRVHTVKLGVLGDAQQVRDTLFVVDTRSG
FT                   RQHDIALPEGWNTLSEAGILGWDGDRLYAVIAHFGTPRRLRLVEIDASSGALRTVLEEA
FT                   SDTRLQLNVYSYNRPAVAILPGQDTAVWFSQRDGWGHLYRVRLSDGKVLRQLTRGHWAV
FT                   RDLLGVDAVGGWAYFSAGGVDAGDPYVRGLYRISLQGGPIQRLAADGNDHMADAGTGAL
FT                   FGGRAPQALSPSGGYLVDTVSRLDQPPRTVLRASDDGRELLVLEAADNRAVLAAGWRPP
FT                   QRERLLAADGRTPIFATVYLPRDYRDDGSFPVIDAMYGGAFISNAPVTYAEAVSALNPV
FT                   SRASLAELGFVVASIDARGTGGRDKAFHDSSFLHGADVQLDDHVAALRQLGERYPGIDL
FT                   QRVGIYGHSFGGYSAARALLRYPAFYKVGVASAGSHKFQGMYGGALHGMDRLFGGVLPA
FT                   TAMTDGVPAPFAGLDNAALAGNLRGHLMLVYGELDENAPPALTLQLAAALNKAQRSYDL
FT                   LYLARQDHELFRNDATYTHRMWDYFVRHLAGQQPPDTVLAPLPGGPG"
FT   misc_feature    complement(381789..382433)
FT                   /locus_tag="Smlt0386"
FT                   /note="HMMPfam hit to PF00326, Prolyl oligopeptidase
FT                   family, score 4.9e-23"
FT                   /inference="protein motif:HMMPfam:PF00326"
FT   misc_feature    complement(382689..383789)
FT                   /locus_tag="Smlt0386"
FT                   /note="HMMPfam hit to PF00930, Dipeptidyl peptidase IV (DPP
FT                   IV) N-termi, score 7.9e-12"
FT                   /inference="protein motif:HMMPfam:PF00930"
FT   sig_peptide     complement(384057..384161)
FT                   /locus_tag="Smlt0386"
FT                   /note="Signal peptide predicted for Smlt0386 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.841) with cleavage site
FT                   probability 0.760 between residues 35 and 36"
FT                   /inference="protein motif:SignalP:2.0"
FT   repeat_region   384191..384198
FT                   /rpt_unit_seq="(cg)4"
FT   CDS_pept        384354..384926
FT                   /transl_table=11
FT                   /locus_tag="Smlt0387"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q5GV20
FT                   (EMBL:AE013598;); Xanthomonas oryzae pv. oryzae.;
FT                   Hypothetical protein.; length=198; id 61.111%; ungapped id
FT                   63.684%; E()=1.8e-46; 198 aa overlap; query 1-190; subject
FT                   1-198"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0387"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43987"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR026364"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJV0"
FT                   /protein_id="CAQ43987.1"
FT                   /translation="MKNSLIALALAAALPFTASAAENLSYNYAEADYAKTDVDGIKADG
FT                   WGVKGSYGFLPNFHAFGEYSRQEVDHTNIKVDQWKVGAGYNVEIAPSTDFVARVAYQKF
FT                   DRKHGLDFNGYSAEAGIRTAFGAHAEVYGMVGYEDYAKKHGVDIDGQWYGRLGGQVKLN
FT                   QNWGLNGELKMNRHGDKEYTVGPRFSW"
FT   sig_peptide     384354..384413
FT                   /locus_tag="Smlt0387"
FT                   /note="Signal peptide predicted for Smlt0387 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.989 between residues 20 and 21"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        385117..385788
FT                   /transl_table=11
FT                   /locus_tag="Smlt0389"
FT                   /product="putative two-component LuxR family
FT                   transcriptional regulator"
FT                   /note="similarity:fasta; with=UniProt:Q1LLE4
FT                   (EMBL:CP000352;); Ralstonia metallidurans (strain CH34/ATCC
FT                   43123/DSM 2839).; Two component transcriptional regulator,
FT                   LuxR family.; length=213; id 33.491%; ungapped id 34.804%;
FT                   E()=7.7e-18; 212 aa overlap; query 1-207; subject 5-213"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0389"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43988"
FT                   /db_xref="GOA:B2FJV1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJV1"
FT                   /protein_id="CAQ43988.1"
FT                   /translation="MTPFPSPRDSPCRLLLLDPHPLLRHGVQELLARQAGLQIDGSYGR
FT                   SGDLLQRLQQQAAAIDLLLVDALPIGDSGEGLELLRHVSRHWPAVPILVLSAHCNAGVV
FT                   SLALQAGARGFLSKACAPQMLLRAVSVVARGGRFVPPELRAQLNQSRRQRQQSMRSPRL
FT                   STRERAVLQWVLRGCSTGEMARRSGRAASTISTQKRAAYRKLGIRNDGELFRFRHLIDA
FT                   D"
FT   misc_feature    385156..385506
FT                   /locus_tag="Smlt0389"
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 2.2e-14"
FT                   /inference="protein motif:HMMPfam:PF00072"
FT   misc_feature    385594..385767
FT                   /locus_tag="Smlt0389"
FT                   /note="HMMPfam hit to PF00196, Bacterial regulatory
FT                   proteins, luxR fami, score 6.9e-11"
FT                   /inference="protein motif:HMMPfam:PF00196"
FT   CDS_pept        complement(385796..386185)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0390"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q8PBX5
FT                   (EMBL:AE012196;); Xanthomonas campestris pv. campestris.;
FT                   Hypothetical protein XCC0991.; length=134; id 56.452%;
FT                   ungapped id 56.452%; E()=5.2e-19; 124 aa overlap; query
FT                   4-127; subject 4-127"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0390"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43989"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJV2"
FT                   /protein_id="CAQ43989.1"
FT                   /translation="MDAILTPVSIGELIDKITILEIKAERIDDAAKLANVRTELDGLLP
FT                   LLQQLLHAQPALAALKQQLKVINERMWDIQDQLRDKEAAQVFDDAFIQLARGVYGTNGE
FT                   RVQVKNEINRVAGSALVEEKQYQGE"
FT   CDS_pept        386378..387061
FT                   /transl_table=11
FT                   /locus_tag="Smlt0391"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q2NZP1
FT                   (EMBL:AP008229;); Xanthomonas oryzae pv. oryzae (strain
FT                   MAFF 311018).; Hypothetical protein XOO3481.; length=237;
FT                   id 36.019%; ungapped id 38.974%; E()=7.8e-15; 211 aa
FT                   overlap; query 18-216; subject 20-226"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0391"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43990"
FT                   /db_xref="InterPro:IPR010239"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJV3"
FT                   /protein_id="CAQ43990.1"
FT                   /translation="MMAALVAALAGLLGIGSAQAQVQVSGSAALTSDYVWRGSSQSDGD
FT                   PAVQAGAKVSIPAGWYASVWGSNVSFKPDNGARSEFDLVAGWSGALAPDWSLDANLTRY
FT                   VYPGTGRALDWTELNTTVTWKQRAWLQVAHSNDALAGGHRGTYAQLGVRVPLHERLRLE
FT                   AAVGEYWLATAQGPDYLHGQLSAIASLTPAWELRATVHDTDNAAKRLFPGNAGGRWELA
FT                   LQGSF"
FT   sig_peptide     386378..386437
FT                   /locus_tag="Smlt0391"
FT                   /note="Signal peptide predicted for Smlt0391 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.986 between residues 20 and 21"
FT                   /inference="protein motif:SignalP:2.0"
FT   repeat_region   386604..386611
FT                   /rpt_unit_seq="(gc)4"
FT   CDS_pept        complement(387058..388251)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0392"
FT                   /product="putative MFS family transporter"
FT                   /note="similarity:fasta; with=UniProt:Q88LS8
FT                   (EMBL:AE015451;); Pseudomonas putida (strain KT2440).;
FT                   Membrane protein, putative.; length=395; id 64.450%;
FT                   ungapped id 64.948%; E()=1.7e-79; 391 aa overlap; query
FT                   6-395; subject 4-392"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0392"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43991"
FT                   /db_xref="GOA:B2FJV4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJV4"
FT                   /protein_id="CAQ43991.1"
FT                   /translation="MSPSLPPLHRWQVLLMSVATGVAVASNYYAQPLLHTIADAFGVPF
FT                   GQVGMVVTAAQLSYAAGLILLVPLGDLFERRRLIVVMSLLSAGGLVISACAPSLTWLLV
FT                   GTAITGLFSVVAQVLVPFAATLAAPEHRGRVVGTLMSGLLLGILLARTVAGLLSSLGDW
FT                   RLVYVIAAATLVLTALALQRGLPRFHHSAGLGYFALLRSIGVLFVQEPVLRQRTLLGAC
FT                   SFAMFAIFWTPLAFLLAQPPYAYSDATIGLFGLVGAAGTLAAGLAGRMSDRGQTGRATA
FT                   IALLLLLLSWLPLGLSAHSLLALLVGVVVLDLAAQLLHVSNQNLIYALQPAARNRLNAG
FT                   YMTGYFIGGSLGSLLSAQVYQRFGWTGVCVAGAAVAALALLLWLPGALRARQASLPD"
FT   repeat_region   387079..387088
FT                   /rpt_unit_seq="(gc)5"
FT   misc_feature    complement(order(387097..387165,387184..387243,
FT                   387343..387411,387448..387507,387535..387603,
FT                   387709..387762,387790..387849,387868..387936,
FT                   387949..388017,388051..388119,388162..388215))
FT                   /locus_tag="Smlt0392"
FT                   /note="11 probable transmembrane helices predicted for
FT                   Smlt0392 by TMHMM2.0 at aa 29-46, 61-83, 95-117, 122-144,
FT                   151-170, 180-197, 233-255, 265-284, 297-319, 353-372 and
FT                   379-401"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(387169..388206)
FT                   /locus_tag="Smlt0392"
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 3.9e-38"
FT                   /inference="protein motif:HMMPfam:PF07690"
FT   sig_peptide     complement(388162..388251)
FT                   /locus_tag="Smlt0392"
FT                   /note="Signal peptide predicted for Smlt0392 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.956) with cleavage site
FT                   probability 0.773 between residues 30 and 31"
FT                   /inference="protein motif:SignalP:2.0"
FT   repeat_region   388230..388237
FT                   /rpt_unit_seq="(g)8"
FT   repeat_region   388311..388322
FT                   /rpt_unit_seq="(atc)4"
FT   CDS_pept        388350..389237
FT                   /transl_table=11
FT                   /locus_tag="Smlt0393"
FT                   /product="putative LysR family transcriptional regulator"
FT                   /note="similarity:fasta; with=UniProt:Q1ID41
FT                   (EMBL:CT573326;); Pseudomonas entomophila L48.; Putative
FT                   transcriptional regulator, LysR family.; length=293; id
FT                   55.088%; ungapped id 55.088%; E()=2.4e-51; 285 aa overlap;
FT                   query 1-285; subject 1-285"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0393"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43992"
FT                   /db_xref="GOA:B2FJV5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJV5"
FT                   /protein_id="CAQ43992.1"
FT                   /translation="MNLKQLEFAVALAEEGNFTRAAERCHVVQSALSHQIAYLEQELGT
FT                   PLFERLPRQVRATAAGEALLVHARQVLVSLRHLRADVAAVSGEVRGLLAIGQISSLTDI
FT                   DVVAMLAAFQQAHPQVEFQLRVDKSEDLIAQVQSRDLDVALVGLAPSAGLDGVCHQMLQ
FT                   EEDLVAVLAPSHRLARRKRLPLTELQDEALVDFPRGTGARRQTDDAFVAAGLPHTVRFE
FT                   VNLMELVERFVRHGLAVGIVPALIAEGFQGVVRIPLQPTPTRRVHLVWQRLPTPAARAF
FT                   VEAVLSRAGAGSGP"
FT   misc_feature    388356..388535
FT                   /locus_tag="Smlt0393"
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix, score 2.5e-21"
FT                   /inference="protein motif:HMMPfam:PF00126"
FT   misc_feature    388605..389219
FT                   /locus_tag="Smlt0393"
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 5.2e-47"
FT                   /inference="protein motif:HMMPfam:PF03466"
FT   CDS_pept        complement(389206..389673)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0394"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q3BYY0
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; Hypothetical protein.; length=157; id
FT                   65.584%; ungapped id 65.584%; E()=1.9e-37; 154 aa overlap;
FT                   query 1-154; subject 1-154"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0394"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43993"
FT                   /db_xref="InterPro:IPR009921"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJV6"
FT                   /protein_id="CAQ43993.1"
FT                   /translation="MINNDVLRSVRYSLDLGDHHVVTLCQMADPAFAVDPEQVKAWLRR
FT                   EDEAGFEAMSDSALAHFLDGLIVHLRGRDESQPQRAVETRIDNNLVLKKLRVAFQLRDV
FT                   DLMEIFASAGFNVSKSEVGALFRQPGHTNYRRCLDQMLRNFLKGLSLRLRG"
FT   misc_feature    complement(389209..389412)
FT                   /locus_tag="Smlt0394"
FT                   /note="HMMPfam hit to PF07308, Protein of unknown function
FT                   (DUF1456), score 3e-34"
FT                   /inference="protein motif:HMMPfam:PF07308"
FT   misc_feature    complement(389458..389667)
FT                   /locus_tag="Smlt0394"
FT                   /note="HMMPfam hit to PF07308, Protein of unknown function
FT                   (DUF1456), score 5.3e-25"
FT                   /inference="protein motif:HMMPfam:PF07308"
FT   CDS_pept        389889..390245
FT                   /transl_table=11
FT                   /locus_tag="Smlt0395"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q3BQI3
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; Putative secreted protein precursor.;
FT                   length=173; id 33.750%; ungapped id 36.000%; E()=0.0025; 80
FT                   aa overlap; query 41-118; subject 97-173"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0395"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43994"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJV7"
FT                   /protein_id="CAQ43994.1"
FT                   /translation="MQALNRVLREAERAATGPTAAVAPAAAPLPANVPAPAAMHLGLEE
FT                   GPVNARVVGEVAGWQPGTLFTLDNGQQWQVMKGQMKLRKVLQSPQIAVVPGIAGRWFLQ
FT                   VDEDLPKARVFRVR"
FT   CDS_pept        390333..391085
FT                   /transl_table=11
FT                   /locus_tag="Smlt0396"
FT                   /product="putative oxidoreductase"
FT                   /note="similarity:fasta; YE2028; yenterocolitica; putative
FT                   oxidoreductase; length 251 aa; id=55.6%; ; E()=7.2e-53; 252
FT                   aa overlap; query 1-250 aa; subject 1-251 aa"
FT                   /note="similarity:fasta; ECA2252; ecarotovora_atroseptica;
FT                   probable oxidoreductase; length 249 aa; id=55.2%; ;
FT                   E()=4e-51; 248 aa overlap; query 5-250 aa; subject 3-249
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0396"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43995"
FT                   /db_xref="GOA:B2FJV8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJV8"
FT                   /protein_id="CAQ43995.1"
FT                   /translation="MTRTVLITGATSGFGAAAVHRFAQAGWKVIATGRRGERLQPLVDR
FT                   YGKDVVHAAAFDIRDPVAMEAALLALPPAFGEIDLLVNNAGLAQGTAPAQSAKLSDWTT
FT                   MIDTNITALVTLTHRLLPQLVERKGAIINISSVAGVYPYPGGNAYGGTKAFVSQFSLGL
FT                   RSDLHGTGVRVTTIEPGMAETEFTVVRTHGDQAASDKLYNGANPMTAEDIAEQIFWVAS
FT                   LPPHLNINRLELMPVSQSFAGFQVAREG"
FT   sig_peptide     390333..390401
FT                   /locus_tag="Smlt0396"
FT                   /note="Signal peptide predicted for Smlt0396 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.990) with cleavage site
FT                   probability 0.583 between residues 23 and 24"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    390339..390836
FT                   /locus_tag="Smlt0396"
FT                   /note="HMMPfam hit to PF00106, short chain dehydrogenase,
FT                   score 1.6e-32"
FT                   /inference="protein motif:HMMPfam:PF00106"
FT   misc_feature    390345..391022
FT                   /locus_tag="Smlt0396"
FT                   /note="HMMPfam hit to PF01370, NAD dependent
FT                   epimerase/dehydratase family, score 9.6e-05"
FT                   /inference="protein motif:HMMPfam:PF01370"
FT   CDS_pept        complement(391175..392074)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0397"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q3BNA2; Xanthomonas
FT                   campestris pv. vesicatoria (strain 85-10).; Putative
FT                   secreted protein precursor.; length=294; id 69.935%;
FT                   ungapped id 74.564%; E()=7.7e-62; 306 aa overlap; query
FT                   1-299; subject 1-294"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0397"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43996"
FT                   /db_xref="GOA:B2FJV9"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJV9"
FT                   /protein_id="CAQ43996.1"
FT                   /translation="MAARRGKSQARRNSGSQGTPGWVWLVAGVAIAAVVFLAAPNLFKG
FT                   EGDGFLRAGPQPNPNAQPAPVADADSDVGTQPAAQPAAPKQAEPEKPAATQYDFYTLLP
FT                   GKEVEMSDAELAASARAEDQRRAKAEAQRAQAALEGKPVPPATTTTTAPAATASVSSTA
FT                   QVTATSRPLPAPLSERPAAATPPASTASTSTAAATPAARAETATATAGTPATAAPAAAD
FT                   NARYILQAGAFGASGDAEATKAKLAMMGLAARVESAQINGKTVYRVRMGPYGSAGELSE
FT                   AKQKLDGTGLQAMAIKAQ"
FT   misc_feature    complement(391184..391411)
FT                   /locus_tag="Smlt0397"
FT                   /note="HMMPfam hit to PF05036, Sporulation related domain,
FT                   score 2.2e-17"
FT                   /inference="protein motif:HMMPfam:PF05036"
FT   repeat_region   391466..391473
FT                   /rpt_unit_seq="(cg)4"
FT   repeat_region   391672..391679
FT                   /rpt_unit_seq="(gc)4"
FT   sig_peptide     complement(391961..392074)
FT                   /locus_tag="Smlt0397"
FT                   /note="Signal peptide predicted for Smlt0397 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.671) with cleavage site
FT                   probability 0.432 between residues 38 and 39"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(392096..393784)
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="Smlt0398"
FT                   /product="arginyl-tRNA synthetase"
FT                   /note="similarity:fasta; BAV3361; bavium; arginyl-tRNA
FT                   synthetase; length 561 aa; id=55.8%; ; E()=4.6e-110; 550 aa
FT                   overlap; query 20-562 aa; subject 19-561 aa"
FT                   /note="similarity:fasta; BPP4352; bparapertussis;
FT                   arginyl-tRNA synthetase; length 561 aa; id=56.8%; ;
FT                   E()=1.6e-105; 537 aa overlap; query 33-562 aa; subject
FT                   30-561 aa"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0398"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43997"
FT                   /db_xref="GOA:B2FJW0"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2FJW0"
FT                   /protein_id="CAQ43997.1"
FT                   /translation="MKNLLRALISQGIEALRANGTLPADSLPPDFVVERPKTRDHGDFA
FT                   TNAAMLLAKAARSNPRALAQALVEALPRSEDVSKVEIAGPGFINFHLAPAAYQREAASV
FT                   IKEAHDYGRNLSGNGRTVGVEYVSANPTGPLHVGHGRAAAIGDCVARVLDANGWNAKRE
FT                   FYYNDAGVQIENLALSTQARIKGIAPDQDGWPEGGYRGEYIADVARAYMAGASVDLEGS
FT                   TVVGAKDPDDMQAIRRFAVAYLRNEQNLDLAAFGVDFDIYFLESSLYADGKVAEAVAKL
FT                   QASGHTYEEGGALWLRSTDFGDDKDRVMRKSDGTFTYFVPDVAYHLSKWQRGYERAITE
FT                   LGADHHGSLARVRAGLQAMEVGIPQGWPEYVLHQMVTVMRGGEEVKLSKRAGSYFTLRD
FT                   LIEEAGRDATRWFLIARKPDSQLTFDIDLARQQSNDNPVFYVQYAHARVCSLLRQAQEK
FT                   GLVYEQGNGLANLGRLADDASLLLMNEISRYPEVVEAAGVALEPHLVAQYLRELAHAFH
FT                   TWYHGTPVLVEDAADRNAKLTLACAARQVLANGLELLGVSAPEKM"
FT   misc_feature    complement(392099..392464)
FT                   /gene="argS"
FT                   /locus_tag="Smlt0398"
FT                   /note="HMMPfam hit to PF05746, DALR anticodon binding
FT                   domain, score 1.9e-50"
FT                   /inference="protein motif:HMMPfam:PF05746"
FT   misc_feature    complement(392507..393487)
FT                   /gene="argS"
FT                   /locus_tag="Smlt0398"
FT                   /note="HMMPfam hit to PF00750, tRNA synthetases class I
FT                   (R), score 1.8e-66"
FT                   /inference="protein motif:HMMPfam:PF00750"
FT   misc_feature    complement(393509..393769)
FT                   /gene="argS"
FT                   /locus_tag="Smlt0398"
FT                   /note="HMMPfam hit to PF03485, Arginyl tRNA synthetase N
FT                   terminal do, score 1e-33"
FT                   /inference="protein motif:HMMPfam:PF03485"
FT   CDS_pept        complement(393898..394602)
FT                   /transl_table=11
FT                   /gene="radC"
FT                   /locus_tag="Smlt0399"
FT                   /product="putative DNA repair protein RadC"
FT                   /note="similarity:fasta; BPSL0917; bpseudomallei; putative
FT                   DNA repair protein; length 236 aa; id=52.8%; ; E()=9.5e-35;
FT                   212 aa overlap; query 12-223 aa; subject 24-234 aa"
FT                   /note="similarity:fasta; BP1235; bpertussis; DNA repair
FT                   protein; length 225 aa; id=48.9%; ; E()=2.1e-31; 221 aa
FT                   overlap; query 5-225 aa; subject 11-225 aa"
FT                   /note="similarity:blastp; with=UniProt:P25531; Escherichia
FT                   coli.; radC; DNA repair protein radC.; length=222;
FT                   E()=7e-38;"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0399"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43998"
FT                   /db_xref="GOA:B2FJW1"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2FJW1"
FT                   /protein_id="CAQ43998.1"
FT                   /translation="MPIHDWPEQERPREKLIARGPTALSDAELLALFLGSGFGGRDAVQ
FT                   TARDLLQAHGPLRVLLDRPAAELARLPGLGPARSCTLAAGLELAHRYLAAELEHGEAVG
FT                   NNPAAVGRYLQHRLRGQAREVFMALFLDNRHRLIACEELFHGTINAAPVYPREVVRRAL
FT                   LHNAAAVILSHNHPSGDPEPSSADTRITDELQQALAMVDVRLLDHFVVGEGRPVSFAER
FT                   GLLSPPQPRLFG"
FT   misc_feature    complement(393928..394305)
FT                   /gene="radC"
FT                   /locus_tag="Smlt0399"
FT                   /note="HMMPfam hit to PF04002, RadC, DNA repair protein,
FT                   score 4.3e-73"
FT                   /inference="protein motif:HMMPfam:PF04002"
FT   repeat_region   394458..394465
FT                   /rpt_unit_seq="(cg)4"
FT   repeat_region   394545..394552
FT                   /rpt_unit_seq="(cg)4"
FT   CDS_pept        complement(394672..395436)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0400"
FT                   /product="putative two-component response regulator
FT                   transcriptional regulatory protein"
FT                   /note="similarity:fasta; CAM0222; bcenocepacia; putative
FT                   response-regulator; length 230 aa; id=38.6%; ; E()=7.7e-17;
FT                   207 aa overlap; query 45-248 aa; subject 2-207 aa"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0400"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ43999"
FT                   /db_xref="GOA:B2FJW2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJW2"
FT                   /protein_id="CAQ43999.1"
FT                   /translation="MESVSVDPGFTRYQFRTFPIPLRVCAFAESGIGCRPPWPVRPSRS
FT                   RVHPRIIIADDHPVVLHGIRIVLQTYLMDIVGSARDGAQLLELVDHHDCDAVLTDLSMP
FT                   GAGPDGPELIDALRMRRPGLPVVVLTGARHPGLLDGLLREGISGLVDKCADFAELPHAL
FT                   NAALAGQVFVSQQLRHHLQARDLLFPRQPAPLSAREQEVLELLAAGLSVNEVAERCGRS
FT                   PKTISRQKAEAKRKLGLQNNQELFDYLQTRRG"
FT   misc_feature    complement(394690..394863)
FT                   /locus_tag="Smlt0400"
FT                   /note="HMMPfam hit to PF00196, Bacterial regulatory
FT                   proteins, luxR fami, score 1.3e-18"
FT                   /inference="protein motif:HMMPfam:PF00196"
FT   misc_feature    complement(394945..395292)
FT                   /locus_tag="Smlt0400"
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 3.2e-21"
FT                   /inference="protein motif:HMMPfam:PF00072"
FT   CDS_pept        395527..396789
FT                   /transl_table=11
FT                   /gene="dfp"
FT                   /locus_tag="Smlt0401"
FT                   /product="putative pantothenate biosynthesis protein"
FT                   /note="similarity:fasta; SBG3311; sbongori; conserved
FT                   hypothetical protein; length 454 aa; id=52.5%; ;
FT                   E()=2.7e-67; 402 aa overlap; query 18-417 aa; subject
FT                   54-447 aa"
FT                   /note="similarity:fasta; SEN3552; senteritidisPT4;
FT                   conserved hypothetical protein; length 407 aa; id=52.2%; ;
FT                   E()=9.2e-68; 406 aa overlap; query 14-417 aa; subject 3-400
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0401"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ44000"
FT                   /db_xref="GOA:B2FJW3"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJW3"
FT                   /protein_id="CAQ44000.1"
FT                   /translation="MADSPNASPAPARALERQKLLLCVGGGIAAYKALELVRRLRDAGA
FT                   QVQVAMTAGAQQFVTPLSFQALSGQPTRTTLWDSAAEQAMGHIELARWADRIVVAPGTA
FT                   DLLARLAQGHADDLVSTLCLASTAPLTICPAMNHRMWLHPATQANIALLRQRGAQVIGP
FT                   VDGPLAEGESGPGRLAEPGDIVAALAANGSAAAAVVAPETRALQGLRLLISAGPTYEDI
FT                   DPVRYVGNRSSGKMGFALAAAAATMGAQVVLVSGPVQLPTPAGVQRVDVRSAAQMRDAV
FT                   LKSLPADIYIGAAAVSDYTPRQVAPQKLKKTADSQSLVIELVRTPDILAEVAAQTQSLK
FT                   LVVGFAAETHDVEKYARGKLVDKRLDLVIANQVGISGGGFESDNNAATAFWQDGEQVFP
FT                   ATSKRELAEQLLALIARRLQA"
FT   repeat_region   complement(395549..395569)
FT                   /rpt_family="GC_rich"
FT                   /inference="nucleotide motif:RepeatScout"
FT   misc_feature    395578..395931
FT                   /gene="dfp"
FT                   /locus_tag="Smlt0401"
FT                   /note="HMMPfam hit to PF02441, Flavoprotein, score 2.1e-40"
FT                   /inference="protein motif:HMMPfam:PF02441"
FT   misc_feature    396142..396735
FT                   /gene="dfp"
FT                   /locus_tag="Smlt0401"
FT                   /note="HMMPfam hit to PF04127, DNA / pantothenate
FT                   metabolism flavoprote, score 1.8e-26"
FT                   /inference="protein motif:HMMPfam:PF04127"
FT   CDS_pept        396786..397259
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="Smlt0402"
FT                   /product="putative deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /note="similarity:fasta; YPO0047; ypestis; deoxyuridine
FT                   5'-triphosphate nucleotidohydrolase; length 151 aa;
FT                   id=66.2%; ; E()=3.9e-42; 148 aa overlap; query 8-155 aa;
FT                   subject 2-149 aa"
FT                   /note="similarity:fasta; SBG3312; sbongori; deoxyuridine
FT                   5'-triphosphate nucleotidohydrolase; length 151 aa;
FT                   id=63.5%; ; E()=4.7e-41; 148 aa overlap; query 8-155 aa;
FT                   subject 2-149 aa"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0402"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ44001"
FT                   /db_xref="GOA:B2FJW4"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJW4"
FT                   /protein_id="CAQ44001.1"
FT                   /translation="MTQASTSQPLQVKLLDPRFGDSWPLPAYATEASAGMDLRAALDTA
FT                   LTLQPGDTALVPSGLAIHIADPHLCAVILPRSGLGHRHGIVLGNGTGLIDADYQGPLLI
FT                   SVWNRGREAFTIEPGDRIAQLVVVPIARVSLQVVDTFTDSVRGTGGFGHTGVR"
FT   misc_feature    396846..397250
FT                   /gene="dut"
FT                   /locus_tag="Smlt0402"
FT                   /note="HMMPfam hit to PF00692, dUTPase, score 6e-46"
FT                   /inference="protein motif:HMMPfam:PF00692"
FT   CDS_pept        397272..399614
FT                   /transl_table=11
FT                   /gene="spgM"
FT                   /gene_synonym="algC"
FT                   /locus_tag="Smlt0403"
FT                   /product="putative phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /note="similarity:fasta; BPSL2666; bpseudomallei;
FT                   phosphoglucomutase; length 464 aa; id=55.3%; ; E()=1.7e-75;
FT                   470 aa overlap; query 319-780 aa; subject 2-464 aa"
FT                   /note="similarity:blastp; with=UniProt:P26276
FT                   (EMBL:M60873;); Pseudomonas aeruginosa.; algC;
FT                   Phosphomannomutase/phosphoglucomutase (EC 5.4.2.8) (EC
FT                   5.4.2.2) (PMM/PGM).; length=462; E()=0e-139;"
FT                   /note="similarity:blastp; with=UniProt:Q3BNA7
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; manB; Phosphomannomutase precursor (EC
FT                   5.4.2.8).; length=781; E()=0.0;"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0403"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ44002"
FT                   /db_xref="GOA:B2FJW5"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJW5"
FT                   /protein_id="CAQ44002.1"
FT                   /translation="MSGIGEGQRERSLGRSAPLLGVLLVLLAGWFGWSAVQQWRQEANG
FT                   QALEEARDQAVQGLQEAAAGQLKQLQQQLKNERVQQALQAGDAAAAALAVRESWTGVEQ
FT                   ADVLTADLATAYADPATFGYARLALLEQALAEGKPGLRVVRDAGGNRLGLAAPVQLGSL
FT                   GPAVLYVRQPLLRLTSPLDQVSAPSTGFLGLRQGTHDLVAQGDAGLAESAEALARPVPG
FT                   TPLRLVAAVPNVEAGPLGLGSLASAIVALLLAFIAVLLVVGRGRLPKSLPLPRRAAVAE
FT                   ADHGPTLSESLQMAPPPVAAASAADTAPPPPPVPAGELAAGIFRAYDIRGVVGSELTPK
FT                   TAALIGQAIGTVALEQGLREVVIGRDGRLSGPELAAGLAEGLRRTGCAVIDIGLAPTPV
FT                   VYYAAFHLRTGTCVAVTGSHNPPEYNGFKVVIGGETLSGDAITDLYQRIVEGRLAQAAE
FT                   PGDYQQRDVSADYIQRIADDVQLDRPLKVVADAGNGVAGALAPQLLEAIGAEVIPLYCD
FT                   VDGTFPNHHPDPSEPANLEDLVQTVKRFGADLGVAFDGDGDRLGVVTGEGRIIYADRLL
FT                   MLFAADVLMRNPGAMVIYDVKCTGKLSDHVLRNGGSPLMWKTGHSLMKAKMRETDAELA
FT                   GEMSGHFFFKERWFGFDDGLYAAARLLEILAQREETPDEVLAELPEMVATPELKVPVAE
FT                   GTPHALVAMLVAAAQSPDNPYVGGRLSTIDGLRVDFPDGWGLVRASNTTPVLVLRFEGN
FT                   DEAALERIQALFRSQLQPVLGDTPLGF"
FT   misc_feature    order(397320..397379,397986..398054)
FT                   /gene="spgM"
FT                   /gene_synonym="algC"
FT                   /locus_tag="Smlt0403"
FT                   /note="2 probable transmembrane helices predicted for
FT                   Smlt0403 by TMHMM2.0 at aa 5-24 and 227-249"
FT                   /inference="protein motif:TMHMM:2.0"
FT   repeat_region   complement(398155..398210)
FT                   /rpt_family="(CGG)n"
FT                   /inference="nucleotide motif:RepeatScout"
FT   repeat_region   398194..398205
FT                   /rpt_unit_seq="(cgc)4"
FT   misc_feature    398232..398636
FT                   /gene="spgM"
FT                   /gene_synonym="algC"
FT                   /locus_tag="Smlt0403"
FT                   /note="HMMPfam hit to PF02878,
FT                   Phosphoglucomutase/phosphomannomutase, al, score 2.6e-47"
FT                   /inference="protein motif:HMMPfam:PF02878"
FT   misc_feature    398676..398978
FT                   /gene="spgM"
FT                   /gene_synonym="algC"
FT                   /locus_tag="Smlt0403"
FT                   /note="HMMPfam hit to PF02879,
FT                   Phosphoglucomutase/phosphomannomutase, al, score 4.4e-45"
FT                   /inference="protein motif:HMMPfam:PF02879"
FT   misc_feature    398982..399317
FT                   /gene="spgM"
FT                   /gene_synonym="algC"
FT                   /locus_tag="Smlt0403"
FT                   /note="HMMPfam hit to PF02880,
FT                   Phosphoglucomutase/phosphomannomutase, al, score 1.2e-42"
FT                   /inference="protein motif:HMMPfam:PF02880"
FT   misc_feature    399330..399584
FT                   /gene="spgM"
FT                   /gene_synonym="algC"
FT                   /locus_tag="Smlt0403"
FT                   /note="HMMPfam hit to PF00408,
FT                   Phosphoglucomutase/phosphomannomutase, C-, score 5.8e-17"
FT                   /inference="protein motif:HMMPfam:PF00408"
FT   CDS_pept        complement(399711..400376)
FT                   /transl_table=11
FT                   /gene="kdpE"
FT                   /locus_tag="Smlt0404"
FT                   /product="putative two-component response regulator
FT                   transcriptional regulatory protein"
FT                   /note="similarity:fasta; BPSL1175; bpseudomallei;
FT                   two-component system, regulatory protein KdpE; length 232
FT                   aa; id=49.3%; ; E()=1.9e-36; 221 aa overlap; query 1-221
FT                   aa; subject 10-230 aa"
FT                   /note="similarity:fasta; SCO5872; scoelicolor; putative
FT                   turgor pressure regulator; length 227 aa; id=48.4%; ;
FT                   E()=5.5e-34; 221 aa overlap; query 1-220 aa; subject 6-226
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0404"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ44003"
FT                   /db_xref="GOA:B2FJW6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJW6"
FT                   /protein_id="CAQ44003.1"
FT                   /translation="MIDDETQIRRFLDISLRAQGYQVRQAATGQEGLQLAASEDMDLVI
FT                   LDIGLPDMEGHEVLEQLRQWSQVPVIMLTVRAGEAEKVRALDTGANDYVTKPFGTQELM
FT                   ARVRALLRTRSVPSDGTPPVFDDGHLHVDLVRREVALDGEPVALTRKEYALLSLLLRNA
FT                   GRVVTQPQILQEIWGPTHQHDTHYLRILVGKLRHKLGDSALDSRYLFTEPGVGLRFKG"
FT   misc_feature    complement(399720..399950)
FT                   /gene="kdpE"
FT                   /locus_tag="Smlt0404"
FT                   /note="HMMPfam hit to PF00486, Transcriptional regulatory
FT                   protein, C te, score 8.1e-19"
FT                   /inference="protein motif:HMMPfam:PF00486"
FT   misc_feature    complement(400053..400376)
FT                   /gene="kdpE"
FT                   /locus_tag="Smlt0404"
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 1.8e-33"
FT                   /inference="protein motif:HMMPfam:PF00072"
FT   repeat_region   400322..400329
FT                   /rpt_unit_seq="(gc)4"
FT   CDS_pept        complement(400405..403065)
FT                   /transl_table=11
FT                   /gene="kdpD"
FT                   /locus_tag="Smlt0405"
FT                   /product="putative two-component sensor histidine kinase
FT                   potassium transport regulator protein"
FT                   /EC_number="2.7.3.-"
FT                   /note="similarity:fasta; RL110378; rleguminosarum; putative
FT                   two-component sensor histidine kinase potassium transport
FT                   regulator protein; length 902 aa; id=41.1%; ; E()=1.2e-65;
FT                   898 aa overlap; query 10-886 aa; subject 15-899 aa"
FT                   /note="similarity:fasta; BPSL1174; bpseudomallei;
FT                   two-component system, sensor kinase protein KdpD; length
FT                   993 aa; id=39.0%; ; E()=2.8e-48; 929 aa overlap; query
FT                   10-886 aa; subject 7-926 aa"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0405"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ44004"
FT                   /db_xref="GOA:B2FJW7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR003852"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJW7"
FT                   /protein_id="CAQ44004.1"
FT                   /translation="MTDARTRQADALVEGLQREAGGKLTVFLGAAPGVGKTYAMLTRAQ
FT                   EQLRRGVDLVVGLVETHGRADTQALLEGLPQLPLKDVAYHGHALQEMDLDAVLARHPAL
FT                   VLVDELAHRNAPGSRHERRWQDVMELLDAGIDVWTTVNIQHLESLNDVVMRITGVRVSE
FT                   TVPDGVLDRLHDIVLVDLPPRELIARLQQGKVYVPEQAAQALQAFFSPANLTALRELAM
FT                   QEAADRVDSSLREARAARGESNLPLRRGVLVAIDGGGQSEYLVRVARRIAERRDAPWTV
FT                   VTVQGRRQDEATRREIDAAFALARRLGGDAELLHGSSIADALLDHAAHNGVSTLVLGRT
FT                   RERPLARMFNRTLTQQLIQRGAHYEITIISTPQARARSRREGLLPPMRGISYEPVQALI
FT                   ATALACAVAWLAERWVGMADLSMVFIVAVVLVAARTRASVAVMAAILCFLAYNFLFIAP
FT                   RFTFAIGARQGVITVFLFLAAALVAGRLASRLRMQVIALRAANRHARARQQLGRQLASA
FT                   AGNGEVAQAGRHALEQAMDVPAWLRIGADTATGGRSQPGDTDLAAADWALRHGQPSGRF
FT                   TDTLAGAQWWFLPLLDGEDRAIGVAGLYLPGAQARLLPEQRQLAEAMVDDIAQAALRTR
FT                   LVAELEQAHVSNETERLRSALLSSVSHDLRSPLAAMIGSADSLASYGAAMDTADRRALL
FT                   DTILVEGERLDRYIQNLLDMTRLGHEGLKINRDWIGVDELIGSAARRLQRYQPKVRLEL
FT                   DIPATLAPIWVHPALVEQAVFNVMENAAKFSPPDAAVQVQARELDGQLRIDVIDAGPGI
FT                   PDDERARIFDMFYSVERGDRGRHGTGLGLTICQGMVGAHGGSVQALPGRDGRGTLIRIT
FT                   LPLLKPASHDEPDSD"
FT   misc_feature    complement(400441..400776)
FT                   /gene="kdpD"
FT                   /locus_tag="Smlt0405"
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HSP90, score 4.4e-31"
FT                   /inference="protein motif:HMMPfam:PF02518"
FT   repeat_region   400609..400618
FT                   /rpt_unit_seq="(gc)5"
FT   misc_feature    complement(400906..401112)
FT                   /gene="kdpD"
FT                   /locus_tag="Smlt0405"
FT                   /note="HMMPfam hit to PF00512, His Kinase A
FT                   (phosphoacceptor) domain, score 2.5e-17"
FT                   /inference="protein motif:HMMPfam:PF00512"
FT   misc_feature    complement(order(401602..401661,401698..401757,
FT                   401767..401826,401833..401901))
FT                   /gene="kdpD"
FT                   /locus_tag="Smlt0405"
FT                   /note="4 probable transmembrane helices predicted for
FT                   Smlt0405 by TMHMM2.0 at aa 392-414, 417-436, 440-459 and
FT                   472-491"
FT                   /inference="protein motif:TMHMM:2.0"
FT   repeat_region   401665..401672
FT                   /rpt_unit_seq="(gc)4"
FT   misc_feature    complement(401956..402327)
FT                   /gene="kdpD"
FT                   /locus_tag="Smlt0405"
FT                   /note="HMMPfam hit to PF00582, Universal stress protein
FT                   family, score 4.9e-14"
FT                   /inference="protein motif:HMMPfam:PF00582"
FT   repeat_region   402345..402352
FT                   /rpt_unit_seq="(cg)4"
FT   repeat_region   402353..402360
FT                   /rpt_unit_seq="(gc)4"
FT   misc_feature    complement(402379..403005)
FT                   /gene="kdpD"
FT                   /locus_tag="Smlt0405"
FT                   /note="HMMPfam hit to PF02702, Osmosensitive K+ channel His
FT                   kinase sensor, score 1.2e-152"
FT                   /inference="protein motif:HMMPfam:PF02702"
FT   CDS_pept        complement(403102..403752)
FT                   /transl_table=11
FT                   /gene="kdpC"
FT                   /locus_tag="Smlt0406"
FT                   /product="putative potassium-transporting ATPase C chain"
FT                   /EC_number="3.6.3.12"
FT                   /note="similarity:fasta; BAV2703; bavium;
FT                   potassium-transporting ATPase C chain; length 194 aa;
FT                   id=45.9%; ; E()=1.7e-20; 183 aa overlap; query 31-210 aa;
FT                   subject 10-191 aa"
FT                   /note="similarity:fasta; BB3919; bbronchiseptica;
FT                   potassium-transporting ATPase C chain; length 199 aa;
FT                   id=47.6%; ; E()=9.9e-18; 187 aa overlap; query 27-210 aa;
FT                   subject 11-196 aa"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0406"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ44005"
FT                   /db_xref="GOA:B2FJW8"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJW8"
FT                   /protein_id="CAQ44005.1"
FT                   /translation="MNRSASTSTSLSREPKAEARVASLQDGASWRPAIGLGLATLLLAG
FT                   AVYAGIATGFAGLAYPTQAQGSLLRDGSGQVRGSAWLSQPFTGDGYFQARPSAANYDPM
FT                   AAAGSNMARSNPALAERVAASTAAVAAREGVTAAQVPADLVTQSAGGLDPQLSPAAAQL
FT                   QVARVARARGLPVERVQALVQAHTEGRQWGLFGQPRVNVVTLNFALDHAPKAP"
FT   misc_feature    complement(403117..403674)
FT                   /gene="kdpC"
FT                   /locus_tag="Smlt0406"
FT                   /note="HMMPfam hit to PF02669, K+-transporting ATPase, c
FT                   chain, score 7.1e-58"
FT                   /inference="protein motif:HMMPfam:PF02669"
FT   repeat_region   403356..403363
FT                   /rpt_unit_seq="(cg)4"
FT   misc_feature    complement(403585..403653)
FT                   /gene="kdpC"
FT                   /locus_tag="Smlt0406"
FT                   /note="1 probable transmembrane helix predicted for
FT                   Smlt0406 by TMHMM2.0 at aa 34-56"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(403749..405806)
FT                   /transl_table=11
FT                   /gene="kdpB"
FT                   /locus_tag="Smlt0407"
FT                   /product="putative potassium-transporting ATPase B chain"
FT                   /EC_number="3.6.3.12"
FT                   /note="similarity:fasta; BPSL1172; bpseudomallei;
FT                   potassium-transporting ATPase b chain; length 686 aa;
FT                   id=60.6%; ; E()=9.3e-83; 681 aa overlap; query 18-679 aa;
FT                   subject 1-680 aa"
FT                   /note="similarity:fasta; SDT0723; styphimuriumDT104;
FT                   potassium-transporting ATPase B chain; length 682 aa;
FT                   id=60.7%; ; E()=9.2e-134; 675 aa overlap; query 17-682 aa;
FT                   subject 7-679 aa"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0407"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ44006"
FT                   /db_xref="GOA:B2FJW9"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006391"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJW9"
FT                   /protein_id="CAQ44006.1"
FT                   /translation="MSTHASSTRSSLAPRPALLDGAGLRRALVEAVRKLSPMHLVRSPV
FT                   MAVVMAGTIVAAIVTLTGNAPLGFGLAVTAILLVTVLFGNFAEAVAEARGRGQAASLRR
FT                   ARQDLVARRLAAPQPGAAETQLPAAELRPGDHVIVSAGELVPADGEIVQGLATINEAAV
FT                   TGESAPVLREAGTDRSGVIGGTKVLSDQIIVRVTAEPGHSFLDRMIALVEGANRQKTPN
FT                   EIALTLLLAAMTLTFLVVVATLPAIGAAVGVQVDPLLLIALLVCLIPTTIGGLLPAIGI
FT                   AGMNRALAANVLAKSGKAVEVAGDVDVLLLDKTGTITYGDRQASHFHPLAGIDASQLRE
FT                   AALLSSLADPTPEGKSIVRLAREQGCATAEPDHAEYLAFSAQTRMSGVDLEHGRQIRKG
FT                   AADAIRAHVQALGGNVPAELAGRVEQVARNGATPLVVAEGRHVLGVIELSDVVKHGMRE
FT                   KFAQLRAMGIRTVMITGDNPLTAAAIAAEAGVDDYIAEARPEDKLARIRQEQAGGRLVA
FT                   MVGDGTNDAPALAQADIGLAMNSGTQAAKEAGNMVDLDSDPAKLLAVVEVGKQQLITRG
FT                   ALTTFSLANDVSKYFAILPALFAAAVPTMAALNVMQLSSPRNAVLAALIFNALVIPALI
FT                   PLALRGVRFRPATATALLRRNMLVYGLGGVLLPFAAIKAIDLLLVLVFGA"
FT   misc_feature    complement(order(403770..403838,403875..403943,
FT                   403971..404039,404967..405035,405063..405131,
FT                   405546..405614,405624..405692))
FT                   /gene="kdpB"
FT                   /locus_tag="Smlt0407"
FT                   /note="7 probable transmembrane helices predicted for
FT                   Smlt0407 by TMHMM2.0 at aa 39-61, 65-87, 226-248, 258-280,
FT                   590-612, 622-644 and 657-679"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(404181..404891)
FT                   /gene="kdpB"
FT                   /locus_tag="Smlt0407"
FT                   /note="HMMPfam hit to PF00702, haloacid dehalogenase-like
FT                   hydrolase, score 5.8e-32"
FT                   /inference="protein motif:HMMPfam:PF00702"
FT   misc_feature    complement(404901..405581)
FT                   /gene="kdpB"
FT                   /locus_tag="Smlt0407"
FT                   /note="HMMPfam hit to PF00122, E1-E2 ATPase, score 3.4e-49"
FT                   /inference="protein motif:HMMPfam:PF00122"
FT   repeat_region   405083..405094
FT                   /rpt_unit_seq="(cca)4"
FT   CDS_pept        complement(405817..407526)
FT                   /transl_table=11
FT                   /gene="kdpA"
FT                   /locus_tag="Smlt0408"
FT                   /product="putative potassium-transporting ATPase A chain"
FT                   /EC_number="3.6.3.12"
FT                   /note="similarity:fasta; CD1591; cdifficile;
FT                   potassium-transporting ATPase A chain; length 564 aa;
FT                   id=40.0%; ; E()=6.1e-66; 578 aa overlap; query 1-566 aa;
FT                   subject 7-562 aa"
FT                   /note="similarity:fasta; BF0528; bfragilisNCTC9343;
FT                   putative potassium-transporting ATPase; length 568 aa;
FT                   id=41.1%; ; E()=2.5e-42; 584 aa overlap; query 2-566 aa;
FT                   subject 3-568 aa"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0408"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ44007"
FT                   /db_xref="GOA:B2FJX0"
FT                   /db_xref="InterPro:IPR004623"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJX0"
FT                   /protein_id="CAQ44007.1"
FT                   /translation="MTEMLVIIAASLLLAWPLGLYLARVMRGTPMKVDVLFHWIEKPLY
FT                   KVLGVDPSRAMSWRGYVLAFVLSNVVVAVLTQAVFMTQAWLPLNPDQIPNMRWDTALHT
FT                   MISFLTNTNQQHYSGQAQLSYFSQMTGITGLQVVTPMMGLALAVATLRALFSRAPQAAA
FT                   TTGAGDDRQVAVGNYYVDVVRLCVRFLLPLCLVWTLVLTSQGVPSTIAGGPQATPIDAS
FT                   AGMAEQKLPLGPVAAMVAAKQLGANGGGWYGPNSSFPLENPTPLSNALEIVGILLVPMA
FT                   VIFMIGAFTGRRRFGALVFSCMLGMSLLSTGAMMWSEGHSASAATPLLMEGKEVRFGAD
FT                   GTALWAAVTTQVSNGSVNGMHDSLAPLSGGIAMVNMLVSAIWGGIGCGLQQFIVYLLLG
FT                   VFLAGLMTGRTPELFGRKLETPQVRLLALLVLLQPITLLVFTAITLAVPGLAGTSNPGF
FT                   HGISQVFYEYVSAYANNGSGFEGLGDATLWWNLSCSLVLLLGRFPLLIIPLVVAAQLAA
FT                   KRQAPESAGSLQIETPTFALTLVSVIVILTVLQFMPALVLGPIADHLSLGLH"
FT   misc_feature    complement(405829..407523)
FT                   /gene="kdpA"
FT                   /locus_tag="Smlt0408"
FT                   /note="HMMPfam hit to PF03814, Potassium-transporting
FT                   ATPase A subunit, score 2.1e-209"
FT                   /inference="protein motif:HMMPfam:PF03814"
FT   misc_feature    complement(order(405859..405927,405988..406056,
FT                   406186..406254,406315..406383,406576..406644,
FT                   406663..406731,406906..406974,407062..407130,
FT                   407281..407349,407458..407517))
FT                   /gene="kdpA"
FT                   /locus_tag="Smlt0408"
FT                   /note="10 probable transmembrane helices predicted for
FT                   Smlt0408 by TMHMM2.0 at aa 4-23, 60-82, 133-155, 185-207,
FT                   266-288, 295-317, 382-404, 425-447, 491-513 and 534-556"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(407806..408471)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0410"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q8P468
FT                   (EMBL:AE012506;); Xanthomonas campestris pv. campestris.;
FT                   Hypothetical protein XCC3848.; length=203; id 57.711%;
FT                   ungapped id 58.000%; E()=2.7e-38; 201 aa overlap; query
FT                   21-221; subject 4-203"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0410"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ44008"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJX1"
FT                   /protein_id="CAQ44008.1"
FT                   /translation="MSRVPAVLFAGLLLVVPFTVPAQSRDSSKAEKKLYCWNEGKERIC
FT                   SDSLPADAVNHAREEFNASTGLRNAQVQRALTDEERAAASTAAQQQQLDLMAEQTRQRT
FT                   EQAMLSTYGSEADLRRVFAERQEVLDNNLKTAEYNVTSLRESLVALLSAAGDRELAGAK
FT                   VADKQAEAIRKRHAQLQAQQRLQAGLVQQQQALKAEIDSTLQRYRELKGLVPADTPAG"
FT   repeat_region   407890..407901
FT                   /rpt_unit_seq="(ctg)4"
FT   sig_peptide     complement(408400..408471)
FT                   /locus_tag="Smlt0410"
FT                   /note="Signal peptide predicted for Smlt0410 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.746 between residues 24 and 25"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(408491..409150)
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="Smlt0411"
FT                   /product="putative orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="similarity:fasta; NMA0582;
FT                   nmeningitidis_serogroupA_strainZ2491; putative orotate
FT                   phosphoribosyltransferase; length 213 aa; id=53.0%; ;
FT                   E()=1.2e-42; 215 aa overlap; query 1-215 aa; subject 1-212
FT                   aa"
FT                   /note="similarity:fasta; NMC0345;
FT                   nmeningitidis_serogroupC_strainFAM18; putative orotate
FT                   phosphoribosyltransferase; length 213 aa; id=53.0%; ;
FT                   E()=2.3e-42; 215 aa overlap; query 1-215 aa; subject 1-212
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0411"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ44009"
FT                   /db_xref="GOA:B2FJX2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2FJX2"
FT                   /protein_id="CAQ44009.1"
FT                   /translation="MSDHRHRFLQLALTADALRFGQFTLKSGRLSPYFFNAGRFDSGSL
FT                   LSQLGACYADAIDASGIKYDVVFGPAYKGIPLATAMACELAQRGRDLPLSFNRKEAKDH
FT                   GEGGQLIGADMQGKRVLIVDDVITAGTAIREALGIIRAAGGTPAGIVVALDRQEIASET
FT                   DRRSAAQSVAEEAGIPVIAVASLADLLDFASGNPELVGYRQPLEAYRAQYGVRSIR"
FT   misc_feature    complement(408635..409045)
FT                   /gene="pyrE"
FT                   /locus_tag="Smlt0411"
FT                   /note="HMMPfam hit to PF00156, Phosphoribosyl transferase
FT                   domain, score 1.1e-33"
FT                   /inference="protein motif:HMMPfam:PF00156"
FT   CDS_pept        409313..410113
FT                   /transl_table=11
FT                   /locus_tag="Smlt0412"
FT                   /product="putative endonuclease/exonuclease/phosphatase
FT                   family protein"
FT                   /EC_number="4.2.99.18"
FT                   /note="similarity:fasta; CAL0487; bcenocepacia;
FT                   endonuclease/exonuclease/phosphatase family protein; length
FT                   257 aa; id=55.1%; ; E()=9.3e-16; 265 aa overlap; query
FT                   1-265 aa; subject 2-254 aa"
FT                   /note="similarity:fasta; BPSL0191; bpseudomallei;
FT                   endonuclease/exonuclease/phosphatase family protein; length
FT                   256 aa; id=54.7%; ; E()=2.1e-15; 265 aa overlap; query
FT                   1-265 aa; subject 2-254 aa"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0412"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ44010"
FT                   /db_xref="GOA:B2FJX3"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJX3"
FT                   /protein_id="CAQ44010.1"
FT                   /translation="MRIISFNANGIRSAATKGFLDWFRAQDADVLCIQETKAQEDQLSD
FT                   PMFRPDGHHCFYRDAITKKGYSGVAIYSKREPDQVITSLGWAPFDDEGRYIEARYGNLS
FT                   VVSFYIPSGSSGDLRQGFKFEVMEWLRPILEEWARSGRDYVLCGDWNIVRSALDIKNWK
FT                   SNQKNSGCLPEERDWLNALCADHGQATDVTAGRGWADAYRLLNPTGEDYTWWSNRGAAR
FT                   ANNVGWRIDYQFITPGLRDRLRSCSIYRDERFSDHAPFTVDYDL"
FT   misc_feature    409313..410104
FT                   /locus_tag="Smlt0412"
FT                   /note="HMMPfam hit to PF03372,
FT                   Endonuclease/Exonuclease/phosphatase fa, score 2.8e-51"
FT                   /inference="protein motif:HMMPfam:PF03372"
FT   CDS_pept        410110..411483
FT                   /transl_table=11
FT                   /gene="ampG"
FT                   /locus_tag="Smlt0413"
FT                   /product="putative beta-lactamase induction signal
FT                   transducer AmpG"
FT                   /note="similarity:fasta; YE3139; yenterocolitica;
FT                   Beta-lactamase induction signal transducer AmpG; length 492
FT                   aa; id=36.6%; ; E()=1.9e-13; 437 aa overlap; query 16-448
FT                   aa; subject 6-404 aa"
FT                   /note="similarity:fasta; YPO3162; ypestis; Beta-lactamase
FT                   induction signal transducer AmpG; length 492 aa; id=36.1%;
FT                   ; E()=8e-14; 429 aa overlap; query 16-440 aa; subject 6-398
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0413"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ44011"
FT                   /db_xref="GOA:B2FJX4"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR024371"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJX4"
FT                   /protein_id="CAQ44011.1"
FT                   /translation="MTEAAKPRRPWQQVLSNLSQRKVLAMLLLGFSSGLPIYLVGNTLG
FT                   FWMRKEGIELSTIGFLSWVGLAYTMKFLWAPIVDKTDVPLFGRFGRRRGWMLLSQLVVV
FT                   VGLVGMALVQPKGGQIQFLGIAWQHIVVFGVMAVIVAFASATQDIVIDAWRIESADNSE
FT                   QLGLLTSSSALGYRTALLVTDALILIIAARVGWQVSYEIMAVLMALGVVAVVMAREPAR
FT                   EVAAVQAQATSLWTPRGLFDAVAGPFIAFVREHRSGAILILVAISVYRMADFVMGPMAN
FT                   PFYVDLGLDEDTVGAVRGSVGLVATFVGIAAAGLVSVRWGVLAALMVGAVLGPASNLAF
FT                   AWLAYSGPDTTHFAVAMAIDNFASGFAGTALIAYMSSLTSIGYTATQYALLSSFYAMPG
FT                   KALKGLSGWSVQTLAQGRTLLEGYALFFVGTALVAIPVVILCALLILQQRRRQAAGST"
FT   misc_feature    order(410176..410244,410272..410340,410389..410448,
FT                   410476..410544,410629..410697,410707..410760,
FT                   410878..410946,410989..411057,411070..411138,
FT                   411166..411234,411271..411339,411382..411450)
FT                   /gene="ampG"
FT                   /locus_tag="Smlt0413"
FT                   /note="12 probable transmembrane helices predicted for
FT                   Smlt0413 by TMHMM2.0 at aa 23-45, 55-77, 94-113, 123-145,
FT                   174-196, 200-217, 257-279, 294-316, 321-343, 353-375,
FT                   388-410 and 425-447"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    410185..411342
FT                   /gene="ampG"
FT                   /locus_tag="Smlt0413"
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 7.2e-06"
FT                   /inference="protein motif:HMMPfam:PF07690"
FT   CDS_pept        411561..411791
FT                   /transl_table=11
FT                   /locus_tag="Smlt0414"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q5H5K5
FT                   (EMBL:AE013598;); Xanthomonas oryzae pv. oryzae.;
FT                   Hypothetical protein.; length=75; id 65.753%; ungapped id
FT                   65.753%; E()=1.3e-15; 73 aa overlap; query 1-73; subject
FT                   1-73"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0414"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ44012"
FT                   /db_xref="GOA:B2FJX5"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJX5"
FT                   /protein_id="CAQ44012.1"
FT                   /translation="MADVVLRDLDPLLLERIKRVAVARGWTHEQTCAALLEQGLFSSEL
FT                   EVRSGFGDPEVDALSDAIAALQALPAGQGFD"
FT   CDS_pept        complement(411871..413007)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0415"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; BAV2965; bavium; conserved
FT                   hypothetical protein; length 372 aa; id=49.9%; ;
FT                   E()=2.8e-54; 373 aa overlap; query 9-378 aa; subject 9-371
FT                   aa"
FT                   /note="similarity:fasta; YPO2372; ypestis; conserved
FT                   hypothetical protein; length 370 aa; id=48.4%; ;
FT                   E()=1.7e-59; 366 aa overlap; query 15-376 aa; subject 6-365
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0415"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ44013"
FT                   /db_xref="GOA:B2FJX6"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJX6"
FT                   /protein_id="CAQ44013.1"
FT                   /translation="MPAMNTTADTDAPLYLGLMSGTSADGIDAALVQFPAGGGCRFVHG
FT                   LTARWEPVLRARLVALGEGGPLDSLEELGELDARIAISFAGAANQLLAEAGVDRSQVRA
FT                   IGSHGQTVRHRPLADPAFTVQLGDGNRIAELTGITTVSDFRRRDVAAGGHGAPLMPAFH
FT                   LAMLGTADEDRAVLNLGGIANLTLIPREGAVRGFDTGPANALMDAWCQRHTGRTFDADG
FT                   AYAASGAVDEGLLAGWRSDPWFALPPPKSTGREQFHLAWAEAHMAEGQYAAADVQATLL
FT                   ELTVATVADALLAQQPQTRRLLVCGGGVRNRQLMKRLAARLPDVQVESSAVHGLDPEYV
FT                   EAMGFAWLAQRTMDGLAGNLPSVTGAKGPRILGAIHLA"
FT   misc_feature    complement(411874..412971)
FT                   /locus_tag="Smlt0415"
FT                   /note="HMMPfam hit to PF03702, Uncharacterised protein
FT                   family (UPF0075), score 1e-190"
FT                   /inference="protein motif:HMMPfam:PF03702"
FT   CDS_pept        complement(413064..414536)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0416"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; BP2956; bpertussis; hypothetical
FT                   protein; length 471 aa; id=39.5%; ; E()=9.5e-39; 415 aa
FT                   overlap; query 52-452 aa; subject 45-452 aa"
FT                   /note="similarity:fasta; BPP3878; bparapertussis;
FT                   hypothetical protein; length 471 aa; id=39.5%; ;
FT                   E()=3.9e-39; 415 aa overlap; query 52-452 aa; subject
FT                   45-452 aa"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0416"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ44014"
FT                   /db_xref="GOA:B2FJX7"
FT                   /db_xref="InterPro:IPR007340"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJX7"
FT                   /protein_id="CAQ44014.1"
FT                   /translation="MHNSEQGRARKQRFQERLHVLHDNALHRKLRQHLPAAFNERWTRR
FT                   HWMHASLFATIGALVATIVPGFSHTIDAPFADSHTSLALPLPPLAMARQQQVPGDSWQV
FT                   LRVERGQTLSDLFDKAGIPATTLHRVLDHPGAREALTKLRPGAEIAFDMPLSGDLRSIR
FT                   FDRDADNRVELSLAGDDIKEKVTKRETSTRTVVTSGEITSSLYAAARRAGLSPSAIATM
FT                   TDDIFKYDIDFSKDLQPGDRFSVVMDETWREGEKVDTSKILAATFTTGGKTYSGFRFDR
FT                   NGKSEYYDINGRSLKKSFIRMPIPFARLSSTFGARKHPVLGKMRMHKGVDYAARTGTPI
FT                   MAAGDARVQFAGVQRGYGNVVILDHGRGHTTLYGHMSRFANIKTGQRVAQGTVIGYVGS
FT                   TGLATGPHLHYEFRVNGEHRNPLTVTMPPPEPLKGAELVAFRAQTAPAMARIQGMEKLI
FT                   YADASPAPTSRDEAAPEVASAKDKSSTGRKRG"
FT   misc_feature    complement(413274..413564)
FT                   /locus_tag="Smlt0416"
FT                   /note="HMMPfam hit to PF01551, Peptidase family M23, score
FT                   2.8e-51"
FT                   /inference="protein motif:HMMPfam:PF01551"
FT   repeat_region   complement(413897..413918)
FT                   /rpt_family="GC_rich"
FT                   /inference="nucleotide motif:RepeatScout"
FT   misc_feature    complement(414024..414236)
FT                   /locus_tag="Smlt0416"
FT                   /note="HMMPfam hit to PF04225, Opacity-associated protein A
FT                   LysM-like, score 0.0032"
FT                   /inference="protein motif:HMMPfam:PF04225"
FT   misc_feature    complement(414324..414392)
FT                   /locus_tag="Smlt0416"
FT                   /note="1 probable transmembrane helix predicted for
FT                   Smlt0416 by TMHMM2.0 at aa 49-71"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        414704..415915
FT                   /transl_table=11
FT                   /locus_tag="Smlt0417"
FT                   /product="putative tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /note="similarity:fasta; BPSL2904; bpseudomallei;
FT                   tyrosyl-tRNA synthetase; length 413 aa; id=56.0%; ;
FT                   E()=3.4e-77; 405 aa overlap; query 4-402 aa; subject 17-413
FT                   aa"
FT                   /note="similarity:fasta; CAL3344; bcenocepacia;
FT                   tyrosyl-tRNA synthetase; length 413 aa; id=55.6%; ;
FT                   E()=1.5e-78; 403 aa overlap; query 4-402 aa; subject 17-413
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0417"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ44015"
FT                   /db_xref="GOA:B2FJX8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJX8"
FT                   /protein_id="CAQ44015.1"
FT                   /translation="MSSIEEALAQIGRGADEILKLEDLRARLQEGRPLRIKAGFDPTAP
FT                   DLHLGHTVLLNKMRQFQDLGHQVIFLIGDFTGMIGDPSGKSLTRKPLSREDVLANARTY
FT                   EEQVFKVLDRSRTEVRFNSEWFGKMGAADMIRLAGQHTVARMLERDDFAKRYAAQQSIA
FT                   IHEFLYPLVQGYDSVALEADVELGGTDQKFNLLMGRGLQEHHGQKPQVVLTMPLLEGLD
FT                   GVNKMSKSLGNYIGISEPAIDIVTKTMKVDDTLMWRWIELLSFDISQAEAVQLREQVAN
FT                   GGLNPRVVKLRLARELATRFHDAAAAEQAIAGWEAAVTGQGDITQLPLQDVAIPVEGLR
FT                   IAALLTAAGLTPSNSEANRKLKERAVKVDGEVVEDGQQVLQPGFEGLLQVGKRTFARVR
FT                   LVAA"
FT   misc_feature    414788..415660
FT                   /locus_tag="Smlt0417"
FT                   /note="HMMPfam hit to PF00579, tRNA synthetases class I (W
FT                   and Y), score 4.2e-100"
FT                   /inference="protein motif:HMMPfam:PF00579"
FT   misc_feature    415718..415861
FT                   /locus_tag="Smlt0417"
FT                   /note="HMMPfam hit to PF01479, S4 domain, score 0.013"
FT                   /inference="protein motif:HMMPfam:PF01479"
FT   repeat_region   416171..421607
FT                   /rpt_family="R=18"
FT                   /inference="nucleotide motif:RepeatScout"
FT   repeat_region   421835..427271
FT                   /rpt_family="R=18"
FT                   /inference="nucleotide motif:RepeatScout"
FT   repeat_region   426812..427271
FT                   /rpt_family="R=18"
FT                   /inference="nucleotide motif:RepeatScout"
FT   CDS_pept        complement(427579..429294)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0418"
FT                   /product="putative aminopeptidase"
FT                   /note="similarity:fasta; BF0657; bfragilisNCTC9343;
FT                   putative aminopeptidase; length 333 aa; id=35.2%; ;
FT                   E()=5.2e-16; 236 aa overlap; query 283-499 aa; subject
FT                   87-307 aa"
FT                   /note="similarity:blastp; with=UniProt:Q3BZQ5; Xanthomonas
FT                   campestris pv. vesicatoria (strain 85-10).; Putative
FT                   peptidase precursor.; length=598; E()=0.0;"
FT                   /note="similarity:blastp; with=UniProt:Q8PRD7; Xanthomonas
FT                   axonopodis pv. citri.; Hypothetical protein XAC0026.;
FT                   length=598; E()=0.0;"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0418"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ44016"
FT                   /db_xref="GOA:B2FJX9"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJX9"
FT                   /protein_id="CAQ44016.1"
FT                   /translation="MPRKLLLCLAAAAALSACKGEDTPATAPASATDTAAAKPAAHQFS
FT                   PEINAGDFAEMVKTLASDEFEGRAPGSKGEELTVNYIRDQMQRIGLQPGNGDSWFQDVP
FT                   MTETTADASTVLKITQGGKTTELKFGTDMVVGTRTGQAEVKVDASDLVFVGYGVDAPEQ
FT                   KWNDYAGQDWKGKTVVMFVNDPGFHVDDAKLFDGKRMTYYGRWTYKFEEAARKGAAAAL
FT                   IVHDTAGASYGWDVVKNSWAGPQYDLPAKDDPEARIPVQGWLSADAAKALFAGAGLDLA
FT                   QAYKDASKRGFKPVPLKATAAVDLKSQIAQKQSRNVVGVLPGSKRADEAVLYMAHWDHL
FT                   GKHEGETGDNIYNGAVDNATGVAGILEVAEAMAHQDPKPERSVVFLAVTLEESGLLGSK
FT                   YYVSHPTFPLDKIAGVINIDAMSVAGRAKDVTVTGFGSSELEDILKPLAAAQDRTLHGE
FT                   TSVQSGFYFRSDHFNFAKAGVPALYADGGEDLREGGVDAGRKAAADYGANRYHGPKDEF
FT                   DASTWKLDGTVEDLQLMYGVGKELAGADRWPNWYEGNPFKAARDAMMKDKAPAR"
FT   misc_feature    complement(427711..428310)
FT                   /locus_tag="Smlt0418"
FT                   /note="HMMPfam hit to PF04389, Peptidase family M28, score
FT                   3.6e-63"
FT                   /inference="protein motif:HMMPfam:PF04389"
FT   sig_peptide     complement(429202..429294)
FT                   /locus_tag="Smlt0418"
FT                   /note="Signal peptide predicted for Smlt0418 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.518 between residues 31 and 32"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(429381..430043)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0419"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q8PEF7; Xanthomonas
FT                   campestris pv. campestris.; Hypothetical protein XCC0023.;
FT                   length=218; id 61.353%; ungapped id 61.353%; E()=6.4e-41;
FT                   207 aa overlap; query 14-220; subject 12-218"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0419"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ44017"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJY0"
FT                   /protein_id="CAQ44017.1"
FT                   /translation="MKTLSIPLLLGVLLVAGPAGAQDNISKVNGSISAEPGQRYGKLDT
FT                   VNGGIRVGEGVETGSIDTVNGGVKVADRARTGKIETVNGGVRLGREVIAHGSVSTVNGS
FT                   IFTDRGSQIEGGVETVNGGIGLVESRVGKDVETVNGDITVGIGSQVNGGVHVRKPNFSV
FT                   SLTASRKPRVIVGPNAVVNGPLQFEREVVLYVHRTARIGPVTGAEPIPFDTETAPAD"
FT   sig_peptide     complement(429981..430043)
FT                   /locus_tag="Smlt0419"
FT                   /note="Signal peptide predicted for Smlt0419 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 1.000 between residues 21 and 22"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        430138..431439
FT                   /transl_table=11
FT                   /locus_tag="Smlt0420"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; STY4090; styphi; conserved
FT                   hypothetical protein; length 427 aa; id=34.8%; ;
FT                   E()=8.7e-34; 396 aa overlap; query 47-432 aa; subject
FT                   47-427 aa"
FT                   /note="similarity:fasta; SEN3527; senteritidisPT4;
FT                   conserved hypothetical protein; length 427 aa; id=34.8%; ;
FT                   E()=1.1e-34; 396 aa overlap; query 47-432 aa; subject
FT                   47-427 aa"
FT                   /note="similarity:fasta; SDT3684; styphimuriumDT104;
FT                   conserved hypothetical protein; length 427 aa; id=34.8%; ;
FT                   E()=1.7e-33; 396 aa overlap; query 47-432 aa; subject
FT                   47-427 aa"
FT                   /note="similarity:fasta; SBG3287; sbongori; conserved
FT                   hypothetical protein; length 427 aa; id=35.9%; ; E()=1e-34;
FT                   398 aa overlap; query 52-432 aa; subject 45-427 aa"
FT                   /note="similarity:fasta; YPO0063; ypestis; putative
FT                   membrane protein; length 450 aa; id=33.0%; ; E()=9.2e-34;
FT                   415 aa overlap; query 27-432 aa; subject 40-450 aa"
FT                   /note="similarity:fasta; YE0076; yenterocolitica; putative
FT                   membrane protein; length 384 aa; id=33.1%; ; E()=9.9e-34;
FT                   387 aa overlap; query 51-432 aa; subject 1-384 aa"
FT                   /note="similarity:fasta; ECA0170; ecarotovora_atroseptica;
FT                   putative exported peptidase; length 433 aa; id=33.8%; ;
FT                   E()=8.5e-33; 400 aa overlap; query 43-432 aa; subject
FT                   46-433 aa"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0420"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ44018"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJY1"
FT                   /protein_id="CAQ44018.1"
FT                   /translation="MRDNAFPSRRHHIAAIRGGRCLLLGLAIALALPLQGAAQTTRETE
FT                   RKLQKLRSELKGVAQERRQIEGQRGQASQQLREADEKVARTGRALAQTETALREQGRAL
FT                   AEAEQRRSTLQANLAQQHRELAGLLRAAYQLGNHAPLKLLLSQDTVADANRALAYHRYL
FT                   QRERAQRITTLTADLKELEVLQAQIAERKQKLQGAQQDQKQQAAALEADRRDRARTVAS
FT                   LDERFKDQREKEQALGQDAKALEKLLANLRAAAARAEAERRAAARRAAAEKAAAERAAR
FT                   QAAAQGRPPPPPTKVPPAVASAPAPKVGGLGWPLSGNLLARYGGKLPDGRTSSGVLIGA
FT                   PAGSTVTAVADGTVVFSDWMTGYGMILIVDHGNGYMSLYAHNDTLLKDAGARVSRGDAV
FT                   AKVGNSGGQGVTALYFELRRGGQPVNPDSWLQRR"
FT   sig_peptide     430138..430251
FT                   /locus_tag="Smlt0420"
FT                   /note="Signal peptide predicted for Smlt0420 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.997) with cleavage site
FT                   probability 0.499 between residues 38 and 39"
FT                   /inference="protein motif:SignalP:2.0"
FT   repeat_region   complement(430920..430940)
FT                   /rpt_family="GC_rich"
FT                   /inference="nucleotide motif:RepeatScout"
FT   misc_feature    431128..431415
FT                   /locus_tag="Smlt0420"
FT                   /note="HMMPfam hit to PF01551, Peptidase family M23, score
FT                   9.2e-40"
FT                   /inference="protein motif:HMMPfam:PF01551"
FT   CDS_pept        431548..432996
FT                   /transl_table=11
FT                   /gene="ctpA"
FT                   /locus_tag="Smlt0421"
FT                   /product="putative carboxy-terminal processing protease
FT                   precursor"
FT                   /EC_number="3.4.21.102"
FT                   /note="similarity:fasta; BAV0245; bavium; carboxy-terminal
FT                   processing protease precursor; length 484 aa; id=41.2%; ;
FT                   E()=2.6e-16; 461 aa overlap; query 46-482 aa; subject
FT                   38-480 aa"
FT                   /note="similarity:fasta; CAL0738; bcenocepacia; C-terminal
FT                   processing protease-3; length 517 aa; id=38.8%; ;
FT                   E()=1.5e-11; 498 aa overlap; query 35-479 aa; subject
FT                   26-516 aa"
FT                   /note="similarity:fasta; BP0609; bpertussis; putative
FT                   carboxy-terminal processing protease precursor; length 481
FT                   aa; id=42.2%; ; E()=1.1e-14; 446 aa overlap; query 44-467
FT                   aa; subject 34-460 aa"
FT                   /note="similarity:fasta; BB0300; bbronchiseptica; putative
FT                   carboxy-terminal processing protease precursor; length 483
FT                   aa; id=42.2%; ; E()=4.3e-14; 446 aa overlap; query 44-467
FT                   aa; subject 36-462 aa"
FT                   /note="similarity:blastp; with=UniProt:Q3BZQ8
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; ctp; Periplasmic carboxyl-terminal
FT                   protease precursor.; length=509; E()=0e-156;"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0421"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ44019"
FT                   /db_xref="GOA:B2FJY2"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJY2"
FT                   /protein_id="CAQ44019.1"
FT                   /translation="MRAARTATLLLALLPALSWAQQTAPAPSKETSGQAANSEEAVTSK
FT                   VPLEDIRRFVAVYNAVRAAYVDPVDDKKLMQSAVRGLLLDLDPHSTYFNKEDAQAFDEQ
FT                   ANGAYEGIGVELQQQPDNASMKVISPIDDTPAAKAGILAGDLIIAIDGKPISAIDASEP
FT                   LRGPAGSKVVLTIVRAGKPKPFDVSLTRQTIRVTSVRSRLLEPGYGYIRLSTFQADTGS
FT                   DFQKHLQQLQKQSGGQLKGLVLDLRSNPGGLLTAAVQVADDLLDKGNIVSTRGRISISD
FT                   ARFDATPGDLLKGAPVVVLVDAGSASASEVLAGALRDNKRARVVGSRTFGKGSVQTVLP
FT                   LDNGDSVKLTTARYYTPSGKSIQATGIVPEVELKPAARPGDEALPASLSDYSEATLPGH
FT                   LRGDDEGTEGYRAGAVLPGDGPINDALAELKNPGSVAARLKAEAAKADAAKAAKAAAAK
FT                   PEAKVEPKPEAQPEAKPAPAPAKP"
FT   sig_peptide     431548..431607
FT                   /gene="ctpA"
FT                   /locus_tag="Smlt0421"
FT                   /note="Signal peptide predicted for Smlt0421 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.953 between residues 20 and 21"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    431842..432078
FT                   /gene="ctpA"
FT                   /locus_tag="Smlt0421"
FT                   /note="HMMPfam hit to PF00595, PDZ domain (Also known as
FT                   DHR or GLGF), score 3.9e-07"
FT                   /inference="protein motif:HMMPfam:PF00595"
FT   misc_feature    432166..432666
FT                   /gene="ctpA"
FT                   /locus_tag="Smlt0421"
FT                   /note="HMMPfam hit to PF03572, Peptidase family S41, score
FT                   2e-75"
FT                   /inference="protein motif:HMMPfam:PF03572"
FT   repeat_region   432507..432516
FT                   /rpt_unit_seq="(gc)5"
FT   CDS_pept        complement(433079..433771)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0422"
FT                   /product="putative rhomboid family transmembrane protein"
FT                   /note="similarity:fasta; SCO6038; scoelicolor; putative
FT                   integral membrane protein; length 383 aa; id=41.5%; ;
FT                   E()=4.2e-14; 159 aa overlap; query 69-222 aa; subject
FT                   212-366 aa"
FT                   /note="similarity:blastp; with=UniProt:Q4V0R1; Xanthomonas
FT                   campestris pv. campestris (strain 8004).; Hypothetical
FT                   protein.; length=230; E()=9e-93;"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0422"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ44020"
FT                   /db_xref="GOA:B2FJY3"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJY3"
FT                   /protein_id="CAQ44020.1"
FT                   /translation="MFVSLPSRKKAALRWATPVLFAALWLAFLWSISRPDDARGSLWLD
FT                   WGALSTGLTHPLDWWATLQDGSVLRLFTALFLHADWSHLLGNLVFLLIFGLPAERVLGP
FT                   WRLLLLFLVGGAVSNLVAIYTMGSPDQIIIGASGAVSALIGAYLALFPGARLGVVIPLG
FT                   LFLEFVRAPAYLLIGVWAALQVVFAHIGPSFGMVAWWAHIGGFVFGLVYGVYVRAAIAR
FT                   RLRKRHGF"
FT   misc_feature    complement(433109..433588)
FT                   /locus_tag="Smlt0422"
FT                   /note="HMMPfam hit to PF01694, Rhomboid family, score
FT                   6.3e-39"
FT                   /inference="protein motif:HMMPfam:PF01694"
FT   misc_feature    complement(order(433112..433180,433208..433276,
FT                   433310..433378,433391..433459,433478..433531,
FT                   433670..433738))
FT                   /locus_tag="Smlt0422"
FT                   /note="6 probable transmembrane helices predicted for
FT                   Smlt0422 by TMHMM2.0 at aa 12-34, 81-98, 105-127, 132-154,
FT                   166-188 and 198-220"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(433658..433771)
FT                   /locus_tag="Smlt0422"
FT                   /note="Signal peptide predicted for Smlt0422 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.735) with cleavage site
FT                   probability 0.507 between residues 38 and 39"
FT                   /inference="protein motif:SignalP:2.0"
FT   repeat_region   433983..433992
FT                   /rpt_unit_seq="(ga)5"
FT   CDS_pept        433999..435426
FT                   /transl_table=11
FT                   /locus_tag="Smlt0423"
FT                   /product="putative fatty acid transport system, membrane
FT                   protein"
FT                   /note="similarity:fasta; BB1793; bbronchiseptica; Putative
FT                   fatty acid transport system, membrane protein; length 434
FT                   aa; id=30.0%; ; E()=6e-18; 476 aa overlap; query 10-475 aa;
FT                   subject 8-434 aa"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0423"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ44021"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJY4"
FT                   /protein_id="CAQ44021.1"
FT                   /translation="MQTASTIARLTLLAVGVAGALAAADANAAAFQLKENSAKGLGRAF
FT                   AGSTSTEGDASVIATNPASMRLLDGTLIQGDVSAISFGAKFRGQGQYGNGQPISGGNGG
FT                   DAGMIAPVPAAYFHLPFGEKENMHFGASLTVPFGFKTEYDRDWVGRYNGVKTELQAVDL
FT                   GVAFSYDVNPYLSFGASVFAERLNVDLTSAVDTGTAINATAQRTAAARVLAAGGTAAQA
FT                   AAASQAAARQAAQLGFSPGTADGYLRIKGDEVSVGYTLGMTVTPVEGTNIAFSYRSKVE
FT                   HKITDGKADFTIPQNAAAFLATAAPGTFIDSNGRATITLPASATVGFTHRVNDQWQIMA
FT                   EVTRTAWSKFDQVTVDYDSNQPDSVLPFHYRDTTFASIGTDFRVNDKLTLRGGLAYDQT
FT                   PTTDAHRDVRVPDTTRKWLSLGLTYAASDKMEYSVGYTHLFTKDPNVTSTSATANTVTG
FT                   KYKVSGDVLAASMQYKF"
FT   sig_peptide     433999..434082
FT                   /locus_tag="Smlt0423"
FT                   /note="Signal peptide predicted for Smlt0423 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.691 between residues 28 and 29"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    434017..434085
FT                   /locus_tag="Smlt0423"
FT                   /note="1 probable transmembrane helix predicted for
FT                   Smlt0423 by TMHMM2.0 at aa 7-29"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    434053..435423
FT                   /locus_tag="Smlt0423"
FT                   /note="HMMPfam hit to PF03349, Outer membrane protein
FT                   transport protein (O, score 2.5e-132"
FT                   /inference="protein motif:HMMPfam:PF03349"
FT   repeat_region   435479..435487
FT                   /rpt_unit_seq="(t)9"
FT   CDS_pept        435539..436138
FT                   /transl_table=11
FT                   /locus_tag="Smlt0424"
FT                   /product="putative transmembrane protein"
FT                   /note="similarity:fasta; SCO1442; scoelicolor; putative
FT                   integral membrane protein; length 214 aa; id=30.3%; ;
FT                   E()=7.7e-13; 188 aa overlap; query 11-193 aa; subject
FT                   20-206 aa"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0424"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ44022"
FT                   /db_xref="GOA:B2FJY5"
FT                   /db_xref="InterPro:IPR006419"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJY5"
FT                   /protein_id="CAQ44022.1"
FT                   /translation="MNLSDPNFQLELAANIAVAGSILLAGRNNVHTWWLGIVGCALFAA
FT                   VFERSHLYADMVLQFFFIAISVLGWWQWLRGDHGAPLPITALRPRAWAWLVPLAVVATF
FT                   GYGWMLTRLTNAYAPYIDSAVLVLSVIAQILMMRRKLESWWVWLLVNTVAVPLYYSRGL
FT                   HLTSILYVGFWINALVALRHWRHLMRDEAKTADAAA"
FT   misc_feature    435539..435997
FT                   /locus_tag="Smlt0424"
FT                   /note="HMMPfam hit to PF04973, Nicotinamide mononucleotide
FT                   transport, score 1.1e-11"
FT                   /inference="protein motif:HMMPfam:PF04973"
FT   misc_feature    order(435626..435679,435692..435760,435803..435862,
FT                   435881..435949,436007..436075)
FT                   /locus_tag="Smlt0424"
FT                   /note="5 probable transmembrane helices predicted for
FT                   Smlt0424 by TMHMM2.0 at aa 38-55, 60-82, 97-116, 123-145
FT                   and 165-187"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        436125..437198
FT                   /transl_table=11
FT                   /gene="nadR"
FT                   /locus_tag="Smlt0425"
FT                   /product="putative TRANSCRIPTIONAL REGULATORY PROTEIN NADR
FT                   (PROBABLY ASNC-FAMILY)"
FT                   /note="similarity:fasta; Rv0212c; mtuberculosis; POSSIBLE
FT                   TRANSCRIPTIONAL REGULATORY PROTEIN NADR (PROBABLY
FT                   ASNC-FAMILY); length 323 aa; id=35.6%; ; E()=1.9e-23; 331
FT                   aa overlap; query 7-337 aa; subject 1-309 aa"
FT                   /note="similarity:fasta; Mb0218c; mbovis; POSSIBLE
FT                   TRANSCRIPTIONAL REGULATORY PROTEIN NADR (PROBABLY
FT                   ASNC-FAMILY); length 323 aa; id=35.6%; ; E()=1.3e-23; 331
FT                   aa overlap; query 7-337 aa; subject 1-309 aa"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0425"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ44023"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038727"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJY6"
FT                   /protein_id="CAQ44023.1"
FT                   /translation="MLLPERVARGLVVGKFCPLHLGHEHLIEFAATRCRQLLVIGWSQP
FT                   GFPGYSAERRERWLRARFPQATVAVLDDARLAALCTQHGLPVRTLPQDSDNEHVQREFT
FT                   AWLCLSLFGGPVQAVYTGEDYGDGFAQALATHFGASVRHERLERALDVGQACGTQLRAD
FT                   PHAHRHGLAPQVYAGYVQRVAFIGGESSGKTTLARVMAERLQTVWVPEYGRTLWEQQGG
FT                   ELTPDDLLRIAMAQPQHEDETARHAHRWLFCDTTPMVTLGYSGWMSGTAPEALRQAALR
FT                   PYDLLFLCAPDIPFDQDGTRVGEAFRAQQHAWYVRELEARGVDYVLLEGGLEARIARVH
FT                   GELAKRADNRFSVAQPL"
FT   repeat_region   437132..437139
FT                   /rpt_unit_seq="(cg)4"
FT   CDS_pept        complement(437316..440534)
FT                   /transl_table=11
FT                   /gene="putA"
FT                   /locus_tag="Smlt0426"
FT                   /product="putative bifunctional PutA protein [includes:
FT                   proline dehydrogenase; delta-1-pyrroline-5-carboxylate
FT                   dehydrogenase]"
FT                   /EC_number="1.5.99.8"
FT                   /note="similarity:fasta; CAL0042; bcenocepacia;
FT                   bifunctional PutA protein [includes: proline
FT                   dehydrogenase\; delta-1-pyrroline-5-carboxylate
FT                   dehydrogenase]; length 1310 aa; id=55.2%; ; E()=1e-97; 1048
FT                   aa overlap; query 12-1048 aa; subject 74-1095 aa"
FT                   /note="similarity:fasta; BPSL3389; bpseudomallei;
FT                   bifunctional PutA protein [includes: proline dehydrogenase
FT                   (EC 1.5.99.8) (proline oxidase)\;
FT                   delta-1-pyrroline-5-carboxylate dehydrogenase (EC 1.5.1.12)
FT                   (p5c dehydrogenase)]; length 1309 aa; id=55.1%; ;
FT                   E()=2.4e-100; 1059 aa overlap; query 5-1048 aa; subject
FT                   63-1094 aa"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0426"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ44024"
FT                   /db_xref="GOA:B2FJY7"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR005933"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR024082"
FT                   /db_xref="InterPro:IPR024089"
FT                   /db_xref="InterPro:IPR025703"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="InterPro:IPR041349"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJY7"
FT                   /protein_id="CAQ44024.1"
FT                   /translation="MNAPSSSPAAHDAPRPGALLSPELPAPPNPFRQAITDAWLKDEAT
FT                   HVRELLAQARLPAEEQAKVQALAADLVGRVRVRAKDQGAIEAFMRQYDLGSEEGVLLMC
FT                   VAEALLRIPDQDTADKLIRDKLADADWEKHLGGSDSVLVNASTWGLMLTGKLVQMNDAT
FT                   RADAPSAFKRLVGRVGEPVVRLAVRQAMKIMGHQFVMGRTISEALARSHKGDNASYRYS
FT                   FDMLGEGALTMKDALRYLEDYRRAIHAIGGDHKARGGRPDGDVNNAPGISIKLSALYPR
FT                   YEHAKRERVLKDLVPGVLELAQLAKSYGIGCTVDAEESDRLELSLDIIEQVFSDASLSG
FT                   WDGFGVVVQAYQKRTPYTIDHLADMARRAGRRLQVRLVKGAYWDAEIKRAQIEGYPGYP
FT                   VFTRKQNTDVSYLACAKRLFTHADAIYPMFATHNAHTIAAVRSIANGGVYEHQKLHGMG
FT                   DDLYAEVVPADRLGLPCRVYAPVGSHEDLLPYLVRRLLENGANSSFVNRITDERVPIAD
FT                   LIRDPVEMVASFASIPHPKIPLPVDLLRSQNHDRKNSMGANLANDNELRALAEQINAAV
FT                   KPWQAAPLVPGANPAGAALPVTNPADTREVVGQWLAADAATVQKALANAVAAQPAWNRT
FT                   PAASRAAILEHAADQLEARMPEFMALCVKEAGKSLPDSIAEVREAVDFLRYYAKQAREQ
FT                   FSHAEKLPSPTGESNELQLHGRGVFVCISPWNFPLAIFLGQVAAALAAGNSVIAKPAEQ
FT                   TNLIGYYAVKLLHDAGVPAEVVQFLPGDGATVGAALTADPRVAGVAFTGSTDTARAINR
FT                   AMAARDAAIGVLIAETGGQNAFIADSSALPEQLVKDAIGSAFTSAGQRCSAARVLFVQD
FT                   DIADKVMTMLAGAMKELKVGNPGLLSTDVGPVIDADALKILQDHAERMDREARLIAAAE
FT                   LSAEAANGAFFAPRAYELKDLGQLQKEVFGPVLHVIRWKGDQLDAVIDQINATGYGLTL
FT                   GVHSRIDETVDRISNGVHVGNVYVNRNQIGAVVGVQPFGGQGLSGTGPKAGGPHYLLRF
FT                   ATEKTVTVNTTAAGGNASLLTLGD"
FT   misc_feature    complement(437373..438785)
FT                   /gene="putA"
FT                   /locus_tag="Smlt0426"
FT                   /note="HMMPfam hit to PF00171, Aldehyde dehydrogenase
FT                   family, score 8.3e-127"
FT                   /inference="protein motif:HMMPfam:PF00171"
FT   repeat_region   437939..437946
FT                   /rpt_unit_seq="(cg)4"
FT   misc_feature    complement(438999..440036)
FT                   /gene="putA"
FT                   /locus_tag="Smlt0426"
FT                   /note="HMMPfam hit to PF01619, Proline dehydrogenase, score
FT                   1.2e-131"
FT                   /inference="protein motif:HMMPfam:PF01619"
FT   repeat_region   439364..439371
FT                   /rpt_unit_seq="(gc)4"
FT   CDS_pept        440710..441285
FT                   /transl_table=11
FT                   /locus_tag="Smlt0427"
FT                   /product="putative transmembrane protein"
FT                   /note="similarity:fasta; with=UniProt:Q3BNC5
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; Putative membrane protein.; length=216; id
FT                   57.812%; ungapped id 60.656%; E()=1.3e-33; 192 aa overlap;
FT                   query 1-189; subject 31-216"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0427"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ44025"
FT                   /db_xref="GOA:B2FJY8"
FT                   /db_xref="InterPro:IPR019253"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJY8"
FT                   /protein_id="CAQ44025.1"
FT                   /translation="MLQHRKMCECTLATGERAGLPSRRFPRQERGCDMIEVLPAPDGSG
FT                   TQLRLRPPRALDARQFVLLFTVLSGAMWLVSALGWLAGNAFAPLFALLYSLVLAAALRA
FT                   LWRSGERQEEIRVVPAYVEVIPVPGGSPVFRAHPHWVRLLTDDERVRLASSGRQVEVGS
FT                   FLAPAERQTLAETLESLLAASDGGNRRR"
FT   misc_feature    order(440890..440958,440968..441027)
FT                   /locus_tag="Smlt0427"
FT                   /note="2 probable transmembrane helices predicted for
FT                   Smlt0427 by TMHMM2.0 at aa 61-83 and 87-106"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        441297..442262
FT                   /transl_table=11
FT                   /gene="ctaC"
FT                   /locus_tag="Smlt0428"
FT                   /product="putative cytochrome c oxidase subunit II"
FT                   /EC_number="1.9.3.1"
FT                   /note="similarity:fasta; SCO2156; scoelicolor; putative
FT                   cytochrome c oxidase subunit II; length 319 aa; id=30.3%; ;
FT                   E()=3.5e-05; 274 aa overlap; query 21-271 aa; subject
FT                   23-289 aa"
FT                   /note="similarity:fasta; with=UniProt:Q03736; Rhodobacter
FT                   sphaeroides (Rhodopseudomonas sphaeroides).; ctaC;
FT                   Cytochrome c oxidase subunit 2 precursor (EC 1.9.3.1)
FT                   (Cytochrome c oxidase polypeptide II) (Cytochrome aa3
FT                   subunit 2) (Oxidase aa(3) subunit 2).; length=303; id
FT                   34.219%; ungapped id 36.014%; E()=3e-30; 301 aa overlap;
FT                   query 1-289; subject 1-298"
FT                   /note="similarity:blastp; with=UniProt:Q8P478
FT                   (EMBL:AE012504;); Xanthomonas campestris pv. campestris.;
FT                   ctaC; Cytochrome C oxidase subunit II.; length=327;
FT                   E()=0e-113;"
FT                   /note="similarity:fasta; with=UniProt:Q8P478
FT                   (EMBL:AE012504;); Xanthomonas campestris pv. campestris.;
FT                   ctaC; Cytochrome C oxidase subunit II.; length=327; id
FT                   70.279%; ungapped id 71.609%; E()=5.9e-87; 323 aa overlap;
FT                   query 1-319; subject 1-321"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0428"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ44026"
FT                   /db_xref="GOA:B2FJY9"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR034210"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJY9"
FT                   /protein_id="CAQ44026.1"
FT                   /translation="MKQSSRWGTKCVNAVAAMLATGGLMPALAWAQAADPKPWQLNMGK
FT                   GVTQTSRLAWESNNLSLIICTVIGVIVFGAMAYAIFKFRKSKGAVAATFSHNTKAEIIW
FT                   TVIPVIILIVMAWPATANLIKMYDTRDAEMTVKVTGYQWMWKYEYLGENVTFTSRLDRE
FT                   SDRVRQSGIVPTRESHPHYLLDVDNRLVLPVDTKVRFVITSDDVIHAWWVPALGWKQDA
FT                   IPGFINEAWTRIEQPGVYRGQCAELCGKDHGFMPIVVEAVSKEDFRKWLAQRKPAPPAE
FT                   PATPAAPAEPTEPTAPTGEAPAAPAAAEAGSAPATAASGA"
FT   sig_peptide     441297..441389
FT                   /gene="ctaC"
FT                   /locus_tag="Smlt0428"
FT                   /note="Signal peptide predicted for Smlt0428 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.967 between residues 31 and 32"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(441330..441398,441471..441539,441600..441668)
FT                   /gene="ctaC"
FT                   /locus_tag="Smlt0428"
FT                   /note="3 probable transmembrane helices predicted for
FT                   Smlt0428 by TMHMM2.0 at aa 12-34, 59-81 and 102-124"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    441399..441650
FT                   /gene="ctaC"
FT                   /locus_tag="Smlt0428"
FT                   /note="HMMPfam hit to PF02790, Cytochrome C oxidase subunit
FT                   II, transmembra, score 1.2e-06"
FT                   /inference="protein motif:HMMPfam:PF02790"
FT   misc_feature    441696..442082
FT                   /gene="ctaC"
FT                   /locus_tag="Smlt0428"
FT                   /note="HMMPfam hit to PF00116, Cytochrome C oxidase subunit
FT                   II, periplasmic, score 3.8e-44"
FT                   /inference="protein motif:HMMPfam:PF00116"
FT   CDS_pept        442322..443929
FT                   /transl_table=11
FT                   /gene="ctaD"
FT                   /locus_tag="Smlt0429"
FT                   /product="putative cytochrome c oxidase polypeptide I"
FT                   /EC_number="1.9.3.1"
FT                   /note="similarity:fasta; BPSL0454; bpseudomallei;
FT                   cytochrome c oxidase polypeptide I; length 535 aa;
FT                   id=66.8%; ; E()=6.6e-135; 521 aa overlap; query 8-523 aa;
FT                   subject 14-534 aa"
FT                   /note="similarity:fasta; BPP4242; bparapertussis;
FT                   cytochrome c oxidase polypeptide I; length 535 aa;
FT                   id=66.9%; ; E()=6.8e-130; 520 aa overlap; query 7-524 aa;
FT                   subject 16-535 aa"
FT                   /note="similarity:fasta; BB4830; bbronchiseptica;
FT                   cytochrome c oxidase polypeptide I; length 535 aa;
FT                   id=66.9%; ; E()=5.8e-131; 520 aa overlap; query 7-524 aa;
FT                   subject 16-535 aa"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0429"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ44027"
FT                   /db_xref="GOA:B2FJZ0"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJZ0"
FT                   /protein_id="CAQ44027.1"
FT                   /translation="MAHSAVGHDDHHHHQSFFERWFFSTNHKDIGTLYLGFSFIMFIIG
FT                   AAMSVVIRAELAQPGLQFVKPEFFNQMTTVHALVMIFGGVMPAFVGLANWMIPLQIGAP
FT                   DMALPRMNNWSFWLLPVAFSLLLLTLFLPGGAPAGGWTLYPPLSLQGGYNVAFSVFAIH
FT                   VAGISSIMGAINIIATVLNMRAPGIDLLKMPIFCWAWLITAFLLIAVMPVLAGAVTMLL
FT                   TDKFFGTSFFNAAGGGDPVMYQHIFWFFGHPEVYIMILPAFGVVSEIIPTFSRKPLFGY
FT                   QAMVYATAAIAFLSFIVWAHHMFTVGMPLGGEIYFMFATMLISIPTGVKVFNWVSTMWR
FT                   GSLTFEAPMLWSVAFVILFTIGGFSGLMLAIVAADFQYHDTYFVVAHFHYVLVTGAVFA
FT                   LIAAVYYWWPKWTGRMYSEKWAKVHFWWSIVFVNLLFFPQHFLGLAGMPRRIPDYSVAF
FT                   ADWNLISSIGAFGMFVTPFMMAAILLSSLRNGEKAEARSWEGARGLEWTLPSPAPAHTF
FT                   TTPPTIRPGDLAHDDITH"
FT   misc_feature    442379..443737
FT                   /gene="ctaD"
FT                   /locus_tag="Smlt0429"
FT                   /note="HMMPfam hit to PF00115, Cytochrome C and Quinol
FT                   oxidase polypeptide, score 7.7e-256"
FT                   /inference="protein motif:HMMPfam:PF00115"
FT   misc_feature    order(442409..442477,442535..442603,442661..442729,
FT                   442787..442855,442916..442984,443063..443131,
FT                   443150..443218,443261..443329,443366..443434,
FT                   443477..443545,443594..443662,443705..443773)
FT                   /gene="ctaD"
FT                   /locus_tag="Smlt0429"
FT                   /note="12 probable transmembrane helices predicted for
FT                   Smlt0429 by TMHMM2.0 at aa 40-62, 82-104, 124-146, 166-188,
FT                   209-231, 258-280, 287-309, 324-346, 359-381, 396-418,
FT                   435-457 and 472-494"
FT                   /inference="protein motif:TMHMM:2.0"
FT   repeat_region   442694..442705
FT                   /rpt_unit_seq="(ctg)4"
FT   repeat_region   443820..443827
FT                   /rpt_unit_seq="(gc)4"
FT   CDS_pept        443938..444174
FT                   /transl_table=11
FT                   /locus_tag="Smlt0430"
FT                   /product="putative transmembrane protein"
FT                   /note="similarity:blastp; with=UniProt:Q8PFT7
FT                   (EMBL:AE012038;); Xanthomonas axonopodis pv. citri.;
FT                   Hypothetical protein XAC3886.; length=44; E()=5e-04;"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0430"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ44028"
FT                   /db_xref="GOA:B2FJZ1"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJZ1"
FT                   /protein_id="CAQ44028.1"
FT                   /translation="MHNESPLPIGRVDCQSTREVQPTSSRLYQSQSQSQSQTEAQRHGI
FT                   EQQRQRARRTAMWVGAIAVLVYVGFILSGVIGR"
FT   repeat_region   444021..444044
FT                   /rpt_unit_seq="(ccaaag)4"
FT   misc_feature    444100..444168
FT                   /locus_tag="Smlt0430"
FT                   /note="1 probable transmembrane helix predicted for
FT                   Smlt0430 by TMHMM2.0 at aa 59-81"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        444171..444761
FT                   /transl_table=11
FT                   /locus_tag="Smlt0431"
FT                   /product="putative putative cytochrome c oxidase assembly
FT                   protein"
FT                   /note="similarity:fasta; BPSL0456; bpseudomallei; putative
FT                   cytochrome c oxidase assembly protein; length 201 aa;
FT                   id=42.6%; ; E()=3.3e-28; 197 aa overlap; query 2-195 aa;
FT                   subject 4-197 aa"
FT                   /note="similarity:fasta; CAL0752; bcenocepacia; putative
FT                   cytochrome c oxidase assembly protein; length 203 aa;
FT                   id=42.5%; ; E()=4.7e-26; 193 aa overlap; query 3-192 aa;
FT                   subject 6-194 aa"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0431"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ44029"
FT                   /db_xref="GOA:B2FJZ2"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJZ2"
FT                   /protein_id="CAQ44029.1"
FT                   /translation="MSEAPASTPSRSAGLPRLIGVAVAVFLLTFSLVPLYRIACEKVFG
FT                   VRLERGPGSEASTGAATGKRTVRVEFDGGVNSRLPWSFHPEQLTMDVVPGELNEALYFA
FT                   RNDSQQAVVGSAVPSVAPARASGFFSKTECFCFTAQTLQAGEKRDMPVRFIVDPDLPPE
FT                   IKTITLSYTFYRNDALSDRLAPAATSEGAHAAP"
FT   misc_feature    444207..444275
FT                   /locus_tag="Smlt0431"
FT                   /note="1 probable transmembrane helix predicted for
FT                   Smlt0431 by TMHMM2.0 at aa 13-35"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    444264..444698
FT                   /locus_tag="Smlt0431"
FT                   /note="HMMPfam hit to PF04442, Cytochrome c oxidase
FT                   assembly protein Cta, score 1.5e-49"
FT                   /inference="protein motif:HMMPfam:PF04442"
FT   CDS_pept        444775..445650
FT                   /transl_table=11
FT                   /locus_tag="Smlt0432"
FT                   /product="putative cytochrome c oxidase, subunit III"
FT                   /note="similarity:fasta; BB4827; bbronchiseptica; putative
FT                   cytochrome c oxidase, subunit III; length 291 aa; id=53.5%;
FT                   ; E()=6.2e-59; 284 aa overlap; query 7-289 aa; subject
FT                   11-289 aa"
FT                   /note="similarity:fasta; BP3740; bpertussis; putative
FT                   cytochrome c oxidase, subunit III; length 291 aa; id=53.5%;
FT                   ; E()=3.3e-56; 284 aa overlap; query 7-289 aa; subject
FT                   11-289 aa"
FT                   /note="similarity:fasta; BPP4239; bparapertussis; putative
FT                   cytochrome c oxidase, subunit III; length 291 aa; id=53.5%;
FT                   ; E()=6e-59; 284 aa overlap; query 7-289 aa; subject 11-289
FT                   aa"
FT                   /note="similarity:fasta; CAL0754; bcenocepacia; putative
FT                   cytochrome c oxidase subunit III; length 285 aa; id=53.3%;
FT                   ; E()=1.1e-58; 289 aa overlap; query 3-291 aa; subject
FT                   6-285 aa"
FT                   /note="similarity:fasta; BPSL0458; bpseudomallei; putative
FT                   cytochrome c oxidase subunit III; length 285 aa; id=52.0%;
FT                   ; E()=5e-58; 281 aa overlap; query 11-291 aa; subject
FT                   10-285 aa"
FT                   /note="similarity:fasta; TW524; twhipplei; cytochrome c
FT                   oxidase subunit III; length 207 aa; id=32.9%; ;
FT                   E()=5.1e-13; 234 aa overlap; query 73-291 aa; subject 6-205
FT                   aa"
FT                   /note="similarity:blastp; with=UniProt:Q4UPT2
FT                   (EMBL:CP000050;); Xanthomonas campestris pv. campestris
FT                   (strain 8004).; Cytochrome C oxidase subunit III.;
FT                   length=291; E()=0e-134;"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0432"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ44030"
FT                   /db_xref="GOA:B2FJZ3"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJZ3"
FT                   /protein_id="CAQ44030.1"
FT                   /translation="MAQTPTDANVYFVPAQSKWPFVGSIAMMVTMVGVASWLNDASWGR
FT                   WTFYIGIAMLVLTLFWWFSDVVRESQAGNYNHQVDGSFRMGMIWFIFSEVMFFGAFFGA
FT                   LFYTRNLGLSWLSGEGRGVMTNELLWQGYSAGWPTNGPAAIGGAFQTIPAWGLPLINTL
FT                   ILLTSGVTLTIAHHALKAGNRRQLLIWLGLTVVLGLGFLTLQAEEYIHAYKELNLTLGS
FT                   GIYGSTFFMLTGFHGAHVLLGTIMLIVMWLRSAKGHFTRDNHFGFEAAAWYWHFVDVVW
FT                   LMLFMFVYVL"
FT   misc_feature    444805..445647
FT                   /locus_tag="Smlt0432"
FT                   /note="HMMPfam hit to PF00510, Cytochrome c oxidase subunit
FT                   III, score 1.8e-64"
FT                   /inference="protein motif:HMMPfam:PF00510"
FT   misc_feature    order(444835..444888,444898..444966,445027..445095,
FT                   445228..445296,445333..445401,445459..445527,
FT                   445585..445644)
FT                   /locus_tag="Smlt0432"
FT                   /note="7 probable transmembrane helices predicted for
FT                   Smlt0432 by TMHMM2.0 at aa 21-38, 42-64, 85-107, 152-174,
FT                   187-209, 229-251 and 271-290"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(445671..445889)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0433"
FT                   /product="putative transmembrane protein"
FT                   /note="similarity:fasta; BB4826; bbronchiseptica; putative
FT                   membrane protein; length 66 aa; id=40.9%; ; E()=6.2e-09; 66
FT                   aa overlap; query 5-70 aa; subject 1-65 aa"
FT                   /note="similarity:fasta; BP3739; bpertussis; putative
FT                   membrane protein; length 66 aa; id=40.9%; ; E()=1.2e-08; 66
FT                   aa overlap; query 5-70 aa; subject 1-65 aa"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0433"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ44031"
FT                   /db_xref="GOA:B2FJZ4"
FT                   /db_xref="InterPro:IPR021313"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJZ4"
FT                   /protein_id="CAQ44031.1"
FT                   /translation="MSDSLKTLLVIAFLIVIVWNLGAGLYYLLVDRGQTKRTVNALTRR
FT                   IAVSVVLILLVIVSIYMGWIKPHGIGG"
FT   misc_feature    complement(order(445695..445754,445800..445868))
FT                   /locus_tag="Smlt0433"
FT                   /note="2 probable transmembrane helices predicted for
FT                   Smlt0433 by TMHMM2.0 at aa 32-54 and 70-89"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        445947..446660
FT                   /transl_table=11
FT                   /locus_tag="Smlt0434"
FT                   /product="putative transmembrane protein"
FT                   /note="similarity:fasta; BPP4237; bparapertussis; putative
FT                   membrane protein; length 246 aa; id=34.4%; ; E()=0.073; 250
FT                   aa overlap; query 12-236 aa; subject 6-246 aa"
FT                   /note="similarity:fasta; CAL0756; bcenocepacia; putative
FT                   membrane protein; length 236 aa; id=31.0%; ; E()=1.5e-09;
FT                   239 aa overlap; query 9-237 aa; subject 3-231 aa"
FT                   /note="similarity:fasta; BPSL0459; bpseudomallei; putative
FT                   membrane protein; length 237 aa; id=31.1%; ; E()=1.5e-09;
FT                   241 aa overlap; query 9-237 aa; subject 3-231 aa"
FT                   /note="similarity:fasta; BP3738; bpertussis; putative
FT                   membrane protein; length 246 aa; id=34.0%; ; E()=0.037; 250
FT                   aa overlap; query 12-236 aa; subject 6-246 aa"
FT                   /note="similarity:fasta; BB4825; bbronchiseptica; putative
FT                   membrane protein; length 240 aa; id=33.7%; ; E()=0.083; 246
FT                   aa overlap; query 16-236 aa; subject 3-240 aa"
FT                   /note="similarity:fasta; CMS1969; Cms; putative
FT                   sortase-sorted surface protein; length 281 aa; id=30.0%; ;
FT                   E()=3.1e-05; 247 aa overlap; query 7-231 aa; subject 11-242
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0434"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ44032"
FT                   /db_xref="GOA:B2FJZ5"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJZ5"
FT                   /protein_id="CAQ44032.1"
FT                   /translation="MMRQHTRVIGWLLAVLAMVGFTALGLWQLQRMHAKQAMLDAQGPA
FT                   VAQALPLAQALVAPGALHGVADHGRFLPGVVLLDNQTRHGRAGVKIYRPFRSDEGSVLL
FT                   VDLGWRALPPDRRLPDVPSPPSPVAVRGLLAPPPSAGLALGPAFSATDEAGRWLASRLP
FT                   AEGLAAALGLPALPERVLRLDPALPFGDERDLDLLPNTLPPQRHLGYAVQWFGLALTVL
FT                   VVALVLEWRRRRAAR"
FT   sig_peptide     445947..446021
FT                   /locus_tag="Smlt0434"
FT                   /note="Signal peptide predicted for Smlt0434 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.984) with cleavage site
FT                   probability 0.776 between residues 25 and 26"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(445965..446033,446568..446636)
FT                   /locus_tag="Smlt0434"
FT                   /note="2 probable transmembrane helices predicted for
FT                   Smlt0434 by TMHMM2.0 at aa 7-29 and 208-230"
FT                   /inference="protein motif:TMHMM:2.0"
FT   repeat_region   446273..446280
FT                   /rpt_unit_seq="(gc)4"
FT   CDS_pept        446760..447338
FT                   /transl_table=11
FT                   /locus_tag="Smlt0435"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; BB4824; bbronchiseptica; putative
FT                   exported protein; length 206 aa; id=31.0%; ; E()=4.4; 203
FT                   aa overlap; query 4-189 aa; subject 1-200 aa"
FT                   /note="similarity:fasta; BPP4236; bparapertussis; putative
FT                   exported protein; length 206 aa; id=31.0%; ; E()=3.5; 203
FT                   aa overlap; query 4-189 aa; subject 1-200 aa"
FT                   /note="similarity:fasta; BP3737; bpertussis; putative
FT                   exported protein; length 206 aa; id=30.0%; ; E()=5.6; 203
FT                   aa overlap; query 4-189 aa; subject 1-200 aa"
FT                   /note="similarity:blastp; with=UniProt:Q5GV85
FT                   (EMBL:AE013598;); Xanthomonas oryzae pv. oryzae.;
FT                   Hypothetical protein.; length=191; E()=6e-48;"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0435"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ44033"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJZ6"
FT                   /protein_id="CAQ44033.1"
FT                   /translation="MPRMNTATSPQARGSGRRTLVLLFAVFFGAMALAAVLRFSGWQPT
FT                   GHRNAGQLLKPPVDLRQQAPTLANGQPYPWNPEARTWRLLVAPAGACDAQCVTLSQGLG
FT                   KVWQLFGHNADNVEILWLGTPPASIASLPALRPLAPSPALRAALPGVDDPAGLPVYVID
FT                   PNGFVIMRHAPGTDLGGLRKDMATLLKLK"
FT   sig_peptide     446760..446861
FT                   /locus_tag="Smlt0435"
FT                   /note="Signal peptide predicted for Smlt0435 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.978 between residues 34 and 35"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    446817..446885
FT                   /locus_tag="Smlt0435"
FT                   /note="1 probable transmembrane helix predicted for
FT                   Smlt0435 by TMHMM2.0 at aa 20-42"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        447349..448512
FT                   /transl_table=11
FT                   /locus_tag="Smlt0436"
FT                   /product="putative cytochrome oxidase assembly protein"
FT                   /note="similarity:fasta; CAL0758; bcenocepacia; putative
FT                   cytochrome oxidase assembly protein; length 370 aa;
FT                   id=35.8%; ; E()=6.4e-25; 374 aa overlap; query 13-383 aa;
FT                   subject 31-352 aa"
FT                   /note="similarity:fasta; BPSL0461; bpseudomallei; putative
FT                   cytochrome oxidase assembly protein; length 349 aa;
FT                   id=35.8%; ; E()=1.9e-24; 374 aa overlap; query 13-383 aa;
FT                   subject 10-331 aa"
FT                   /note="similarity:fasta; BAV3281; bavium; putative
FT                   cytochrome oxidase assembly protein; length 337 aa;
FT                   id=34.1%; ; E()=1.2e-21; 375 aa overlap; query 13-383 aa;
FT                   subject 8-326 aa"
FT                   /note="similarity:fasta; BB4823; bbronchiseptica; putative
FT                   cytochrome oxidase assembly protein; length 343 aa;
FT                   id=35.1%; ; E()=2.6e-21; 382 aa overlap; query 9-386 aa;
FT                   subject 4-330 aa"
FT                   /note="similarity:fasta; BPP4235; bparapertussis; putative
FT                   cytochrome oxidase assembly protein; length 343 aa;
FT                   id=35.4%; ; E()=2.1e-21; 378 aa overlap; query 13-386 aa;
FT                   subject 8-330 aa"
FT                   /note="similarity:fasta; BP3736; bpertussis; putative
FT                   cytochrome oxidase assembly protein; length 343 aa;
FT                   id=35.1%; ; E()=1.3e-22; 382 aa overlap; query 9-386 aa;
FT                   subject 4-330 aa"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0436"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ44034"
FT                   /db_xref="GOA:B2FJZ7"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJZ7"
FT                   /protein_id="CAQ44034.1"
FT                   /translation="MSLSARPALHRNFHRLAWFAMIMTASTIMFGAFVRLSDAGLSCPD
FT                   WPTCYGQATWPQHVEETIGHPAAEIRPLETHKAWREQVHRFLAGALGIEILTLALLATR
FT                   KRRFGSTAVVTACVLVAAGIPLYMMGWHGTASTLALIGEAILLIAALRWSNIDLARAAL
FT                   LTLAVVIFQALLGMWTVTLLLKPIVVMGHLLGGMLMFALLVWMAWRATHMPITLAEAPK
FT                   LKWVLRIGVAVLVTQIALGGWVSANYAALACGGGSASLDNFPRCANQWWPQHNFVEGFT
FT                   LWRGIGVDYEGGVLDGASRIAIQMAHRLFAVVVAVYLLWLGVRLFRLPSMRGWASALIA
FT                   LLVLQVTLGILNVKLALPLEVAVAHNGVAVALLFVLVSLLARLRAPD"
FT   sig_peptide     447349..447459
FT                   /locus_tag="Smlt0436"
FT                   /note="Signal peptide predicted for Smlt0436 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.890) with cleavage site
FT                   probability 0.583 between residues 37 and 38"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    447361..448494
FT                   /locus_tag="Smlt0436"
FT                   /note="HMMPfam hit to PF02628, Cytochrome oxidase assembly
FT                   protein, score 1.3e-05"
FT                   /inference="protein motif:HMMPfam:PF02628"
FT   misc_feature    order(447382..447450,447592..447651,447670..447738,
FT                   447748..447816,447835..447894,447904..447972,
FT                   448033..448101,448258..448326,448345..448401,
FT                   448429..448497)
FT                   /locus_tag="Smlt0436"
FT                   /note="10 probable transmembrane helices predicted for
FT                   Smlt0436 by TMHMM2.0 at aa 12-34, 82-101, 108-130, 134-156,
FT                   163-182, 186-208, 229-251, 304-326, 333-351 and 361-383"
FT                   /inference="protein motif:TMHMM:2.0"
FT   repeat_region   447823..447830
FT                   /rpt_unit_seq="(gc)4"
FT   CDS_pept        448517..449410
FT                   /transl_table=11
FT                   /locus_tag="Smlt0436A"
FT                   /product="putative cytochrome c oxidase assembly factor
FT                   protein"
FT                   /note="similarity:fasta; CAL0759; bcenocepacia; UbiA
FT                   prenyltransferase family protein; length 300 aa; id=52.9%;
FT                   ; E()=1.4e-50; 295 aa overlap; query 3-297 aa; subject
FT                   11-298 aa"
FT                   /note="similarity:fasta; BPP4234; bparapertussis; UbiA
FT                   prenyltransferase family protein; length 297 aa; id=52.4%;
FT                   ; E()=8.6e-48; 288 aa overlap; query 6-293 aa; subject
FT                   13-293 aa"
FT                   /note="similarity:fasta; BB4822; bbronchiseptica; UbiA
FT                   prenyltransferase family protein; length 297 aa; id=52.4%;
FT                   ; E()=1.1e-47; 288 aa overlap; query 6-293 aa; subject
FT                   13-293 aa"
FT                   /note="similarity:fasta; with=UniProt:Q2NYG1
FT                   (EMBL:AP008229;); Xanthomonas oryzae pv. oryzae (strain
FT                   MAFF 311018).; Cytochrome C oxidase assembly factor.;
FT                   length=298; id 86.644%; ungapped id 86.644%; E()=3.4e-88;
FT                   292 aa overlap; query 6-297; subject 6-297"
FT                   /note="similarity:blastp; with=UniProt:P08301
FT                   (EMBL:X05828;); E()=4e-49;"
FT                   /note="similarity:blastp; with=UniProt:Q5GV87
FT                   (EMBL:AE013598;); Xanthomonas oryzae pv. oryzae.; coxD;
FT                   Cytochrome C oxidase assembly factor.; length=300;
FT                   E()=0e-141;"
FT                   /note="similarity:blastp; with=UniProt:P08301; E()=4e-49;"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0436A"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ44035"
FT                   /db_xref="GOA:B2FJZ8"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJZ8"
FT                   /protein_id="CAQ44035.1"
FT                   /translation="MFSNYRQYWDLTKPKVVALIVFTALVGMVLAIPGVPSWEQVRAGV
FT                   LGFLGIWLAASAAAAINQLLDAHIDAQMARTSWRPLVVGKVKPWQVLVFAGVLIVLSMT
FT                   ILVLWVNLITAVLTFASLIGYAVIYTVYLKRATSQNIVIGGLAGAMPPMLGWAAVTGMQ
FT                   GSSDWAYSSLLVLIIFIWTPPHFWALAIFRREDYAKAEIPMLPVTHGVVHTRKQIMVYS
FT                   VVLALVCLLPYLVGMSGAFYLGGAIVLNAVFLWYAWRMLNPPDELFSMKMFYYSIVYLM
FT                   ALFAFLLVDHWILPWL"
FT   sig_peptide     448517..448609
FT                   /locus_tag="Smlt0436A"
FT                   /note="Signal peptide predicted for Smlt0436A by SignalP
FT                   2.0 HMM (Signal peptide probability 0.968) with cleavage
FT                   site probability 0.930 between residues 31 and 32"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        449557..450363
FT                   /transl_table=11
FT                   /locus_tag="Smlt0438"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:blastp; with=UniProt:Q0AQA7
FT                   (EMBL:CP000449;); Maricaulis maris (strain MCS10).;
FT                   Hypothetical protein.; length=285; E()=5e-16;"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0438"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ44036"
FT                   /db_xref="UniProtKB/TrEMBL:B2FJZ9"
FT                   /protein_id="CAQ44036.1"
FT                   /translation="MHSIFRWTTALLLALGVALTAHADDTAAQIRQHAGEHRLLVLGEF
FT                   HGTRETPLLVRQLVDDYSRNGPVLMALELPRAENPVLRDYLESDGGARARRHLHGRAFW
FT                   TVRDDQHDGRRSRDMLAMIEGLRVLKTQGRVIEVVGYDVNASSGGNQARDDFMAAELRR
FT                   LYRGLPDNARMLVLTGNVHAMLRRPEGMPPEMQRRPLASQLRDLDIYSVRLGALRGQAW
FT                   ACADRCMARPLPEQVAPRLRGDTHAERAYDLWVWMPELSVGTLVDP"
FT   sig_peptide     449557..449625
FT                   /locus_tag="Smlt0438"
FT                   /note="Signal peptide predicted for Smlt0438 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 1.000 between residues 23 and 24"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(450480..451451)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0439"
FT                   /product="putative symporter family protein"
FT                   /note="similarity:fasta; BPSL0324; bpseudomallei; putative
FT                   sodium bile acid symporter family protein; length 346 aa;
FT                   id=60.1%; ; E()=2.7e-67; 318 aa overlap; query 6-321 aa;
FT                   subject 4-321 aa"
FT                   /note="similarity:fasta; BB1920; bbronchiseptica; putative
FT                   exported protein; length 322 aa; id=57.6%; ; E()=2.2e-64;
FT                   316 aa overlap; query 6-321 aa; subject 5-320 aa"
FT                   /note="similarity:fasta; BP2790; bpertussis; putative
FT                   exported protein; length 322 aa; id=57.6%; ; E()=6e-62; 316
FT                   aa overlap; query 6-321 aa; subject 5-320 aa"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0439"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ44037"
FT                   /db_xref="GOA:B2FK00"
FT                   /db_xref="InterPro:IPR016833"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B2FK00"
FT                   /protein_id="CAQ44037.1"
FT                   /translation="MTRWWSRLRPDNFTLALLCTVGLASLLPMKGAAAIVLDDVTTVAI
FT                   AALFFLHGARLPRESIIGGMLHWRLHLTILACTFLLFPLLGLMFKPLSGWLLTPELYLG
FT                   VLFLCTLPSTVQSSIAFTSMARGNVPAAVCSASLSSILGVFLTPLLLTALAGTSGGVHD
FT                   PLHAIGGIMLQLLVPFVAGHLLRPWIAGWVEKQRALLRYTDQGTILLVVYSAFGEAVTE
FT                   GLWSKTPLLSLLAVAVVAAVLLGIAMPLITFIARRLRFNREDEIAIVFCGSKKSLATGV
FT                   PIAKVLFAGGSLGAIVLPVMIYHQIQLIVCGVIAQRYARRKP"
FT   misc_feature    complement(order(450507..450575,450588..450656,
FT                   450690..450758,450801..450860,450897..450959,
FT                   450987..451055,451089..451157,451185..451244,
FT                   451281..451334,451347..451415))
FT                   /locus_tag="Smlt0439"
FT                   /note="10 probable transmembrane helices predicted for
FT                   Smlt0439 by TMHMM2.0 at aa 13-35, 40-57, 70-89, 99-121,
FT                   133-155, 165-185, 198-217, 232-254, 266-288 and 293-315"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(450783..451328)
FT                   /locus_tag="Smlt0439"
FT                   /note="HMMPfam hit to PF01758, Sodium Bile acid symporter
FT                   family, score 0.00046"
FT                   /inference="protein motif:HMMPfam:PF01758"
FT   repeat_region   450857..450864
FT                   /rpt_unit_seq="(gc)4"
FT   repeat_region   451287..451294
FT                   /rpt_unit_seq="(gc)4"
FT   sig_peptide     complement(451353..451451)
FT                   /locus_tag="Smlt0439"
FT                   /note="Signal peptide predicted for Smlt0439 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.997) with cleavage site
FT                   probability 0.772 between residues 33 and 34"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(451480..451980)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0440"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; with=UniProt:Q8P490
FT                   (EMBL:AE012503;); Xanthomonas campestris pv. campestris.;
FT                   Hypothetical protein XCC3821.; length=166; id 56.970%;
FT                   ungapped id 59.119%; E()=4e-23; 165 aa overlap; query
FT                   1-162; subject 2-163"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0440"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ44038"
FT                   /db_xref="GOA:B2FK01"
FT                   /db_xref="InterPro:IPR005939"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:B2FK01"
FT                   /protein_id="CAQ44038.1"
FT                   /translation="MLLRLTCLLLLSLCLPLTALAEDASLNEVRPGLYAGGQPSAAQLQ
FT                   ALAAQGVRTVIDLRQPGEDRGFDETRVAESLGLRYVRIPVAGADGLDTANVRAVHLALQ
FT                   QSQGPVLLHCASGNRAGAVLGLVNARYEHASPEQALQLGQRAGLKSLEAATRQRLATPV
FT                   TSP"
FT   misc_feature    complement(451588..451908)
FT                   /locus_tag="Smlt0440"
FT                   /note="HMMPfam hit to PF04273, Protein of unknown function
FT                   (DUF442), score 6.1e-07"
FT                   /inference="protein motif:HMMPfam:PF04273"
FT   sig_peptide     complement(451918..451980)
FT                   /locus_tag="Smlt0440"
FT                   /note="Signal peptide predicted for Smlt0440 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.999 between residues 21 and 22"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(452008..453747)
FT                   /transl_table=11
FT                   /gene="dnaG"
FT                   /locus_tag="Smlt0441"
FT                   /product="putative DNA primase"
FT                   /note="similarity:fasta; YE3683; yenterocolitica; DNA
FT                   primase; length 582 aa; id=46.5%; ; E()=2.1e-103; 572 aa
FT                   overlap; query 3-570 aa; subject 4-574 aa"
FT                   /note="similarity:fasta; YPO0644; ypestis; DNA primase;
FT                   length 582 aa; id=46.3%; ; E()=8.5e-102; 572 aa overlap;
FT                   query 3-570 aa; subject 4-574 aa"
FT                   /note="similarity:fasta; ECA0681; ecarotovora_atroseptica;
FT                   DNA primase; length 584 aa; id=45.4%; ; E()=7.1e-97; 575 aa
FT                   overlap; query 3-570 aa; subject 4-576 aa"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0441"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ44039"
FT                   /db_xref="GOA:B2FK02"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013173"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:B2FK02"
FT                   /protein_id="CAQ44039.1"
FT                   /translation="MARIPDAFIDDLLARTDIVEVVGSRVPLKRQGKEYAARCPFHDER
FT                   SASFTVSPTKQFYHCFGCGAHGTAISFLMNYDRLEFLDAVDELAKRAGMEVPRNENPRS
FT                   PQQQDDSRELYSALDAAARFFQKNLESSDKARSYLDGRGVDEENRARFQIGYAPDGYSG
FT                   LRDALGKDERRMKLLDRAGLFSKNDRGHVYDKFRDRVMFPIFDRRGRVIAFGGRVFEKD
FT                   DGPKYLNSPETALFHKGRELYGLWQVRQANQKIERLIVVEGYMDVVSLFQFGVTQAVAT
FT                   LGTATTPDHAELLFRNAPDVFFCFDGDAAGRRAGWKALESVLPRMKDGRQAFFLFLPDG
FT                   EDPDTIVRKEGAEAFNERLKQATPLSQFFFDELTREINLGTLDGKARLAERAKPMLAQI
FT                   PDGAFGDLMKQQLAQLTGLGGTAQATRAPMPQRQPQRTIQPVAKRSLVRGAIAVLLQQP
FT                   SLALTLGGKHHFQGLRLPGVELLLELLGLVEQRPDISTGALLEHFDGREEQASLHTLAA
FT                   QTLPGTEASWTQELHDAVAQLEKQLLVQRLEELLAKQRQQGLDDTDKYELRELLKARAG
FT                   LRL"
FT   repeat_region   452024..452031
FT                   /rpt_unit_seq="(gc)4"
FT   misc_feature    complement(452035..452412)
FT                   /gene="dnaG"
FT                   /locus_tag="Smlt0441"
FT                   /note="HMMPfam hit to PF08278, DNA primase DnaG
FT                   DnaB-binding, score 7.5e-41"
FT                   /inference="protein motif:HMMPfam:PF08278"
FT   repeat_region   452466..452473
FT                   /rpt_unit_seq="(gc)4"
FT   misc_feature    complement(452734..452982)
FT                   /gene="dnaG"
FT                   /locus_tag="Smlt0441"
FT                   /note="HMMPfam hit to PF01751, Toprim domain, score
FT                   1.4e-24"
FT                   /inference="protein motif:HMMPfam:PF01751"
FT   repeat_region   452803..452824
FT                   /rpt_family="GC_rich"
FT                   /inference="nucleotide motif:RepeatScout"
FT   misc_feature    complement(453001..453378)
FT                   /gene="dnaG"
FT                   /locus_tag="Smlt0441"
FT                   /note="HMMPfam hit to PF08275, DNA primase catalytic core,
FT                   N-terminal, score 2.1e-62"
FT                   /inference="protein motif:HMMPfam:PF08275"
FT   repeat_region   453295..453302
FT                   /rpt_unit_seq="(gc)4"
FT   misc_feature    complement(453445..453738)
FT                   /gene="dnaG"
FT                   /locus_tag="Smlt0441"
FT                   /note="HMMPfam hit to PF01807, CHC2 zinc finger, score
FT                   2.7e-59"
FT                   /inference="protein motif:HMMPfam:PF01807"
FT   CDS_pept        complement(453808..454728)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0442"
FT                   /product="putative ribonuclease"
FT                   /note="similarity:fasta; CAM1016; bcenocepacia; putative
FT                   ribonuclease; length 317 aa; id=31.6%; ; E()=8.1e-23; 291
FT                   aa overlap; query 20-301 aa; subject 16-300 aa"
FT                   /note="similarity:fasta; BB0960; bbronchiseptica; serum
FT                   resistance protein; length 296 aa; id=33.1%; ; E()=6.5e-15;
FT                   266 aa overlap; query 38-292 aa; subject 33-296 aa"
FT                   /note="similarity:fasta; BP3493; bpertussis; serum
FT                   resistance protein; length 296 aa; id=33.1%; ; E()=2.1e-15;
FT                   266 aa overlap; query 38-292 aa; subject 33-296 aa"
FT                   /note="similarity:fasta; BPSS1678; bpseudomallei; putative
FT                   ribonuclease; length 307 aa; id=31.2%; ; E()=5.3e-21; 311
FT                   aa overlap; query 6-306 aa; subject 6-303 aa"
FT                   /note="similarity:fasta; BPP0866; bparapertussis; serum
FT                   resistance protein; length 296 aa; id=33.1%; ; E()=7.9e-15;
FT                   257 aa overlap; query 38-283 aa; subject 33-287 aa"
FT                   /note="similarity:fasta; BAV0578; bavium; BrkB; length 299
FT                   aa; id=31.0%; ; E()=3e-10; 277 aa overlap; query 19-276 aa;
FT                   subject 7-282 aa"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0442"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ44040"
FT                   /db_xref="GOA:B2FK03"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:B2FK03"
FT                   /protein_id="CAQ44040.1"
FT                   /translation="MVEPEPNVPVSLRKYIKRLQDSFPMAVAKRFVDVDVLTQAASVSF
FT                   YALLSMAPLLVLLLWLTASLYPPAQQALIDQISSVAGSSAATVAETVLKNADNQPDVGS
FT                   LAGVWSTLLLFVGATAVFAQLQNALNLIFRTSGERLEGLKAWLRKRVFSFGVVLALGFL
FT                   LILSMTATTVLQVAFAQLPSILPALGYVTSLLLYAVGFAFMYHYLPDRRVAWRQAFIGG
FT                   VITSALFALGRYGIGVYIATVAPGSAYGSMGALVISLVWIYYATVVFFVGALMTAVIDE
FT                   RLRARHHLAAAGIDPATASQVPDRG"
FT   repeat_region   453872..453879
FT                   /rpt_unit_seq="(cg)4"
FT   misc_feature    complement(453880..454635)
FT                   /locus_tag="Smlt0442"
FT                   /note="HMMPfam hit to PF03631, Ribonuclease BN-like family,
FT                   score 5.4e-68"
FT                   /inference="protein motif:HMMPfam:PF03631"
FT   misc_feature    complement(order(453895..453963,454006..454074,
FT                   454111..454179,454207..454275,454354..454422,
FT                   454543..454611))
FT                   /locus_tag="Smlt0442"
FT                   /note="6 probable transmembrane helices predicted for
FT                   Smlt0442 by TMHMM2.0 at aa 40-62, 103-125, 152-174,
FT                   184-206, 219-241 and 256-278"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(454834..455277)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0443"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:fasta; BPSS1757; bpseudomallei; conserved
FT                   hypothetical protein; length 148 aa; id=63.3%; ;
FT                   E()=1.7e-33; 147 aa overlap; query 1-147 aa; subject 1-147
FT                   aa"
FT                   /note="similarity:fasta; CAM0916; bcenocepacia; conserved
FT                   hypothetical protein; length 148 aa; id=58.9%; ;
FT                   E()=5.8e-31; 146 aa overlap; query 1-146 aa; subject 1-146
FT                   aa"
FT                   /note="similarity:fasta; NMA0501;
FT                   nmeningitidis_serogroupA_strainZ2491; conserved
FT                   hypothetical protein; length 148 aa; id=60.3%; ;
FT                   E()=1.2e-29; 146 aa overlap; query 1-146 aa; subject 1-146
FT                   aa"
FT                   /note="similarity:fasta; NMC1922;
FT                   nmeningitidis_serogroupC_strainFAM18; conserved
FT                   hypothetical protein; length 134 aa; id=58.3%; ;
FT                   E()=7.1e-26; 132 aa overlap; query 15-146 aa; subject 1-132
FT                   aa"
FT                   /note="similarity:fasta; BAV2033; bavium; conserved
FT                   hypothetical protein; length 153 aa; id=44.3%; ;
FT                   E()=2.5e-20; 149 aa overlap; query 2-147 aa; subject 5-153
FT                   aa"
FT                   /note="similarity:fasta; BB3092; bbronchiseptica; conserved
FT                   hypothetical protein; length 154 aa; id=46.3%; ;
FT                   E()=2.7e-20; 149 aa overlap; query 2-146 aa; subject 5-152
FT                   aa"
FT                   /note="similarity:fasta; BPP1636; bparapertussis; conserved
FT                   hypothetical protein; length 154 aa; id=45.3%; ;
FT                   E()=4.9e-20; 148 aa overlap; query 2-146 aa; subject 5-152
FT                   aa"
FT                   /note="similarity:fasta; BP2213; bpertussis; conserved
FT                   hypothetical protein; length 154 aa; id=46.3%; ;
FT                   E()=7.8e-20; 149 aa overlap; query 2-146 aa; subject 5-152
FT                   aa"
FT                   /note="similarity:fasta; Cj0573; cjejuni; hypothetical
FT                   protein Cj0573; length 147 aa; id=39.7%; ; E()=5.6e-18; 146
FT                   aa overlap; query 1-146 aa; subject 1-146 aa"
FT                   /note="similarity:fasta; CBO2952; cbotulinum; putative tRNA
FT                   modifying protein; length 148 aa; id=38.8%; ; E()=1.6e-16;
FT                   147 aa overlap; query 1-147 aa; subject 1-147 aa"
FT                   /note="similarity:fasta; BF0249; bfragilisNCTC9343;
FT                   conserved hypothetical protein; length 149 aa; id=37.8%; ;
FT                   E()=1.3e-15; 148 aa overlap; query 1-146 aa; subject 1-148
FT                   aa"
FT                   /note="similarity:fasta; SCO3581; scoelicolor; conserved
FT                   hypothetical protein; length 154 aa; id=35.8%; ;
FT                   E()=6.3e-13; 151 aa overlap; query 2-147 aa; subject 3-153
FT                   aa"
FT                   /note="similarity:fasta; DIP0297; cdiphtheriae; Conserved
FT                   hypothetical protein; length 154 aa; id=32.5%; ;
FT                   E()=1.2e-11; 151 aa overlap; query 3-147 aa; subject 4-154
FT                   aa"
FT                   /note="similarity:fasta; Rv3688c; mtuberculosis; CONSERVED
FT                   HYPOTHETICAL PROTEIN; length 154 aa; id=35.8%; ;
FT                   E()=3.1e-10; 151 aa overlap; query 3-146 aa; subject 4-154
FT                   aa"
FT                   /note="similarity:fasta; Mb3713c; mbovis; CONSERVED
FT                   HYPOTHETICAL PROTEIN; length 154 aa; id=35.8%; ;
FT                   E()=3.2e-10; 151 aa overlap; query 3-146 aa; subject 4-154
FT                   aa"
FT                   /note="similarity:blastp; with=UniProt:Q8PFV0; Xanthomonas
FT                   axonopodis pv. citri.; Hypothetical protein XAC3873.;
FT                   length=148; E()=1e-48;"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0443"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ44041"
FT                   /db_xref="GOA:B2FK04"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:B2FK04"
FT                   /protein_id="CAQ44041.1"
FT                   /translation="MSMKQQLTEDMKAAMKAGEKHKLGVIRLINAAIKQREVDERIELD
FT                   DTAVIAVLDKMVKQRKDSVSQYEAANREDLAEIERAEIVVIEAYLPAKMDEAEIVAAIQ
FT                   AAIAETGASGPADMGKLMGALKPKLAGQADMGLVSKLVKQLLA"
FT   misc_feature    complement(454840..455262)
FT                   /locus_tag="Smlt0443"
FT                   /note="HMMPfam hit to PF02637, GatB/Yqey domain, score
FT                   1.4e-49"
FT                   /inference="protein motif:HMMPfam:PF02637"
FT   CDS_pept        complement(455412..455627)
FT                   /transl_table=11
FT                   /gene="rpsU"
FT                   /locus_tag="Smlt0444"
FT                   /product="30S ribosomal protein S21"
FT                   /note="similarity:fasta; YE3682; yenterocolitica; 30S
FT                   ribosomal protein S21; length 71 aa; id=69.0%; ;
FT                   E()=2.6e-22; 71 aa overlap; query 1-71 aa; subject 1-71 aa"
FT                   /note="similarity:fasta; SDT3202; styphimuriumDT104; 30S
FT                   ribosomal subunit protein S21; length 71 aa; id=69.0%; ;
FT                   E()=8.7e-22; 71 aa overlap; query 1-71 aa; subject 1-71 aa"
FT                   /note="similarity:fasta; SEN3052; senteritidisPT4; 30S
FT                   ribosomal subunit protein S21; length 71 aa; id=69.0%; ;
FT                   E()=1e-21; 71 aa overlap; query 1-71 aa; subject 1-71 aa"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0444"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ44042"
FT                   /db_xref="GOA:B2FK05"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2FK05"
FT                   /protein_id="CAQ44042.1"
FT                   /translation="MPSVKVRENEPFEFALRRFKRTCEKAGVLAETRKREFYEKPTQER
FT                   KRKAAAAVKRQLRRSSRDVTKRQRLY"
FT   misc_feature    complement(455463..455624)
FT                   /gene="rpsU"
FT                   /locus_tag="Smlt0444"
FT                   /note="HMMPfam hit to PF01165, Ribosomal protein S21, score
FT                   4.4e-31"
FT                   /inference="protein motif:HMMPfam:PF01165"
FT   CDS_pept        455794..456819
FT                   /transl_table=11
FT                   /gene="gcp"
FT                   /locus_tag="Smlt0445"
FT                   /product="possible glycoprotease"
FT                   /product="probable o-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /note="similarity:fasta; SDT3201; styphimuriumDT104;
FT                   possible glycoprotease; length 337 aa; id=66.2%; ;
FT                   E()=6.3e-82; 340 aa overlap; query 1-340 aa; subject 1-336
FT                   aa"
FT                   /note="similarity:fasta; SEN3051; senteritidisPT4; possible
FT                   glycoprotease; length 337 aa; id=66.2%; ; E()=7.9e-84; 340
FT                   aa overlap; query 1-340 aa; subject 1-336 aa"
FT                   /note="similarity:fasta; ECA0683; ecarotovora_atroseptica;
FT                   O-sialoglycoprotein endopeptidase; length 337 aa; id=66.3%;
FT                   ; E()=2.3e-83; 341 aa overlap; query 1-341 aa; subject
FT                   1-337 aa"
FT                   /note="similarity:blastp; with=UniProt:P05852; Escherichia
FT                   coli.; gcp; Probable O-sialoglycoprotein endopeptidase (EC
FT                   3.4.24.57) (Glycoprotease).; length=337; E()=0e-111;"
FT                   /note="similarity:blastp; with=UniProt:Q3BNE2
FT                   (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
FT                   (strain 85-10).; gcp; O-sialoglycoprotein endopeptidase (EC
FT                   3.4.24.57).; length=353; E()=0e-151;"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0445"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ44043"
FT                   /db_xref="GOA:B2FK06"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2FK06"
FT                   /protein_id="CAQ44043.1"
FT                   /translation="MRVLGIESSCDETGVAVYDTGLSGSAALRAHAVYSQIALHAEYGG
FT                   VVPELASRDHVRKLLPLVRQTLAEAGLGVGDIDGVAYTAGPGLVGALLVGAGVARSLAW
FT                   ALEVPAVGVHHMEGHLLAPLMEDDPPEAPFVALLVSGGHTQLVAVDAIGQYRLLGETLD
FT                   DAAGEAFDKTAKLMGLPYPGGPQLARLAEQGTPGAYRFARPMTDRPGLDFSFSGLKTQV
FT                   LMAWRDSDQSEQTRADIARGFEDAVVETLSIKCERALEAAGTNVIVVAGGVGANKRLRA
FT                   RLQQMAERLGGRACFPRPALCTDNGAMIAFAGALRLQAGQYSPPKVDVTPRWDMATLPA
FT                   V"
FT   misc_feature    455872..456726
FT                   /gene="gcp"
FT                   /locus_tag="Smlt0445"
FT                   /note="HMMPfam hit to PF00814, Glycoprotease family, score
FT                   5.1e-75"
FT                   /inference="protein motif:HMMPfam:PF00814"
FT   repeat_region   456561..456568
FT                   /rpt_unit_seq="(gc)4"
FT   CDS_pept        complement(456853..457506)
FT                   /transl_table=11
FT                   /locus_tag="Smlt0446"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarity:blastp; with=UniProt:Q88B70
FT                   (EMBL:AE016853;); Pseudomonas syringae pv. tomato.;
FT                   Hypothetical protein.; length=225; E()=9e-39;"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0446"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ44044"
FT                   /db_xref="UniProtKB/TrEMBL:B2FK07"
FT                   /protein_id="CAQ44044.1"
FT                   /translation="MREQRILQAALSRPRWATYKRIAYRHCLDAASLYVWNMQMCGALL
FT                   SPLHVCEIVIRNAVAAALAHTFGPRWPWHPALLQRMPADGALSALQDIHRQADPRMDTP
FT                   EIIASLRLAFWQQLFTRRFEGAIWARGLKIALPNAPQDALSVVRTNIHADLDRIRHLRN
FT                   RIAHHEPILERDIGADLAAIGRLIHARCPHTLGWLQRHERATTVLAASPLAVHR"
FT   misc_feature    complement(456931..457419)
FT                   /locus_tag="Smlt0446"
FT                   /note="HMMPfam hit to PF07512, Protein of unknown function
FT                   (DUF1526), score 9.7e-44"
FT                   /inference="protein motif:HMMPfam:PF07512"
FT   CDS_pept        457861..458214
FT                   /transl_table=11
FT                   /gene="folB"
FT                   /locus_tag="Smlt0447"
FT                   /product="putative dihydroneopterin aldolase"
FT                   /EC_number="4.1.2.25"
FT                   /note="similarity:fasta; ECA3590; ecarotovora_atroseptica;
FT                   dihydroneopterin aldolase; length 118 aa; id=55.3%; ;
FT                   E()=2.3e-24; 114 aa overlap; query 1-114 aa; subject 2-115
FT                   aa"
FT                   /note="similarity:fasta; YE3679; yenterocolitica; putative
FT                   dihydroneopterin aldolase; length 119 aa; id=51.8%; ;
FT                   E()=3.6e-24; 114 aa overlap; query 1-114 aa; subject 1-114
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0447"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ44045"
FT                   /db_xref="GOA:B2FK08"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:B2FK08"
FT                   /protein_id="CAQ44045.1"
FT                   /translation="MDKVFIEGLTIDALIGIYDWERRIRQDLVFDLEMGFDNRRPAATD
FT                   DIAHTLNYKAVSKRLEQFVRESEFGLVETLAERCAQIVLDEFDVKWLRLKLSKPGAVRG
FT                   ARAVGVIIERTRD"
FT   misc_feature    457870..458208
FT                   /gene="folB"
FT                   /locus_tag="Smlt0447"
FT                   /note="HMMPfam hit to PF02152, Dihydroneopterin aldolase,
FT                   score 3.1e-40"
FT                   /inference="protein motif:HMMPfam:PF02152"
FT   repeat_region   458154..458182
FT                   /rpt_family="GC_rich"
FT                   /inference="nucleotide motif:RepeatScout"
FT   repeat_region   458171..458180
FT                   /rpt_unit_seq="(gc)5"
FT   repeat_region   complement(458236..458284)
FT                   /rpt_family="R=14"
FT                   /inference="nucleotide motif:RepeatScout"
FT   CDS_pept        458306..459577
FT                   /transl_table=11
FT                   /locus_tag="Smlt0448"
FT                   /product="putative mechanosensitive ion channel"
FT                   /note="similarity:fasta; CAM1754; bcenocepacia; putative
FT                   mchanosensitive ion channel; length 413 aa; id=47.5%; ;
FT                   E()=3e-62; 383 aa overlap; query 30-408 aa; subject 14-392
FT                   aa"
FT                   /note="similarity:fasta; BB2508; bbronchiseptica; putative
FT                   membrane transport protein; length 448 aa; id=44.7%; ;
FT                   E()=6.9e-60; 421 aa overlap; query 11-423 aa; subject 6-424
FT                   aa"
FT                   /note="similarity:fasta; BPP1434; bparapertussis; putative
FT                   membrane transport protein; length 448 aa; id=44.7%; ;
FT                   E()=5.1e-60; 421 aa overlap; query 11-423 aa; subject 6-424
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:Smlt0448"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ44046"
FT