(data stored in SCRATCH zone)

EMBL: AM747720

ID   AM747720; SV 1; circular; genomic DNA; STD; PRO; 3870082 BP.
XX
AC   AM747720;
XX
PR   Project:PRJNA339;
XX
DT   19-JUN-2008 (Rel. 96, Created)
DT   06-FEB-2015 (Rel. 123, Last updated, Version 8)
XX
DE   Burkholderia cenocepacia J2315 chromosome 1, complete genome
XX
KW   al0001 gene; sodium/hydrogen exchanger family protein.
XX
OS   Burkholderia cenocepacia J2315
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
XX
RN   [1]
RP   1-3870082
RA   Holden M.T.G.;
RT   ;
RL   Submitted (20-JUN-2007) to the INSDC.
RL   Holden M.T.G., The Pathogen Sequencing Unit, The Wellcome Trust Sanger
RL   Institute, The Wellcome Trust Genome Campus, CB10 1SA, UNITED KINGDOM.
XX
RN   [2]
RX   DOI; 10.1128/JB.01230-08.
RX   PUBMED; 18931103.
RA   Holden M.T., Seth-Smith H.M., Crossman L.C., Sebaihia M., Bentley S.D.,
RA   Cerdeno-Tarraga A.M., Thomson N.R., Bason N., Quail M.A., Sharp S.,
RA   Cherevach I., Churcher C., Goodhead I., Hauser H., Holroyd N., Mungall K.,
RA   Scott P., Walker D., White B., Rose H., Iversen P., Mil-Homens D.,
RA   Rocha E.P., Fialho A.M., Baldwin A., Dowson C., Barrell B.G., Govan J.R.,
RA   Vandamme P., Hart C.A., Mahenthiralingam E., Parkhill J.;
RT   "The genome of Burkholderia cenocepacia J2315, an epidemic pathogen of
RT   cystic fibrosis patients";
RL   J. Bacteriol. 191(1):261-277(2009).
XX
DR   MD5; 76f3d5ef76bf2038197cc3d461a5a669.
DR   BioSample; SAMEA1705928.
DR   EnsemblGenomes-Gn; BCAL0138.
DR   EnsemblGenomes-Gn; BCAL0168.
DR   EnsemblGenomes-Gn; BCAL0355.
DR   EnsemblGenomes-Gn; BCAL0411.
DR   EnsemblGenomes-Gn; BCAL0412.
DR   EnsemblGenomes-Gn; BCAL0414.
DR   EnsemblGenomes-Gn; BCAL0415.
DR   EnsemblGenomes-Gn; BCAL0615.
DR   EnsemblGenomes-Gn; BCAL0648.
DR   EnsemblGenomes-Gn; BCAL0810.
DR   EnsemblGenomes-Gn; BCAL0938.
DR   EnsemblGenomes-Gn; BCAL1014.
DR   EnsemblGenomes-Gn; BCAL1028.
DR   EnsemblGenomes-Gn; BCAL1082.
DR   EnsemblGenomes-Gn; BCAL1124a.
DR   EnsemblGenomes-Gn; BCAL1132.
DR   EnsemblGenomes-Gn; BCAL1140.
DR   EnsemblGenomes-Gn; BCAL1143.
DR   EnsemblGenomes-Gn; BCAL1143a.
DR   EnsemblGenomes-Gn; BCAL1169.
DR   EnsemblGenomes-Gn; BCAL1170.
DR   EnsemblGenomes-Gn; BCAL1184.
DR   EnsemblGenomes-Gn; BCAL1302.
DR   EnsemblGenomes-Gn; BCAL1303.
DR   EnsemblGenomes-Gn; BCAL1308.
DR   EnsemblGenomes-Gn; BCAL1312.
DR   EnsemblGenomes-Gn; BCAL1482.
DR   EnsemblGenomes-Gn; BCAL1558.
DR   EnsemblGenomes-Gn; BCAL1633.
DR   EnsemblGenomes-Gn; BCAL1672.
DR   EnsemblGenomes-Gn; BCAL1783.
DR   EnsemblGenomes-Gn; BCAL2066.
DR   EnsemblGenomes-Gn; BCAL2219.
DR   EnsemblGenomes-Gn; BCAL2279.
DR   EnsemblGenomes-Gn; BCAL2311.
DR   EnsemblGenomes-Gn; BCAL2476a.
DR   EnsemblGenomes-Gn; BCAL2477.
DR   EnsemblGenomes-Gn; BCAL2480.
DR   EnsemblGenomes-Gn; BCAL2496.
DR   EnsemblGenomes-Gn; BCAL2521.
DR   EnsemblGenomes-Gn; BCAL2526.
DR   EnsemblGenomes-Gn; BCAL2533.
DR   EnsemblGenomes-Gn; BCAL2535.
DR   EnsemblGenomes-Gn; BCAL2535A.
DR   EnsemblGenomes-Gn; BCAL2545a.
DR   EnsemblGenomes-Gn; BCAL2546a.
DR   EnsemblGenomes-Gn; BCAL2548.
DR   EnsemblGenomes-Gn; BCAL2562.
DR   EnsemblGenomes-Gn; BCAL2568.
DR   EnsemblGenomes-Gn; BCAL2574.
DR   EnsemblGenomes-Gn; BCAL2581.
DR   EnsemblGenomes-Gn; BCAL2588.
DR   EnsemblGenomes-Gn; BCAL2589.
DR   EnsemblGenomes-Gn; BCAL2591.
DR   EnsemblGenomes-Gn; BCAL2593.
DR   EnsemblGenomes-Gn; BCAL2601.
DR   EnsemblGenomes-Gn; BCAL2854.
DR   EnsemblGenomes-Gn; BCAL3075.
DR   EnsemblGenomes-Gn; BCAL3125.
DR   EnsemblGenomes-Gn; BCAL3195a.
DR   EnsemblGenomes-Gn; BCAL3223.
DR   EnsemblGenomes-Gn; BCAL3224.
DR   EnsemblGenomes-Gn; BCAL3248.
DR   EnsemblGenomes-Gn; BCAL3249.
DR   EnsemblGenomes-Gn; BCAL3259.
DR   EnsemblGenomes-Gn; BCAL3354.
DR   EnsemblGenomes-Gn; BCAL3517.
DR   EnsemblGenomes-Gn; EBG00000501072.
DR   EnsemblGenomes-Gn; EBG00000501073.
DR   EnsemblGenomes-Gn; EBG00000501074.
DR   EnsemblGenomes-Gn; EBG00000501075.
DR   EnsemblGenomes-Gn; EBG00000501076.
DR   EnsemblGenomes-Gn; EBG00000501077.
DR   EnsemblGenomes-Gn; EBG00000501078.
DR   EnsemblGenomes-Gn; EBG00000501079.
DR   EnsemblGenomes-Gn; EBG00000501080.
DR   EnsemblGenomes-Gn; EBG00000501081.
DR   EnsemblGenomes-Gn; EBG00000501082.
DR   EnsemblGenomes-Gn; EBG00000501083.
DR   EnsemblGenomes-Gn; EBG00000501084.
DR   EnsemblGenomes-Gn; EBG00000501085.
DR   EnsemblGenomes-Gn; EBG00000501086.
DR   EnsemblGenomes-Gn; EBG00000501087.
DR   EnsemblGenomes-Gn; EBG00000501088.
DR   EnsemblGenomes-Gn; EBG00000501089.
DR   EnsemblGenomes-Gn; EBG00000501090.
DR   EnsemblGenomes-Gn; EBG00000501091.
DR   EnsemblGenomes-Gn; EBG00000501092.
DR   EnsemblGenomes-Gn; EBG00000501093.
DR   EnsemblGenomes-Gn; EBG00000501094.
DR   EnsemblGenomes-Gn; EBG00000501095.
DR   EnsemblGenomes-Gn; EBG00000501096.
DR   EnsemblGenomes-Gn; EBG00000501097.
DR   EnsemblGenomes-Gn; EBG00000501098.
DR   EnsemblGenomes-Gn; EBG00000501099.
DR   EnsemblGenomes-Gn; EBG00000501100.
DR   EnsemblGenomes-Gn; EBG00000501101.
DR   EnsemblGenomes-Gn; EBG00000501102.
DR   EnsemblGenomes-Gn; EBG00000501103.
DR   EnsemblGenomes-Gn; EBG00000501104.
DR   EnsemblGenomes-Gn; EBG00000501105.
DR   EnsemblGenomes-Gn; EBG00000501106.
DR   EnsemblGenomes-Gn; EBG00000501107.
DR   EnsemblGenomes-Gn; EBG00000501108.
DR   EnsemblGenomes-Gn; EBG00000501109.
DR   EnsemblGenomes-Gn; EBG00000501110.
DR   EnsemblGenomes-Gn; EBG00000501111.
DR   EnsemblGenomes-Gn; EBG00000501112.
DR   EnsemblGenomes-Gn; EBG00000501113.
DR   EnsemblGenomes-Gn; EBG00000501114.
DR   EnsemblGenomes-Gn; EBG00000501115.
DR   EnsemblGenomes-Gn; EBG00000501116.
DR   EnsemblGenomes-Gn; EBG00000501117.
DR   EnsemblGenomes-Gn; EBG00000501118.
DR   EnsemblGenomes-Gn; EBG00000501119.
DR   EnsemblGenomes-Gn; EBG00000501120.
DR   EnsemblGenomes-Gn; EBG00000501121.
DR   EnsemblGenomes-Gn; EBG00000501122.
DR   EnsemblGenomes-Gn; EBG00000501123.
DR   EnsemblGenomes-Gn; EBG00000501124.
DR   EnsemblGenomes-Gn; EBG00000501125.
DR   EnsemblGenomes-Gn; EBG00000501126.
DR   EnsemblGenomes-Gn; EBG00000501127.
DR   EnsemblGenomes-Gn; EBG00000501128.
DR   EnsemblGenomes-Gn; EBG00000501129.
DR   EnsemblGenomes-Gn; EBG00000501130.
DR   EnsemblGenomes-Gn; EBG00000501131.
DR   EnsemblGenomes-Gn; EBG00000501132.
DR   EnsemblGenomes-Gn; EBG00000501133.
DR   EnsemblGenomes-Gn; EBG00000501134.
DR   EnsemblGenomes-Gn; EBG00000501135.
DR   EnsemblGenomes-Gn; EBG00000501136.
DR   EnsemblGenomes-Gn; EBG00000501137.
DR   EnsemblGenomes-Gn; EBG00000501138.
DR   EnsemblGenomes-Gn; EBG00000501139.
DR   EnsemblGenomes-Gn; EBG00000501140.
DR   EnsemblGenomes-Gn; EBG00000501141.
DR   EnsemblGenomes-Gn; EBG00000501142.
DR   EnsemblGenomes-Gn; EBG00000501143.
DR   EnsemblGenomes-Gn; EBG00000501144.
DR   EnsemblGenomes-Gn; EBG00000501145.
DR   EnsemblGenomes-Gn; EBG00000501146.
DR   EnsemblGenomes-Gn; EBG00000501147.
DR   EnsemblGenomes-Gn; EBG00000501148.
DR   EnsemblGenomes-Gn; EBG00000501149.
DR   EnsemblGenomes-Gn; EBG00001048752.
DR   EnsemblGenomes-Gn; EBG00001048753.
DR   EnsemblGenomes-Gn; EBG00001048754.
DR   EnsemblGenomes-Gn; EBG00001048755.
DR   EnsemblGenomes-Gn; EBG00001048756.
DR   EnsemblGenomes-Gn; EBG00001048757.
DR   EnsemblGenomes-Gn; EBG00001048758.
DR   EnsemblGenomes-Gn; EBG00001048759.
DR   EnsemblGenomes-Gn; EBG00001048760.
DR   EnsemblGenomes-Gn; EBG00001048761.
DR   EnsemblGenomes-Gn; EBG00001048762.
DR   EnsemblGenomes-Gn; EBG00001048763.
DR   EnsemblGenomes-Gn; EBG00001048764.
DR   EnsemblGenomes-Gn; EBG00001048765.
DR   EnsemblGenomes-Gn; EBG00001048766.
DR   EnsemblGenomes-Gn; EBG00001048767.
DR   EnsemblGenomes-Gn; EBG00001048768.
DR   EnsemblGenomes-Gn; EBG00001048769.
DR   EnsemblGenomes-Gn; EBG00001048770.
DR   EnsemblGenomes-Gn; EBG00001048771.
DR   EnsemblGenomes-Gn; EBG00001048772.
DR   EnsemblGenomes-Gn; EBG00001048773.
DR   EnsemblGenomes-Gn; EBG00001048774.
DR   EnsemblGenomes-Gn; EBG00001048775.
DR   EnsemblGenomes-Gn; EBG00001048776.
DR   EnsemblGenomes-Gn; EBG00001048777.
DR   EnsemblGenomes-Gn; EBG00001048778.
DR   EnsemblGenomes-Gn; EBG00001048779.
DR   EnsemblGenomes-Gn; EBG00001048780.
DR   EnsemblGenomes-Gn; EBG00001048781.
DR   EnsemblGenomes-Gn; EBG00001048782.
DR   EnsemblGenomes-Gn; EBG00001048783.
DR   EnsemblGenomes-Gn; EBG00001048784.
DR   EnsemblGenomes-Gn; EBG00001048785.
DR   EnsemblGenomes-Gn; EBG00001048786.
DR   EnsemblGenomes-Gn; EBG00001048787.
DR   EnsemblGenomes-Gn; EBG00001048788.
DR   EnsemblGenomes-Gn; EBG00001048789.
DR   EnsemblGenomes-Gn; EBG00001048790.
DR   EnsemblGenomes-Gn; EBG00001048791.
DR   EnsemblGenomes-Gn; EBG00001048792.
DR   EnsemblGenomes-Gn; EBG00001048793.
DR   EnsemblGenomes-Gn; EBG00001048794.
DR   EnsemblGenomes-Gn; EBG00001048795.
DR   EnsemblGenomes-Gn; EBG00001048796.
DR   EnsemblGenomes-Gn; EBG00001048797.
DR   EnsemblGenomes-Gn; EBG00001048798.
DR   EnsemblGenomes-Gn; EBG00001048799.
DR   EnsemblGenomes-Gn; EBG00001048800.
DR   EnsemblGenomes-Gn; EBG00001048801.
DR   EnsemblGenomes-Gn; EBG00001048802.
DR   EnsemblGenomes-Gn; EBG00001048803.
DR   EnsemblGenomes-Gn; EBG00001048804.
DR   EnsemblGenomes-Gn; EBG00001048805.
DR   EnsemblGenomes-Gn; EBG00001048806.
DR   EnsemblGenomes-Gn; EBG00001048807.
DR   EnsemblGenomes-Gn; EBG00001048808.
DR   EnsemblGenomes-Gn; EBG00001048809.
DR   EnsemblGenomes-Gn; EBG00001048810.
DR   EnsemblGenomes-Gn; EBG00001048811.
DR   EnsemblGenomes-Gn; EBG00001048812.
DR   EnsemblGenomes-Gn; EBG00001048813.
DR   EnsemblGenomes-Gn; EBG00001048814.
DR   EnsemblGenomes-Gn; EBG00001048815.
DR   EnsemblGenomes-Gn; EBG00001048816.
DR   EnsemblGenomes-Gn; EBG00001048817.
DR   EnsemblGenomes-Gn; EBG00001048818.
DR   EnsemblGenomes-Gn; EBG00001048819.
DR   EnsemblGenomes-Gn; EBG00001048820.
DR   EnsemblGenomes-Gn; EBG00001048821.
DR   EnsemblGenomes-Gn; EBG00001048822.
DR   EnsemblGenomes-Gn; EBG00001048823.
DR   EnsemblGenomes-Gn; EBG00001048824.
DR   EnsemblGenomes-Gn; EBG00001048825.
DR   EnsemblGenomes-Gn; EBG00001048826.
DR   EnsemblGenomes-Gn; EBG00001048827.
DR   EnsemblGenomes-Gn; EBG00001048828.
DR   EnsemblGenomes-Gn; EBG00001048829.
DR   EnsemblGenomes-Gn; EBG00001048830.
DR   EnsemblGenomes-Gn; EBG00001048831.
DR   EnsemblGenomes-Gn; EBG00001048832.
DR   EnsemblGenomes-Gn; EBG00001048833.
DR   EnsemblGenomes-Gn; EBG00001048834.
DR   EnsemblGenomes-Gn; EBG00001048835.
DR   EnsemblGenomes-Gn; EBG00001048836.
DR   EnsemblGenomes-Gn; EBG00001048837.
DR   EnsemblGenomes-Gn; EBG00001048838.
DR   EnsemblGenomes-Gn; EBG00001048839.
DR   EnsemblGenomes-Gn; EBG00001048840.
DR   EnsemblGenomes-Gn; EBG00001048841.
DR   EnsemblGenomes-Gn; EBG00001048842.
DR   EnsemblGenomes-Gn; EBG00001048843.
DR   EnsemblGenomes-Gn; EBG00001048844.
DR   EnsemblGenomes-Gn; EBG00001048845.
DR   EnsemblGenomes-Gn; EBG00001048846.
DR   EnsemblGenomes-Gn; EBG00001048847.
DR   EnsemblGenomes-Gn; EBG00001048848.
DR   EnsemblGenomes-Gn; EBG00001048849.
DR   EnsemblGenomes-Gn; EBG00001048850.
DR   EnsemblGenomes-Gn; EBG00001048851.
DR   EnsemblGenomes-Gn; EBG00001048852.
DR   EnsemblGenomes-Gn; EBG00001048853.
DR   EnsemblGenomes-Gn; EBG00001048854.
DR   EnsemblGenomes-Gn; EBG00001048855.
DR   EnsemblGenomes-Tr; BCAL0138.
DR   EnsemblGenomes-Tr; BCAL0168.
DR   EnsemblGenomes-Tr; BCAL0355.
DR   EnsemblGenomes-Tr; BCAL0411.
DR   EnsemblGenomes-Tr; BCAL0412.
DR   EnsemblGenomes-Tr; BCAL0414.
DR   EnsemblGenomes-Tr; BCAL0415.
DR   EnsemblGenomes-Tr; BCAL0615.
DR   EnsemblGenomes-Tr; BCAL0648.
DR   EnsemblGenomes-Tr; BCAL0810.
DR   EnsemblGenomes-Tr; BCAL0938.
DR   EnsemblGenomes-Tr; BCAL1014.
DR   EnsemblGenomes-Tr; BCAL1028.
DR   EnsemblGenomes-Tr; BCAL1082.
DR   EnsemblGenomes-Tr; BCAL1124a.
DR   EnsemblGenomes-Tr; BCAL1132.
DR   EnsemblGenomes-Tr; BCAL1140.
DR   EnsemblGenomes-Tr; BCAL1143.
DR   EnsemblGenomes-Tr; BCAL1143a.
DR   EnsemblGenomes-Tr; BCAL1169.
DR   EnsemblGenomes-Tr; BCAL1170.
DR   EnsemblGenomes-Tr; BCAL1184.
DR   EnsemblGenomes-Tr; BCAL1302.
DR   EnsemblGenomes-Tr; BCAL1303.
DR   EnsemblGenomes-Tr; BCAL1308.
DR   EnsemblGenomes-Tr; BCAL1312.
DR   EnsemblGenomes-Tr; BCAL1482.
DR   EnsemblGenomes-Tr; BCAL1558.
DR   EnsemblGenomes-Tr; BCAL1633.
DR   EnsemblGenomes-Tr; BCAL1672.
DR   EnsemblGenomes-Tr; BCAL1783.
DR   EnsemblGenomes-Tr; BCAL2066.
DR   EnsemblGenomes-Tr; BCAL2219.
DR   EnsemblGenomes-Tr; BCAL2279.
DR   EnsemblGenomes-Tr; BCAL2311.
DR   EnsemblGenomes-Tr; BCAL2476a.
DR   EnsemblGenomes-Tr; BCAL2477.
DR   EnsemblGenomes-Tr; BCAL2480.
DR   EnsemblGenomes-Tr; BCAL2496.
DR   EnsemblGenomes-Tr; BCAL2521.
DR   EnsemblGenomes-Tr; BCAL2526.
DR   EnsemblGenomes-Tr; BCAL2533.
DR   EnsemblGenomes-Tr; BCAL2535.
DR   EnsemblGenomes-Tr; BCAL2535A.
DR   EnsemblGenomes-Tr; BCAL2545a.
DR   EnsemblGenomes-Tr; BCAL2546a.
DR   EnsemblGenomes-Tr; BCAL2548.
DR   EnsemblGenomes-Tr; BCAL2562.
DR   EnsemblGenomes-Tr; BCAL2568.
DR   EnsemblGenomes-Tr; BCAL2574.
DR   EnsemblGenomes-Tr; BCAL2581.
DR   EnsemblGenomes-Tr; BCAL2588.
DR   EnsemblGenomes-Tr; BCAL2589.
DR   EnsemblGenomes-Tr; BCAL2591.
DR   EnsemblGenomes-Tr; BCAL2593.
DR   EnsemblGenomes-Tr; BCAL2601.
DR   EnsemblGenomes-Tr; BCAL2854.
DR   EnsemblGenomes-Tr; BCAL3075.
DR   EnsemblGenomes-Tr; BCAL3125.
DR   EnsemblGenomes-Tr; BCAL3195a.
DR   EnsemblGenomes-Tr; BCAL3223.
DR   EnsemblGenomes-Tr; BCAL3224.
DR   EnsemblGenomes-Tr; BCAL3248.
DR   EnsemblGenomes-Tr; BCAL3249.
DR   EnsemblGenomes-Tr; BCAL3259.
DR   EnsemblGenomes-Tr; BCAL3354.
DR   EnsemblGenomes-Tr; BCAL3517.
DR   EnsemblGenomes-Tr; EBG00000501072-1.
DR   EnsemblGenomes-Tr; EBG00000501073-1.
DR   EnsemblGenomes-Tr; EBG00000501074-1.
DR   EnsemblGenomes-Tr; EBG00000501075-1.
DR   EnsemblGenomes-Tr; EBG00000501076-1.
DR   EnsemblGenomes-Tr; EBG00000501077-1.
DR   EnsemblGenomes-Tr; EBG00000501078-1.
DR   EnsemblGenomes-Tr; EBG00000501079-1.
DR   EnsemblGenomes-Tr; EBG00000501080-1.
DR   EnsemblGenomes-Tr; EBG00000501081-1.
DR   EnsemblGenomes-Tr; EBG00000501082-1.
DR   EnsemblGenomes-Tr; EBG00000501083-1.
DR   EnsemblGenomes-Tr; EBG00000501084-1.
DR   EnsemblGenomes-Tr; EBG00000501085-1.
DR   EnsemblGenomes-Tr; EBG00000501086-1.
DR   EnsemblGenomes-Tr; EBG00000501087-1.
DR   EnsemblGenomes-Tr; EBG00000501088-1.
DR   EnsemblGenomes-Tr; EBG00000501089-1.
DR   EnsemblGenomes-Tr; EBG00000501090-1.
DR   EnsemblGenomes-Tr; EBG00000501091-1.
DR   EnsemblGenomes-Tr; EBG00000501092-1.
DR   EnsemblGenomes-Tr; EBG00000501093-1.
DR   EnsemblGenomes-Tr; EBG00000501094-1.
DR   EnsemblGenomes-Tr; EBG00000501095-1.
DR   EnsemblGenomes-Tr; EBG00000501096-1.
DR   EnsemblGenomes-Tr; EBG00000501097-1.
DR   EnsemblGenomes-Tr; EBG00000501098-1.
DR   EnsemblGenomes-Tr; EBG00000501099-1.
DR   EnsemblGenomes-Tr; EBG00000501100-1.
DR   EnsemblGenomes-Tr; EBG00000501101-1.
DR   EnsemblGenomes-Tr; EBG00000501102-1.
DR   EnsemblGenomes-Tr; EBG00000501103-1.
DR   EnsemblGenomes-Tr; EBG00000501104-1.
DR   EnsemblGenomes-Tr; EBG00000501105-1.
DR   EnsemblGenomes-Tr; EBG00000501106-1.
DR   EnsemblGenomes-Tr; EBG00000501107-1.
DR   EnsemblGenomes-Tr; EBG00000501108-1.
DR   EnsemblGenomes-Tr; EBG00000501109-1.
DR   EnsemblGenomes-Tr; EBG00000501110-1.
DR   EnsemblGenomes-Tr; EBG00000501111-1.
DR   EnsemblGenomes-Tr; EBG00000501112-1.
DR   EnsemblGenomes-Tr; EBG00000501113-1.
DR   EnsemblGenomes-Tr; EBG00000501114-1.
DR   EnsemblGenomes-Tr; EBG00000501115-1.
DR   EnsemblGenomes-Tr; EBG00000501116-1.
DR   EnsemblGenomes-Tr; EBG00000501117-1.
DR   EnsemblGenomes-Tr; EBG00000501118-1.
DR   EnsemblGenomes-Tr; EBG00000501119-1.
DR   EnsemblGenomes-Tr; EBG00000501120-1.
DR   EnsemblGenomes-Tr; EBG00000501121-1.
DR   EnsemblGenomes-Tr; EBG00000501122-1.
DR   EnsemblGenomes-Tr; EBG00000501123-1.
DR   EnsemblGenomes-Tr; EBG00000501124-1.
DR   EnsemblGenomes-Tr; EBG00000501125-1.
DR   EnsemblGenomes-Tr; EBG00000501126-1.
DR   EnsemblGenomes-Tr; EBG00000501127-1.
DR   EnsemblGenomes-Tr; EBG00000501128-1.
DR   EnsemblGenomes-Tr; EBG00000501129-1.
DR   EnsemblGenomes-Tr; EBG00000501130-1.
DR   EnsemblGenomes-Tr; EBG00000501131-1.
DR   EnsemblGenomes-Tr; EBG00000501132-1.
DR   EnsemblGenomes-Tr; EBG00000501133-1.
DR   EnsemblGenomes-Tr; EBG00000501134-1.
DR   EnsemblGenomes-Tr; EBG00000501135-1.
DR   EnsemblGenomes-Tr; EBG00000501136-1.
DR   EnsemblGenomes-Tr; EBG00000501137-1.
DR   EnsemblGenomes-Tr; EBG00000501138-1.
DR   EnsemblGenomes-Tr; EBG00000501139-1.
DR   EnsemblGenomes-Tr; EBG00000501140-1.
DR   EnsemblGenomes-Tr; EBG00000501141-1.
DR   EnsemblGenomes-Tr; EBG00000501142-1.
DR   EnsemblGenomes-Tr; EBG00000501143-1.
DR   EnsemblGenomes-Tr; EBG00000501144-1.
DR   EnsemblGenomes-Tr; EBG00000501145-1.
DR   EnsemblGenomes-Tr; EBG00000501146-1.
DR   EnsemblGenomes-Tr; EBG00000501147-1.
DR   EnsemblGenomes-Tr; EBG00000501148-1.
DR   EnsemblGenomes-Tr; EBG00000501149-1.
DR   EnsemblGenomes-Tr; EBT00001651084.
DR   EnsemblGenomes-Tr; EBT00001651085.
DR   EnsemblGenomes-Tr; EBT00001651086.
DR   EnsemblGenomes-Tr; EBT00001651087.
DR   EnsemblGenomes-Tr; EBT00001651088.
DR   EnsemblGenomes-Tr; EBT00001651089.
DR   EnsemblGenomes-Tr; EBT00001651090.
DR   EnsemblGenomes-Tr; EBT00001651091.
DR   EnsemblGenomes-Tr; EBT00001651092.
DR   EnsemblGenomes-Tr; EBT00001651093.
DR   EnsemblGenomes-Tr; EBT00001651094.
DR   EnsemblGenomes-Tr; EBT00001651095.
DR   EnsemblGenomes-Tr; EBT00001651096.
DR   EnsemblGenomes-Tr; EBT00001651097.
DR   EnsemblGenomes-Tr; EBT00001651098.
DR   EnsemblGenomes-Tr; EBT00001651099.
DR   EnsemblGenomes-Tr; EBT00001651100.
DR   EnsemblGenomes-Tr; EBT00001651101.
DR   EnsemblGenomes-Tr; EBT00001651102.
DR   EnsemblGenomes-Tr; EBT00001651103.
DR   EnsemblGenomes-Tr; EBT00001651104.
DR   EnsemblGenomes-Tr; EBT00001651105.
DR   EnsemblGenomes-Tr; EBT00001651106.
DR   EnsemblGenomes-Tr; EBT00001651107.
DR   EnsemblGenomes-Tr; EBT00001651108.
DR   EnsemblGenomes-Tr; EBT00001651109.
DR   EnsemblGenomes-Tr; EBT00001651110.
DR   EnsemblGenomes-Tr; EBT00001651111.
DR   EnsemblGenomes-Tr; EBT00001651112.
DR   EnsemblGenomes-Tr; EBT00001651113.
DR   EnsemblGenomes-Tr; EBT00001651114.
DR   EnsemblGenomes-Tr; EBT00001651115.
DR   EnsemblGenomes-Tr; EBT00001651116.
DR   EnsemblGenomes-Tr; EBT00001651117.
DR   EnsemblGenomes-Tr; EBT00001651118.
DR   EnsemblGenomes-Tr; EBT00001651119.
DR   EnsemblGenomes-Tr; EBT00001651120.
DR   EnsemblGenomes-Tr; EBT00001651121.
DR   EnsemblGenomes-Tr; EBT00001651122.
DR   EnsemblGenomes-Tr; EBT00001651123.
DR   EnsemblGenomes-Tr; EBT00001651124.
DR   EnsemblGenomes-Tr; EBT00001651125.
DR   EnsemblGenomes-Tr; EBT00001651126.
DR   EnsemblGenomes-Tr; EBT00001651127.
DR   EnsemblGenomes-Tr; EBT00001651128.
DR   EnsemblGenomes-Tr; EBT00001651129.
DR   EnsemblGenomes-Tr; EBT00001651130.
DR   EnsemblGenomes-Tr; EBT00001651131.
DR   EnsemblGenomes-Tr; EBT00001651132.
DR   EnsemblGenomes-Tr; EBT00001651133.
DR   EnsemblGenomes-Tr; EBT00001651134.
DR   EnsemblGenomes-Tr; EBT00001651135.
DR   EnsemblGenomes-Tr; EBT00001651136.
DR   EnsemblGenomes-Tr; EBT00001651137.
DR   EnsemblGenomes-Tr; EBT00001651138.
DR   EnsemblGenomes-Tr; EBT00001651139.
DR   EnsemblGenomes-Tr; EBT00001651140.
DR   EnsemblGenomes-Tr; EBT00001651141.
DR   EnsemblGenomes-Tr; EBT00001651142.
DR   EnsemblGenomes-Tr; EBT00001651143.
DR   EnsemblGenomes-Tr; EBT00001651144.
DR   EnsemblGenomes-Tr; EBT00001651145.
DR   EnsemblGenomes-Tr; EBT00001651146.
DR   EnsemblGenomes-Tr; EBT00001651147.
DR   EnsemblGenomes-Tr; EBT00001651148.
DR   EnsemblGenomes-Tr; EBT00001651149.
DR   EnsemblGenomes-Tr; EBT00001651150.
DR   EnsemblGenomes-Tr; EBT00001651151.
DR   EnsemblGenomes-Tr; EBT00001651152.
DR   EnsemblGenomes-Tr; EBT00001651153.
DR   EnsemblGenomes-Tr; EBT00001651154.
DR   EnsemblGenomes-Tr; EBT00001651155.
DR   EnsemblGenomes-Tr; EBT00001651156.
DR   EnsemblGenomes-Tr; EBT00001651157.
DR   EnsemblGenomes-Tr; EBT00001651158.
DR   EnsemblGenomes-Tr; EBT00001651159.
DR   EnsemblGenomes-Tr; EBT00001651160.
DR   EnsemblGenomes-Tr; EBT00001651161.
DR   EnsemblGenomes-Tr; EBT00001651162.
DR   EnsemblGenomes-Tr; EBT00001651163.
DR   EnsemblGenomes-Tr; EBT00001651164.
DR   EnsemblGenomes-Tr; EBT00001651165.
DR   EnsemblGenomes-Tr; EBT00001651166.
DR   EnsemblGenomes-Tr; EBT00001651167.
DR   EnsemblGenomes-Tr; EBT00001651168.
DR   EnsemblGenomes-Tr; EBT00001651169.
DR   EnsemblGenomes-Tr; EBT00001651170.
DR   EnsemblGenomes-Tr; EBT00001651171.
DR   EnsemblGenomes-Tr; EBT00001651172.
DR   EnsemblGenomes-Tr; EBT00001651173.
DR   EnsemblGenomes-Tr; EBT00001651174.
DR   EnsemblGenomes-Tr; EBT00001651175.
DR   EnsemblGenomes-Tr; EBT00001651176.
DR   EnsemblGenomes-Tr; EBT00001651177.
DR   EnsemblGenomes-Tr; EBT00001651178.
DR   EnsemblGenomes-Tr; EBT00001651179.
DR   EnsemblGenomes-Tr; EBT00001651180.
DR   EnsemblGenomes-Tr; EBT00001651181.
DR   EnsemblGenomes-Tr; EBT00001651182.
DR   EnsemblGenomes-Tr; EBT00001651183.
DR   EnsemblGenomes-Tr; EBT00001651184.
DR   EnsemblGenomes-Tr; EBT00001651185.
DR   EnsemblGenomes-Tr; EBT00001651186.
DR   EnsemblGenomes-Tr; EBT00001651187.
DR   EuropePMC; PMC2612433; 18931103.
DR   EuropePMC; PMC4029289; 24883196.
DR   EuropePMC; PMC4143217; 25153194.
DR   EuropePMC; PMC4603805; 26462475.
DR   EuropePMC; PMC4993015; 27597847.
DR   EuropePMC; PMC5688073; 29142288.
DR   EuropePMC; PMC5749847; 29293658.
DR   EuropePMC; PMC5987112; 29896180.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01070; sucA.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01760; traJ-II.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01811; PtaRNA1.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02005; group-II-D1D4-6.
DR   RFAM; RF02276; Hammerhead_II.
DR   RFAM; RF02278; Betaproteobacteria_toxic_sRNA.
DR   SILVA-LSU; AM747720.
DR   SILVA-SSU; AM747720.
DR   StrainInfo; 322838; 1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3870082
FT                   /organism="Burkholderia cenocepacia J2315"
FT                   /chromosome="1"
FT                   /strain="J2315"
FT                   /mol_type="genomic DNA"
FT                   /country="United Kingdom:Edinburgh"
FT                   /isolation_source="cystic fibrosis patient"
FT                   /note="representative of the ET12 epidemic lineage"
FT                   /db_xref="taxon:216591"
FT   CDS_pept        431..1645
FT                   /transl_table=11
FT                   /locus_tag="BCAL0001"
FT                   /product="sodium/hydrogen exchanger family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAO00536"
FT                   /db_xref="GOA:B3KYE3"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B3KYE3"
FT                   /protein_id="CAO00536.1"
FT                   /translation="MKSAFSFLPNWPLTPDAVFWAGLALFAAGLCGELCYRAWRLPRIT
FT                   GYAVIGLIAGSFGFGVIDASTDETSRLLMDVALGLLLFELGSRLDLRWIRRNPWLVASS
FT                   LAEATLTFVLVLFVMLALGVSGMVALVLSAIAIATSPSMVIQLKTELRAEGQVSQRLIT
FT                   LTALNSVYAIVLTKLVTSWLHQEAYGNVFATILQPLYLLAGSFIVAYLVARSCNYLFRH
FT                   MTATMRDEHSFVALFGLVMLAIAVAQALKLSTLLTLLLAGIIVKNLEARPQLWPEHFGT
FT                   AGWLLTVVLFVLTLTSFTWGDIALGGLLAIVLIVTRLVAKLAGVVAFAKPSGLGMKQGV
FT                   ALGIALTPMSALSYLLVDDTYQLYPNFDPHLRAIVMCSIVILQLVSPFVVYRCLSAVGE
FT                   RSDGN"
FT   misc_feature    join(473..541,560..628,770..838,899..958,1001..1069,
FT                   1127..1222,1265..1333,1346..1414,1442..1501,1535..1603)
FT                   /locus_tag="BCAL0001"
FT                   /note="10 probable transmembrane helices predicted for
FT                   BCAL0001 by TMHMM2.0 at aa 15-37, 44-66, 114-136, 157-176,
FT                   191-213, 233-264, 279-301, 306-328, 338-357 and 369-391"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    479..1603
FT                   /locus_tag="BCAL0001"
FT                   /note="HMMPfam hit to PF00999, Sodium/hydrogen exchanger
FT                   family, score 8.4e-11"
FT                   /inference="protein motif:HMMPfam:PF00999"
FT   CDS_pept        1660..2775
FT                   /transl_table=11
FT                   /locus_tag="BCAL0002"
FT                   /product="carboxylate-amine ligase YbdK"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50307"
FT                   /db_xref="GOA:B4E558"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E558"
FT                   /protein_id="CAR50307.1"
FT                   /translation="MALETFVNSEPFTFGVELEIQVVNTHNYDLTKAASDLMRLIQGET
FT                   FPGNITPEITESMIELSTGICHSHEQAVSELHAIRDVLVKAADQLNVGLAGGGTHAFQQ
FT                   WSDRQIYDAPRFQYISELYGYLAKQFTVFGQHVHIGCPDPDSALFLLHSMSRFIPHFIA
FT                   LSASSPFVQNVDTGFHSARLNSVFAFPLSGRAPFVLTWDSFEEYFTKMVNTGVVNSMKD
FT                   FYWDIRPKPGYGTIEVRVMDTPLSVDRAAAIACYIQTLARYLLTDRPLKLSEDDYLVYT
FT                   FNRFEACRFGLEGTCVNPQTGERRTIAEDILDTLDRIAPHAAALGSRAALDEIGALAKA
FT                   RVNDASWLRTVFKQEKSLNETVRQQCLRWRE"
FT   misc_feature    1696..2535
FT                   /locus_tag="BCAL0002"
FT                   /note="HMMPfam hit to PF04107, Glutamate-cysteine ligase
FT                   family 2(GCS2), score 1.3e-60"
FT                   /inference="protein motif:HMMPfam:PF04107"
FT   CDS_pept        3283..3921
FT                   /transl_table=11
FT                   /locus_tag="BCAL0003"
FT                   /product="MarR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50308"
FT                   /db_xref="GOA:B4E559"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4E559"
FT                   /protein_id="CAR50308.1"
FT                   /translation="MSEGVYGNQAAGRVTHSLLRLSTAMRSEAWDWAEGAGLTPTQGEI
FT                   LVLLLQRKGPMRLGEIARETQLTAATTSDAVSTLETKGLVEKRRALDDGRALAVRLSAR
FT                   GRTAAKKALQWPEFLTKAVGKLGADEQGTLYRALLKTLRELQVAGATPPQRMCLTCTHF
FT                   QPGKPSKKTVHHCAALDIAMSDSDLRLDCSVQEEADAATQKKTWKIFAG"
FT   misc_feature    3394..3606
FT                   /locus_tag="BCAL0003"
FT                   /note="HMMPfam hit to PF01047, MarR family, score 1.1e-12"
FT                   /inference="protein motif:HMMPfam:PF01047"
FT   misc_feature    3397..3543
FT                   /locus_tag="BCAL0003"
FT                   /note="HMMPfam hit to PF01022, Bacterial regulatory
FT                   protein, arsR family, score 1.4e-05"
FT                   /inference="protein motif:HMMPfam:PF01022"
FT   CDS_pept        3950..4660
FT                   /transl_table=11
FT                   /locus_tag="BCAL0004"
FT                   /product="cysteine peptidase, family C26"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50309"
FT                   /db_xref="GOA:B4E560"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B4E560"
FT                   /protein_id="CAR50309.1"
FT                   /translation="MNAEVVAIRHVHFEDLGSFEQVLGERGRRVRYVDVGSSRVEVLDV
FT                   LEPSLLVVLGGPLSVYDDAQYPTIAPLLALVRQRIDAGLPILGICLGAQFIARALGARV
FT                   YPAAQHELGWAPLTLTDAGRASPLRHLDGATTSMLHWHGDTFDLPGGAIHLASTPACRH
FT                   QAFAWGQHVLALQCHPEIRTDRFEPWLIANAGEIAATPGVDARQLRADTAQHGPVLEAA
FT                   ARRMFAEWLGSVGL"
FT   misc_feature    3983..4543
FT                   /locus_tag="BCAL0004"
FT                   /note="HMMPfam hit to PF00117, Glutamine amidotransferase
FT                   class-I, score 4.3e-13"
FT                   /inference="protein motif:HMMPfam:PF00117"
FT   misc_feature    4202..4237
FT                   /note="PS00442 Glutamine amidotransferases class-I active
FT                   site."
FT                   /inference="protein motif:Prosite:PS00442"
FT   CDS_pept        4871..5983
FT                   /transl_table=11
FT                   /locus_tag="BCAL0005"
FT                   /product="putative NADH-dependent flavin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50310"
FT                   /db_xref="GOA:B4E561"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B4E561"
FT                   /protein_id="CAR50310.1"
FT                   /translation="MTALFSPFTLRGVTLPNRIVISPMCQYSAERGEATDWHMIHLGHL
FT                   ALSGAGLLCIEATAVEPDGRITHGDLGLWDDVTEAALKPVLAAIRKHSPVRIAMQLSHA
FT                   GRKASSAAPWEGGQLVPVADGGWLPHGPSAVPHKDGETPPLALDAAGLNRIREAFAASA
FT                   KRAARLGIDAIEVHAAHGYLLHQFLSPLANQRTDEYGGSRDNRMRFPLEIFEIVRAAFP
FT                   EDQPVGVRVSATDWVEGGWELDDTIAFAHELKRRGCDWIDVSSGGVSPLQKIPLSPGYQ
FT                   VPFAQAVKRAVGMPTIAVGLINEPAHANRLIEAGDADFVAMARAMLYDPRWPWHAAAEL
FT                   GAQVTAPPQYWRSQPREHKALFGDVAFGQR"
FT   misc_feature    4877..5899
FT                   /locus_tag="BCAL0005"
FT                   /note="HMMPfam hit to PF00724, NADH:flavin oxidoreductase /
FT                   NADH oxidas, score 4.2e-68"
FT                   /inference="protein motif:HMMPfam:PF00724"
FT   CDS_pept        6161..6691
FT                   /transl_table=11
FT                   /locus_tag="BCAL0006"
FT                   /product="putative protein lysine methyltransferase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50311"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR003616"
FT                   /db_xref="UniProtKB/TrEMBL:B4E562"
FT                   /protein_id="CAR50311.1"
FT                   /translation="MSSRRIAVRRSGVHGKGVFAVAPIKAGERVVEYKGERISWKEALR
FT                   RHPHDPSEPNHTFYFALDEGGVIDGKIDGNSARWINHSCAPNCEAEEVKGRVYIHALRD
FT                   IEPEEELFYDYGLVIDAKLTKKLKREYACHCGAESCRGTLLATSDEGGKKKKKKDKKDG
FT                   KSASGSKDKKHKK"
FT   misc_feature    6161..6529
FT                   /locus_tag="BCAL0006"
FT                   /note="HMMPfam hit to PF00856, SET domain, score 1.3e-24"
FT                   /inference="protein motif:HMMPfam:PF00856"
FT   CDS_pept        complement(6845..8329)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0007"
FT                   /product="two-component regulatory system, sensor kinase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50312"
FT                   /db_xref="GOA:B4E563"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4E563"
FT                   /protein_id="CAR50312.1"
FT                   /translation="MSPDPAVTTSLRRSLLRRLAAPLSMLALMSGLIAYWLAWQYTQHV
FT                   IDRSLADLATAISKQIQIAGPDAPFTVPPLAQAMFSDPAEALIYRISDGEQELAGDPKL
FT                   PLQGINVRRMHHAYVFEAEYDNRAVRVAQVRVDDVEGGKPMVVEVAQPVRHRYRIAAEF
FT                   LVAIMMPLLLLLLAGWGIVWRVVNQQLGPLTHLADSLNRQTHTSLEPVDETDVPLEIRP
FT                   LTSAMNALLGRLKTALDAQRKFIADAAHQLRTPLTAVKLHAEQAAVARDPHQTFAAVRE
FT                   LRAAADRAVRLSNQLLSLARAEPGEQAARFVDVDLAAMAFETGAEWVPRALASHVDLGF
FT                   QRSDDPGDDEKLIVRGNPVLLREVIANLLDNALKYVPLARPDGARITVNVARAALEGNQ
FT                   PAAEIVVEDNGPGVPANQQADLFKRFFRGDAQSGNGVETGAGLGLAIVHDIIAMHGGTV
FT                   SYEDAPEGGSRFVVRVPLAARTEKPASETPAAAPTH"
FT   misc_feature    complement(6899..7264)
FT                   /locus_tag="BCAL0007"
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HSP90, score 2.6e-36"
FT                   /inference="protein motif:HMMPfam:PF02518"
FT   misc_feature    complement(7415..7612)
FT                   /locus_tag="BCAL0007"
FT                   /note="HMMPfam hit to PF00512, His Kinase A
FT                   (phosphoacceptor) domain, score 3.6e-14"
FT                   /inference="protein motif:HMMPfam:PF00512"
FT   misc_feature    complement(7622..7831)
FT                   /locus_tag="BCAL0007"
FT                   /note="HMMPfam hit to PF00672, HAMP domain, score 2.7e-06"
FT                   /inference="protein motif:HMMPfam:PF00672"
FT   misc_feature    complement(join(7781..7849,8213..8272))
FT                   /locus_tag="BCAL0007"
FT                   /note="2 probable transmembrane helices predicted for
FT                   BCAL0007 by TMHMM2.0 at aa 20-39 and 161-183"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(7838..8266)
FT                   /locus_tag="BCAL0007"
FT                   /note="HMMPfam hit to PF08521, Two-component sensor kinase
FT                   N-terminal, score 3.8e-48"
FT                   /inference="protein motif:HMMPfam:PF08521"
FT   sig_peptide     complement(8228..8329)
FT                   /locus_tag="BCAL0007"
FT                   /note="Signal peptide predicted for BCAL0007 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.871) with cleavage site
FT                   probability 0.792 between residues 34 and 35"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(8450..9142)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0008"
FT                   /product="two-component regulatory system, response
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50313"
FT                   /db_xref="GOA:B4E564"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B4E564"
FT                   /protein_id="CAR50313.1"
FT                   /translation="MRLLLIEDDRPIARGIQSSLEQAGFTVDMVHDGIFAEQALAQNRH
FT                   ELVILDLGLPGIDGMTLLTRFRQTNRHTPVIVLTARDELNDRIQGLNSGADDYMLKPFE
FT                   PAELEARIRAVMRRSGPHSDMPRPEVSLGGVRLSGVDRRIFNDDKPLELSPREFAVLEM
FT                   LLLRHGRVVSKAQLQDHLTHFGGDLGDTAIEVYVHRVRKKLEQCRVEIVTVRGFGYLLQ
FT                   EIRQTASV"
FT   misc_feature    complement(8480..8701)
FT                   /locus_tag="BCAL0008"
FT                   /note="HMMPfam hit to PF00486, Transcriptional regulatory
FT                   protein, C te, score 1.5e-22"
FT                   /inference="protein motif:HMMPfam:PF00486"
FT   misc_feature    complement(8804..9142)
FT                   /locus_tag="BCAL0008"
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 6.5e-36"
FT                   /inference="protein motif:HMMPfam:PF00072"
FT   CDS_pept        9265..9495
FT                   /transl_table=11
FT                   /locus_tag="BCAL0008A"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0008A"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50314"
FT                   /db_xref="InterPro:IPR022191"
FT                   /db_xref="UniProtKB/TrEMBL:B4E565"
FT                   /protein_id="CAR50314.1"
FT                   /translation="MSDISIHDLEAAINFWRARSPSSGDELKLCEEASALSKPYALLIV
FT                   QRESALQLEGLDPKARKAYETYVRLKDGLES"
FT   CDS_pept        complement(9588..9896)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0009"
FT                   /product="pterin-4-alpha-carbinolamine dehydratase"
FT                   /EC_number="4.2.1.96"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50315"
FT                   /db_xref="GOA:B4E566"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E566"
FT                   /protein_id="CAR50315.1"
FT                   /translation="MIHKLTSEERKTRLEGLPHWTAVPGRDAIQRRLRFADFNEAFGFM
FT                   TRVAIKAQEMNHHPEWFNVYNRVDVTLSTHDADGLTERDIELARFIDGAATHAQPGA"
FT   misc_feature    complement(9609..9896)
FT                   /locus_tag="BCAL0009"
FT                   /note="HMMPfam hit to PF01329, Pterin 4 alpha carbinolamine
FT                   dehydratase, score 2.4e-36"
FT                   /inference="protein motif:HMMPfam:PF01329"
FT   CDS_pept        complement(10057..10950)
FT                   /transl_table=11
FT                   /gene="phhA"
FT                   /locus_tag="BCAL0010"
FT                   /product="phenylalanine-4-hydroxylase"
FT                   /EC_number="1.14.16.1"
FT                   /note="Possible alternative upstream translational start
FT                   sites"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50316"
FT                   /db_xref="GOA:B4E567"
FT                   /db_xref="InterPro:IPR001273"
FT                   /db_xref="InterPro:IPR005960"
FT                   /db_xref="InterPro:IPR018301"
FT                   /db_xref="InterPro:IPR019774"
FT                   /db_xref="InterPro:IPR036329"
FT                   /db_xref="InterPro:IPR036951"
FT                   /db_xref="UniProtKB/TrEMBL:B4E567"
FT                   /protein_id="CAR50316.1"
FT                   /translation="MSTVVTAKLQEQFDAGLETRADFTIDQPLHCYGQVDHAVWKQLYA
FT                   RQSALLRGRACDAFVAGLGKIELPADHVPSFADVNRQLKPATGWEIVAVPGLVPDRVFF
FT                   EHLANRRFPVTWWMRRPDQLDYLQEPDCFHDLFGHVPLLIDPVFADYMQAYGRTALAVA
FT                   DDEAALARLARLYWYTVEFGLIRDPRGTDGLSIYGAGIVSSKGESLYSLESAAPNRLGF
FT                   DLERVMRTKYRIDTFQKTYFVIDDFAQLFALADVDGRALADRLAALPEFAAGAVLDTDR
FT                   VLHRGTGDGWPDDADA"
FT   misc_feature    complement(10150..10929)
FT                   /gene="phhA"
FT                   /locus_tag="BCAL0010"
FT                   /note="HMMPfam hit to PF00351, Biopterin-dependent aromatic
FT                   amino acid h, score 2e-11"
FT                   /inference="protein motif:HMMPfam:PF00351"
FT   misc_feature    complement(10528..10563)
FT                   /note="PS00367 Biopterin-dependent aromatic amino acid
FT                   hydroxylases signature."
FT                   /inference="protein motif:Prosite:PS00367"
FT   CDS_pept        11090..11575
FT                   /transl_table=11
FT                   /locus_tag="BCAL0011"
FT                   /product="AnsC family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50317"
FT                   /db_xref="GOA:B4E568"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4E568"
FT                   /protein_id="CAR50317.1"
FT                   /translation="MLELDHFDLALLDVLQRFGRATHQQLGEEVPLSPSQIGRRLQRLE
FT                   AAGVIEGYRVMLRPEKLGLGVTAFTSLKLKHHGDSIIEQFQQQIDVLPEVLECHAVVGD
FT                   ADYLLRIVAPDLNALSQFVMKKLMRVPGVDSVRSNIVLTTFKRNGALPLAHLAPGAA"
FT   misc_feature    11150..11215
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1383.000, SD 3.90 at aa 26-47, sequence
FT                   ATHQQLGEEVPLSPSQIGRRLQ"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    11291..11521
FT                   /locus_tag="BCAL0011"
FT                   /note="HMMPfam hit to PF01037, AsnC family, score 3e-28"
FT                   /inference="protein motif:HMMPfam:PF01037"
FT   CDS_pept        complement(11647..12180)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0012"
FT                   /product="putative adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50318"
FT                   /db_xref="InterPro:IPR008173"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:B4E569"
FT                   /protein_id="CAR50318.1"
FT                   /translation="MARNIEIKARAREFDRLREQAAQLATEAPLFYRQQDFFYDVPRGR
FT                   LKLRRFEDGTPAELIFYQRDDRDGPKASYYTRSPVTNPDAMHSLLATALTTRGIVTKER
FT                   HVYLAGRTRIHLDRVDGLGDFIELEVVLGPDDDEAGGEAEAHEVFAKLGVAQEDLVAVA
FT                   YVDLLNADAQPETA"
FT   misc_feature    complement(11671..12177)
FT                   /locus_tag="BCAL0012"
FT                   /note="HMMPfam hit to PF01928, CYTH domain, score 2.4e-19"
FT                   /inference="protein motif:HMMPfam:PF01928"
FT   CDS_pept        complement(12385..13284)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0013"
FT                   /product="LysR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50319"
FT                   /db_xref="GOA:B4E570"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4E570"
FT                   /protein_id="CAR50319.1"
FT                   /translation="MDLTLLRAFATVAREGNLTRAAAQLHLTQPAVSLQIKHLQETLGV
FT                   ALFTRTSRGLALTRDGQTLLPHAERALAAAADVQRAAAALRHEVRGRLRIGTILDPGFL
FT                   RLGGFLRALVETHPQIETALRHGMSGWVIEQVRARALDVGYYIGRPEEDSPRDEALFHT
FT                   VTLTRFEYRVLAPAGWKERVQRAHDWRALAALPWIWTPPASAHHRLLSRRFADAGAQPV
FT                   KVAEVDQEQSMLDLVKSGIGLTLARDSTALAEAHAHALTIVEHVTVPTELTFVTLAERR
FT                   DEPAIAAALRLIEAQWAI"
FT   misc_feature    complement(12391..13029)
FT                   /locus_tag="BCAL0013"
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 2e-27"
FT                   /inference="protein motif:HMMPfam:PF03466"
FT   misc_feature    complement(13099..13278)
FT                   /locus_tag="BCAL0013"
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix, score 9.4e-20"
FT                   /inference="protein motif:HMMPfam:PF00126"
FT   misc_feature    complement(13174..13239)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1604.000, SD 4.65 at aa 16-37, sequence
FT                   GNLTRAAAQLHLTQPAVSLQIK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        13473..15158
FT                   /transl_table=11
FT                   /locus_tag="BCAL0014"
FT                   /product="putative GMC oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50320"
FT                   /db_xref="GOA:B4E571"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B4E571"
FT                   /protein_id="CAR50320.1"
FT                   /translation="MSTQRTLEGEFDYVIVGAGTAGCVLANRLTEDPDISVLLLEAGGK
FT                   DDYHWIHIPVGYLYCIGNPRTDWLYKTQPEAALNGRALSYPRGRVLGGCSSINGMIYMR
FT                   GQREDYDHWAQETGDAGWSWDSVLPIFKRSEDHHAGASDAHGAGGYWRVEKQRLRWEIL
FT                   ESFAQAAQQTGIPATDDFNRGDNAGVGYFEVNQKRGVRWNTSKGFLRPAMARPNLTVIT
FT                   GAHAQRVIFDGRRAVGVEYRGGGTDYVACARAEVLLTSGAVNSPQLLELSGIGDGRRLQ
FT                   ALGIDVVQDLPGVGENLQDHLQLRMAFRVDGVRTLNTLSAHWWGKLMIGAEYALLQRGP
FT                   MSMAPSQLGAFAKSDPDDPALMRPDLQYHVQPLSLERFGEPLHRFNAFTASVCHLRPTS
FT                   RGSVHVTSADPGSAPAIAPNYLSTDHDRHVAANALRLTRRIASAPALARYRPEEILPGP
FT                   QYRTEAELVDAAGAVGTTIFHPVGTCRMGRADDERAVVDSRLRVRGIAGLRIVDASVMP
FT                   FITSGNTNSPTLMIAERASDMIRADRRAAREATAVRTEAAVTAV"
FT   misc_feature    13503..14420
FT                   /locus_tag="BCAL0014"
FT                   /note="HMMPfam hit to PF00732, GMC oxidoreductase, score
FT                   1.8e-105"
FT                   /inference="protein motif:HMMPfam:PF00732"
FT   misc_feature    13509..13541
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    14253..14297
FT                   /note="PS00624 GMC oxidoreductases signature 2."
FT                   /inference="protein motif:Prosite:PS00624"
FT   misc_feature    14640..15077
FT                   /locus_tag="BCAL0014"
FT                   /note="HMMPfam hit to PF05199, GMC oxidoreductase, score
FT                   2.5e-53"
FT                   /inference="protein motif:HMMPfam:PF05199"
FT   CDS_pept        15597..16376
FT                   /transl_table=11
FT                   /locus_tag="BCAL0015"
FT                   /product="putative branched-chain amino acid ABC
FT                   transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50321"
FT                   /db_xref="GOA:B4E572"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:B4E572"
FT                   /protein_id="CAR50321.1"
FT                   /translation="MILGDTILETRGLTKEFRGFTAVNGVNLRVRRGAIHALIGPNGAG
FT                   KTTCFNLLTKFLTPTAGQIVFNGIDITDERPAQVARRGIIRSFQISAVFPHLTALQNVR
FT                   IGLQRALGTEFHFWRSERTLKRLDDRAMDLLTQVGLTDFAHVPTVELAYGRKRALEIAT
FT                   TLAMEPELMLLDEPTQGMGHEDVDRVTALIKKVASGRTILMVEHNMNVIAGISDTITVL
FT                   QRGEVLAEGSYAEVSKNPLVIEAYMGSADAALAGAHA"
FT   misc_feature    15693..16271
FT                   /locus_tag="BCAL0015"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   5.9e-45"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    15714..15737
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        16373..17128
FT                   /transl_table=11
FT                   /locus_tag="BCAL0016"
FT                   /product="putative branched-chain amino acid ABC
FT                   transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50322"
FT                   /db_xref="GOA:B4E573"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4E573"
FT                   /protein_id="CAR50322.1"
FT                   /translation="MKHSEREERELSGVESGTPALEITGLEAWYGESHILHGVDLTVHR
FT                   GEVVTLLGRNGAGRTTTLRAIMGLTGRRSGSIKVAGHETIGLATHRIAHYGIGYCPEER
FT                   GIFSSLSCEENLMLPPLIGSREHAMSLDEIYAMFPNLASRRQSQGTRLSGGEQQMLAVA
FT                   RILRTGANLLLLDEISEGLAPVIVQALARMIVALKARGYTIVMVEQNFRFAAPLADRFY
FT                   VMEHGSIVEHFRASELEGKMPTLHDLLGV"
FT   misc_feature    16508..17053
FT                   /locus_tag="BCAL0016"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   1.1e-34"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    16826..16870
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        17206..18405
FT                   /transl_table=11
FT                   /locus_tag="BCAL0017"
FT                   /product="putative branched-chain amino acid ABC
FT                   transporter periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50323"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B4E574"
FT                   /protein_id="CAR50323.1"
FT                   /translation="MKMKTLAQACLALATAAFTAGAAHAADTVKIGFITDMSGLYADID
FT                   GQGGLEAIRMAVADFGGKVLGKPIEVVYADHQNKADIAASKAREWMDRGGLDLLVGGTN
FT                   SATALSMNQVAAEKKKVYINIGAGADTLTNEQCTPYTVHYAYDTMALAKGTGSAVVKQG
FT                   GKSWFFLTADYAFGKALEKNTSDVVKANGGQVLGAVRHPLSASDFSSFLLQAQSSKAQI
FT                   LGLANAGGDTINSIKAAKEFGITKTMKLAALLMFIDDVHSLGLETTQGLVLTDSWYWNR
FT                   DAASRQWAQRYFGKMKKMPSSLQAADYSSVTTYLKAVQAAGTTDSDKVMAELKKIKISD
FT                   FYAKGYIRQDGSMIHDMYLMEVKKPSESKEPWDYYKVLATIPGEQAFGTKQETRCALWK
FT                   "
FT   sig_peptide     17206..17280
FT                   /locus_tag="BCAL0017"
FT                   /note="Signal peptide predicted for BCAL0017 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 1.000 between residues 52 and 53"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        18538..19422
FT                   /transl_table=11
FT                   /locus_tag="BCAL0018"
FT                   /product="putative branched-chain amino acid ABC
FT                   transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50324"
FT                   /db_xref="GOA:B4E575"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B4E575"
FT                   /protein_id="CAR50324.1"
FT                   /translation="MEIFGIPLPAMLSQLLLGLVNGSFYAILSLGLAVIFGLLNVINFA
FT                   HGALFMLGAMLAWMGLSYFGLPYWAMLALAPLMVGAFGIAIERSMLRWLYKLDHLYGLL
FT                   LTFGLTLVVEGVFRSIYGSSGQPYDVPSQLSGATNLGFMFLPNYRAWVVVASLAVCLAT
FT                   WFVIEKTRLGAYLRAGTENPKLVEAFGVNVPMMITLTYGFGVALAAFAGVLAAPVIQVS
FT                   PLMGQPMIITVFAVVVIGGMGSILGSIVTGLLLGVIEGFTRVFYPEASATVVFVIMAIV
FT                   LLFRPAGLFGKEK"
FT   misc_feature    18577..19383
FT                   /locus_tag="BCAL0018"
FT                   /note="HMMPfam hit to PF02653, Branched-chain amino acid
FT                   transport syst, score 2.1e-35"
FT                   /inference="protein motif:HMMPfam:PF02653"
FT   misc_feature    join(18580..18648,18652..18720,18730..18798,18835..18903,
FT                   18979..19038,19132..19200,19243..19311,19330..19398)
FT                   /locus_tag="BCAL0018"
FT                   /note="8 probable transmembrane helices predicted for
FT                   BCAL0018 by TMHMM2.0 at aa 15-37, 39-61, 65-87, 100-122,
FT                   148-167, 199-221, 236-258 and 265-287"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        19422..20399
FT                   /transl_table=11
FT                   /locus_tag="BCAL0019"
FT                   /product="putative branched-chain amino acid ABC
FT                   transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50325"
FT                   /db_xref="GOA:B4E576"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B4E576"
FT                   /protein_id="CAR50325.1"
FT                   /translation="MQRKVLYGVLLAALLAAPFIGAYPVFVMKVLAFALFAAAFNLLIG
FT                   YTGLLSFGHAMFLATAGYATGYSMQTLGFTPELGVLVGTVAATLLGLVVGLFAIRRQGI
FT                   YFAMITLAFAQMVYFIYLQAPFTHGEDGLQGVPRGRLFGLLDLSNDVALYYVVLVVVVA
FT                   ACAFIVRVVHSPFGQVLVAIKENEARAISLGYDTDRFKLLAFILSAGLAGLAGSLKVLV
FT                   LGFETLSDAYWTMSGLVVLMTLVGGMGTLFGPLLGAALIVALEDRLGDIGEWLASTTGV
FT                   AWFHSLGESATIVTGLIFIACVLAFRRGIVGEMVARVKPLRASS"
FT   sig_peptide     19422..19532
FT                   /locus_tag="BCAL0019"
FT                   /note="Signal peptide predicted for BCAL0019 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.694 between residues 37 and 38"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(19434..19502,19545..19613,19650..19718,19728..19787,
FT                   19872..19940,20028..20096,20133..20201,20271..20339)
FT                   /locus_tag="BCAL0019"
FT                   /note="8 probable transmembrane helices predicted for
FT                   BCAL0019 by TMHMM2.0 at aa 5-27, 42-64, 77-99, 103-122,
FT                   151-173, 203-225, 238-260 and 284-306"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    19485..20330
FT                   /locus_tag="BCAL0019"
FT                   /note="HMMPfam hit to PF02653, Branched-chain amino acid
FT                   transport syst, score 6.5e-20"
FT                   /inference="protein motif:HMMPfam:PF02653"
FT   CDS_pept        21481..22638
FT                   /transl_table=11
FT                   /locus_tag="BCAL0020"
FT                   /product="putative branched-chain amino acid ABC
FT                   transporter periplasmic substrate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50326"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B4E577"
FT                   /protein_id="CAR50326.1"
FT                   /translation="MKMNRWMEALLAAGLVCAAATASAQVKIGVTLSATGPAASLGIPE
FT                   KNTIALLPKEIAGKSVQYIVLDDASDTSRAVQNVRKLIDEDHVDAIIGSSVTPNSLAML
FT                   DPVSQGKTPTISLAASAQIIAPMDAKRAWMFKVPQNDQLMADAIAGYMAKHGVKTVGFI
FT                   GFADAYGDSWYKTFDAAAAKNGLKLVSNERYNRTDASVMGQVLKLLGSNPDAVLIAGSG
FT                   TPAALPAKTLKERGYKGKVYQTHGVANNDFLRVCGKDCEGEILPAGPVLVTDQLPDSNP
FT                   VKKPALGYKAAYEKAYGAGSLSTFGGHAWDAGLLLQRAIPEALKKGQPGTEAFREALRA
FT                   SLESVKDLPVSHGVINMTATDHNGFDTRARVMVQIVDGKWKLQAE"
FT   sig_peptide     21481..21552
FT                   /locus_tag="BCAL0020"
FT                   /note="Signal peptide predicted for BCAL0020 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.899 between residues 24 and 25"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    21580..22617
FT                   /locus_tag="BCAL0020"
FT                   /note="HMMPfam hit to PF01094, Receptor family ligand
FT                   binding region, score 2e-06"
FT                   /inference="protein motif:HMMPfam:PF01094"
FT   CDS_pept        22845..23900
FT                   /transl_table=11
FT                   /locus_tag="BCAL0021"
FT                   /product="putative branched-chain amino acid ABC
FT                   transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50327"
FT                   /db_xref="GOA:B4E578"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B4E578"
FT                   /protein_id="CAR50327.1"
FT                   /translation="MDLSIAAILAQDGITTGAIYALLSLALVLVFSVTRVIFIPQGEFV
FT                   AYGALTLAALQAQKFPATCWLLFAMGIACFLLEVGSLIRHRERRHQLGRTLATLASRYI
FT                   LLPLAVFAITRSFAAQPMPMLAQIALTLAIVVPMGPFVYRLVYQPIAEGTTLLLLIVSV
FT                   AVHFAMVGLGLVMFGAEGSRTNAFSDASLAIGSMTVSVQSILVVVTALVLIGALYVYFG
FT                   RTIAGKALRATSVNRLGARLVGIGTTEAGRLAFTFAAGLGVLSGILVGPLTTIYYDSGF
FT                   LIGLKGFVGAIIGGLVSYPLAAAGSLLVGVLESYSSFWASAYKEVIVFTLIIPVLLWRS
FT                   FVTPHAEEEEE"
FT   misc_feature    22869..23852
FT                   /locus_tag="BCAL0021"
FT                   /note="HMMPfam hit to PF02653, Branched-chain amino acid
FT                   transport syst, score 5e-05"
FT                   /inference="protein motif:HMMPfam:PF02653"
FT   misc_feature    join(22893..22961,23025..23093,23130..23198,23211..23279,
FT                   23313..23381,23439..23507,23601..23669,23712..23780,
FT                   23817..23870)
FT                   /locus_tag="BCAL0021"
FT                   /note="9 probable transmembrane helices predicted for
FT                   BCAL0021 by TMHMM2.0 at aa 17-39, 61-83, 96-118, 123-145,
FT                   157-179, 199-221, 253-275, 290-312 and 325-342"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        23905..25689
FT                   /transl_table=11
FT                   /locus_tag="BCAL0022"
FT                   /product="putative branched-chain amino acid ABC
FT                   transporter ATP-binding membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50328"
FT                   /db_xref="GOA:B4E579"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:B4E579"
FT                   /protein_id="CAR50328.1"
FT                   /translation="MKTMVRNKTFWVFLVVLFALPVLPGALQVPEYWITLLNYIGLYAI
FT                   VAIGLVLLTGVGGMTSFGQAAFVGIGAYATAFLTTRYGVSPWLALIVGVVLTALVALVL
FT                   GAVTMRLSGHFLPLGTIAWGLALFYLFGNLELLGKYDGINGIPALNLFGIELESGRSLY
FT                   FLIWAVVLAAIVSVQNLLNSRPGRAIRALRGGGVMAEAMGVNTAWMRVVIFVYAAVLAA
FT                   VSGFLYAHLQRAVNPTPFGLNHGIEFLFMAVVGGVSHVWGAVLGAAILTVLQDYLQTLL
FT                   PKLLGSEGNFEIIVFGVLMVLLLQYARQGVWPFVAKLFPRGPRAHVPEQADPLPQRAKP
FT                   VAGEPLLVVDNARKQFGGLVAVNDVSFDVKAGQIIGLIGPNGAGKSTTFNLVTGVLKPT
FT                   GGAITFRGERIDGLTSRQIVRRGIGRTFQHVKLLPAMTVLENVAIGAHLRGHTGVWRSI
FT                   ARLNAHEEAQLLAEAARQIRRVGLEKHMYDEAGSLALGQQRILEIARALCCDPTLLLLD
FT                   EPAAGLRYQEKQQLADLLRRLKAEGMSVLLVEHDMDFVMNLTDRLVVMEFGTRIAEGLP
FT                   QDVQQDPAVLEAYLGGVE"
FT   sig_peptide     23905..23988
FT                   /locus_tag="BCAL0022"
FT                   /note="Signal peptide predicted for BCAL0022 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.983) with cleavage site
FT                   probability 0.464 between residues 28 and 29"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(23929..23988,23998..24066,24085..24144,24154..24222,
FT                   24241..24300,24385..24453,24523..24591,24649..24717,
FT                   24754..24822)
FT                   /locus_tag="BCAL0022"
FT                   /note="9 probable transmembrane helices predicted for
FT                   BCAL0022 by TMHMM2.0 at aa 9-28, 32-54, 61-80, 84-106,
FT                   113-132, 161-183, 207-229, 249-271 and 284-306"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    23998..24813
FT                   /locus_tag="BCAL0022"
FT                   /note="HMMPfam hit to PF02653, Branched-chain amino acid
FT                   transport syst, score 2.5e-28"
FT                   /inference="protein motif:HMMPfam:PF02653"
FT   misc_feature    25018..25608
FT                   /locus_tag="BCAL0022"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   7.5e-56"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    25039..25062
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        25704..26444
FT                   /transl_table=11
FT                   /locus_tag="BCAL0023"
FT                   /product="putative branched-chain amino acid ABC
FT                   transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50329"
FT                   /db_xref="GOA:B4E580"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4E580"
FT                   /protein_id="CAR50329.1"
FT                   /translation="MPILEVRGLAVRYGKVEALHGAAIKVGAGQIVSVIGPNGAGKSTL
FT                   LNAIMGALPVTGHASGAIVYRGNDVGALPVEQRVARGMCLVPEKRELFSTMTVEDNLVL
FT                   GAYRRKQAGEANFLDQLDHVFALFPRLKERRRQAAGTLSGGERQMLAVGRALMGKPDLL
FT                   MLDEPSLGLAPLIVKEIFHIISALRGTGVATLLIEQNARAALQISDYGYVLETGEFALE
FT                   GPAAELAQNPRVIETYLGLAKKTA"
FT   misc_feature    25788..26354
FT                   /locus_tag="BCAL0023"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   7.2e-46"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    25809..25832
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    26127..26171
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        26985..28955
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /locus_tag="BCAL0024"
FT                   /product="tRNA uridine 5-carboxymethylaminomethyl
FT                   modification enzyme GidA"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0024"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50330"
FT                   /db_xref="GOA:B4E581"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E581"
FT                   /protein_id="CAR50330.1"
FT                   /translation="MLFPTEFDVIVVGGGHAGTEAALASARMGAKTLLLTHNIETLGQM
FT                   SCNPSIGGIGKGHLVKEVDALGGAMAAATDESGIQFRILNSSKGPAVRATRAQADRILY
FT                   KAAIRHRLENQPNLWLFQQAVDDLMVEGDRVVGAVTQIGIRFRARAVVLTAGTFLDGKI
FT                   HVGLNNYTGGRAGDPAAVSLSSRLKELKLPQGRLKTGTPPRIDGRTIDFSKLDEQPGDL
FT                   DPIPVFSFLGRAEQHPQQLPCWVTHTNERTHDIIRGGLDRSPMYTGVIEGVGPRYCPSI
FT                   EDKIHRFASKESHQIFLEPEGLTTNEFYPNGISTSLPFDVQLELVHSMRGLENAHILRP
FT                   GYAIEYDYFDPRALKASLETKAINGLFFAGQINGTTGYEEAAAQGLLAGLNAGRYVQEK
FT                   EAWCPRRDQAYLGVLVDDLVTRGVAEPYRMFTSRAEYRLSLREDNADMRLTEIGRELGL
FT                   VDDARWDAFSRKRDAVSRETERLKSTWVTPKTLPAEEATALLGKAIDHEYSLAELLRRP
FT                   GVSYDGVCGLKGGECGPAEPLTDDPVLLEQIKEQVEIGIKYQGYIERQASEIERNDANE
FT                   NTRLPDGIDYREVRGLSFEVSQKLNEFRPETIGQASRISGVTPAAISLLMVHLKRRGLG
FT                   RRNGTAAEAAEQGGGTVPTQQ"
FT   misc_feature    27006..28184
FT                   /gene="gidA"
FT                   /locus_tag="BCAL0024"
FT                   /note="HMMPfam hit to PF01134, Glucose inhibited division
FT                   protein A, score 1.4e-274"
FT                   /inference="protein motif:HMMPfam:PF01134"
FT   misc_feature    27006..28181
FT                   /gene="gidA"
FT                   /locus_tag="BCAL0024"
FT                   /note="HMMPfam hit to PF01266, FAD dependent
FT                   oxidoreductase, score 0.0016"
FT                   /inference="protein motif:HMMPfam:PF01266"
FT   misc_feature    27804..27848
FT                   /note="PS01280 Glucose inhibited division protein A family
FT                   signature 1."
FT                   /inference="protein motif:Prosite:PS01280"
FT   misc_feature    28089..28160
FT                   /note="PS01281 Glucose inhibited division protein A family
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS01281"
FT   CDS_pept        28952..29638
FT                   /transl_table=11
FT                   /gene="gidB"
FT                   /locus_tag="BCAL0025"
FT                   /product="methyltransferase GidB"
FT                   /EC_number="2.1.-.-"
FT                   /note="Possible alternative translational start site after
FT                   codon 16"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50331"
FT                   /db_xref="GOA:B4E582"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E582"
FT                   /protein_id="CAR50331.1"
FT                   /translation="MTARRAPAVNRDVLEQMLVEGTAALDLTLTDAQRNQLLDYVALLG
FT                   KWNAVYNLTAIRDPKQMLIQHILDSLSIVPHLRGRTSARVLDVGSGGGLPGIVLAIVEP
FT                   GWQVTLNDIVQKKSAFQTQMRAELKLVNLSVVTGRVESLQPGVEVPEKFDMIVSRAFAD
FT                   LSDFVKLARHLVAPGGSIWAMKGVHPDDEIARLPEGSHVKQTIRLAVPMLDAERHLFEV
FT                   AVDDAN"
FT   misc_feature    29048..29611
FT                   /gene="gidB"
FT                   /locus_tag="BCAL0025"
FT                   /note="HMMPfam hit to PF02527, Glucose inhibited division
FT                   protein, score 5.5e-58"
FT                   /inference="protein motif:HMMPfam:PF02527"
FT   misc_feature    29207..29500
FT                   /gene="gidB"
FT                   /locus_tag="BCAL0025"
FT                   /note="HMMPfam hit to PF08241, Methyltransferase domain,
FT                   score 0.0011"
FT                   /inference="protein motif:HMMPfam:PF08241"
FT   CDS_pept        29690..30469
FT                   /transl_table=11
FT                   /locus_tag="BCAL0026"
FT                   /product="chromosome partitioning protein ParA"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50332"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4E583"
FT                   /protein_id="CAR50332.1"
FT                   /translation="MAKIFCVANQKGGVGKTTTSVNLAASLAAQEQRVLLIDLDPQGNA
FT                   TMGSGIDKAACEATVYEVLVDGVSVTDARVRPEGVTYDVLPANRELSGAEIELISIDNR
FT                   ERRLKAALERVADDYDFVLIDCPPTLSLLTLNGLCAAHGVVIPMQCEYFALEGLSDLVN
FT                   TIKQVHANMNRDLKIIGLLRVMFDPRITLQQQVSDQLKAHFGDKVFDAVIPRNVRLAEA
FT                   PSYGLPGVVFDRSSRGAQAYIQFGAEMIERVRAFEVS"
FT   misc_feature    29702..30352
FT                   /locus_tag="BCAL0026"
FT                   /note="HMMPfam hit to PF01656, CobQ/CobB/MinD/ParA
FT                   nucleotide binding domai, score 1.4e-58"
FT                   /inference="protein motif:HMMPfam:PF01656"
FT   CDS_pept        30501..31394
FT                   /transl_table=11
FT                   /locus_tag="BCAL0027"
FT                   /product="chromosome partitioning protein ParB"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50333"
FT                   /db_xref="GOA:B4E584"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:B4E584"
FT                   /protein_id="CAR50333.1"
FT                   /translation="MNAVPKKKGLGRGLEALLGGSADITEAVKIEGAPNTLALGKLQAG
FT                   KYQPRTRMDEGSLQELAASIRAQGVMQPILVRPISSDKYEIIAGERRFRAARLAGLDEV
FT                   PVLVKDVSDQAAAAMALIENIQREDLNPLEEAHGIQRLLDEFGFTHEQAAESVGRSRSA
FT                   VSNLLRLLNLASPVQTMLLAGDLDMGHARALLAVDAATQITLAHQVVNKRMSVRETEKL
FT                   VAHTTKEAPAVKARAKDDGGRDTRRLEEELSDLLASTVKIKLGRRGRGQVLIDFGNLDA
FT                   LEGILARLRGNVATEE"
FT   misc_feature    30603..30875
FT                   /locus_tag="BCAL0027"
FT                   /note="HMMPfam hit to PF02195, ParB-like nuclease domain,
FT                   score 2e-35"
FT                   /inference="protein motif:HMMPfam:PF02195"
FT   misc_feature    30942..31007
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1768.000, SD 5.21 at aa 148-169, sequence
FT                   FTHEQAAESVGRSRSAVSNLLR"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        31405..32535
FT                   /transl_table=11
FT                   /locus_tag="BCAL0028"
FT                   /product="putative citrate transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50334"
FT                   /db_xref="GOA:B4E585"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:B4E585"
FT                   /protein_id="CAR50334.1"
FT                   /translation="MEQTGAPAPRRWLGWLAQEPVLSVLALGLIVLQWVRPQPFSVLAD
FT                   RVDWQTVATLAGLLMLTKALELSGCLMWLAHRIVHHVHSERGLAMLLVGFAAVLSMWLT
FT                   NDVALFVVVPLMVSLRALTPLPFRRLVIVVALAVNAGSVATPLGNPQNLFLWQLSGVSF
FT                   GRFVVTLGPLAVALMALLLVLTALMFRAKPLDLSGDAASFPVQRMHALIAAVLFAAFVL
FT                   LADAHHPLPGLVGVAIVLLAVKRDAVLKIDWLLLLIFVLMFVVLRSAAALPVVHDAVAH
FT                   AQLDSPLRVYAAGAALSQVISNVPAAILLSEFTHDWRALAFGVSVGGFGFAIGSLANLI
FT                   AVRLAKEPRMWLPFHLVSIPFALVSAALGAWLLMHG"
FT   misc_feature    join(31441..31509,31675..31743,31777..31845,31903..31971,
FT                   32032..32133,32161..32229,32266..32334,32362..32430,
FT                   32455..32523)
FT                   /locus_tag="BCAL0028"
FT                   /note="9 probable transmembrane helices predicted for
FT                   BCAL0028 by TMHMM2.0 at aa 13-35, 91-113, 125-147, 167-189,
FT                   210-243, 253-275, 288-310, 320-342 and 351-373"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    31441..32388
FT                   /locus_tag="BCAL0028"
FT                   /note="HMMPfam hit to PF03600, Citrate transporter, score
FT                   5.2e-05"
FT                   /inference="protein motif:HMMPfam:PF03600"
FT   CDS_pept        33104..33628
FT                   /transl_table=11
FT                   /locus_tag="BCAL0029"
FT                   /product="putative ATP synthase protein I AtpI"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50335"
FT                   /db_xref="GOA:B4E586"
FT                   /db_xref="InterPro:IPR005598"
FT                   /db_xref="UniProtKB/TrEMBL:B4E586"
FT                   /protein_id="CAR50335.1"
FT                   /translation="MAGQAPDDRHDDQRTQRTASAAGARRESDDDWDVEQQDNNIVPLT
FT                   RAEAERLFGPNVSKPSRVTPYKVVFAQVVLSLVATLAWWLFSKSPGAAAQSAFLGGAIG
FT                   WVPSAVFVARLKAGGSATVMSWVMGEALKLALTIGMFTAVAFGWAGVHWVPFLVTYLVV
FT                   LKTYWIALAWR"
FT   misc_feature    join(33305..33364,33374..33442,33479..33547,33560..33619)
FT                   /locus_tag="BCAL0029"
FT                   /note="4 probable transmembrane helices predicted for
FT                   BCAL0029 by TMHMM2.0 at aa 68-87, 91-113, 126-148 and
FT                   153-172"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        33738..34589
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="BCAL0030"
FT                   /product="ATP synthase A chain"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50336"
FT                   /db_xref="GOA:B4E587"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:B4E587"
FT                   /protein_id="CAR50336.1"
FT                   /translation="MAASEGTRGPDPSEYIAHHLQNFSTSHQTSIFDIHVWNLDTLFWS
FT                   IVCGIVTIVLLRLAARKATSGVPGRFQCAIEMLVEMVEDQSKAIVHGNRTFIAPLALTV
FT                   FVWVALMNSLDFLPVDLPGRVIGLLGLSDVISHHRIVPTADLNGTLGIALGVFVLMIYY
FT                   SIKIKGAGGFVHELLSAPFGAHPLLWIPNLALNIVEYLAKTVSLGMRLFGNMYAGELLF
FT                   LLIALLGSMWSFGGDATFLGFVGHVIAGSVWAIFHILIVLLQAFIFMMLTLVYLGQAHD
FT                   KH"
FT   misc_feature    33849..34571
FT                   /gene="atpB"
FT                   /locus_tag="BCAL0030"
FT                   /note="HMMPfam hit to PF00119, ATP synthase A chain, score
FT                   2.9e-55"
FT                   /inference="protein motif:HMMPfam:PF00119"
FT   misc_feature    join(33858..33917,34002..34070,34173..34232,34371..34439,
FT                   34497..34565)
FT                   /gene="atpB"
FT                   /locus_tag="BCAL0030"
FT                   /note="5 probable transmembrane helices predicted for
FT                   BCAL0030 by TMHMM2.0 at aa 47-66, 95-117, 152-171, 218-240
FT                   and 260-282"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    34353..34382
FT                   /note="PS00449 ATP synthase a subunit signature."
FT                   /inference="protein motif:Prosite:PS00449"
FT   CDS_pept        34665..34934
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="BCAL0031"
FT                   /product="ATP synthase C chain"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50337"
FT                   /db_xref="GOA:B4EEY4"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:B4EEY4"
FT                   /protein_id="CAR50337.1"
FT                   /translation="MQAYIANIQGLTAIGIGIIIGLGAIGACIGIALMGGKYIEACARQ
FT                   PELINPLQTKMFLLAGLIDAAFLIGVGVAMLFAFANPLLSKLAG"
FT   misc_feature    34695..34904
FT                   /gene="atpE"
FT                   /locus_tag="BCAL0031"
FT                   /note="HMMPfam hit to PF00137, ATP synthase subunit C,
FT                   score 5e-18"
FT                   /inference="protein motif:HMMPfam:PF00137"
FT   misc_feature    join(34701..34769,34830..34898)
FT                   /gene="atpE"
FT                   /locus_tag="BCAL0031"
FT                   /note="2 probable transmembrane helices predicted for
FT                   BCAL0031 by TMHMM2.0 at aa 15-37 and 58-80"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    34716..34748
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    34791..34856
FT                   /note="PS00605 ATP synthase c subunit signature."
FT                   /inference="protein motif:Prosite:PS00605"
FT   CDS_pept        35064..35534
FT                   /transl_table=11
FT                   /gene="atpF"
FT                   /locus_tag="BCAL0032"
FT                   /product="ATP synthase B chain"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50338"
FT                   /db_xref="GOA:B4EEY5"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EEY5"
FT                   /protein_id="CAR50338.1"
FT                   /translation="MNLNATLFAQMVVFLVLAWFTMKFVWPPLINALDERSKKIADGLA
FT                   AAEKGKAELDAAHKRVDQELAQARNDGQQRIADAEKRAQAVAEEIKANAQAEAARIVAQ
FT                   AKAEAEQQIVKAREALRGEVAALAVKGAEQILKREVDQTAHAQLLNQLKAEL"
FT   misc_feature    35094..35474
FT                   /gene="atpF"
FT                   /locus_tag="BCAL0032"
FT                   /note="HMMPfam hit to PF00430, ATP synthase B/B' CF(0),
FT                   score 3e-25"
FT                   /inference="protein motif:HMMPfam:PF00430"
FT   CDS_pept        35537..36076
FT                   /transl_table=11
FT                   /gene="atpH"
FT                   /locus_tag="BCAL0033"
FT                   /product="ATP synthase delta chain"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50339"
FT                   /db_xref="GOA:B4EEY6"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EEY6"
FT                   /protein_id="CAR50339.1"
FT                   /translation="MAELATIARPYAEALFRVAEGGDIAAWSTLVQELAQVARLPEVLS
FT                   VASSPKVTRTQVAELLLAAAKSPLAAGAEAKNFVQMLVDNHRIALLPEIAEQFEALKNE
FT                   REGAADAEIVSAFPLNGADLDSLVSGLERKFKRKLKPTVEVDSSLIGGVRVTVGDEVLD
FT                   TSVRARLASMQAALTA"
FT   misc_feature    35555..36067
FT                   /gene="atpH"
FT                   /locus_tag="BCAL0033"
FT                   /note="HMMPfam hit to PF00213, ATP synthase delta (OSCP)
FT                   subunit, score 9.6e-32"
FT                   /inference="protein motif:HMMPfam:PF00213"
FT   CDS_pept        36121..37662
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="BCAL0034"
FT                   /product="ATP synthase alpha chain"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0034"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50340"
FT                   /db_xref="GOA:B4EEY7"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EEY7"
FT                   /protein_id="CAR50340.1"
FT                   /translation="MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGLS
FT                   DVMQGEMLEFPGNTFGLALNLERDSVGAVILGEYEHISEGDIVKTTGRILEVPVGPELV
FT                   GRVVDALGNPIDGKGPVNAKLTDAIEKIAPGVIWRKSVSQPVQTGIKSIDAMVPIGRGQ
FT                   RELIIGDRQCGKTAVALDAIINQKGKDLICIYVAIGQKASSIMNVVRKLEETGAMEYTI
FT                   VVAASASDSAAMQYLAPYAGCTMGEYFRDRGQDALIIYDDLTKQAWAYRQISLLLRRPP
FT                   GREAYPGDVFYLHSRLLERAARVSEEYVEKFTNGEVKGKSGSLTALPVIETQAGDVTAF
FT                   VPTNVISITDGQIFLETDLFNAGIRPAINAGVSVSRVGGAAQTKVVKKLSGGIRTDLAQ
FT                   YRELAAFAQFASDLDEATRKQLERGRRVTELLKQPQYQPLQVWELAVSLYAANNGYLDD
FT                   LDVKQVLSFEKGLRDNLKTSHADLIKRIEDTKDLSKDDEGALRSAIEAFKKSGAY"
FT   misc_feature    36190..36396
FT                   /gene="atpA"
FT                   /locus_tag="BCAL0034"
FT                   /note="HMMPfam hit to PF02874, ATP synthase alpha/beta
FT                   family, beta-ba, score 2.2e-19"
FT                   /inference="protein motif:HMMPfam:PF02874"
FT   misc_feature    36562..37245
FT                   /gene="atpA"
FT                   /locus_tag="BCAL0034"
FT                   /note="HMMPfam hit to PF00006, ATP synthase alpha/beta
FT                   family, nucleot, score 5.7e-122"
FT                   /inference="protein motif:HMMPfam:PF00006"
FT   misc_feature    36625..36648
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    37216..37245
FT                   /note="PS00152 ATP synthase alpha and beta subunits
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00152"
FT   misc_feature    37279..37593
FT                   /gene="atpA"
FT                   /locus_tag="BCAL0034"
FT                   /note="HMMPfam hit to PF00306, ATP synthase alpha/beta
FT                   chain, C termin, score 1.6e-33"
FT                   /inference="protein motif:HMMPfam:PF00306"
FT   CDS_pept        37731..38606
FT                   /transl_table=11
FT                   /gene="atpG"
FT                   /locus_tag="BCAL0035"
FT                   /product="ATP synthase gamma chain"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50341"
FT                   /db_xref="GOA:B4EEY8"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EEY8"
FT                   /protein_id="CAR50341.1"
FT                   /translation="MAGMKEIRGKIKSVQNTRKITKAMEMVAASKMRRAQERMRAARPY
FT                   ADKVRAIAAHMSRANPEYRHPFMVANDGAQTAGIILVTTDKGLCGGLNTNVLRATVQKF
FT                   KELEEKGQKVEATAIGGKGLGFLNRFGAKVMSQVVHLGDTPHLDKLIGAVKTQLDLYSE
FT                   GKLSAVYIAYTRFVNTMKQEAVIEQLLPLSSDHFEADDGTPATSWDYIYEPDAQAVVDE
FT                   LLVRYVEALVYQAVAENMASEQSARMVAMKAASDNAKTVISELQLVYNKSRQAAITKEL
FT                   SEIVGGAAAV"
FT   misc_feature    37734..38603
FT                   /gene="atpG"
FT                   /locus_tag="BCAL0035"
FT                   /note="HMMPfam hit to PF00231, ATP synthase, score
FT                   7.8e-134"
FT                   /inference="protein motif:HMMPfam:PF00231"
FT   misc_feature    38559..38600
FT                   /note="PS00153 ATP synthase gamma subunit signature."
FT                   /inference="protein motif:Prosite:PS00153"
FT   CDS_pept        38673..40067
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="BCAL0036"
FT                   /product="ATP synthase beta chain"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50342"
FT                   /db_xref="GOA:B4EEY9"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EEY9"
FT                   /protein_id="CAR50342.1"
FT                   /translation="MSTAALVEGKIVQCIGAVIDVEFPRDSMPKIYDALILDGSELTLE
FT                   VQQQLGDGVVRTICLGASDGLRRGLTVKNTAKPISVPVGKPTLGRIMDVLGRPIDEAGP
FT                   IDSDVTRSIHQKAPAFDELSPSTELLETGIKVIDLICPFAKGGKVGLFGGAGVGKTVNM
FT                   MELINNIAKEHGGYSVFAGVGERTREGNDFYHEMKDSNVLDKVALVYGQMNEPPGNRLR
FT                   VALTGLTMAEHFRDEGLDVLFFVDNIYRFTLAGTEVSALLGRMPSAVGYQPTLAEEMGK
FT                   LQERITSTKKGSITSVQAVYVPADDLTDPSPATTFGHLDATVVLSRDIASLGIYPAVDP
FT                   LDSTSRQIDPNVIGEEHYSITRRVQQTLQRYKELRDIIAILGMDELSPEDKLSVARARK
FT                   IQRFLSQPFHVAEVFTGSPGKYVPLKETIRGFKMIVDGECDHLPEQAFYMVGTIDEAFE
FT                   KAKKIQ"
FT   misc_feature    38703..38900
FT                   /gene="atpD"
FT                   /locus_tag="BCAL0036"
FT                   /note="HMMPfam hit to PF02874, ATP synthase alpha/beta
FT                   family, beta-ba, score 3.2e-23"
FT                   /inference="protein motif:HMMPfam:PF02874"
FT   misc_feature    39066..39707
FT                   /gene="atpD"
FT                   /locus_tag="BCAL0036"
FT                   /note="HMMPfam hit to PF00006, ATP synthase alpha/beta
FT                   family, nucleot, score 1.9e-96"
FT                   /inference="protein motif:HMMPfam:PF00006"
FT   misc_feature    39129..39152
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    39678..39707
FT                   /note="PS00152 ATP synthase alpha and beta subunits
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00152"
FT   misc_feature    39744..40064
FT                   /gene="atpD"
FT                   /locus_tag="BCAL0036"
FT                   /note="HMMPfam hit to PF00306, ATP synthase alpha/beta
FT                   chain, C termin, score 4.6e-48"
FT                   /inference="protein motif:HMMPfam:PF00306"
FT   CDS_pept        40189..40614
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /locus_tag="BCAL0037"
FT                   /product="ATP synthase epsilon chain"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0037"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50343"
FT                   /db_xref="GOA:B4EEZ0"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EEZ0"
FT                   /protein_id="CAR50343.1"
FT                   /translation="MATIKVDVVSAEEQIFSGEAKFVALPGETGELGILPGHTPLITRI
FT                   RPGAVRIEVEGGNDEFVFVAGGILEVQPGAVTVLADTAIRGKDLDAAKAEEARKRAEET
FT                   LQNVKSDLDLAKAQSELATAMAQLEAIQRLAKIRSRH"
FT   misc_feature    40195..40443
FT                   /gene="atpC"
FT                   /locus_tag="BCAL0037"
FT                   /note="HMMPfam hit to PF02823, ATP synthase, Delta/Epsilon
FT                   chain, beta, score 2.5e-31"
FT                   /inference="protein motif:HMMPfam:PF02823"
FT   misc_feature    40447..40590
FT                   /gene="atpC"
FT                   /locus_tag="BCAL0037"
FT                   /note="HMMPfam hit to PF00401, ATP synthase, Delta/Epsilon
FT                   chain, long, score 0.0026"
FT                   /inference="protein motif:HMMPfam:PF00401"
FT   CDS_pept        40897..42624
FT                   /transl_table=11
FT                   /locus_tag="BCAL0038"
FT                   /product="putative long-chain-fatty-acid--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0038"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50344"
FT                   /db_xref="GOA:B4EEZ1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B4EEZ1"
FT                   /protein_id="CAR50344.1"
FT                   /translation="MAADLGVGALIAPENGLSYVRGATDVPLSEATIGRFLLDTAGRFP
FT                   DRPAVVFREQQVRWTWREFANEIDVLAAGLAALGIVKGDCVGIWSPNRSEWLLTQFATA
FT                   RIGAVLVNINPAYRLSELEYALNKVGCKAVIAAERFKSSAYVEMLQTIAPELATATPGD
FT                   LHAARVPSLRTIVSMGEVAPAGMFRFADVMARGRRAVDPALLDAIGATLSANDPINIQF
FT                   TSGTTGSPKGATLTHRNVVNNARSIAMAMRFTEQDSLCIPVPLYHCFGMVLAVLACVSK
FT                   GAAMVFPGEAFDPVATLAAVAEERCTALHGVPTMFIAELDHPEFAKFDLSTLRTGIMAG
FT                   SPCPIETMKRVVSQMHLSEITIAYGMTETSPVSFQSSTDDPLEKRTTTVGRIQPHLEVK
FT                   IVDPSGDIVPVGATGELCTKGYSVMLGYWDDDAKTREVLVDGWMHTGDLATLDADGYCN
FT                   IVGRLKDMVIRGGENVYPREIEEFLFRHPKIQSAQVFGVPDAKYGEELCAWIVLRADEQ
FT                   MTEDDVRAFCNGQIAHYKIPRYIRFVDELPMTVTGKVQKFVMRDRMIEELKLDVQKTA"
FT   misc_feature    41074..42378
FT                   /locus_tag="BCAL0038"
FT                   /note="HMMPfam hit to PF00501, AMP-binding enzyme, score
FT                   8e-129"
FT                   /inference="protein motif:HMMPfam:PF00501"
FT   misc_feature    41554..41589
FT                   /note="PS00455 Putative AMP-binding domain signature."
FT                   /inference="protein motif:Prosite:PS00455"
FT   misc_feature    41698..41730
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(43359..44171)
FT                   /transl_table=11
FT                   /gene="pheC"
FT                   /locus_tag="BCAL0039"
FT                   /product="periplasmic cyclohexadienyl dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50345"
FT                   /db_xref="GOA:B4EEZ2"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="InterPro:IPR037298"
FT                   /db_xref="UniProtKB/TrEMBL:B4EEZ2"
FT                   /protein_id="CAR50345.1"
FT                   /translation="MKTFATLATLAAAAAFCCAAAHAQSTATAAPASAATAGSRLDDVL
FT                   ARGALRVCTTGDYKPYSYYRADGRFEGIDIDMAESLAKSLGVKTDYVKTSWSNLTNDFV
FT                   AKCDIAVGGVSTTLERQKRVFFTQPYVVDGKTPIVRCADADKYQTVAQIDRPETRVIVN
FT                   PGGTNERFAKQFFTHANLTVYPDNVTIFKQILAGKADVMVTDASETLLQQKLNPGLCSV
FT                   HPDKPFQFGEKAYMVPRGDVVFQQYVDQWLHLARSTGEYQAISDKWLK"
FT   misc_feature    complement(43362..44024)
FT                   /gene="pheC"
FT                   /locus_tag="BCAL0039"
FT                   /note="HMMPfam hit to PF00497, Bacterial extracellular
FT                   solute-binding prot, score 5.9e-22"
FT                   /inference="protein motif:HMMPfam:PF00497"
FT   misc_feature    complement(43917..43958)
FT                   /note="PS01039 Bacterial extracellular solute-binding
FT                   proteins, family 3 signature."
FT                   /inference="protein motif:Prosite:PS01039"
FT   CDS_pept        44321..45415
FT                   /transl_table=11
FT                   /gene="hemE"
FT                   /locus_tag="BCAL0040"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50346"
FT                   /db_xref="GOA:B4EEZ3"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EEZ3"
FT                   /protein_id="CAR50346.1"
FT                   /translation="MAHNLLNDTFLRALLREPTDYTPIWLMRQAGRYLPEYNATRARAG
FT                   SFLGLAKNPDYATEVTLQPLERFPLDAAILFSDILTIPDAMGLGLDFQVGEGPKFAHPV
FT                   RTEADVAKLAVPDIEATLGYVTGAVREIRRALTDAQGRQRVPLIGFSGSPWTLACYMVE
FT                   GGGSDDFRTVKSMAYSRPDLMHRILDVNAQAVAAYLNAQIEAGAQAVMIFDTWGGALAD
FT                   GAYQRFSLDYIRRVVSQLKREHDGERVPVITFTKGGGLWLEEIAATGVDAVGLDWTVNL
FT                   GAARERVAGRVALQGNLDPTILFAPPAAVREQARAVLDSYGNHPGHVFNLGHGISQFTS
FT                   PDHVAELVDEVHTHSRAIRSGAAG"
FT   misc_feature    44333..45382
FT                   /gene="hemE"
FT                   /locus_tag="BCAL0040"
FT                   /note="HMMPfam hit to PF01208, Uroporphyrinogen
FT                   decarboxylase (URO-D), score 2.6e-165"
FT                   /inference="protein motif:HMMPfam:PF01208"
FT   misc_feature    44387..44416
FT                   /note="PS00906 Uroporphyrinogen decarboxylase signature 1."
FT                   /inference="protein motif:Prosite:PS00906"
FT   misc_feature    44765..44812
FT                   /note="PS00907 Uroporphyrinogen decarboxylase signature 2."
FT                   /inference="protein motif:Prosite:PS00907"
FT   misc_feature    44765..44797
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        45867..48128
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /locus_tag="BCAL0041"
FT                   /product="primosomal protein N'"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50347"
FT                   /db_xref="GOA:B4EEZ4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:B4EEZ4"
FT                   /protein_id="CAR50347.1"
FT                   /translation="MSGTYLRVALDHPLATLFDYRCDAQPAPVPGTLVQVPFGKRQAVG
FT                   LVCEVTTHTDVPPSRLRAVDAICADLPPLSPDWLALVSFAADYYQRGRGEVALPALPQA
FT                   LRDAGRWGRLLAPEVRYQPTEAGRAALPDALPARGAALRRLAQALVDTGSLTLPDARAL
FT                   HPKAAATLDDWAARGWVDVEEIGWADTPVAKPVDNLSTNGGRTVPPALTDQQAEALDAI
FT                   RAAHGFAPFLLHGVTGSGKTEVYLHALASLLDARPDAQALVLVPEINLTPQFEAAFRAR
FT                   FAGALADDAIVTLHSGLAEGERARNWLAAHTGRARIVLGTRLAVLASMPTLALIVVDEE
FT                   HEPAYKQQEGLRYSARDLAVWRAKQLGITVVLGSATPSLESWWQAEQGRYTRLTLSRRA
FT                   VADATLPTVRLIDLEEERRRGRASMGGLSGPLVAALKARLERGEQSLVFLNRRGYAPQL
FT                   ACDACGWVAGCPRCSAYVVLHKPEHALRCHHCGWEARIPRSCPECGNVDIAPLGRGTQR
FT                   IEEALAEAVPGARILRIDADSTRRKGSAQALFSDVHAGEVDILVGTQMIAKGHDFQRVS
FT                   LVGVLNADTALFSHDFRASERLFAQLMQVSGRAGRAGLPGEVMVQTRYPRHALYHALGR
FT                   QDYVGFANSTLAERRDAHLPPFVYQALLRAEGRTLDAALAFLLQAAAALPGLPGADRVT
FT                   VYDAVPMTIVKVANVHRAQLLLESASRAALQHALRAWQPALRALKGVLRWSVEVDPLDI
FT                   "
FT   misc_feature    46488..47003
FT                   /gene="priA"
FT                   /locus_tag="BCAL0041"
FT                   /note="HMMPfam hit to PF04851, Type III restriction enzyme,
FT                   res subunit, score 1.5e-09"
FT                   /inference="protein motif:HMMPfam:PF04851"
FT   misc_feature    46500..47012
FT                   /gene="priA"
FT                   /locus_tag="BCAL0041"
FT                   /note="HMMPfam hit to PF00270, DEAD/DEAH box helicase,
FT                   score 3.9e-18"
FT                   /inference="protein motif:HMMPfam:PF00270"
FT   misc_feature    46569..46592
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    46773..46814
FT                   /note="PS00036 bZIP transcription factors basic domain
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00036"
FT   misc_feature    47433..47705
FT                   /gene="priA"
FT                   /locus_tag="BCAL0041"
FT                   /note="HMMPfam hit to PF00271, Helicase conserved
FT                   C-terminal domain, score 2.4e-06"
FT                   /inference="protein motif:HMMPfam:PF00271"
FT   CDS_pept        48506..52438
FT                   /transl_table=11
FT                   /gene="putA"
FT                   /locus_tag="BCAL0042"
FT                   /product="bifunctional PutA protein [includes: proline
FT                   dehydrogenase; delta-1-pyrroline-5-carboxylate
FT                   dehydrogenase]"
FT                   /EC_number="1.5.99.8"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50348"
FT                   /db_xref="GOA:B4EF02"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR005933"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR024082"
FT                   /db_xref="InterPro:IPR024089"
FT                   /db_xref="InterPro:IPR025703"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="InterPro:IPR041349"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF02"
FT                   /protein_id="CAR50348.1"
FT                   /translation="MASTTLGVKVDDLLRSRLKDAAARLERTPHWLIKQAIFAYLERIE
FT                   HGQLPPELSGHSGVTELADGQAADGDDDNSPHPFLEFAQNVQPQSVLRAAITAAYRRPE
FT                   PECVPFLLGQARLPANLQADVQALATKLAEALREKSSGGGVEGLIHEFSLSSQEGVALM
FT                   CLAEALLRIPDRATRDALIRDKISKGDWRSHVGHAPSLFVNAATWGLMITGKLVTTNSE
FT                   AGLSSALTRLIGRGGEPLIRKGVDMAMRLMGEQFVTGETISEALANSRKYEARGFRYSY
FT                   DMLGEAATTEEDAQRYYASYEQAIHAIGKAAGGRGIYEGPGISIKLSALHARYSRSQQD
FT                   RTMSELLPRVRALALLARRYDIGLNIDAEEADRLELSLDLLEALCFDPELAGWNGIGFV
FT                   VQGYQKRCPFVIDYLIDLARRSRHRLMIRLVKGAYWDTEIKRAQVDGLEGYPVYTRKIY
FT                   TDVSYLACAKKLLAAPDAVYPQFATHNAYTLAAIYQLAGQNYYPGQYEFQCLHGMGEPL
FT                   YEEVTGRDKLNRPCRVYAPVGTHETLLAYLVRRLLENGANTSFVNRIADKTVSVKELVA
FT                   DPVDEASKVVPLGAPHAKIPLPRNLYGDERPNSMGLDLSNEHRLASLSSALLASAHHPW
FT                   RAAPMLADDALADAPARDVRNPADQRDVVGTVSEATSEHVSAALAHAVAAAPIWQATPV
FT                   DARADCLVRAADLLEAQMHTLMGLIVREAGKSLPNAIAEIREAVDFLRYYAAQIRGEFS
FT                   NDTHRPLGPVVCISPWNFPLAIFMGQVAAALAAGNTVLAKPAEQTPLIAAQAVRLLREA
FT                   GVPAGAVQLLPGTGETVGAALVADARTRAVMFTGSTEVARLINKTLSARLDPDGKPIPL
FT                   IAETGGQNAMIVDSSALAEQVVADVMQSSFDSAGQRCSALRVLCLQDDVADRTLTMLKG
FT                   AMHELALGNPDRLSTDVGPVIDAEAKQTIDTHIAAMKDKGHTVTQLPMPDACAHGTFVP
FT                   PTLIEIGSIDELKREVFGPVLHVVRYRRSQLDKLLEQIRATGYGLTLGIHTRIDETIAH
FT                   VISNAHVGNIYVNRNVIGAVVGVQPFGGEGLSGTGPKAGGALYLQRLLATRPSGLPRAL
FT                   AQSLVADGATESDARGNPAAALTTLRDWLIEQREPALAARCDGYLAQVPAGATAVLTGP
FT                   TGERNTYTLGPRGTVLCVAATPGGARAQFAAVLATGNRALFAGAAGEALVAALPASLKA
FT                   HAAVRKQADAPFDAVLFEGDSDELQTLVKDVAQRPGPIVSVQGVSAGAFENGGAEDYAL
FT                   ERLLTERSVSVNTAAAGGNANLMTIG"
FT   misc_feature    49178..50209
FT                   /gene="putA"
FT                   /locus_tag="BCAL0042"
FT                   /note="HMMPfam hit to PF01619, Proline dehydrogenase, score
FT                   6.9e-174"
FT                   /inference="protein motif:HMMPfam:PF01619"
FT   misc_feature    50441..51808
FT                   /gene="putA"
FT                   /locus_tag="BCAL0042"
FT                   /note="HMMPfam hit to PF00171, Aldehyde dehydrogenase
FT                   family, score 1.7e-109"
FT                   /inference="protein motif:HMMPfam:PF00171"
FT   misc_feature    50969..50986
FT                   /note="PS00343 Gram-positive cocci surface proteins
FT                   'anchoring' hexapeptide."
FT                   /inference="protein motif:Prosite:PS00343"
FT   misc_feature    51206..51241
FT                   /note="PS00070 Aldehyde dehydrogenases cysteine active
FT                   site."
FT                   /inference="protein motif:Prosite:PS00070"
FT   CDS_pept        52523..53662
FT                   /transl_table=11
FT                   /locus_tag="BCAL0043"
FT                   /product="putative extracellular ligand-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50349"
FT                   /db_xref="GOA:B4EF03"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF03"
FT                   /protein_id="CAR50349.1"
FT                   /translation="MQHTMKKVAGATFVAVMSLAGTAHADDVKIGYAGPMTGAQAHYGK
FT                   DMQNGIVLALEDFNATNPKIGGKPVKFVLSTQDDQADPRTGTTVAQKLVDDGIKGMLGH
FT                   FNSGTTIPASRIYANAGIPEIAMATAPEYTQQGYKTTFRMMTSDTQQGSVAGTFASKDL
FT                   GMKKIAIVDDRTAYGQGLADQFEKAAKAGGATIVDREFTNDKAVDFKAILTKLKAAKPD
FT                   LVYYGGADSQAAPMVKQMKALGFNAPLMSGEMVKTPTFLKIAGNAADGTIASLAGLPLE
FT                   EMPGGKTYADKYKKRFGEDVQTYSPYAYDGAMAMLNAMKKADSTDPAKYLPVLAKTDMA
FT                   GVTSTHVAYDAKGDLKNGGITMYKVEKGEWKPLKSIGGK"
FT   sig_peptide     52523..52597
FT                   /locus_tag="BCAL0043"
FT                   /note="Signal peptide predicted for BCAL0043 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.999 between residues 25 and 26"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    52658..53626
FT                   /locus_tag="BCAL0043"
FT                   /note="HMMPfam hit to PF01094, Receptor family ligand
FT                   binding region, score 2.9e-48"
FT                   /inference="protein motif:HMMPfam:PF01094"
FT   repeat_region   53748..53750
FT                   /note="duplicated insertion sequence target"
FT   mobile_element  53751..55189
FT                   /mobile_element_type="insertion sequence:ISBcen9"
FT                   /note="putative IS element - ISBcen9"
FT   repeat_region   53751..53775
FT                   /note="IS element imperfect inverted repeat region"
FT   CDS_pept        53796..54320
FT                   /transl_table=11
FT                   /locus_tag="BCAL0044"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50350"
FT                   /db_xref="GOA:B4E6E7"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6E7"
FT                   /protein_id="CAR50350.1"
FT                   /translation="MARYTEQFKLSVVKRCIGGEAIRAVARTHGLSHSTVSQWYATYQA
FT                   HGKDGVRRKYNSYDVAFRLKVVQHMREHGVSSKEAAARFNIRNPSAVLEWARRYDDGGL
FT                   TALAPRPKGRRPTAMPKTPPAQPLNPTDGTDTRTREDLLQELNYLRMENAYLKKLRALV
FT                   QAQAVPRKKRK"
FT   misc_feature    53853..53918
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1703.000, SD 4.99 at aa 20-41, sequence
FT                   EAIRAVARTHGLSHSTVSQWYA"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        54320..55156
FT                   /transl_table=11
FT                   /locus_tag="BCAL0045"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50351"
FT                   /db_xref="GOA:B4E6E8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6E8"
FT                   /protein_id="CAR50351.1"
FT                   /translation="MLELRQQFPLAGLLRVAGLARSTFYYQCKALAAPDRHASVKAKIR
FT                   ALFEQHKGRYGYRRITLALRRLGQMINHKTVARLMRKMQLKSCVRVKKYRAYRGNTCKT
FT                   APHLLQRQFHAARPNEKWVTDITEFSVGGQKLYLSPVLDLYNGEIIAYQTHTRPAFQMV
FT                   TDMLRKALRRLQPDERPMLHSDQGWHYQMPGWRLMLEQRSLAQSMSRKGNCLDNAAMES
FT                   FFGTLKSEFFYLNHFSSIEQLRIGLKRYIRYYNHERIKLKLKGLSPVQYRTQPHPA"
FT   misc_feature    54659..55138
FT                   /locus_tag="BCAL0045"
FT                   /note="HMMPfam hit to PF00665, Integrase core domain, score
FT                   5.1e-42"
FT                   /inference="protein motif:HMMPfam:PF00665"
FT   repeat_region   complement(55165..55189)
FT                   /note="IS element imperfect inverted repeat region"
FT   repeat_region   55190..55192
FT                   /note="duplicated insertion sequence target"
FT   CDS_pept        complement(55228..56736)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0046"
FT                   /product="putative fatty-acid CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0046"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50352"
FT                   /db_xref="GOA:B4EEZ5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B4EEZ5"
FT                   /protein_id="CAR50352.1"
FT                   /translation="MNLVAALDRVARATPDKPFLVSESATITYAAARARSHRAAAVLSA
FT                   LGVAAGDRVAAMCFNTPAFVDLMFGAWRLGAAFVPINHKLQAPEVDYVLEHSGSTALLF
FT                   DVALAPVVERLVHPARRLVTEGELDGVPNFDTMCATMDGLAGIEPADDDIAQILYTSGT
FT                   TGRPKGCVHSHRTVTLAAMQAALAIGIGRNERTLMAMPIWHSSPLNNWFGGTLVAGGTV
FT                   VLLREYHPLRFLQTVERERVTLYFGAPVSYTLPLDTIDGFAAFDLSSVRAWLYGGGPIG
FT                   AAQAERLAQAYRSHAFFQVYGMTETGPAGTTLYPDEQIAKAGSIGRQGGPGVDLRVVRM
FT                   DGVDARPGETGEIWLKADSMMLGYLDDAAATRAAFAPDGWYRTDDVARIDQEGYLFIVD
FT                   RLKDMIVTGGENVYSKEVEDVLGAHPDIAEAAVVGVPHPDWGETVVAHVVMRANAVRDA
FT                   DALRTFCGERLAAYKIPREFTFAQALPRTPTGKLQKFLLRVRGN"
FT   misc_feature    complement(55441..56655)
FT                   /locus_tag="BCAL0046"
FT                   /note="HMMPfam hit to PF00501, AMP-binding enzyme, score
FT                   3.9e-114"
FT                   /inference="protein motif:HMMPfam:PF00501"
FT   misc_feature    complement(56233..56268)
FT                   /note="PS00455 Putative AMP-binding domain signature."
FT                   /inference="protein motif:Prosite:PS00455"
FT   CDS_pept        complement(56788..58440)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0047"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50353"
FT                   /db_xref="GOA:B4EEZ6"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR041504"
FT                   /db_xref="UniProtKB/TrEMBL:B4EEZ6"
FT                   /protein_id="CAR50353.1"
FT                   /translation="MTDSTHAVTNQFDELVDYNLFATDLALRDALARAGADWAVPQLDA
FT                   YAARLGSADTARLADEANRHTPELNTFDRRGRRIDRVDFHPAWHALLGQYRHEGFVSLA
FT                   FRDARRGRWAATAAGFYLHGQIEAGTLCPATMTQAAIPVLQKEPALWDLLRDKLYSDDY
FT                   DPRDVPVADKRAIWFGMGMTEKQGGSDVRANTTLATPVGAGGRGGEYRLRGHKWFFSAP
FT                   MCDAHLVVARTEAGSPSCFYVPRWRPDGTKNAVEIQRLKNKVGNRSNSSSEIELNDAWG
FT                   IMLGDEGRGIPTIIEMATYTRLNCVLGSAAMLRQGVVQAIAYTRQRHAFGRALAEQPLM
FT                   RTVLADLALESEAALSLAMRLADAFERDDSPRERAWKRIVTPAAKFWVCKRAVELTGEV
FT                   MEVFGGNGYVDDGPIARLFREAPVNSIWEGSGNVMCLDVLRAVSREPDAAAALFDELAD
FT                   LGAGEPRIRAALDGLRAMLAAPADTLEASGRVFAQRLALVAQACLLRRDAPAAVADAFV
FT                   ATRLAAPDWGRIAGGFDPHAIDVAALLQRAYPA"
FT   misc_feature    complement(57112..57579)
FT                   /locus_tag="BCAL0047"
FT                   /note="HMMPfam hit to PF00441, Acyl-CoA dehydrogenase,
FT                   C-terminal doma, score 1.5e-44"
FT                   /inference="protein motif:HMMPfam:PF00441"
FT   misc_feature    complement(57145..57528)
FT                   /locus_tag="BCAL0047"
FT                   /note="HMMPfam hit to PF08028, Acyl-CoA dehydrogenase,
FT                   C-terminal doma, score 8.6e-06"
FT                   /inference="protein motif:HMMPfam:PF08028"
FT   misc_feature    complement(57181..57240)
FT                   /note="PS00073 Acyl-CoA dehydrogenases signature 2."
FT                   /inference="protein motif:Prosite:PS00073"
FT   misc_feature    complement(57739..57906)
FT                   /locus_tag="BCAL0047"
FT                   /note="HMMPfam hit to PF02770, Acyl-CoA dehydrogenase,
FT                   middle domain, score 1.6e-16"
FT                   /inference="protein motif:HMMPfam:PF02770"
FT   misc_feature    complement(57862..57900)
FT                   /note="PS00072 Acyl-CoA dehydrogenases signature 1."
FT                   /inference="protein motif:Prosite:PS00072"
FT   CDS_pept        58561..59229
FT                   /transl_table=11
FT                   /locus_tag="BCAL0048A"
FT                   /product="TetR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0048A"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50354"
FT                   /db_xref="GOA:B4EEZ7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:B4EEZ7"
FT                   /protein_id="CAR50354.1"
FT                   /translation="MPPRHVQVPAPPGSPAAQPAPALRRRPRQSRAQASSDALQQAFVQ
FT                   LLLERGYAKATIREIAAVAGVSIGTFYEYFGDKQSLAALCIHRRVLALADRLRDAVQRL
FT                   RGAPRAELAAALVDLQVETIAADAALWGALFVLERQVSPLAAYRRHYDAYVALWRDALA
FT                   HAADPPPAARLDGLARMAHTICYGGLSQALLTLGPALDFAAQRRELRAVLLAYLAAAHA
FT                   "
FT   misc_feature    58675..58815
FT                   /locus_tag="BCAL0048A"
FT                   /note="HMMPfam hit to PF00440, Bacterial regulatory
FT                   proteins, tetR family, score 1.6e-12"
FT                   /inference="protein motif:HMMPfam:PF00440"
FT   misc_feature    58711..58803
FT                   /note="PS01081 Bacterial regulatory proteins, tetR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS01081"
FT   misc_feature    58723..58788
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1231.000, SD 3.38 at aa 55-76, sequence
FT                   ATIREIAAVAGVSIGTFYEYFG"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        59441..60595
FT                   /transl_table=11
FT                   /locus_tag="BCAL0049"
FT                   /product="putative aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50355"
FT                   /db_xref="GOA:B4EEZ8"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B4EEZ8"
FT                   /protein_id="CAR50355.1"
FT                   /translation="MRSATAPRSKLPDVGTTIFTVIGQLAAQHNALNLSQGAPNFAPDP
FT                   ALVEGVARAMRDGHNQYAPMAGVIALRERLAEKTEALYGARYDPATEITVIASASEGLY
FT                   AAISALVHPGDEVIYFEPSFDSYAPIVRLQGATPVAIKLSPEHFRVDWDEVAAAITPRT
FT                   RMIIVNTPHNPTATVFSADDLERLARLTRDTGIVVLSDEVYEHVVFDGAQHQSVARHRE
FT                   LAERSVIVSSFGKSFHVTGWRVGHCLAPAELMDEIRKVHQFMVFSADTPMQVAFAEILA
FT                   RPDSYLGLSAFYQAKRDLLARELADSRFELLPSEGSFFMLARFRHFSDESDGDFVLRLI
FT                   RDARVATIPLSAFYTDGTDAGVIRLSFSKDDATLVEGARRLRSL"
FT   misc_feature    59525..60583
FT                   /locus_tag="BCAL0049"
FT                   /note="HMMPfam hit to PF00155, Aminotransferase class I and
FT                   II, score 2.3e-59"
FT                   /inference="protein motif:HMMPfam:PF00155"
FT   repeat_region   60637
FT                   /note="duplicated insertion sequence target"
FT   mobile_element  60638..62062
FT                   /mobile_element_type="insertion sequence:ISBcen5"
FT                   /note="putative IS element - ISBcen5"
FT   repeat_region   60645..60657
FT                   /note="IS element inverted repeat region"
FT   CDS_pept        60764..61783
FT                   /transl_table=11
FT                   /locus_tag="BCAL0050"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50356"
FT                   /db_xref="GOA:B4EDC6"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:B4EDC6"
FT                   /protein_id="CAR50356.1"
FT                   /translation="MNSMAVGVDVAKQVFQVHYVDRETGGIVNKAIKRAKFLEFFANRA
FT                   ACLIGMEACGGAHHWARQLTQMGHEVRLMPAEFVKAFNIRNKNDAADARAIWLAVQQPG
FT                   KPVAVKTEMQQAMVALHRMREQLVKFRTMQVNGLRGLLTEYGEVMSKGRAKLDKEIPVV
FT                   LGRIAERLPAALIDTLREQWNGLAKLDEQIAEIERRMREWKKEDKAVKAISEIPGVGLL
FT                   TATAAVAMMGDPKAFSSGREFAAWAGLVPKQTGSGGKVNLHGISKRGDMYLRTLLIHGA
FT                   RSVLTHAKEPGEWIEQMKKRRPPNVVIVALANKMARTIWAVLAHDRPYQKGYVSVKPA"
FT   misc_feature    61319..61645
FT                   /locus_tag="BCAL0050"
FT                   /note="HMMPfam hit to PF02371, Transposase
FT                   IS116/IS110/IS902 family, score 2e-31"
FT                   /inference="protein motif:HMMPfam:PF02371"
FT   repeat_region   complement(62047..62059)
FT                   /note="IS element inverted repeat region"
FT   repeat_region   62063
FT                   /note="duplicated insertion sequence target"
FT   CDS_pept        62070..62858
FT                   /transl_table=11
FT                   /locus_tag="BCAL0051"
FT                   /product="periplasmic solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50357"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF00"
FT                   /protein_id="CAR50357.1"
FT                   /translation="MKHTATLKLAFALACAIGSGAALADAPTLRFGLEAQYPPFESKAP
FT                   NGDLQGFDIDVGNAVCQTAKLSCKWVETSFDGLIPALKGRKFDAINSAMNATEQRRQAI
FT                   DFTTIIYRVPTQLIARTGSGLLPTPESLKGKRVGVLQASIQETFAKAHWEPAGVAIVAY
FT                   QDQNQAYADLVAGRLDATLVLAPSGQRGFLSRPDGKGFSFVGQPVHDDKILGSGIAFGL
FT                   RKGDDALKAKLDAAIDKLKADGTVKSLGLKYFGDIDISTK"
FT   sig_peptide     62088..62141
FT                   /locus_tag="BCAL0051"
FT                   /note="Signal peptide predicted for BCAL0051 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.999 between residues 18 and 19"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    62154..62837
FT                   /locus_tag="BCAL0051"
FT                   /note="HMMPfam hit to PF00497, Bacterial extracellular
FT                   solute-binding prot, score 6.3e-75"
FT                   /inference="protein motif:HMMPfam:PF00497"
FT   misc_feature    62220..62261
FT                   /note="PS01039 Bacterial extracellular solute-binding
FT                   proteins, family 3 signature."
FT                   /inference="protein motif:Prosite:PS01039"
FT   CDS_pept        62874..64304
FT                   /transl_table=11
FT                   /locus_tag="BCAL0052"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50358"
FT                   /db_xref="GOA:B4EF01"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF01"
FT                   /protein_id="CAR50358.1"
FT                   /translation="MPTPNPTVAGRAPDGRPLPDDAVDAVLAAELGDALVTRAADIDPR
FT                   YFTAYNEPAGVRPRALVRPRSVDDVSRALALCMRLGQPVVPQGGLTGLARGAVALGGEV
FT                   VLSMERFAGIEALDAAAGTITVRAGTPLQTVQDAAEAAGFTFGVDLGARGSCQIGGMLA
FT                   TNAGGTRAIRYGMMREQVLGLEAVLADGTVVSSMNRMLKNNAGYDLKQLFIGSEGTLGV
FT                   VTRAVLRLHPLLAAPATALCRVRDYDAVVALWNRVRTLPEVVSFEAMWPAFYDYVARHT
FT                   PGVSAPFVGDGGFVVLIECATSAPGGDAHHALETALAAGFDAALVDDAVLATSERQARD
FT                   LWTLREGLAIDALPHLVNFDVSLPTGELGAFAERCEAVLRTRWPALTCLFFGHVGDGNV
FT                   HIGVSLAAMTDADADALDHCVYAVVRDMGGSVSAEHGIGVLKRPYLAHTRSDAEIGLMR
FT                   RLKAALDPRGILNPGKVL"
FT   misc_feature    63045..63464
FT                   /locus_tag="BCAL0052"
FT                   /note="HMMPfam hit to PF01565, FAD binding domain, score
FT                   3.6e-47"
FT                   /inference="protein motif:HMMPfam:PF01565"
FT   misc_feature    63186..63215
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00339"
FT   misc_feature    63570..64298
FT                   /locus_tag="BCAL0052"
FT                   /note="HMMPfam hit to PF02913, FAD linked oxidases,
FT                   C-terminal domain, score 2e-48"
FT                   /inference="protein motif:HMMPfam:PF02913"
FT   CDS_pept        complement(64350..64922)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0053"
FT                   /product="PadR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50359"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF06"
FT                   /protein_id="CAR50359.1"
FT                   /translation="MSTSRPSPLALAVLATLTETPMHPYGMLQQLKARGYDEVVNVRQR
FT                   TSLYQTIDRLLRDGLIAVHDTERDGAFPERTLYALTEAGHTAGQAWLHALLAEPAREFP
FT                   AFGAGLAFLPLLDAEDARHQLELRIARLDAERERLEALRATAQADQVPRLFLLQNEHAL
FT                   VLLNAELDWARSVVEHLKIGALRWVDG"
FT   misc_feature    complement(64650..64916)
FT                   /locus_tag="BCAL0053"
FT                   /note="HMMPfam hit to PF03551, Transcriptional regulator
FT                   PadR-like family, score 6.4e-09"
FT                   /inference="protein motif:HMMPfam:PF03551"
FT   CDS_pept        complement(64991..65422)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0054"
FT                   /product="MerR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0054"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50360"
FT                   /db_xref="GOA:B4EF07"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011791"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF07"
FT                   /protein_id="CAR50360.1"
FT                   /translation="MKIGELAKAARCTPETIRFYEKEGLMPDAERTDSNYRNYTDVHVE
FT                   RLRFIRNCRALDMAHDEIRALLRLTDTPADRCDSINSLLDDHIGHVDARLAELTQLRDQ
FT                   LTELRRQCVGEHSVEDCGIVHGLATMETVAPAAKRSHLG"
FT   misc_feature    complement(65306..65419)
FT                   /locus_tag="BCAL0054"
FT                   /note="HMMPfam hit to PF00376, MerR family regulatory
FT                   protein, score 4.3e-12"
FT                   /inference="protein motif:HMMPfam:PF00376"
FT   misc_feature    complement(65345..65413)
FT                   /note="PS00552 Bacterial regulatory proteins, merR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00552"
FT   misc_feature    complement(65357..65422)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1631.000, SD 4.74 at aa 1-22, sequence
FT                   MKIGELAKAARCTPETIRFYEK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        65504..68044
FT                   /transl_table=11
FT                   /locus_tag="BCAL0055"
FT                   /product="putative heavy metal resistance membrane ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0055"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50361"
FT                   /db_xref="GOA:B4EF08"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF08"
FT                   /protein_id="CAR50361.1"
FT                   /translation="MTDAKRPHDPRHRHTGGADACCAEARDTQTATVADAAPAAGERAH
FT                   GHDHDHGHDHAAHGKAGHDHDHGHAGDDQHVHGATCSHDHAAHDHAGHDHDHDHDHDHD
FT                   HDHDHAAGDCCAPAALTLAPLPVARATASGHVRSAFRIMQMDCPTEETLIRKKLGGMSE
FT                   VSALEFNLMQRMLTVEHAPGAQPAIESAIRTLGMTPEAATAGAPAARVADAPAKPWWPL
FT                   ALAGVAAIASEGATWAGLPVWLSAALALAAVLACGLTTYKKGWIAIRNGNLNINALMSI
FT                   AVTGAMAIGQWPEAAMVMVLFTIAELIEAKSLDRARNAIQGLMQLAPDTATVQQADGAW
FT                   RTIEAAQVALGAVVRVKPGERIGLDGEVVAGRSTVNQAPITGESLPVEKASGDAVYAGT
FT                   INESGSFDYRVTAVAANSTLARIIHAVEEAQGAKAPTQRFVDQFARVYTPIVFAVALLV
FT                   AVVPPLVMGGAWHDWIYRALVLLVIACPCALVISTPVTIVSGLAAAARRGILVKGGVYL
FT                   EEGRKLAWLALDKTGTITHGKPVQTDFDVHADDADAARVRHLGASLAARSDHPVSQAIA
FT                   AAARDAGTTAFADVQDFEAIVGRGVRGTIDGTRYWLGNHRLVEELERCSTALEAKLDAL
FT                   ERQGKSVVVLVDETRVLGLFAVADTIKDTSRDAIADLHALGIRTAMLTGDNPHTAQAIA
FT                   QQAGIDDARGNQLPEDKLAAVEELSAGGAGAVGMVGDGINDAPALARADIGFAMGAMGT
FT                   DTAIETADVALMDDDLRKIPAFVRLSRATHRVLVQNIGFALGVKVVFLGLTVAGLGTMW
FT                   MAVFADAGASLIVVANGLRLLSSSGAFGGARAQR"
FT   misc_feature    join(66218..66286,66344..66412,66830..66898,66941..67009,
FT                   67856..67924,67937..68005)
FT                   /locus_tag="BCAL0055"
FT                   /note="6 probable transmembrane helices predicted for
FT                   BCAL0055 by TMHMM2.0 at aa 104-126, 146-168, 308-330,
FT                   345-367, 650-672 and 677-699"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    66392..67060
FT                   /locus_tag="BCAL0055"
FT                   /note="HMMPfam hit to PF00122, E1-E2 ATPase, score 6.2e-91"
FT                   /inference="protein motif:HMMPfam:PF00122"
FT   misc_feature    67070..67759
FT                   /locus_tag="BCAL0055"
FT                   /note="HMMPfam hit to PF00702, haloacid dehalogenase-like
FT                   hydrolase, score 1.1e-33"
FT                   /inference="protein motif:HMMPfam:PF00702"
FT   misc_feature    67088..67108
FT                   /note="PS00154 E1-E2 ATPases phosphorylation site."
FT                   /inference="protein motif:Prosite:PS00154"
FT   misc_feature    67403..67426
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(68591..69472)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0056"
FT                   /product="AraC family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50362"
FT                   /db_xref="GOA:B4EF09"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF09"
FT                   /protein_id="CAR50362.1"
FT                   /translation="MPPTETNPEPPAWARYAASVARVHAYISTHLDGPLDLNRLAEVAC
FT                   LSPYHWQRVYRALYGESIVLTVRRMRIVRASEDLVCTTRPLDEIARRAGYGSTHAFARA
FT                   FRDAYGVLPAQHRRTGSHRPIYPLQRGEEDMFKHEVEIRRLPALRGYAVAHTGAYMKVG
FT                   DAFGRIGAWAGQHGLIGPGAKMIGIFYDDPDTTPEAQLRAKACLMPADGAPDVAPVPPV
FT                   ERATIAGGEYAVLLHTGPYADLKTAYQWLYGDWLRHSGREAADAPPFELYLNTPMDTAP
FT                   ADLRTEIHLPLR"
FT   misc_feature    complement(68594..69061)
FT                   /locus_tag="BCAL0056"
FT                   /note="HMMPfam hit to PF06445, Bacterial transcription
FT                   activator, effect, score 6.3e-41"
FT                   /inference="protein motif:HMMPfam:PF06445"
FT   misc_feature    complement(69119..69253)
FT                   /locus_tag="BCAL0056"
FT                   /note="HMMPfam hit to PF00165, Bacterial regulatory
FT                   helix-turn-helix pro, score 6.4e-05"
FT                   /inference="protein motif:HMMPfam:PF00165"
FT   misc_feature    complement(69134..69262)
FT                   /note="PS00041 Bacterial regulatory proteins, araC family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00041"
FT   CDS_pept        69748..71211
FT                   /transl_table=11
FT                   /locus_tag="BCAL0057"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50363"
FT                   /db_xref="GOA:B4EF10"
FT                   /db_xref="InterPro:IPR008910"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF10"
FT                   /protein_id="CAR50363.1"
FT                   /translation="MDASSFITSLQTTLGGYLPKIAGAIGILVIGWLIAVAVRAGALRL
FT                   LNALKVDQRITDSTGQGACVERIIAGGLFWLVLLVTAVGIFNVLNLYAVSNPFSLLVTH
FT                   IVTYLPNLIGGAALTLIAWLIASLLRSLANRALKASKVDATLSESAGMQPMSGYLGDVL
FT                   FWLVILMFLPAILASFALSGLLSPVQGMVDKLLAIVPNIFAAAVIGFVGWVVARVLRGL
FT                   VTNLLVAAGADRLTQGIDSPTPVRVSSLVGTIVYVFVFVPTLISALDALKIDAISIPAT
FT                   NMLNQFLGAVPDIVAAIVIVLVTFYFARFVASLAQKLLEAAGVDGLPAVLGVERVFSGI
FT                   LQPSVLVARLIVFFAMLFASVEAANRLGFSQVRDVVTLFIEFGGHVLMGGVILVIGVWL
FT                   AGLARRVIEQADREHSVLFARIVQFAILGLVFAMGLRAMGIANEIVQLAFGLVLGAIAV
FT                   AVALSFGLGGREAAGKLLDRWFNQRGGGQ"
FT   misc_feature    69757..69915
FT                   /locus_tag="BCAL0057"
FT                   /note="HMMPfam hit to PF05552, Conserved TM helix, score
FT                   5.2e-13"
FT                   /inference="protein motif:HMMPfam:PF05552"
FT   misc_feature    join(69808..69876,69937..70005,70063..70131,70231..70299,
FT                   70327..70395,70492..70560,70603..70671,70780..70839,
FT                   70897..70956,70993..71052,71080..71148)
FT                   /locus_tag="BCAL0057"
FT                   /note="11 probable transmembrane helices predicted for
FT                   BCAL0057 by TMHMM2.0 at aa 34-56, 77-99, 119-141, 175-197,
FT                   207-229, 262-284, 299-321, 358-377, 397-416, 429-448 and
FT                   458-480"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    70030..70188
FT                   /locus_tag="BCAL0057"
FT                   /note="HMMPfam hit to PF05552, Conserved TM helix, score
FT                   1.3e-11"
FT                   /inference="protein motif:HMMPfam:PF05552"
FT   misc_feature    70300..70458
FT                   /locus_tag="BCAL0057"
FT                   /note="HMMPfam hit to PF05552, Conserved TM helix, score
FT                   2.7e-16"
FT                   /inference="protein motif:HMMPfam:PF05552"
FT   misc_feature    70576..70734
FT                   /locus_tag="BCAL0057"
FT                   /note="HMMPfam hit to PF05552, Conserved TM helix, score
FT                   1.2e-11"
FT                   /inference="protein motif:HMMPfam:PF05552"
FT   CDS_pept        71401..72813
FT                   /transl_table=11
FT                   /locus_tag="BCAL0058"
FT                   /product="putative ethanolamine permease"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50364"
FT                   /db_xref="GOA:B4EF11"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004757"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF11"
FT                   /protein_id="CAR50364.1"
FT                   /translation="MKAESNGRPAAGAKLSGQPALQQTLGTCQLWGIAVGLVISGEYFG
FT                   WSYGWASAGTLGFVITALFVAAMYTTFIFSFTELTTSIPHAGGPFAYARRAFGPTGGYL
FT                   AGAATLVEFVFAPPAIALAIGAYLHVQFPGLEPKHAAMGAYLVFMALNIVGVQIAATFE
FT                   LVVTLLAIFELLVFMGVVSPGFAWSNFTKGGWSGADHFSLGAFHGMFAAIPFAIWFFLA
FT                   IEGVAMAAEEAKNPKRSIPIAYVAGILTLVALAIGVMVFAGGAGDWTKLANINDPLPQA
FT                   MKYIVGANSGWMHMLVWLGLFGLVASFHGIILGYSRQIFALAREGYLPEWLAKVHPRFK
FT                   TPYRAILAGGVVGIAAIYSDELIQFGGQTLTANIVTMSVFGAIVMYIVSMAALFKLRRS
FT                   QPNLERPFRAPLYPIFPAFAILAALVCLGTMVYFNGLVALVFVGFLAVGYAYFLATRAQ
FT                   RASAPGDALLEE"
FT   misc_feature    join(71482..71550,71560..71628,71704..71772,71815..71883,
FT                   71902..71970,72013..72081,72118..72186,72274..72342,
FT                   72424..72477,72520..72588,72625..72693,72706..72759)
FT                   /locus_tag="BCAL0058"
FT                   /note="12 probable transmembrane helices predicted for
FT                   BCAL0058 by TMHMM2.0 at aa 28-50, 54-76, 102-124, 139-161,
FT                   168-190, 205-227, 240-262, 292-314, 342-359, 374-396,
FT                   409-431 and 436-453"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    71485..72801
FT                   /locus_tag="BCAL0058"
FT                   /note="HMMPfam hit to PF00324, Amino acid permease, score
FT                   1.1e-07"
FT                   /inference="protein motif:HMMPfam:PF00324"
FT   CDS_pept        72953..74350
FT                   /transl_table=11
FT                   /gene="eutB"
FT                   /locus_tag="BCAL0059"
FT                   /product="ethanolamine ammonia-lyase heavy chain"
FT                   /EC_number="4.3.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0059"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50365"
FT                   /db_xref="GOA:B4EF12"
FT                   /db_xref="InterPro:IPR010628"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF12"
FT                   /protein_id="CAR50365.1"
FT                   /translation="MSYTETIGPRTYRFADLKTLLAKASPLRSGDQLAGVAAASEEERV
FT                   AAKIALAGVPLKAFLNEAVIPYEDDEVTRLIIDDHDAQAFADISHLTVGDFRNWLLSPA
FT                   ADGAALERIAPGLTPEMVAAVSKLMRNQDLIAAARKRRVVTRFRNTVGLAGRMSVRLQP
FT                   NHPTDDVKGIAASMLDGLMYGCGDAMIGINPATDSLAAIVKLLAMIDGFRERYGVPTQS
FT                   CVLTHVTNTIAAIEKGAPVDLVFQSIAGTEKANASFGISLALLGEAREAALALKRGTVG
FT                   NNLMYFETGQGSALSANAHFGVDQQTCEVRAYAVARKFEPFLVNTVVGFIGPEYLYDGK
FT                   QIIRAGLEDHFCGKLLGVPMGCDICYTNHAEADQDDMDTLLTLLGAAGINFIMGIPGAD
FT                   DVMLNYQSTSFHDQLYVREVLGLRRAPEFEEWLETMEIADAHGALRAATARVPLLAGAN
FT                   DWMGVSA"
FT   misc_feature    72983..74314
FT                   /gene="eutB"
FT                   /locus_tag="BCAL0059"
FT                   /note="HMMPfam hit to PF06751, Ethanolamine ammonia lyase
FT                   large subunit (Eu, score 0"
FT                   /inference="protein motif:HMMPfam:PF06751"
FT   CDS_pept        74347..75144
FT                   /transl_table=11
FT                   /gene="eutC"
FT                   /locus_tag="BCAL0060"
FT                   /product="ethanolamine ammonia-lyase light chain"
FT                   /EC_number="4.3.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50366"
FT                   /db_xref="GOA:B4EF13"
FT                   /db_xref="InterPro:IPR009246"
FT                   /db_xref="InterPro:IPR042251"
FT                   /db_xref="InterPro:IPR042255"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF13"
FT                   /protein_id="CAR50366.1"
FT                   /translation="MSDAVEKNPWAQLKSFTNARIALGRAGNSLPTAPLLAFNLSHAQA
FT                   RDAVHQPLDADALRREIEAAGMLPTLRVQSAAPDRDHYLRRPDLGRKLSDDSRGLLAGY
FT                   GAALDEAPDVAFVVGDGLSAFAAAKQALPLLQAVRPRLDADGWRIGPVVVATQARVALG
FT                   DEIGELLRAKVVAMLIGERPGLSSPDSLGVYLTWAPKVGCHDALRNCISNVRPEGLPHA
FT                   AAAHKLHYLMTHARRLGLTGVGLKDDSDALLPAAEAERIGVTT"
FT   misc_feature    74353..75084
FT                   /gene="eutC"
FT                   /locus_tag="BCAL0060"
FT                   /note="HMMPfam hit to PF05985, Ethanolamine ammonia-lyase
FT                   light chain (EutC, score 7.7e-112"
FT                   /inference="protein motif:HMMPfam:PF05985"
FT   CDS_pept        complement(75137..76021)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0061"
FT                   /product="LysR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50367"
FT                   /db_xref="GOA:B4EF14"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF14"
FT                   /protein_id="CAR50367.1"
FT                   /translation="MENLTGIVAFVRAAEALSFVAAGRALGISASAVGKTIAKLEQSLG
FT                   VRLFNRTTRRVTLTEEGRHFYERCQRILEDFRDAEATVTASAQRPRGKLRVSLPVIGYR
FT                   FLLPVLPEFRQRYPDVELDLDFNDRMVDVVEGGFDAVIRSGPLSDSSLMSRRLGPFAFV
FT                   LCATPAYLAQAGTPRTPRELEAHDCVRYCFPTTGKLQDWALAADDGTPLKLRTAMTCNN
FT                   MEALRGAVLAGLGIGYMPDFLARDALEHGALVTVLDDYRIAPGQFSIVWPSSRQLSPKL
FT                   RVFVDFLCERLFR"
FT   misc_feature    complement(75152..75763)
FT                   /locus_tag="BCAL0061"
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 1.2e-58"
FT                   /inference="protein motif:HMMPfam:PF03466"
FT   misc_feature    complement(75833..76012)
FT                   /locus_tag="BCAL0061"
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix, score 9.8e-16"
FT                   /inference="protein motif:HMMPfam:PF00126"
FT   misc_feature    complement(75878..75970)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00044"
FT   misc_feature    complement(75908..75973)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1053.000, SD 2.77 at aa 17-38, sequence
FT                   LSFVAAGRALGISASAVGKTIA"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        76174..77799
FT                   /transl_table=11
FT                   /locus_tag="BCAL0062"
FT                   /product="Major Facilitator Superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50368"
FT                   /db_xref="GOA:B4EF15"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF15"
FT                   /protein_id="CAR50368.1"
FT                   /translation="MMDHPVSAVSALAARRRAWVLAAVCMAAVALPLSFSGGAVATPAI
FT                   GRDLHGSPVAMNWITNAFMLAFGSFLMASGALADQFGRKRLFAIGVGGFTLMSVALAFA
FT                   PSMLAVDLLRAAQGLAAAAALAGGTAALAQEFDGAARTRAFSLLGTTFGIGLAFGPVLA
FT                   GGLIGHYGWRAIFVTSAVAGLLSLAFGLPRMHESRDPHATGLDWPGTAAFTTALTLFTF
FT                   GVIEAPARGWSSPLVIALLAGAALGACTFVTIETRVARPMLDLSLFRIARFVGVQVLPV
FT                   STCCCYIVLLVVLPLRFIGIDGFSEIDAGWLMLAISAPMLVVPLVAATLTRWLSAGVIS
FT                   GLGLLVAAAGLVWLGIALRGGAGPAAIAPMLAIGVGAGMPWGLMDGLSVSVVPKERAGM
FT                   ATGIFSTTRVAGEGIALAIVGAVLAALAQAGLAHAAGAAGAADAPDATLRAAARLATGD
FT                   LAGAAAALPGVGRAALIASYTHAFDRLLMGLAVVTVLCAVVVFGFLGRRPAADETGDDA
FT                   DGRAPADASARSRIEPACAETHGR"
FT   sig_peptide     76174..76296
FT                   /locus_tag="BCAL0062"
FT                   /note="Signal peptide predicted for BCAL0062 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.994) with cleavage site
FT                   probability 0.962 between residues 41 and 42"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(76228..76296,76339..76407,76432..76500,76510..76569,
FT                   76606..76674,76687..76746,76780..76848,76876..76935,
FT                   76993..77061,77104..77157,77170..77238,77281..77349,
FT                   77410..77478,77626..77685)
FT                   /locus_tag="BCAL0062"
FT                   /note="14 probable transmembrane helices predicted for
FT                   BCAL0062 by TMHMM2.0 at aa 19-41, 56-78, 87-109, 113-132,
FT                   145-167, 172-191, 203-225, 235-254, 274-296, 311-328,
FT                   333-355, 370-392, 413-435 and 485-504"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    76243..77445
FT                   /locus_tag="BCAL0062"
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 5.9e-48"
FT                   /inference="protein motif:HMMPfam:PF07690"
FT   misc_feature    76393..76443
FT                   /note="PS00216 Sugar transport proteins signature 1."
FT                   /inference="protein motif:Prosite:PS00216"
FT   misc_feature    76888..76920
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(77942..78475)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0063"
FT                   /product="putative FMN flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50369"
FT                   /db_xref="GOA:B4EF16"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF16"
FT                   /protein_id="CAR50369.1"
FT                   /translation="MRAGALPVEARRRVWHVACVRITDPHATAHAPTDTMNDRGPLTDD
FT                   AIAFIREQAFLIVATADAAGNGDCSYRGRQPRADGSFTPLVDIPDRRTLVLPDFAGNNL
FT                   LNTIGNLLVNPAIALLFVDFVRQTTWLVQGRATLDEDAQARAHLWPDALRYLVIDVERA
FT                   QARADAALPPLVLA"
FT   misc_feature    complement(78047..78352)
FT                   /locus_tag="BCAL0063"
FT                   /note="HMMPfam hit to PF01243, Pyridoxamine 5'-phosphate
FT                   oxidase, score 1.2e-10"
FT                   /inference="protein motif:HMMPfam:PF01243"
FT   CDS_pept        78692..80218
FT                   /transl_table=11
FT                   /gene="acoD"
FT                   /locus_tag="BCAL0064"
FT                   /product="acetaldehyde dehydrogenase"
FT                   /EC_number="1.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50370"
FT                   /db_xref="GOA:B4EF17"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF17"
FT                   /protein_id="CAR50370.1"
FT                   /translation="MNPFDLKQLGLDVEYPYRQQYDNYIGGKWVAPVKGEYFENVSPIN
FT                   GQPFCRIPRSGADDIELALDAAHAARRKWGKTSVAERANLLLAAADRMEKNLKLLAVAE
FT                   TIDNGKPLRETMAADLPLAIDHFRYFAGCIRAQEGGISEIDDNTVAYHFHEPLGVVGQI
FT                   IPWNFPLLMAAWKLAPALAAGCCVVMKPAEQTPASVLVLMELIGDLFPAGTINIVNGFG
FT                   KEAGEALATSKRIAKIAFTGSTPVGKHILRAAADSLIPSTVELGGKSPNIFFADVLDQD
FT                   DAFLDKALEGLAMFALNQGEVCTCPSRILIQESIYERFIEKAVARVERIKSGHPLDLQT
FT                   MIGAQASQQQLDKILSYIDIGRGEGAQCLTGGERAAPAADLGTGYYVKPTMLLGNNKMR
FT                   VFQEEIFGPVASVMTFKDEQEAIELANDTFYGLGAGVWTRNGTRAYRMGREVEAGRVWT
FT                   NCYHLYPAHAAFGGYKQSGIGRETHKMALSNYQQTKCLLVSYQAEALGFF"
FT   misc_feature    78776..80179
FT                   /gene="acoD"
FT                   /locus_tag="BCAL0064"
FT                   /note="HMMPfam hit to PF00171, Aldehyde dehydrogenase
FT                   family, score 1.7e-224"
FT                   /inference="protein motif:HMMPfam:PF00171"
FT   misc_feature    78899..78922
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    79478..79501
FT                   /note="PS00687 Aldehyde dehydrogenases glutamic acid active
FT                   site."
FT                   /inference="protein motif:Prosite:PS00687"
FT   misc_feature    79577..79612
FT                   /note="PS00070 Aldehyde dehydrogenases cysteine active
FT                   site."
FT                   /inference="protein motif:Prosite:PS00070"
FT   CDS_pept        80395..80943
FT                   /transl_table=11
FT                   /locus_tag="BCAL0065"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50371"
FT                   /db_xref="GOA:B4EF18"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF18"
FT                   /protein_id="CAR50371.1"
FT                   /translation="MAEPPRSFPRHPVFHPGELDAQHRFGVADEAERMSDAVTTRLSLG
FT                   VRQFVESQPFMFVGMASGAGASMTCDIVQSRRDANGDLLPVVRVIDTKTLRFALPAAHG
FT                   GDGGRIDAAACDGRGVGLLFVDFVRGLRYRINGRATLRADLPEADAAPWAAGSAIVELA
FT                   IAHAYGNCGTRVVRLKPAR"
FT   CDS_pept        81149..82165
FT                   /transl_table=11
FT                   /locus_tag="BCAL0066"
FT                   /product="AraC family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50372"
FT                   /db_xref="GOA:B4EF19"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF19"
FT                   /protein_id="CAR50372.1"
FT                   /translation="MDQHVVSTEEPTAEDTRRSAQGDDAFAGQAVVSVAHDADEQARNL
FT                   IGWRQTYDQLAAGRFVGTLTELPLDTMKLFRESTSHLLRQACEVRGDAYWFGIPLVCDG
FT                   SARVDACRIGPGALAFRPGNVEFELVTPAQFSIYGVVVRGDVLRRYAEDVERRALDERL
FT                   FTQRVMQVGDARLARLCALLGRRLDGAVAMAGPLPDAQRDDLQAEVLAALFDACAQPAD
FT                   DGSGGAPSTRRWLVDQARDYVLAHRTRPVGVPELCEQLHVSRRTLQYCFQDVLGMAPAT
FT                   YLRTLRLNGARRDLCGRAAGSVQDVAEAWGFWHLSQFATDYRRLFGKRPSETLRDRA"
FT   misc_feature    81860..82000
FT                   /locus_tag="BCAL0066"
FT                   /note="HMMPfam hit to PF00165, Bacterial regulatory
FT                   helix-turn-helix protei, score 0.00013"
FT                   /inference="protein motif:HMMPfam:PF00165"
FT   misc_feature    81899..81964
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1472.000, SD 4.20 at aa 256-277, sequence
FT                   VGVPELCEQLHVSRRTLQYCFQ"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    82016..82153
FT                   /locus_tag="BCAL0066"
FT                   /note="HMMPfam hit to PF00165, Bacterial regulatory
FT                   helix-turn-helix protei, score 0.00029"
FT                   /inference="protein motif:HMMPfam:PF00165"
FT   CDS_pept        complement(82260..83342)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0067"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50373"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF20"
FT                   /protein_id="CAR50373.1"
FT                   /translation="MHATPPVAALSHDDALTCPGTLLAPDGTLVAPYDLEQGDARAEGH
FT                   VAAAPALGLRHAASRPFRLDYGAARHVHVINGMGVTLGDSVIGMTALAALRDAHPGLRF
FT                   TLYRPARAPRYVDALYALAADVVAPSRALPYPAEALATETHCIDVGNHLYWPAFARLPM
FT                   IDFFLDALGVDPAAVPAAAKRNRWLARLPLPALPAEWQRPYVLFCPSASTAVRSVPPAL
FT                   RVAFVDRLAQRYGLPVVGFGPLAHPAYVDVSSDAADTARFIAWIKGASLLFAPDTAALH
FT                   LADGFDVPTLACFTTIGPALRVRDYPHCVPVTLDVPAALHGLHRSERPDDLAAVEAAYR
FT                   AIDWDALAWPAPRDVTAQAI"
FT   CDS_pept        complement(83354..85057)
FT                   /transl_table=11
FT                   /gene="ilvG"
FT                   /locus_tag="BCAL0068"
FT                   /product="acetolactate synthase, large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0068"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50374"
FT                   /db_xref="GOA:B4EF21"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF21"
FT                   /protein_id="CAR50374.1"
FT                   /translation="MSHSKDLEPRTTTGARLLVDALLANHVERVFCVPGESFLAVLDAL
FT                   ADDTARIQTVVCRHEAAAANMAEAVGKLTGRPGIAFVTRGPGATHASIGVHTAFQDSTP
FT                   MILFVGQCAREHLDREAFQEIDYRRMFGQMAKWVAQIDDPRRIPEYLSHAFHVATSGRP
FT                   GPVVLALPEDVLSDACAPQPVAPAAKRIAAAPSAAQLDELRERLARAERPFAIVGGSGW
FT                   TPDACANLRTFVERWQLPVACAFRFQDTIDNAHPNYAGDVGLGINPALAKRIRDADLLL
FT                   VIGPRLGEATTGGYTLLDIPKTRQTLIHVHQGADELGRVYAADLPIVSGMPEIAAPLAA
FT                   LEPPERPAWAGAAADAHRAYREWHAPLPMPGDVQLGDVMVQLRERLPHDAILTNGAGNY
FT                   AIWLHRHFAYRHYRSQLAPTSGAMGYGLPAALAAKSLYPQRAVVALAGDGCFMMAGNEL
FT                   ATAMQYGLNIVAIVVNNGHFGTIRMHQERNYPGRVHGTGLTNPDFAAYARAFGAHGETV
FT                   ERTADFAPALERALTCGLPAVIEIRIPQDASTPAATLEQIREQGRRARGA"
FT   misc_feature    complement(83435..83875)
FT                   /gene="ilvG"
FT                   /locus_tag="BCAL0068"
FT                   /note="HMMPfam hit to PF02775, Thiamine pyrophosphate
FT                   enzyme, C-termina, score 7.2e-55"
FT                   /inference="protein motif:HMMPfam:PF02775"
FT   misc_feature    complement(83708..83767)
FT                   /note="PS00187 Thiamine pyrophosphate enzymes signature."
FT                   /inference="protein motif:Prosite:PS00187"
FT   misc_feature    complement(83984..84463)
FT                   /gene="ilvG"
FT                   /locus_tag="BCAL0068"
FT                   /note="HMMPfam hit to PF00205, Thiamine pyrophosphate
FT                   enzyme, central d, score 4.3e-07"
FT                   /inference="protein motif:HMMPfam:PF00205"
FT   misc_feature    complement(84509..85024)
FT                   /gene="ilvG"
FT                   /locus_tag="BCAL0068"
FT                   /note="HMMPfam hit to PF02776, Thiamine pyrophosphate
FT                   enzyme, N-termina, score 3.3e-49"
FT                   /inference="protein motif:HMMPfam:PF02776"
FT   CDS_pept        85336..85797
FT                   /transl_table=11
FT                   /locus_tag="BCAL0069"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50375"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF22"
FT                   /protein_id="CAR50375.1"
FT                   /translation="MTTETIDQKTLTELVEAGAVRAARVVGCGNGWALSARCGAHERFL
FT                   SAKRGDVRVFRRFETLVGFLRDIGISRFDVDASAFDPDAAGRATRPDRAVALKAAHEAA
FT                   AHDRWFREQVQQALDDPRASIPDAEVSADFASRRAALRDRLAGRRGDVS"
FT   CDS_pept        85794..86078
FT                   /transl_table=11
FT                   /locus_tag="BCAL0070"
FT                   /product="plasmid stabilisation system protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0070"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50376"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF23"
FT                   /protein_id="CAR50376.1"
FT                   /translation="MTLALHWNPKALEDRAAIMDYIAEDDPLAAVELDERLEERAVALP
FT                   AHAELYRQGRVAGTRELVIAPNYVLVYRIRPADGIVEILRVLHARRQWP"
FT   misc_feature    85806..86072
FT                   /locus_tag="BCAL0070"
FT                   /note="HMMPfam hit to PF05016, Plasmid stabilisation system
FT                   protein, score 1.3e-21"
FT                   /inference="protein motif:HMMPfam:PF05016"
FT   CDS_pept        complement(86236..87624)
FT                   /transl_table=11
FT                   /gene="sdaA"
FT                   /locus_tag="BCAL0071"
FT                   /product="L-serine dehydratase I"
FT                   /EC_number="4.3.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50377"
FT                   /db_xref="GOA:B4EF24"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF24"
FT                   /protein_id="CAR50377.1"
FT                   /translation="MAVSVFDLFKIGIGPSSSHTVGPMRAALMFVQGLERDGLLDATAH
FT                   VKVELYGSLGATGKGHGTDRGVMLGLLGDAPDTVDPDTIDARLEDVRKTKQLALLGTHP
FT                   VPFVLKDNIAFYRQALPEHPNGMKLRASDANGAVLVERTYLSVGGGFVVTAGAPNTKVL
FT                   SAAEQMTHPFRTGAELLALTASTGKSIAQLMWENERAWHTEEETRDGLLKIWAVMQSCV
FT                   SRGCGIGNPDADGNLPGPFQVKRRAPQLYRTLTGSPERALQDPLSMIDWINLYAIAVNE
FT                   ENAAGGRVVTAPTNGAAGIIPAVLHYYTRFTPGANEQGVIDFLLTAAAIGILYKLNASI
FT                   SGAEVGCQGEVGVACSMAAGALAAVLGGTPQQVENAAEIGMEHNLGLTCDPVGGMVQIP
FT                   CIERNAMASVKAVNAARMALRGDGSHYVSLDSVIKTMRETGADMKTKYKETSRGGLAVN
FT                   IVEC"
FT   misc_feature    complement(86251..87105)
FT                   /gene="sdaA"
FT                   /locus_tag="BCAL0071"
FT                   /note="HMMPfam hit to PF03313, Serine dehydratase alpha
FT                   chain, score 5.4e-170"
FT                   /inference="protein motif:HMMPfam:PF03313"
FT   misc_feature    complement(87154..87615)
FT                   /gene="sdaA"
FT                   /locus_tag="BCAL0071"
FT                   /note="HMMPfam hit to PF03315, Serine dehydratase beta
FT                   chain, score 4.9e-71"
FT                   /inference="protein motif:HMMPfam:PF03315"
FT   CDS_pept        complement(87655..88797)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0072"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50378"
FT                   /db_xref="GOA:B4EF25"
FT                   /db_xref="InterPro:IPR008397"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF25"
FT                   /protein_id="CAR50378.1"
FT                   /translation="MVRPMFPGHGATERRPRIRAGRYVPMLVASLSLAAAGLGVAGSAR
FT                   AAMNFCAAPALQTSETTQAEPGVQALIRSVDARIGEQPKAMARVHTEGTLPHEGIYDQS
FT                   AAALRDMDLMRDAALAWRVTNAPRYLQLVDRFLSAWVSTYQPSFNPIDETRFESLIVAY
FT                   DMTASALPVKTRNATAAFIAKLGAGYVAQVDAQKRPLTGTWRNNWQSHRIKLIALSAFT
FT                   LGDRKMMNAAQRLFVEHLADNIGPDGKTWDFEERDALHYAVYDLQPLVTAALAARRFNR
FT                   NWLRERGANGATLAAALDWLVPYALGEKTHEEFVNSPVPFDAKRREAGLPGYTGQWDPK
FT                   NATELFHLAARLDGRYARVAQQLSPTPPAWLAACLPLQAR"
FT   misc_feature    complement(87676..87708)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   sig_peptide     complement(88660..88797)
FT                   /locus_tag="BCAL0072"
FT                   /note="Signal peptide predicted for BCAL0072 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.934) with cleavage site
FT                   probability 0.711 between residues 46 and 47"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(88672..88740)
FT                   /locus_tag="BCAL0072"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAL0072 by TMHMM2.0 at aa 20-42"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(88949..91876)
FT                   /transl_table=11
FT                   /gene="gcvP"
FT                   /locus_tag="BCAL0073"
FT                   /product="glycine dehydrogenase [decarboxylating]"
FT                   /EC_number="1.4.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50379"
FT                   /db_xref="GOA:B4EF26"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EF26"
FT                   /protein_id="CAR50379.1"
FT                   /translation="MKLEHPDRLMNRTPLSLAALETHDAFAERHIGPDAASQQAMLDTL
FT                   GFASRAALIDAVIPASIRRAETLPLGPFAQPKSEAEALAALRALADKNQVFRSYIGQGY
FT                   HDTHTPAVILRNVLENPAWYTAYTPYQPEISQGRLEALLNFQQMVADLTGLAISNASLL
FT                   DEATAAAEAMTLLQRTGKPKSNVFYVADDVLPQTLEVIRTRALPIGIEVKTGPAADAAQ
FT                   ANAFGVLLQYPGVNGDVRDYRALTEAIHAAGGHVVVAADLLALTVLTPPGEWGADVAVG
FT                   NTQRFGVPMGFGGPHAAYMAVRDEFKRQMPGRLVGVTVDAQGKPALRLALQTREQHIRR
FT                   EKATSNVCTAQALLAIMASMYAVYHGPHGLKTIALRVNRIAALFAAGVKQLGFATVNDT
FT                   FFDTLTIDTGARTAQVHEFAKAKRINLRRVSATQVGVSVDETTTRDDLADLLDVFAQAA
FT                   GGTAPAVDALDAGLAGVAALPAGLERTSAYLTHHVFNRHHSETEMLRYLRSLSDKDLAL
FT                   DRSMIPLGSCTMKLNATSEMLPVTWPEFGRIHPFAPAEQTVGYREMIDQLEQMLVAATG
FT                   YAAVSLQPNAGSQGEYAGLLIIHAYHASRGEGHRDVCLIPASAHGTNPASAHMAGMKVV
FT                   VVACDAQGNVDIADLKAKAEQHSKDLAAIMITYPSTHGVFEQNVREICEIVHAHGGQVY
FT                   VDGANMNAMVGLTAPGQFGGDVSHLNLHKTFCIPHGGGGPGVGPVAVGAHLAKFLPNQR
FT                   STGYARTEDGIGAVSAAPYGSASILPISWMYIAMMGAKNLTAATETAILNANYIAKRLA
FT                   PHYPVLYSGPGGLVAHECILDLRPIKETSGISVDDVAKRLMDYGFHAPTMSFPVPGTLM
FT                   VEPTESESQEELDRFIAAMIAIREEIRAVEEGRADREDNPLRHAPHTAAVVTANEWPHA
FT                   YSREQAAYPVASLGTNKYWPPVGRADNAYGDRNLFCSCVPMSDYA"
FT   misc_feature    complement(89366..90211)
FT                   /gene="gcvP"
FT                   /locus_tag="BCAL0073"
FT                   /note="HMMPfam hit to PF01212, Beta-eliminating lyase,
FT                   score 0.0039"
FT                   /inference="protein motif:HMMPfam:PF01212"
FT   misc_feature    complement(90515..91795)
FT                   /gene="gcvP"
FT                   /locus_tag="BCAL0073"
FT                   /note="HMMPfam hit to PF02347, Glycine cleavage system
FT                   P-protein, score 1.9e-247"
FT                   /inference="protein motif:HMMPfam:PF02347"
FT   CDS_pept        complement(91935..92315)
FT                   /transl_table=11
FT                   /gene="gcvH"
FT                   /locus_tag="BCAL0074"
FT                   /product="glycine cleavage system H protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50380"
FT                   /db_xref="GOA:B4EF27"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EF27"
FT                   /protein_id="CAR50380.1"
FT                   /translation="MSNVPAELKYTDEHEWIRTEADGTLTVGITDHAQSTLGDIVFLEL
FT                   PEVGKSVNAGDAVGVVESVKAASDIYSPVSGEIVAINEAATDAPEEVNGDAYGVWLFKI
FT                   KLAAGASTDKLIDADAYSKLID"
FT   misc_feature    complement(91938..92294)
FT                   /gene="gcvH"
FT                   /locus_tag="BCAL0074"
FT                   /note="HMMPfam hit to PF01597, Glycine cleavage H-protein,
FT                   score 8.5e-54"
FT                   /inference="protein motif:HMMPfam:PF01597"
FT   misc_feature    complement(92082..92171)
FT                   /note="PS00189 2-oxo acid dehydrogenases acyltransferase
FT                   component lipoyl binding site."
FT                   /inference="protein motif:Prosite:PS00189"
FT   CDS_pept        complement(92442..93560)
FT                   /transl_table=11
FT                   /gene="gcvT"
FT                   /locus_tag="BCAL0075"
FT                   /product="aminomethyltransferase"
FT                   /EC_number="2.1.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0075"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50381"
FT                   /db_xref="GOA:B4EF28"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR022903"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EF28"
FT                   /protein_id="CAR50381.1"
FT                   /translation="MTALNHTPLNAAHRALNARMVDFGGWDMPVNYGSQIEEHAAVRTD
FT                   AGMFDVSHMCVVDFTGSRVRAFFEHAIANNVGKLKTPGKALYSCLLNPQGGVIDDLIVY
FT                   YFTEEFFRVVVNAGTADKDIAWFNQLNEQGGYGLTIAPRRDFAIVAVQGPNAREKVWAT
FT                   VPSARAATSELKPFNAAQVAGTPFGDLTIARTGYTGEDGFEVIVPAVHVEVLWNALQQH
FT                   GVRPCGLGARDTLRLEAGMNLYGQDMDDTVSPLDAGLAWTVDLAAPRDFVGRAALEANG
FT                   TRAAFVGLILQKENGKAGGVLRAHQKVVTPHGEGEITSGTFSPSMQESIAFARVPAAVQ
FT                   IGDTVQVQIRDKNLPARVVKLPFVRNGKVLAA"
FT   misc_feature    complement(92463..93419)
FT                   /gene="gcvT"
FT                   /locus_tag="BCAL0075"
FT                   /note="HMMPfam hit to PF01571, Glycine cleavage T-protein
FT                   (aminomethyl tran, score 3.3e-109"
FT                   /inference="protein motif:HMMPfam:PF01571"
FT   misc_RNA        complement(93644..93777)
FT                   /locus_tag="BCALr0075A"
FT                   /note="gcvT element (RF00504) as predicted by Rfam,
FT                   score=48.63"
FT   misc_RNA        complement(93811..93914)
FT                   /locus_tag="BCALr0075B"
FT                   /note="gcvT element (RF00504) as predicted by Rfam,
FT                   score=45.20"
FT   CDS_pept        complement(94028..94390)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0076"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0076"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50382"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF29"
FT                   /protein_id="CAR50382.1"
FT                   /translation="MQRLIRAAACCVLVSSLAACIVQPQRPARQAPPPRPNPQVVANDR
FT                   MQEVQGRIDNLHRRIDARVNGGYYPPPYGAQLHHRLDVIRQEANDMSAQHNGGLSGDEQ
FT                   RVLNQELDTAARAIGE"
FT   misc_feature    complement(94331..94363)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   sig_peptide     complement(94334..94390)
FT                   /locus_tag="BCAL0076"
FT                   /note="Signal peptide predicted for BCAL0076 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.991) with cleavage site
FT                   probability 0.327 between residues 19 and 20"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(94594..95646)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0077"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0077"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50383"
FT                   /db_xref="GOA:B4EF30"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF30"
FT                   /protein_id="CAR50383.1"
FT                   /translation="MSSLLRIGLMGFGFAGATFHAPVIATSGRTEVAAIATGQGERAQA
FT                   AYPGARIVPDLDTLLGLDDIECVVIATPNDTHFALARQVLEAGRHVVVDKPVTLTADEA
FT                   LALARLANARSRLFAPFHNRRWDGDFLTVRRIVESGELGRLTYFASHFDRFRPTPRTRW
FT                   REEPARGGGLLLDLGPHLIDQALALFGTPETVSATVKTRRDHGTAPDFVHLLLGYPDKD
FT                   VALHASALSAIEPARFTLHGTRGSYQKFGLDTQEDQLKAGLTADDVEFGGGNPPGLLRV
FT                   LDGDVEVERPVPTLDGQYAEFYRALAASIRDGAPFPVTAQDAVDVMTIIELAAQSEHDG
FT                   RRVPFVRRPV"
FT   misc_feature    complement(94924..95247)
FT                   /locus_tag="BCAL0077"
FT                   /note="HMMPfam hit to PF02894, Oxidoreductase family,
FT                   C-terminal alph, score 6.2e-17"
FT                   /inference="protein motif:HMMPfam:PF02894"
FT   misc_feature    complement(95281..95634)
FT                   /locus_tag="BCAL0077"
FT                   /note="HMMPfam hit to PF01408, Oxidoreductase family,
FT                   NAD-binding Ros, score 1.9e-30"
FT                   /inference="protein motif:HMMPfam:PF01408"
FT   sig_peptide     complement(95572..95646)
FT                   /locus_tag="BCAL0077"
FT                   /note="Signal peptide predicted for BCAL0077 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.942) with cleavage site
FT                   probability 0.801 between residues 25 and 26"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(95948..96655)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0078"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50384"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF31"
FT                   /protein_id="CAR50384.1"
FT                   /translation="MGYPFATAALGPLLFAQGRYVRRVTPRLPEAAGPRDGSVGDGPPL
FT                   RVLVVGDSAAAGVGVATQHDALAGQLASALAATHRVRWKLLARTGLTTRELVDWLAAEP
FT                   AEPFDVAVTSLGVNDVTGGVPPARWLAQQTELVRLLAARFQVGHAILSAVPPMERFPAL
FT                   PQPLAWYLGRRAKRLNTALAGWAGAQPHCTFLRVDLPLERHLMAADGFHPGAAACAVWA
FT                   AQVAAAVRQRMDG"
FT   CDS_pept        96966..99053
FT                   /transl_table=11
FT                   /gene="rep"
FT                   /locus_tag="BCAL0079"
FT                   /product="ATP-dependent DNA helicase Rep"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0079"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50385"
FT                   /db_xref="GOA:B4EF32"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF32"
FT                   /protein_id="CAR50385.1"
FT                   /translation="MSAGLNPAQNEAVRYLDGPCLVLAGAGSGKTRVITQKIAHLIEAK
FT                   GFEPRHIAAVTFTNKAAAEMRERVSKLLEGKTLTTPGKEGRKVPVNQLTVCTFHSLGVQ
FT                   ILRQEAEHVGLKPQFSIMDSDDCFGMIQEQLGTTDKGLIRKIQSIISLWKNGLIMPDEA
FT                   MAIAANEDEHQAALVYRNYVATLHAYQAVDFDDLIRLPAELFAKNEQVRDRWQNKLRYL
FT                   LIDEYQDTNACQYELLKQLAGPRAAFTAVGDDDQAIYGWRGATLENLAQLGKDFPKLHV
FT                   IKLEQNYRSTVRILTAANNVIANNPKLFEKKLWSEHGMGDSITVTACNDEEHEAESVVF
FT                   RLSAYKFERRAQFRDYAILYRGNFQARIFEQVLRRERIPYVLSGGQSFFDKAEIKDLCA
FT                   YLRLIANADDDPAFIRAVTTPRRGIGNTTLEALGSFAGQAKVSLFEAVYMGGIEARLSA
FT                   RQVEPLRMFCDFIQRLTERADKEPATVVLDDMMEAIHYEAYLYDAFDERQAQSKWQNVL
FT                   EFLEWLKRKGTKPETEAVDGEADGFHNADGLADTGKNLLGLIQTVALMSMLEGKDEDPD
FT                   AVRLSTVHASKGLEYPHVFLVGVEEGIMPHRGGSEDDGPIDNERIEEERRLMYVAITRA
FT                   QRSLHLNWCKKRKRARETVVCEPSRFIPEMGLDEAPPPTPEEAPMSPKDRLASLKALLQ
FT                   K"
FT   misc_feature    96978..98453
FT                   /gene="rep"
FT                   /locus_tag="BCAL0079"
FT                   /note="HMMPfam hit to PF00580, UvrD/REP helicase, score
FT                   2.2e-185"
FT                   /inference="protein motif:HMMPfam:PF00580"
FT   misc_feature    97035..97058
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(99160..100047)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0080"
FT                   /product="putative cytochrome"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50386"
FT                   /db_xref="GOA:B4EF33"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF33"
FT                   /protein_id="CAR50386.1"
FT                   /translation="MSEAPHESPVKTPGQLIAVIIASFAIPIILIVLFANYANHAFRSG
FT                   AGTDALSDEQVAARIAPIAKVDVKDANAPRTYKTGEEVYKAVCVTCHGTGAAGAPKFGN
FT                   KDDWAPRISQGFDTLLKTALAGKGAMPARGGTSPDDVSDYEIARAIVYMANNDGANFPE
FT                   PAAPAANAAQPASGAPASGADASNAQAAAAMAAIAAIPKAGEKPAAAPAGADAATAGKA
FT                   LYASTCQACHAAGVLGAPKFGSKEDWAPRLKDSMDTVYNYALHGKGAMPPKGGSNASDA
FT                   DVKAAVDYMVNAAK"
FT   misc_feature    complement(99166..99399)
FT                   /locus_tag="BCAL0080"
FT                   /note="HMMPfam hit to PF00034, Cytochrome c, score 0.0011"
FT                   /inference="protein motif:HMMPfam:PF00034"
FT   misc_feature    complement(99349..99366)
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00190"
FT   misc_feature    complement(99577..99819)
FT                   /locus_tag="BCAL0080"
FT                   /note="HMMPfam hit to PF00034, Cytochrome c, score 0.00049"
FT                   /inference="protein motif:HMMPfam:PF00034"
FT   misc_feature    complement(99769..99786)
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00190"
FT   misc_feature    complement(99937..100005)
FT                   /locus_tag="BCAL0080"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAL0080 by TMHMM2.0 at aa 15-37"
FT                   /inference="protein motif:TMHMM:2.0"
FT   tRNA            100299..100374
FT                   /gene="BCALr0080"
FT                   /note="tRNA Arg anticodon CCG, Cove score 82.41"
FT   repeat_region   100330..100360
FT                   /note="Perfect repeat flanking prophage"
FT   misc_feature    100361..125265
FT                   /note="BcenGI1"
FT   CDS_pept        complement(100429..101505)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0081"
FT                   /product="prophage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0081"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50387"
FT                   /db_xref="GOA:B4EF47"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF47"
FT                   /protein_id="CAR50387.1"
FT                   /translation="MSLYKRKTSPNWQYKLYPPGGGTPVQGSTGTRDKAQAQEFHDRLK
FT                   VDLWNQARLGTQPRHSWNDAVVRYVGERAGLASLETSKIHLRWLDRHLSGVALADIDRS
FT                   RIDAIALAKRREPRTVRTRHGVVATDRPVSDATVRRVIGVLKAVLNAAVEWEWLARAPV
FT                   TKRAKVVSKRIRWLTPAEAERLLAELPAHLADMARFSLETGLRRANVTGLQWSQVDLAR
FT                   RVAWIHPDQAKARKAITVPLSDTAIAVLQRQRANPRAPACADSVFVYRGKPVYQTATAA
FT                   WAKALRRAGLHDFRWHDLRHTWASWHVQRGTPLQVLKELGGWETMEMVQRYAHLSAAHL
FT                   AQWVAPLTAEPAPIPAAI"
FT   misc_feature    complement(100480..101001)
FT                   /locus_tag="BCAL0081"
FT                   /note="HMMPfam hit to PF00589, Phage integrase family,
FT                   score 1.5e-34"
FT                   /inference="protein motif:HMMPfam:PF00589"
FT   CDS_pept        complement(101373..101693)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0082"
FT                   /product="hypothetical phage protein"
FT                   /note="CDS is possibly extended at the C-terminus, lacking
FT                   an appropriate translational stop"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50388"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF48"
FT                   /protein_id="CAR50388.1"
FT                   /translation="MSGAAALLGAHPETVRLKARAGMLPGRKVGKRWIFSIMALQRYLA
FT                   GDWLPRAAQADQHEETHPCRSTNEKPARTGNTSCTPLAAERRYREALAPATKRRPRNST
FT                   TG"
FT   CDS_pept        complement(102200..104992)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0083"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50389"
FT                   /db_xref="GOA:B4EF49"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF49"
FT                   /protein_id="CAR50389.1"
FT                   /translation="MASIDELKRHIDLHDLASRLGLKRGRGGDRALYHSPQHADRSPSL
FT                   SIYANHPKYGTGWRDHSADAGGSCIDLVIHARGGTVADAVRYLHDAYGLPSERPAPLER
FT                   REKSTVEYIADRCVAERERVRDYLGGRGIAAAAIDAALAARTLGFNTWTSPKVAAGEVG
FT                   HGGPAAAFVVRAPGDARVVAVDMRYVDPALNGGVKTQTQGDKAGYAWTADARRLERAKR
FT                   VVIVESAINALSIDTCALPGTAALALRGLANVERIDFAFLRGKQVTICLDNDEPFADGH
FT                   PRAGQRPGPEAAWALYERLTALDISAVLVDQSDWFADLADGDTARKPINDVNDYLQLRG
FT                   PADLARALDQLEPWLVAGLPGDASRRGRPRLFLPPHDFAQYWRFRVRPDFTSYITRMDR
FT                   NEESGVDTPVMTDLCGFRIAGISRVAVASATSTMTGDADQAPTVYFAVSVQAPRHGAQL
FT                   IRRVMLDDQLHNVDQWGKFGPIWAPAPFKRMVNILERGADLGARRAANFVGLAWRDGRL
FT                   IVNEGPDCYFTEADKQCPYHNLTFPGGPVSDARRVIAAYQTTFRQNAATIPLVWALGGH
FT                   LKALLGFWPHLTIQANKGAGKSTLIKRLERSLAFTMFSGQSLQTEFRLLTSISHTSHPV
FT                   GWEELSARRQDVIDKAVGLLQENYQYTVTRRGTDMTEYLLCAPVMLAGEDVPVRSLLGK
FT                   VVRTTLTGKRGPLLPDDLPRFPVRQWLEFLTGLDRRTALDQYATLRDQALAGCRASGED
FT                   DGARRMAANYAALGLAWRYLCEFAGMDPGEGEFPRDLLAEMNGHVAETSADREPWVWIM
FT                   ETVLSEIDGGNYKHPYTFDTVDGEFCLLLRTGHVMDHLAHTSALRDKWNGLPVKSDRVF
FT                   KAQLKHAGVVVGEKEVERRIYMRRVPYLTPVSLERLATFGLHVSVREDLATDALHGGRA
FT                   "
FT   misc_feature    complement(103199..103222)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(104998..105255)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0083a"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0083a"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF60"
FT                   /protein_id="CAR50390.1"
FT                   /translation="MNRYAEPAPHDVALRAAIAAAADTLRGDPASGSAARQPALGPFVS
FT                   ALADRLALGFPQSAAALHALVAPPACAGDPARHAQPEPQQ"
FT   CDS_pept        complement(105383..105631)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0084"
FT                   /product="putative phage transcriptional activator protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0084"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50391"
FT                   /db_xref="InterPro:IPR007684"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF61"
FT                   /protein_id="CAR50391.1"
FT                   /translation="MRILNRCPHCRTRATARSSREMSLTFREITFQCSNPECGHTYVVN
FT                   MEFARTLSPSAIPNLSLQLPLSPHVRERLAAQLELPV"
FT   misc_feature    complement(105476..105616)
FT                   /locus_tag="BCAL0084"
FT                   /note="HMMPfam hit to PF04606, Ogr/Delta-like zinc finger,
FT                   score 6.2e-22"
FT                   /inference="protein motif:HMMPfam:PF04606"
FT   CDS_pept        complement(105619..105798)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0084a"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0084a"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50392"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF62"
FT                   /protein_id="CAR50392.1"
FT                   /translation="MSAAFERTRPSGPAASIVSRVCARNHSPIGQGCTLATGATRDWPG
FT                   HRQSFVRSEPSCAS"
FT   CDS_pept        complement(105813..106028)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0085"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0085"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50393"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF63"
FT                   /protein_id="CAR50393.1"
FT                   /translation="MTTPKGPRRSPRGTMSDKPVYVGLTPVERGELEQLAAQRNRSISS
FT                   MARELIRLGASHLRAIAAPRSRSARP"
FT   CDS_pept        106119..106610
FT                   /transl_table=11
FT                   /locus_tag="BCAL0086"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0086"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50394"
FT                   /db_xref="GOA:B4EF64"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF64"
FT                   /protein_id="CAR50394.1"
FT                   /translation="MTQIGSRLRDERLRIGLSQDEFATVGGVARRSQSAYESDERAPDA
FT                   AYLLAVREIGVDIGYVLTGKRFAAGEAAPEAGARDADEAEVLAMYRQLNDTGKASLHAF
FT                   LASCISTGAMVQTATPRRAKRVPEKRRAALDQRTAENVDRAMAEIERLKAERAAKQPKK
FT                   "
FT   misc_feature    106806..106809
FT                   /note="IBS2?"
FT   misc_feature    106813..106818
FT                   /note="IBS1?"
FT   intron          106819..108733
FT                   /note="putative Group II intron - Bacterial Class E"
FT   misc_feature    106976..106979
FT                   /note="Group II intron - EBS2"
FT   misc_feature    107002..107007
FT                   /note="Group II intron - EBS1?"
FT   CDS_pept        107182..108714
FT                   /transl_table=11
FT                   /locus_tag="BCAL0087"
FT                   /product="putative reverse transcriptase-group II intron"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0087"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50395"
FT                   /db_xref="GOA:B4EF50"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF50"
FT                   /protein_id="CAR50395.1"
FT                   /translation="MTNGWEKSDSPIVAKKLANKPGQPDAESVERRGGAKGNTEWSRTR
FT                   RTQSRISVSQRLDRVRQAARQRKKEKFTALYHLIDLDLLATAFFWLKRKAAAGVDGVTW
FT                   HDYEQDLDRNLEDLHGRLRRQAYRALPSRRRYIPKADGKQRPLGIAALEDKIVQRALVA
FT                   VLNAVYEMDFLGFSYGFRPQRSQHDALDALATGIARTSVSWILDADISRFFDTVDHDWL
FT                   IRFVEHRIGDQRVIRLIRKWLKAGAMEDGVIEPTDEGTPQGSVISPLLANIYLHYVFDL
FT                   WANQWRKRHAEGNVVIVRYADDVVVGFDKPHDAKRFRRAMQQRLEQFGLSVHPEKTRLI
FT                   EFGRFAARNRASRGLGKPETFNFLGFTHISGRAKDGRFMLMRKTRSDRLRTALKGIKDE
FT                   LRHRWHQSIPEQGDWLRRVVQGYFNYHAVPTNFAALRAFRARVIDLWRLALRRRSQKDD
FT                   TTWAKMHRLAKQWIPKARILHPWPVVRFDANHPRQEPGARIAHAGICAGGAQ"
FT   misc_feature    107563..108285
FT                   /locus_tag="BCAL0087"
FT                   /note="HMMPfam hit to PF00078, Reverse transcriptase
FT                   (RNA-dependent DNA pol, score 1.5e-62"
FT                   /inference="protein motif:HMMPfam:PF00078"
FT   misc_RNA        108659..108733
FT                   /locus_tag="BCALr0087"
FT                   /note="Group II catalytic intron (RF00029) as predicted by
FT                   Rfam, score 37.78"
FT   CDS_pept        108758..109138
FT                   /transl_table=11
FT                   /locus_tag="BCAL0088"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50396"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF51"
FT                   /protein_id="CAR50396.1"
FT                   /translation="MSWRRGVPRRPVVSGGPRLMTEFAETGKMDTNRKHDNGTIGASAH
FT                   ADHRADARGATMGPPRYRSDLTDDERADAHAAIDNAMLSVGQVLEAALQAMANLRDARA
FT                   TLQQCGDARDLRMTLGGRQQSS"
FT   CDS_pept        complement(109326..110396)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0089"
FT                   /product="phage late control gene D protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50397"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF52"
FT                   /protein_id="CAR50397.1"
FT                   /translation="MSTQERTPADAPARAGRVQPQADYRITLDGRDLSRLIAPNLISLS
FT                   LSESRADEADMLDLVLDDAQGTFAIPKRGASIKLSIGWVGEPLVDKGTFTVDEVEHSGA
FT                   PDVITIRARSASMTNDMHERREKSWHRQTIGAIVRTIAARYGLTAAVDATLAATRIDHV
FT                   DQTQESDMSFLTRLAKRYDAVMTVKDKHLLFTPIGSGKTVSGKPLDVLAITRASGDQHR
FT                   YHVAQRDSYTSVRAHYHSNGSARRLPVVVGDAKGKNVKVLPEDYATEAEARAAAQAEYA
FT                   RTQRGESTLSYTLALGRPELFPEMPVTVTGFKPDIDDTPWLVKKATHTIGDGGFTTALE
FT                   LEVRDAPKKTRRTGQR"
FT   misc_feature    complement(109359..110339)
FT                   /locus_tag="BCAL0089"
FT                   /note="HMMPfam hit to PF05954, Phage late control gene D
FT                   protein (GPD), score 1.2e-151"
FT                   /inference="protein motif:HMMPfam:PF05954"
FT   CDS_pept        complement(110393..110824)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0090"
FT                   /product="putative phage tail assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0090"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50398"
FT                   /db_xref="InterPro:IPR009734"
FT                   /db_xref="InterPro:IPR016912"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF53"
FT                   /protein_id="CAR50398.1"
FT                   /translation="MMMSLDQFVFSLATTPYQELQRQRNWKHRTSSRIGVRDASQFTGA
FT                   GDDTITLTGIVAPENGIGEIASIEALARMGDAGDAYVLVDGNGNVYGAYVIDSLNETAT
FT                   YHTKEGMARKIAFTLTLKRVDDGVLAEVQQDDDSGAAEQ"
FT   misc_feature    complement(110444..110809)
FT                   /locus_tag="BCAL0090"
FT                   /note="HMMPfam hit to PF06995, Phage P2 GpU, score 1e-51"
FT                   /inference="protein motif:HMMPfam:PF06995"
FT   CDS_pept        complement(110847..113417)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0091"
FT                   /product="putative phage membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0091"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50399"
FT                   /db_xref="GOA:B4EF54"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF54"
FT                   /protein_id="CAR50399.1"
FT                   /translation="MDNTLKLRVMVDMIDNMTKPLQMMLTGNKGLADSLRATRRELDDM
FT                   AKTQKRIGEFRDLRSGVAKTATELKSAKLRAGELRVALRASGPPSRQMVEDLAKLERTA
FT                   TDLTAAQGRQVARIRELRTQLVGAGIDTRRLDLHEFALATNSARRQAKMTADVRAFDDA
FT                   RRKRAEARRAKIDALGGVGRQWAERGKTIAGAGKSMFGMLSEPLDVAKQAESETLRLRA
FT                   QGASADAVTFARAQQVGGQSVVDNLALMRESLAALGGDEQRARVVMPMLANMKSANEAL
FT                   FGKDDAKANVDKFMAMLKVIDLRGGTKNEAAFGAEANIVQKMQTATGGKVSGDEWNSFA
FT                   ESGGGAARKLRTDAFYYQMQPLIEKLGGKAAGEGLAALSGSLFGGKVTAPAARQLTALG
FT                   LVDPKRVLHARNGAIRGLGPGALAGSDMLQASPLEWLEKVLLPKLAAKGITQPDNVKAA
FT                   LAKLFPDKAAGTLLTTMYEQREQIHDTERQSAAADSVTGMRAKAADSTAGRELAVLAQL
FT                   RDLKLEIGEKITPVYNAALDVTARMLEKIVRFVREHGTATRILVTTFAALGGALAVAGT
FT                   LASVFGGLLGSVNVLRFATSMVGAFRLVGQALLMLGRLAMANPLLAVIGLIAMAAVYVW
FT                   QNWDTLGPKFIALWETIKGAFGAASDWITAKWDATVEWVKTSLGGIGDWFGDIGTRFQE
FT                   IGASIVSGLVDGITNRLGALKDTAGNLGSSTLGWLKEKLGMQASPTPDNGPGGATTGTP
FT                   TRMTRTAAALTSAAALVGPPAFAASPAIAAAAPLERYNLSLDYRPPLTAPAAVASAAPA
FT                   AGPVTINIAPPPGADAAEIARMVRAELERAERAKASRTASRLSD"
FT   misc_feature    complement(join(111510..111578,111639..111707))
FT                   /locus_tag="BCAL0091"
FT                   /note="2 probable transmembrane helices predicted for
FT                   BCAL0091 by TMHMM2.0 at aa 571-593 and 614-636"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(113433..113546)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0092"
FT                   /product="putative phage tail-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0092"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50400"
FT                   /db_xref="InterPro:IPR009493"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF55"
FT                   /protein_id="CAR50400.1"
FT                   /translation="MADIATVFGWTPPVMDAFSLAELMDWRERARVRAGAQ"
FT   misc_feature    complement(113436..113546)
FT                   /locus_tag="BCAL0092"
FT                   /note="HMMPfam hit to PF06528, Phage P2 GpE, score 4.5e-15"
FT                   /inference="protein motif:HMMPfam:PF06528"
FT   CDS_pept        complement(113555..113926)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0093"
FT                   /product="putative phage tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0093"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50401"
FT                   /db_xref="InterPro:IPR019289"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF56"
FT                   /protein_id="CAR50401.1"
FT                   /translation="MNPIQSDAAAPDLQADAAAIATPAQDDPATHTLDTPLVRGTQTIT
FT                   SITLRKPKSGELRGVSLSDLVSLDVVALSKVLPRISSPMLTEADVASIDPADLVQLGGI
FT                   FAGFLMPKAVKSRLASQTA"
FT   misc_feature    complement(113585..113842)
FT                   /locus_tag="BCAL0093"
FT                   /note="HMMPfam hit to PF06158, Phage tail protein E, score
FT                   7.1e-40"
FT                   /inference="protein motif:HMMPfam:PF06158"
FT   CDS_pept        complement(114003..114512)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0094"
FT                   /product="phage major tail tube protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50402"
FT                   /db_xref="InterPro:IPR006498"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF57"
FT                   /protein_id="CAR50402.1"
FT                   /translation="MGMPRKLKGFNLFQNGENFVGQVVEVTLPKLTRKMEDYQGGGMSG
FT                   PIKVDFGQEGIQLEWTCGGFMRSVLGQYAITKHDGVLLRFAGGYQAEDSTNVDAIEIVI
FT                   RGRHSEIDPGTAKSKEDTAFKVTTVASYYKLSVNGQDVIEIDFVNMIEKVNGNDLFAAL
FT                   RNAIGL"
FT   misc_feature    complement(114006..114509)
FT                   /locus_tag="BCAL0094"
FT                   /note="HMMPfam hit to PF04985, Phage tail tube protein FII,
FT                   score 4.1e-82"
FT                   /inference="protein motif:HMMPfam:PF04985"
FT   CDS_pept        complement(114541..115713)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0095"
FT                   /product="putative phage major tail sheath protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0095"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50403"
FT                   /db_xref="InterPro:IPR020287"
FT                   /db_xref="InterPro:IPR035089"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF58"
FT                   /protein_id="CAR50403.1"
FT                   /translation="MPQDYHHGVRVIEINEGSRPIRTVSTAVVGIVCTASDADATAFPL
FT                   DTPVLLTNVVAALGKAGTKGTLRRTLDAIGRQTKPVTIVVRVAEGKDAGETATNVIGSV
FT                   TADGKYTGMKALLGAQARFGVKPRILATPGLDTQPVAAALASIAQSLRAFAYVSANGCK
FT                   TKEEAVAYRKQFSQRELMVVWPDFLAWDDTTNTTVVVPATAYAAGLRAKIDNDTGWHKT
FT                   LSNVGVNGVTGISADVSWDLQDPATDAGFLNEQDVTTLVNRNGFRFWGSRTCSDDPLFA
FT                   FENYTRTAQVIADSIAEAQMAIIDGPLNPSLPRDIIETINAKFREWISQGYLIGGSAWY
FT                   DPEPNTTDVLKSGKAYLDYEYTPVPPLENLMLRQRITDRYLADFAARVSA"
FT   misc_feature    complement(114565..115707)
FT                   /locus_tag="BCAL0095"
FT                   /note="HMMPfam hit to PF04984, Phage tail sheath protein,
FT                   score 4.9e-164"
FT                   /inference="protein motif:HMMPfam:PF04984"
FT   CDS_pept        complement(115768..116502)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0096"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0096"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50404"
FT                   /db_xref="InterPro:IPR003458"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF59"
FT                   /protein_id="CAR50404.1"
FT                   /translation="MLIHHYSPSTGEYLSSSQPDADPRNPERWLIPASATLDAPPARTP
FT                   TTWPFYRNDVWTLLPDFRGRICYRTDTGEPVEIATAGKTPDELGLTTEPRPSPRHAWLD
FT                   GAWTVPPELLEREKRDAAMAEFEQRLETARKANAGKADAYAAGLLDDEGVYYFKAWSAY
FT                   QMALVRVIQADTFPDAIAWPATPAPYVPPPPTPVPPAPSEPSEPSEPSEPIEPIEPPAP
FT                   TEPSSPPADPATPAVPVADSAA"
FT   CDS_pept        complement(116518..119169)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0097"
FT                   /product="putative phage tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0097"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50405"
FT                   /db_xref="InterPro:IPR011083"
FT                   /db_xref="InterPro:IPR037053"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF34"
FT                   /protein_id="CAR50405.1"
FT                   /translation="MATQIIITDAGRAALVAAGNGGTNAHQVVEIGLANAPFVADKGLT
FT                   KLPNELKRIKSFGGANVAPDTIHTTLKDDSTDQYSLYGFGLYLDNGVLLAAYGQATPIM
FT                   EKSPAALLLLSSDMQFATIDATQLVFGDASFLNPPATTERQGVVELATQGEVDAGSDDT
FT                   RAITPKTAASRYAALTGAKFTGPVVTEFDAGPDTAHVSIRPPSGKNGREGRVRLHGTFG
FT                   GGNPDTGSRLVATIRSGFDNGAWGREYVDLWLNRTANDVQSDSYQARALRIGYGGRVLV
FT                   GDVKNDDGNSRLRVGGDTVAEGTSYSRAASIDGGAGNFSTLFFTDGGKIRWSMFKRDGA
FT                   ASGGNGGNDFGVNAFADDGVTQFPAFRVSRGTQAFSIAKRLLVGDIGDDGRNAIQAAGN
FT                   ATFNGGLTSRAMDVNGAHFRAIFGGYGAFLRNDGTNVYLLSTNKGDPEGQWNDFRPVTW
FT                   NLETGRVTIDDRGSGTAIGGNTTVRGELSVGTGQAQGSIRVGPVDGFLYSNGDGYGWWT
FT                   PTKGAFQYYIADRTFRIDGNPVWHSGNLSPLDRTKGGTMSGDLWFDPGKRIYLSEGSAQ
FT                   APSLTFTNDGAPDTGLYHTGDGMFGVTCNSVSQVSFTPGGTTFQTPVQGQTPPAGDRST
FT                   RLATTEWVVAAIASAAIGTVVFEPRTTARAGFLKLNGALLKRADYPALWAYAQASGALS
FT                   TETDWAAGWSGTFSTGDGTTTFRIPELRGEFVRCWDDTRGVDPNRGLGASQNFANAWHA
FT                   HGASAAASGDHVHSAWTDVQGWHGHHGWTASVGDHQHVAPYSESGIAPFGTHSTNQVGS
FT                   HGGVDNDNPWAFTSGAGGHNHEFNTEGAGNHGHNVGIGAAGNHSHAITVNGDGANESRP
FT                   RNVALLAMIRAY"
FT   misc_feature    complement(116992..117213)
FT                   /locus_tag="BCAL0097"
FT                   /note="HMMPfam hit to PF07484, Phage Tail Collar Domain,
FT                   score 5.3e-07"
FT                   /inference="protein motif:HMMPfam:PF07484"
FT   CDS_pept        complement(119176..119643)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0098"
FT                   /product="putative phage tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50406"
FT                   /db_xref="InterPro:IPR006521"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF35"
FT                   /protein_id="CAR50406.1"
FT                   /translation="MPTPLATLTNPDTIRSDLLPWLAWHLGVDAWKDYWPEYVKRARVG
FT                   QAIPIARRKGTAASVREVVAAFGGNIVLREWFEQQPPGAPGTFDLVMTVSGQEGEPPTA
FT                   EYVADILAEIDRTKPVRAHYTFTQGFEMRGRQPIGAAARVAAYRRVNFTDY"
FT   CDS_pept        complement(119711..120625)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0099"
FT                   /product="putative phage baseplate assembly protein J"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0099"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50407"
FT                   /db_xref="InterPro:IPR006949"
FT                   /db_xref="InterPro:IPR014507"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF36"
FT                   /protein_id="CAR50407.1"
FT                   /translation="MSVTPIDLSQLPSPDIVETLDYETLLAARKARLVSLYPAAEQAEI
FT                   AATLALESEPLVKLLQENAYREIVLRQRVNDAARAVMLAYAVGTDLDHLAALFGIRRLT
FT                   ISPADPAHDLAAVMESDADLRARTQLAPQSFSVAGPEGAYVSHARNADGRVLDASAVSP
FT                   APCEVLVTVLARDGDGTAAPALIDAVAAALQADDVRPLTDKVTVRGAEILRYQVRARLV
FT                   FFAGPDRAVALAQANRAMKQYTDSMHRLGMEVTLDGIYAAARAAGVQKVILESPLAGLP
FT                   ATKQQAPYCTGIELIDGGVYSNE"
FT   misc_feature    complement(119840..120463)
FT                   /locus_tag="BCAL0099"
FT                   /note="HMMPfam hit to PF04865, Baseplate J-like protein,
FT                   score 3.9e-81"
FT                   /inference="protein motif:HMMPfam:PF04865"
FT   CDS_pept        complement(120622..120984)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0100"
FT                   /product="putative phage baseplate assembly protein W"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0100"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50408"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF37"
FT                   /protein_id="CAR50408.1"
FT                   /translation="MKGMNANTGRSISGLDHFYQSIGKIVTTPLASCVKRRTFGSELPD
FT                   LIDAPGNGTVRTRLYAAVATALMRWEPRLTLTRVVLTADDANAAAGSLYLDIEGWTGEN
FT                   GTAVSTRVPVANGSPA"
FT   misc_feature    complement(120643..120942)
FT                   /locus_tag="BCAL0100"
FT                   /note="HMMPfam hit to PF04965, GPW / gp25 family, score
FT                   1.1e-26"
FT                   /inference="protein motif:HMMPfam:PF04965"
FT   CDS_pept        complement(120981..121790)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0101"
FT                   /product="phage baseplate assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0101"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50409"
FT                   /db_xref="InterPro:IPR006531"
FT                   /db_xref="InterPro:IPR013046"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="InterPro:IPR040629"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF38"
FT                   /protein_id="CAR50409.1"
FT                   /translation="MRTGAAIVDARLDAGIRRALSPPRRHRPSLAPRAPRRHHGCMDAN
FT                   EIQRQARNAVRKGTILAVDHAAALCRVSVGDADSDGSGLQTNWIPWVAGTAGATRDWLP
FT                   PTPGEQVVLLCPMGDPAQGVALRGVYSNAAPAPASSPDTHARVYPDGARITYDHAAHAL
FT                   TVELPAGATVRVVAPGSVVVQTRDATVQAERITLDAPQTTCTGAMTVKGPFAFEAGMTG
FT                   TGGAGGGATMQIDGAATFTREVTSRGISLPHHTHREQGDGQLVSEPQ"
FT   misc_feature    complement(121296..121619)
FT                   /locus_tag="BCAL0101"
FT                   /note="HMMPfam hit to PF04717, Phage-related baseplate
FT                   assembly protein, score 2.5e-39"
FT                   /inference="protein motif:HMMPfam:PF04717"
FT   CDS_pept        complement(122176..122625)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0102"
FT                   /product="putative phage tail completion protein R"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0102"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50410"
FT                   /db_xref="InterPro:IPR009678"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF39"
FT                   /protein_id="CAR50410.1"
FT                   /translation="MIKPDSLRRALAAAIPSIDDEPGALTVLVEQGSIATTGTLTPSFE
FT                   YRYTAHVLATHFSGDTDPVFVALIEWVRANQPDLVTNPAARASGITFEVGIRDQAAVDL
FT                   SIRLALTESVVVTTGPDGRPVITHVDDTRVDPADTLTWVALPQIR"
FT   misc_feature    complement(122230..122622)
FT                   /locus_tag="BCAL0102"
FT                   /note="HMMPfam hit to PF06891, P2 phage tail completion
FT                   protein R (GpR), score 5.9e-39"
FT                   /inference="protein motif:HMMPfam:PF06891"
FT   CDS_pept        complement(122742..123182)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0103"
FT                   /product="putative phage-encoded lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0103"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50411"
FT                   /db_xref="InterPro:IPR020000"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF40"
FT                   /protein_id="CAR50411.1"
FT                   /translation="MNGLAAKIIAWIVALATCAVVALYVHGLRAERATAQRQRVEAQQA
FT                   LAARDGIIARLRQDAAERAQQQARLDHAQTAIASKLDAIRFENRRLTDENAALRAWADT
FT                   RLPDDVVRLQASPALTGAGDYVEHVPDGETVHAAEARAADQR"
FT   sig_peptide     complement(123102..123182)
FT                   /locus_tag="BCAL0103"
FT                   /note="Signal peptide predicted for BCAL0103 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.791) with cleavage site
FT                   probability 0.455 between residues 27 and 28"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(123102..123170)
FT                   /locus_tag="BCAL0103"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAL0103 by TMHMM2.0 at aa 5-27"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(123179..124030)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0104"
FT                   /product="putative phage-encoded peptidoglycan binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0104"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50412"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR024408"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF41"
FT                   /protein_id="CAR50412.1"
FT                   /translation="MKTRRLGDHGDDVGLLQRRLIRAGYAVQITHLYDAATEAAVIALQ
FT                   RKTGLVDDGIAGPKTYAALATGLRDPKHLGLADLERAARTLDVPLACIRAVNEVESRGA
FT                   GFLPDGRPVILFERHVFWKRLQARGIDPAPFAARQPDIVSRTRGGYRGSAAEYVRLATA
FT                   ESIDAGAAWESASWGAFQVMGYHWERLGYAGIDAFVSCMEDGEAQHLDAFMRYIAADNT
FT                   LRRALGARQWAAFARAYNGPDYAANLYDVKLARAFDRYASQAAAATQAASGSPDATVAS
FT                   RA"
FT   misc_feature    complement(123827..124006)
FT                   /locus_tag="BCAL0104"
FT                   /note="HMMPfam hit to PF01471, Putative peptidoglycan
FT                   binding domain, score 1.7e-17"
FT                   /inference="protein motif:HMMPfam:PF01471"
FT   CDS_pept        complement(124033..124299)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0105"
FT                   /product="putative phage membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0105"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50413"
FT                   /db_xref="GOA:B4EF42"
FT                   /db_xref="InterPro:IPR008473"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF42"
FT                   /protein_id="CAR50413.1"
FT                   /translation="MAFPFALIALAAHLAVLVRVLTYRRNGARHRRHASWFAWMLVAVT
FT                   GGASIEWLLHTGAVGFFDAATAVFLAMFVCGTRGNVARLLRSE"
FT   misc_feature    complement(124036..124284)
FT                   /locus_tag="BCAL0105"
FT                   /note="HMMPfam hit to PF05449, Protein of unknown function
FT                   (DUF754), score 1.4e-17"
FT                   /inference="protein motif:HMMPfam:PF05449"
FT   misc_feature    complement(join(124057..124125,124138..124197,
FT                   124231..124290))
FT                   /locus_tag="BCAL0105"
FT                   /note="3 probable transmembrane helices predicted for
FT                   BCAL0105 by TMHMM2.0 at aa 4-23, 35-54 and 59-81"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(124301..124645)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0106"
FT                   /product="putative phage membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0106"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50414"
FT                   /db_xref="GOA:B4EF43"
FT                   /db_xref="InterPro:IPR032637"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF43"
FT                   /protein_id="CAR50414.1"
FT                   /translation="MAEPNLTTAAMLSTAIGVAGLAPGIDGNALIGAFTGAALVVVTSK
FT                   EIGVARRAAYLLISLVMGYLAAPEIVGATPIHSTGVAAFFAAALVIAVTLQLIERIKTL
FT                   DLLALFRKGG"
FT   misc_feature    complement(join(124352..124405,124418..124486,
FT                   124520..124588))
FT                   /locus_tag="BCAL0106"
FT                   /note="3 probable transmembrane helices predicted for
FT                   BCAL0106 by TMHMM2.0 at aa 20-42, 54-76 and 81-98"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(124662..124868)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0107"
FT                   /product="phage tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0107"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50415"
FT                   /db_xref="InterPro:IPR008861"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF44"
FT                   /protein_id="CAR50415.1"
FT                   /translation="MIARTLQGDTVDTLCWRHYGRTDGTVETVLEANTGLASLGVVLPA
FT                   GTPVYLPPFDTVTSARPLLQLFD"
FT   misc_feature    complement(124689..124868)
FT                   /locus_tag="BCAL0107"
FT                   /note="HMMPfam hit to PF05489, Phage Tail Protein X, score
FT                   1.2e-25"
FT                   /inference="protein motif:HMMPfam:PF05489"
FT   repeat_region   125266..125296
FT                   /note="Perfect repeat flanking prophage, 3-prime fragement
FT                   of tRNA Arg"
FT   CDS_pept        125430..127049
FT                   /transl_table=11
FT                   /locus_tag="BCAL0108"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0108"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50416"
FT                   /db_xref="GOA:B4EF45"
FT                   /db_xref="InterPro:IPR026467"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF45"
FT                   /protein_id="CAR50416.1"
FT                   /translation="MAAIPSTSTAVAACPLTDAQQALLARLHAYSPDDPDAPLPYSRRL
FT                   ADAEGWSHDHALAVIDEYKRFAFLAQVAGHPVTPSVAVDAAWHFHLQYTLEYWDVFCAG
FT                   VLRARLHHMPGTGAPDEAAVYAQRYRDTLDSYRRLFGCEPPASIWPRPVDRAVEGGAEV
FT                   ETQQPERMVAVAPRRAWRDRLPKLVWPAAAASVAATCASAQDLDVLDYTGPQFLAFYVP
FT                   ACVVALSLIVALHAIEFRIRRWGRRTRKASSGLSADEVAYLTGGEARVAQVVTMSLAHA
FT                   GAVDLWSVHLQGSYVKIADLERAGRYDDYCAWLNEQPSGTVRYGVFRERLARYAQEVVD
FT                   GMRAQGWFWAPGELRASRMAARAIALLVFGTGAVKLAVGLSRGRPVLLLCICMAVFAIA
FT                   YRIVAGRLTGFRRGGPTAAGRAALLERRNAHDPRAARDARHVRSAQGASGIRDAERDDP
FT                   DPLLWTAALFGAGALAGTVWSAYAGPVLAASRMPSVAAAKAGGGTSFDSSDGGGASSSC
FT                   SSSSSCSSSSCSSSSCGGCSSS"
FT   misc_feature    125439..125471
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    join(126078..126146,126516..126569,126582..126641,
FT                   126807..126875)
FT                   /locus_tag="BCAL0108"
FT                   /note="4 probable transmembrane helices predicted for
FT                   BCAL0108 by TMHMM2.0 at aa 217-239, 363-380, 385-404 and
FT                   460-482"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    126966..126998
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        127259..129232
FT                   /transl_table=11
FT                   /locus_tag="BCAL0109"
FT                   /product="putative TPR repeat protein"
FT                   /note="C-terminus is similar to Geobacter sulfurreducens
FT                   TPR domain protein gsu1547 SWALL:AAR34921 (EMBL:AE017212)
FT                   (473 aa) fasta scores: E(): 3.1e-69, 47.16% id in 441 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50417"
FT                   /db_xref="GOA:B4EF46"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B4EF46"
FT                   /protein_id="CAR50417.1"
FT                   /translation="MTVRRFAQPSMTTPASDVSACVRHAATLCQNGQFADALSLVAPQL
FT                   DASAVDVAVLHVAAVCALGLNHLADAEASWRRAIDAMPAFEPPYDGLHALLMSQGRLPD
FT                   AEVILRRQLACVAPLRASHHHRLGKVLEALGRLDEAEQAFGQALSIEPRSPDVLTDFGN
FT                   LLRVLARPAEAELAYRLAIAVRADHVLAHANLGAILVDMRRLPEAEAASRQTIALCPDH
FT                   PEAHYNLGVALQNLDRLSEAEAAYRDAIRCRPGLPQAHNNLGCVLRAQGRHDEAAVAFT
FT                   DALALAPQMAEVHYNLGTTLAHAGQLDEAERAYRRALELRADYDDARFGLATLLLSRGR
FT                   FEEGWRRYESRYEQSTFVHRRTREVLRCAQWQGEPLAGKTLLVWQEDGLGDMLQFSRYF
FT                   AEFRARQAARVVFACQPALHRLMETVDGVDAVLDHEAATAQAAQFDYWTSLLSAPMHAG
FT                   TTLDTIPPPVRFVPDPARVAHWGARLDALPPGPRVGLVWKGNPKHHNDAHRSLPSLALL
FT                   TPLWSVPGVNFVSLQKGQGEDEARQPPGGLPLLHLGSELDDFADTAAIVAQLDLVVCVD
FT                   TSTAHLAASLGKPCWVLLPNQDVDWRWMHDREDSPWYPGTVRLFRRGRGDSWIKMAERL
FT                   RGAFAAHFAVARVTADKTARSV"
FT   misc_feature    127619..127720
FT                   /locus_tag="BCAL0109"
FT                   /note="HMMPfam hit to PF00515, Tetratricopeptide repeat,
FT                   score 9.2e-06"
FT                   /inference="protein motif:HMMPfam:PF00515"
FT   misc_feature    127619..127696
FT                   /locus_tag="BCAL0109"
FT                   /note="HMMPfam hit to PF07721, Tetratricopeptide repeat,
FT                   score 0.019"
FT                   /inference="protein motif:HMMPfam:PF07721"
FT   misc_feature    127721..127822
FT                   /locus_tag="BCAL0109"
FT                   /note="HMMPfam hit to PF00515, Tetratricopeptide repeat,
FT                   score 0.4"
FT                   /inference="protein motif:HMMPfam:PF00515"
FT   misc_feature    127823..127924
FT                   /locus_tag="BCAL0109"
FT                   /note="HMMPfam hit to PF00515, Tetratricopeptide repeat,
FT                   score 0.0085"
FT                   /inference="protein motif:HMMPfam:PF00515"
FT   misc_feature    127925..128026
FT                   /locus_tag="BCAL0109"
FT                   /note="HMMPfam hit to PF07719, Tetratricopeptide repeat,
FT                   score 2.5e-06"
FT                   /inference="protein motif:HMMPfam:PF07719"
FT   misc_feature    127925..128002
FT                   /locus_tag="BCAL0109"
FT                   /note="HMMPfam hit to PF07721, Tetratricopeptide repeat,
FT                   score 0.023"
FT                   /inference="protein motif:HMMPfam:PF07721"
FT   misc_feature    128027..128128
FT                   /locus_tag="BCAL0109"
FT                   /note="HMMPfam hit to PF00515, Tetratricopeptide repeat,
FT                   score 1.7e-07"
FT                   /inference="protein motif:HMMPfam:PF00515"
FT   misc_feature    128129..128230
FT                   /locus_tag="BCAL0109"
FT                   /note="HMMPfam hit to PF00515, Tetratricopeptide repeat,
FT                   score 5.9e-09"
FT                   /inference="protein motif:HMMPfam:PF00515"
FT   misc_feature    128129..128206
FT                   /locus_tag="BCAL0109"
FT                   /note="HMMPfam hit to PF07721, Tetratricopeptide repeat,
FT                   score 9.6e-05"
FT                   /inference="protein motif:HMMPfam:PF07721"
FT   misc_feature    128375..128398
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(129387..130529)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0110"
FT                   /product="putative aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0110"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50418"
FT                   /db_xref="GOA:B4EDI4"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B4EDI4"
FT                   /protein_id="CAR50418.1"
FT                   /translation="MTASLPASSVAQLPRERIYVTQPHLPPLEEFLPYLEKIWESRTLT
FT                   NGGPFHQQFEQALCEYLGVPHLSLFANGTLALVTALQALRITGEVITTPYSFVATAHSL
FT                   LWNGIKPVFADVAPGTLNLDAARIEAAITPQTTAIMPVHCYGNPCDVDAIQKIADNYNL
FT                   RVIYDAAHAFGVQTAAGSVLAHGDLSVLSFHATKVFNTFEGGAIVCPDAKTKQRIDHLK
FT                   NFGFVDEVTVVAPGINGKMSEINAAFGMLQLQHIDGALARRRDIDTLYRALLLDVRGIR
FT                   CLPQGGQTVANHAYFPILVEDDYPLDRDALYRKLRDHDVYARRYFHPLISEFPMYRGLP
FT                   SANRDNLPVASEAARKVLCLPLYPALTDDTVHRIVKLIGR"
FT   misc_feature    complement(129393..130457)
FT                   /locus_tag="BCAL0110"
FT                   /note="HMMPfam hit to PF01041, DegT/DnrJ/EryC1/StrS
FT                   aminotransferase, score 1.3e-100"
FT                   /inference="protein motif:HMMPfam:PF01041"
FT   misc_feature    complement(129639..130403)
FT                   /locus_tag="BCAL0110"
FT                   /note="HMMPfam hit to PF01212, Beta-eliminating lyase,
FT                   score 0.00017"
FT                   /inference="protein motif:HMMPfam:PF01212"
FT   CDS_pept        complement(130559..132901)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0111"
FT                   /product="putative TPR repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0111"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50419"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029489"
FT                   /db_xref="UniProtKB/TrEMBL:B4EDI5"
FT                   /protein_id="CAR50419.1"
FT                   /translation="MFSTELPATAALTPEQQLAQDIALVMENALERQRSGAFDDARALY
FT                   EAILDAVPAHGDAHYNLAVLMVDTGQATDAVPHFEAAIGANPDNGYYWVSYIHALHRTG
FT                   QTAAAWIAVEIAQQRGVHGPALDGLIAQLASPEVVLATAAVAPSGIDAAIVLETATGHA
FT                   GRSDSGKPVRRPNQTLLQKHAALFDKNKHAEATALARQLVADYPQDGACWRALSASLHR
FT                   EGRFAEMIEAGFRTIELLPDELLVRMLLADTLRVMNRLEEADEQCTRLIQLQPDHPEAF
FT                   RIRGLVLFALRRMDEAIAACRRAVELAPGAAAPCGTLGFVLLEQGATQEAMGWLKRSIE
FT                   INPTDSVTHSSMLFCITHISDFDPQALITEHRKFGERYGNHKRKRAAVFSNSRDPARKL
FT                   QVGFVSGDLFSHAVASYAVPVIEHLAADPGIAMHFYHNHFEEDHVSERFKAHATTWRTV
FT                   AGMSDTAFLERVRNDRIDIVIDLSGHTGRNRLVALAQRAAPVQASWIGYPATTGLAAMD
FT                   YYLADRFLAPHGQFEDQFVERIVRLPAIASFMPPVNCPPVNVLPALHNGYTTYGSFNRL
FT                   NKLSSHVIAVWARVLHADPTARMALGAIGNEGDQQTLTEWFVAAGIDASRLSFHRRSNI
FT                   PVYMQQHHGVDLCLDTFPYTGSTTTLNGLWMGVPTLTIPGSTMAGRGSASWLQHVGCDA
FT                   YIANDEDDFVAKALALSSDTTTLQALRAGLRARCSASAAFRPDVVAAGLSSALRTMWVR
FT                   WCANEPVTAFDTPLFDDTATAPAAAEA"
FT   misc_feature    complement(131867..131968)
FT                   /locus_tag="BCAL0111"
FT                   /note="HMMPfam hit to PF00515, Tetratricopeptide repeat,
FT                   score 0.028"
FT                   /inference="protein motif:HMMPfam:PF00515"
FT   misc_feature    complement(131969..132070)
FT                   /locus_tag="BCAL0111"
FT                   /note="HMMPfam hit to PF07719, Tetratricopeptide repeat,
FT                   score 3e-06"
FT                   /inference="protein motif:HMMPfam:PF07719"
FT   misc_feature    complement(132071..132172)
FT                   /locus_tag="BCAL0111"
FT                   /note="HMMPfam hit to PF00515, Tetratricopeptide repeat,
FT                   score 0.33"
FT                   /inference="protein motif:HMMPfam:PF00515"
FT   misc_feature    complement(132635..132736)
FT                   /locus_tag="BCAL0111"
FT                   /note="HMMPfam hit to PF07719, Tetratricopeptide repeat,
FT                   score 0.0049"
FT                   /inference="protein motif:HMMPfam:PF07719"
FT   CDS_pept        complement(133158..133457)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0112"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0112"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50420"
FT                   /db_xref="InterPro:IPR008622"
FT                   /db_xref="UniProtKB/TrEMBL:B4EDI6"
FT                   /protein_id="CAR50420.1"
FT                   /translation="MEQTELIAQIDALTDGIEHAAAMADWAEAARLVDARWSLVALLST
FT                   DQPPVGIAAIRRMQASNDRIFADAQRAQQELTDEYQAAMSRVQAVGQYQSIANR"
FT   CDS_pept        complement(133483..134991)
FT                   /transl_table=11
FT                   /gene="fliD1"
FT                   /locus_tag="BCAL0113"
FT                   /product="B-type flagellar hook-associated protein 2
FT                   (HAP2)"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0113"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50421"
FT                   /db_xref="GOA:B4EDI7"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:B4EDI7"
FT                   /protein_id="CAR50421.1"
FT                   /translation="MSTINPAVTAANNSANSALQQAAQSIISGSTGNSSMDVNSLVTAL
FT                   VNAKTAGQAAALNAQQSSDNTQISAYGALSAALSALQASLTTLSNGSLQNTFTATASGT
FT                   GLTATAGAGAVAGSYSVGVTQIATSQSLSSAAFGASTALGTGTMTLSLGSQSFTVDVNG
FT                   TNNTLSGIAAAINTATGNPGIVASVVNGSDGAHLVLSSTPTGAANTIGVALSNVAGDNG
FT                   LSSLGVTSTPSTTGGQSTITSANGSAAWKQSTAAQDAAFTINGIAGTSASNTVTSAITG
FT                   VTLNLTSAAVGATQPQTLTVATDTKSQAAAINNFATLYNTLVTTMGSLSSFTSGASSQG
FT                   PLLGDSTLNTIKNALASIVASGVNSNGSTVNLASIGVTLQADGTLKVDSTALNGALQNN
FT                   PTGVASLFNSKNGIGEQLTTNITNYTKTNGLIAARTTALSNDLKNVAQQQTTLSNYAAQ
FT                   LTSQYQAQFTALNTLMATMNSNSQYLTQLFGGANSAGAMSNNKG"
FT   misc_feature    complement(133555..134226)
FT                   /gene="fliD1"
FT                   /locus_tag="BCAL0113"
FT                   /note="HMMPfam hit to PF07195, Flagellar hook-associated
FT                   protein, score 1.6e-59"
FT                   /inference="protein motif:HMMPfam:PF07195"
FT   misc_feature    complement(134383..134553)
FT                   /gene="fliD1"
FT                   /locus_tag="BCAL0113"
FT                   /note="HMMPfam hit to PF07196, Flagellin hook IN motif,
FT                   score 2.7e-07"
FT                   /inference="protein motif:HMMPfam:PF07196"
FT   misc_feature    complement(134599..134895)
FT                   /gene="fliD1"
FT                   /locus_tag="BCAL0113"
FT                   /note="HMMPfam hit to PF02465, Flagellar hook-associated
FT                   protein, score 4.1e-18"
FT                   /inference="protein motif:HMMPfam:PF02465"
FT   CDS_pept        complement(135124..136278)
FT                   /transl_table=11
FT                   /gene="fliC"
FT                   /locus_tag="BCAL0114"
FT                   /product="flagellin (type II)"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0114"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50422"
FT                   /db_xref="GOA:B4EDI8"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR022578"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:B4EDI8"
FT                   /protein_id="CAR50422.1"
FT                   /translation="MLGINSNINSLVAQQNLNGSQNALSQAITRLSSGKRINSAADDAA
FT                   GLAISTRMQTQINGLNQGVSNANDGVSMIQTASSALSSLTNSLQRIRQLAVQASTGTMS
FT                   TTDQAALQQEVSQQIQEVNRIASQTTYNGTNILDGSAGIVSFQVGANVGQTISLDLSQS
FT                   MSAAKIGGGLVQKGQTVGTVTGLSLDNNGAYTGSGATITAINVLSDGKGGYTFTDQNGG
FT                   AISQTVAQSVFGANATTGTGTAVGNLTLQSGATGAGTSAAQQTAITNAIAQINAVNKPA
FT                   TVSNLDISTVSGANVAMVSIDNALQTVNNVQAALGAAQNRFTAIATSQQAESTDLSSAQ
FT                   SQITDANFAQETANMSKHQVLQQAGISVLAQANSLPQQVLKLLQ"
FT   misc_feature    complement(135193..135408)
FT                   /gene="fliC"
FT                   /locus_tag="BCAL0114"
FT                   /note="HMMPfam hit to PF00700, Bacterial flagellin
FT                   C-terminus, score 2.8e-15"
FT                   /inference="protein motif:HMMPfam:PF00700"
FT   misc_feature    complement(135787..136197)
FT                   /gene="fliC"
FT                   /locus_tag="BCAL0114"
FT                   /note="HMMPfam hit to PF00669, Bacterial flagellin
FT                   N-terminus, score 2.9e-63"
FT                   /inference="protein motif:HMMPfam:PF00669"
FT   CDS_pept        136809..137021
FT                   /transl_table=11
FT                   /gene="rpsU1"
FT                   /locus_tag="BCAL0115"
FT                   /product="30S ribosomal protein S21 1"
FT                   /note="Similar to BCAM0915, 75.714% identity (75.714%
FT                   ungapped) in 70 aa overlap (1-70:1-70) and BCAS0245,
FT                   60.000% identity (60.000% ungapped) in 70 aa overlap
FT                   (1-70:1-70)"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0115"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50423"
FT                   /db_xref="GOA:B4EDI9"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/TrEMBL:B4EDI9"
FT                   /protein_id="CAR50423.1"
FT                   /translation="MTTILLKENEPFEVAIRRFRRAIEKNGLIAELRERQSYEKPTAVR
FT                   KRKKAAAVKRLHKRLRSQMLPKKLH"
FT   misc_feature    136812..136973
FT                   /gene="rpsU1"
FT                   /locus_tag="BCAL0115"
FT                   /note="HMMPfam hit to PF01165, Ribosomal protein S21, score
FT                   3.6e-31"
FT                   /inference="protein motif:HMMPfam:PF01165"
FT   CDS_pept        complement(137188..139311)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0116"
FT                   /product="putative TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0116"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50424"
FT                   /db_xref="GOA:B4EDJ0"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B4EDJ0"
FT                   /protein_id="CAR50424.1"
FT                   /translation="MTVCLARPPVRPRRVAAALACLAASLAHADDSPGDAAVLPALNIT
FT                   AAHDSPQHLTDTISTGALGTRRQLDTPFSTTIVTSEELEARQPYKLGDVFANDASVSDN
FT                   SGAYSAWASYMTVRGMQLDWQNGYKIDGLPFVTYGITMPYEQLDRVELLKGLGGFLYGF
FT                   VTPGGVVNYVTKQPGAEPVRSVDIGYRSTNVWTEHVDLGQRFGPDHMFGARLNATHEEG
FT                   KTYNDGNIRRDSVSLALQANLTRDLSVSFGALYQDRRTTGQTPSIFTGSYPGGALPATI
FT                   SGGSTNLGGKDQYLNTNLQLYTAGLQYQLALDWQLDVAYSYSKATRRRNESTLYLQDAA
FT                   GNYTDSRYVGMEDHRFSQWRAMVEGKVRTGPFSHQIVLGASWQKQANDYSANSVFVPLG
FT                   AGNLYAPNPYRYESPHGFIQYRTSEIVQKSLFASDTVQLTERWSVLAGVRYMNYAQRAF
FT                   QASGAEDPGYRQNGVVTPTFAVMFKLAPTTTAYASYAESLEPGSRVNDVYANAGQVLKP
FT                   LRSKQYELGIKSERARWSATAALFRIERSAEYANAANVYVQDGESIIQGIEVGARAKFG
FT                   AHWNAGVDAMLLDAWYANGIGNHGNRVAGAPRFVLAGDLGYAVPGVPGLTLGVDAKFTG
FT                   ATPLRAAGGLDAPGFLVVNAGARYLTRVGRHDVTLRASIDNVLNRRYWEYQYADYVKPG
FT                   DPRTVSLSAKIDF"
FT   misc_feature    complement(137191..137889)
FT                   /locus_tag="BCAL0116"
FT                   /note="HMMPfam hit to PF00593, TonB dependent receptor,
FT                   score 4e-23"
FT                   /inference="protein motif:HMMPfam:PF00593"
FT   misc_feature    complement(137191..137244)
FT                   /note="PS01156 TonB-dependent receptor proteins signature
FT                   2."
FT                   /inference="protein motif:Prosite:PS01156"
FT   misc_feature    complement(138640..138663)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    complement(138805..139113)
FT                   /locus_tag="BCAL0116"
FT                   /note="HMMPfam hit to PF07715, TonB-dependent Receptor Plug
FT                   Domain, score 8.6e-15"
FT                   /inference="protein motif:HMMPfam:PF07715"
FT   sig_peptide     complement(139225..139311)
FT                   /locus_tag="BCAL0116"
FT                   /note="Signal peptide predicted for BCAL0116 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 1.000 between residues 29 and 30"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        139541..140776
FT                   /transl_table=11
FT                   /locus_tag="BCAL0117"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0117"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50425"
FT                   /db_xref="GOA:B4EDJ1"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:B4EDJ1"
FT                   /protein_id="CAR50425.1"
FT                   /translation="MNAFLRPFLVRLHRWFGLAIALFLFVAGLTGALIAWDHELDAVLN
FT                   PDFYTARSGAAPLAPLELAARIEAADPRVQVTYLPLAIEPGHTLQAGVMPRTDPATGQP
FT                   YALGFSQIAVDPATGAVQGRREWGAPSLARLDLMPFIYRLHYSLFLPVYGGINFGFWVM
FT                   GVVGIVWAIDSLIALVLAFPNLKSWRKSFAFRVRRGGYPLVFDLHRSGGVWVWGLLLVV
FT                   AITSISMNLAVPVVRPLVSLVSPLAETPYTNPEHFPPVPPGSQILPRERIVEIARSAGR
FT                   DAGIAAPPGALLFAPGMNAYAVGFFTLGNDHGDVGLGNAWLYWNAVTGKPVAAQVPGRG
FT                   SAGDLFMQAQFPLHSGRIAGVAGRVAVSVLGIVIAMLSVTGVCIWVKKRGARGRAARSA
FT                   RPAVPASSRAAR"
FT   misc_feature    139565..139645
FT                   /locus_tag="BCAL0117"
FT                   /note="HMMPfam hit to PF03929, PepSY-associated TM helix,
FT                   score 0.18"
FT                   /inference="protein motif:HMMPfam:PF03929"
FT   misc_feature    join(139580..139648,139988..140056,140174..140242,
FT                   140390..140458,140630..140698)
FT                   /locus_tag="BCAL0117"
FT                   /note="5 probable transmembrane helices predicted for
FT                   BCAL0117 by TMHMM2.0 at aa 25-47, 161-183, 223-245, 295-317
FT                   and 375-397"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    140150..140230
FT                   /locus_tag="BCAL0117"
FT                   /note="HMMPfam hit to PF03929, PepSY-associated TM helix,
FT                   score 0.1"
FT                   /inference="protein motif:HMMPfam:PF03929"
FT   misc_feature    140588..140695
FT                   /locus_tag="BCAL0117"
FT                   /note="HMMPfam hit to PF03929, PepSY-associated TM helix,
FT                   score 0.0053"
FT                   /inference="protein motif:HMMPfam:PF03929"
FT   CDS_pept        complement(140861..141463)
FT                   /transl_table=11
FT                   /gene="tag"
FT                   /locus_tag="BCAL0118"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0118"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50426"
FT                   /db_xref="GOA:B4EDJ2"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:B4EDJ2"
FT                   /protein_id="CAR50426.1"
FT                   /translation="MSQRCNWVKTEADAHYHDTEWGVPSHDDRHLFEMLILEGAQAGLS
FT                   WSTILNKRAGYREAFADFDVDAVARFTPTRIEKLLENPGIVRNRAKVESAVTNARAVQR
FT                   IREEHGSLAAFLWSFVGGTPVQNAWQSYRDAPASTEQSDALSKALKAYGCKFVGSTICY
FT                   ALMQATGMVNDHEAGCPCHARCAALGGKQPARRRKAG"
FT   misc_feature    complement(140912..141445)
FT                   /gene="tag"
FT                   /locus_tag="BCAL0118"
FT                   /note="HMMPfam hit to PF03352, Methyladenine glycosylase,
FT                   score 6.7e-93"
FT                   /inference="protein motif:HMMPfam:PF03352"
FT   CDS_pept        141605..142486
FT                   /transl_table=11
FT                   /locus_tag="BCAL0119"
FT                   /product="BadF/BadG/BcrA/BcrD ATPase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0119"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50427"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="UniProtKB/TrEMBL:B4EDJ3"
FT                   /protein_id="CAR50427.1"
FT                   /translation="MAALLFAIGIDGGGTGTRAVLADRDGRELAQGRGGPSGLGLGIER
FT                   AWASISAACADAFTQAGLAFDWSQCALGCGLAGVNNAAWLAAFRAQAPLGALAIESDAY
FT                   TTVVGAHGGAPGLIVALGTGSIAAALDAAGACRIAGGFGFPSGDEASGAWLGVRALAYA
FT                   QQALDGRVPRDAFATALLAETGARDRDALVQWSCDANQTIYARLAPIVFAHRTHPVARA
FT                   LIAQAGDEIGKMIDALDPQHALPVALCGGLADALAPAVPARHAARLRAPLDDSAHGALR
FT                   LALQALRAAEGA"
FT   misc_feature    141626..142453
FT                   /locus_tag="BCAL0119"
FT                   /note="HMMPfam hit to PF01869, BadF/BadG/BcrA/BcrD ATPase
FT                   family, score 3.5e-26"
FT                   /inference="protein motif:HMMPfam:PF01869"
FT   CDS_pept        142626..143450
FT                   /transl_table=11
FT                   /locus_tag="BCAL0120"
FT                   /product="haloacid dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0120"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50428"
FT                   /db_xref="GOA:B4EDJ4"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B4EDJ4"
FT                   /protein_id="CAR50428.1"
FT                   /translation="MYKVIATDLDGTLLNSDHQLDPYTIDTVRRLDRDGVQFVIATGRH
FT                   YADVAGIRDVLGIRPYLITSNGARVHAPDDTKIHGQDIDAAIVRSLVQPEVVGAHGRVI
FT                   VNLFTNDGWLIDREAPHLLEFHQDSGFRYEVIDMAAHDGADIAKVLYIGEPADLAVVAE
FT                   QMRVQFGDTLYVTYSLPDCLEVMTANVSKGRALRTVLARLGVDTGHCIAFGDNMNDIDL
FT                   LETAGHAFMMNNANPDLIARLPHVPRIGNNFDAGVARHLRTLFSLEDDVVAS"
FT   misc_feature    142626..143414
FT                   /locus_tag="BCAL0120"
FT                   /note="HMMPfam hit to PF05116, Sucrose-6F-phosphate
FT                   phosphohydrolase, score 7.1e-06"
FT                   /inference="protein motif:HMMPfam:PF05116"
FT   misc_feature    142629..143333
FT                   /locus_tag="BCAL0120"
FT                   /note="HMMPfam hit to PF00702, haloacid dehalogenase-like
FT                   hydrolase, score 0.00014"
FT                   /inference="protein motif:HMMPfam:PF00702"
FT   misc_feature    142635..142670
FT                   /note="PS01228 Hypothetical cof family signature 1."
FT                   /inference="protein motif:Prosite:PS01228"
FT   misc_feature    142638..143408
FT                   /locus_tag="BCAL0120"
FT                   /note="HMMPfam hit to PF08282, haloacid dehalogenase-like
FT                   hydrolase, score 7.2e-65"
FT                   /inference="protein motif:HMMPfam:PF08282"
FT   CDS_pept        complement(143590..144333)
FT                   /transl_table=11
FT                   /gene="aqpZ"
FT                   /locus_tag="BCAL0121"
FT                   /product="aquaporin Z"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0121"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50429"
FT                   /db_xref="GOA:B4EDJ5"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR023743"
FT                   /db_xref="InterPro:IPR034294"
FT                   /db_xref="UniProtKB/TrEMBL:B4EDJ5"
FT                   /protein_id="CAR50429.1"
FT                   /translation="MNLSQRLAAEVFGTFWLVLGGCGSAVLAAAFPGLGIGFAGVALAF
FT                   GLTVLTMAFAIGHISGCHLNPAVSVGLTVAGRFPARDLAPYIVAQVVGATLGAFVLYLI
FT                   ATGKPGFDVVGSGFATNGFGDRSPGHYSLAASFICEVVMTGFFLFVILGATDKRGVPAG
FT                   FAPIAIGLCLTLIHLISIPVTNTSVNPARSTGPALFVGGDAIGQLWLFWVAPLIGAVLA
FT                   GIIYPLVAGRDDAVDLLPASARTSE"
FT   misc_feature    complement(join(143644..143712,143791..143859,
FT                   143878..143946,144019..144087,144166..144234,
FT                   144247..144315))
FT                   /gene="aqpZ"
FT                   /locus_tag="BCAL0121"
FT                   /note="6 probable transmembrane helices predicted for
FT                   BCAL0121 by TMHMM2.0 at aa 7-29, 34-56, 83-105, 130-152,
FT                   159-181 and 208-230"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(143656..144333)
FT                   /gene="aqpZ"
FT                   /locus_tag="BCAL0121"
FT                   /note="HMMPfam hit to PF00230, Major intrinsic protein,
FT                   score 1.1e-41"
FT                   /inference="protein motif:HMMPfam:PF00230"
FT   misc_feature    complement(144121..144147)
FT                   /note="PS00221 MIP family signature."
FT                   /inference="protein motif:Prosite:PS00221"
FT   sig_peptide     complement(144250..144333)
FT                   /gene="aqpZ"
FT                   /locus_tag="BCAL0121"
FT                   /note="Signal peptide predicted for BCAL0121 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.970) with cleavage site
FT                   probability 0.628 between residues 28 and 29"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(144268..144300)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        144633..144929
FT                   /transl_table=11
FT                   /locus_tag="BCAL0122"
FT                   /product="histone-like nucleoid-structuring (H-NS) protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0122"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50430"
FT                   /db_xref="GOA:B4EDJ6"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:B4EDJ6"
FT                   /protein_id="CAR50430.1"
FT                   /translation="MSQYAKLKAQIADLQAQADDVRRQEVAAVIADVQRMIAEYGLTAQ
FT                   DLGFAERARRGRPPKKAPLPPKYRDPKSGATWSGRGKPPNWIVGKNRDRFLIE"
FT   misc_feature    144636..144923
FT                   /locus_tag="BCAL0122"
FT                   /note="HMMPfam hit to PF00816, H-NS histone family, score
FT                   1.5e-18"
FT                   /inference="protein motif:HMMPfam:PF00816"
FT   CDS_pept        complement(145033..146097)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0123"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0123"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50431"
FT                   /db_xref="GOA:B4EDJ7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B4EDJ7"
FT                   /protein_id="CAR50431.1"
FT                   /translation="MRIAQIAPLYEAVPPKLYGGTERVVSYLTEALVELGHDVTLFASG
FT                   DSVTSARLEAAWPRALRLDPSVRDSMAPHMRLLEQVARVAHEFDVLHFHLDYLPFPLMS
FT                   RLDTPYVTTLHGRLDLPELQPVFDAFPDSPVVSISNNQRKPLPQAAWAGTVYHGLPDTL
FT                   LTPQPDVKPEYLAFLGRICPEKRVDTAIRIAAQSGLPLKIAAKVDKADADYFKEVIEPL
FT                   LDQAHVEFIGEINEAQKPAFLSGAKALLFPIDWPEPFGLVMIEAMACGTPVVAFNRGSV
FT                   PEVIEDGVTGFIVEDVQGAVGALHRIDSLSRPAIRERFDTRFSSKAMARRYVETYESLC
FT                   AATKQPALRRVAGA"
FT   misc_feature    complement(145120..145623)
FT                   /locus_tag="BCAL0123"
FT                   /note="HMMPfam hit to PF00534, Glycosyl transferases group,
FT                   score 4e-22"
FT                   /inference="protein motif:HMMPfam:PF00534"
FT   CDS_pept        146762..147082
FT                   /transl_table=11
FT                   /gene="flhD"
FT                   /locus_tag="BCAL0124"
FT                   /product="flagellar regulon master regulator subunit FlhD"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0124"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50432"
FT                   /db_xref="GOA:B4EDJ8"
FT                   /db_xref="InterPro:IPR023559"
FT                   /db_xref="InterPro:IPR036194"
FT                   /db_xref="UniProtKB/TrEMBL:B4EDJ8"
FT                   /protein_id="CAR50432.1"
FT                   /translation="MSATSEMLSEIKEVNLSYLLLAQRLLREDKAMGMFRMGISQELAD
FT                   VLANLTLAQTVKLAASNQMLCRFRFDDHALLSSLADKGRSDVVAHAHSAILMAGQQVEG
FT                   VR"
FT   misc_feature    146765..147076
FT                   /gene="flhD"
FT                   /locus_tag="BCAL0124"
FT                   /note="HMMPfam hit to PF05247, Flagellar transcriptional
FT                   activator (FlhD), score 4.9e-47"
FT                   /inference="protein motif:HMMPfam:PF05247"
FT   CDS_pept        147175..147729
FT                   /transl_table=11
FT                   /gene="flhC"
FT                   /locus_tag="BCAL0125"
FT                   /product="flagellar regulon master regulator subunit FlhC"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0125"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50433"
FT                   /db_xref="GOA:B4EDJ9"
FT                   /db_xref="InterPro:IPR007944"
FT                   /db_xref="UniProtKB/TrEMBL:B4EDJ9"
FT                   /protein_id="CAR50433.1"
FT                   /translation="MASKSVVIEVKEITLAIELIELGARLQLLEAETSLSRDRLIKLYK
FT                   ELKGVSPPKGMLPFSTDWFMTWQPNIHSSLFYNIYRFMQDHGRCEPIQSIVKAYRLYLE
FT                   HVNLSGDEAALSLTRAWTLVRFFDSGMLQMTPCTRCGGHFVAHAHDPHQGFVCGLCQPP
FT                   SRAGKTRKAAAARAELAAAVA"
FT   misc_feature    147175..147726
FT                   /gene="flhC"
FT                   /locus_tag="BCAL0125"
FT                   /note="HMMPfam hit to PF05280, Flagellar transcriptional
FT                   activator (FlhC), score 7.2e-129"
FT                   /inference="protein motif:HMMPfam:PF05280"
FT   CDS_pept        147910..148770
FT                   /transl_table=11
FT                   /gene="motA"
FT                   /locus_tag="BCAL0126"
FT                   /product="chemotaxis protein MotA"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0126"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50434"
FT                   /db_xref="GOA:B4EDK0"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR022522"
FT                   /db_xref="UniProtKB/TrEMBL:B4EDK0"
FT                   /protein_id="CAR50434.1"
FT                   /translation="MLIIVGTLVTLLSVFGGYALAGGHLGALIQPVEILMIAGAGVGAF
FT                   ILGNGGKTIKATLRVLPTLFKGSKYTKDVYMELMALLYVLLAKARKEGTLTLEADIDDP
FT                   QKSPIFTQYPKILADHHIVEFLTDYLRLMVGGNMNAFEIESLMDEEIETHHAEGEGPAH
FT                   ALMRVGDAMPAFGIVAAVMGVVHTMASADKPPAVLGAMIAQALVGTFLGILLSYGLIGP
FT                   LASLAEQRVAESTKMFQCIKVTILATLNGYAPAIAVEFGRKVLFSTERPSFSELEEHVR
FT                   RVKAK"
FT   sig_peptide     147910..147972
FT                   /gene="motA"
FT                   /locus_tag="BCAL0126"
FT                   /note="Signal peptide predicted for BCAL0126 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.988) with cleavage site
FT                   probability 0.971 between residues 21 and 22"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(147913..147981,147994..148062,148420..148479,
FT                   148522..148590)
FT                   /gene="motA"
FT                   /locus_tag="BCAL0126"
FT                   /note="4 probable transmembrane helices predicted for
FT                   BCAL0126 by TMHMM2.0 at aa 2-24, 29-51, 171-190 and
FT                   205-227"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    148522..148575
FT                   /note="PS01307 Flagellar motor protein motA family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS01307"
FT   CDS_pept        148784..149803
FT                   /transl_table=11
FT                   /gene="motB"
FT                   /locus_tag="BCAL0127"
FT                   /product="chemotaxis protein MotB"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0127"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50435"
FT                   /db_xref="GOA:B4EDK1"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B4EDK1"
FT                   /protein_id="CAR50435.1"
FT                   /translation="MSKSKDRAIVVKRVAPAKKGHHGGAWKLAYADFMTAMMAFFLLMW
FT                   LLSSVTPVQLKGIAEYFNMPLKAAILGSGDRSSQDSSIINGGGRDLSSVDAGTLRRTDG
FT                   TTSLAERLAKAGDENSRSQAQGAQDRLEQTRLHDLQIKLMAAIEANPTLRQFKQQIRID
FT                   STLMGLRIEIVDTQKRPMFAMSSDRVEPYMRDILREIGKTLNDVPNRIIVQGHTDAVPY
FT                   AGGEGGYSNWELSADRANASRRELISGGMDEAKVLRVLGLASTQNLNKADPLDPENRRI
FT                   SVIVLNRKSEEALMRDDATTTTLSADAAGSKLLAQQLGGPTPAVRPVVASAVAVAPKP"
FT   misc_feature    148865..148924
FT                   /gene="motB"
FT                   /locus_tag="BCAL0127"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAL0127 by TMHMM2.0 at aa 28-47"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    149324..149620
FT                   /gene="motB"
FT                   /locus_tag="BCAL0127"
FT                   /note="HMMPfam hit to PF00691, OmpA family, score 3.2e-26"
FT                   /inference="protein motif:HMMPfam:PF00691"
FT   CDS_pept        149828..150205
FT                   /transl_table=11
FT                   /gene="cheY"
FT                   /locus_tag="BCAL0128"
FT                   /product="chemotaxis two-component response regulator CheY"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0128"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50436"
FT                   /db_xref="GOA:B4EDK2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B4EDK2"
FT                   /protein_id="CAR50436.1"
FT                   /translation="MIRTILAIDDSATMRALLQATLAQAGYDVTVAPDGEAGFDMAATA
FT                   PYDLVLTDQNMPRKNGLEVIAALRKLTAYADTPILVLTTEGSDAFKDAARDAGATGWIE
FT                   KPIDPGVLVELVATLSEPAAS"
FT   misc_feature    149834..150178
FT                   /gene="cheY"
FT                   /locus_tag="BCAL0128"
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 1.7e-30"
FT                   /inference="protein motif:HMMPfam:PF00072"
FT   CDS_pept        150239..152506
FT                   /transl_table=11
FT                   /gene="cheA"
FT                   /locus_tag="BCAL0129"
FT                   /product="chemotaxis two-component sensor kinase CheA"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50437"
FT                   /db_xref="GOA:B4EE54"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR015162"
FT                   /db_xref="InterPro:IPR035891"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:B4EE54"
FT                   /protein_id="CAR50437.1"
FT                   /translation="MTLDITQFYQTFFDEADELLAQMEQLLLNLDVDAPDPEDLAAIFR
FT                   AAHSIKGGAATFGFSALTDTTHILESLLDRARNHELTLTKDMVDVFLETKDVLSDQLVD
FT                   YRASAEPDAAAAAAICAKLERLKAESGAGAPAAAEAAPVAPVAAAAVAPAAEPAAAGDR
FT                   APDHVVEQAVAAAHPAADAGAGGPHLKITLVGVDAKDQALLTEELGNLGRIVGREEAGA
FT                   DLSLWVESDVPSDDIVAVCCFVIDESQIRVAHGTAPAAQAAPAAAQDAAAAVAAEPAAA
FT                   PPPARVEVFAPQAAAAQPAASAPAEPAAAAAAQPQPPSPSQQHAQPQPAEHAAPAAAHH
FT                   DDKRARPAAAAAAGAEGSSIRVGVEKVDQLINLVGELVITQAMLAETASAFDPALHDRL
FT                   FNGMAQLERNARDLQEAVMSIRMMPMDYVFSRFPRLVRDLAGKLGKQVELVTFGQATEL
FT                   DKSLIERIIDPLTHLVRNSLDHGIETVDKRVAAGKDAVGQLVLSAAHHGGNIVIEVSDD
FT                   GAGLNRERILAKAAKQGMQIAENISDDEVWQLIFAPGFSTAETVTDVSGRGVGMDVVKR
FT                   NIQSMGGHVEITSLAGRGTTTRIVLPLTLAILDGMSVKVGSEIFILPLNFVMESLQPSN
FT                   DDIYTVGNGERVVRVRGEYLPLVALHEVFSVEDARTDPTQGIVTIMETEGRRFAMLIDE
FT                   LVGQQQVVVKNLETNYRKVHGISAATILGDGSVALIVDVAALNRETRATHGARAGAELA
FT                   VF"
FT   misc_feature    150257..150562
FT                   /gene="cheA"
FT                   /locus_tag="BCAL0129"
FT                   /note="HMMPfam hit to PF01627, Hpt domain, score 4.6e-17"
FT                   /inference="protein motif:HMMPfam:PF01627"
FT   misc_feature    150272..150298
FT                   /note="PS00039 DEAD-box subfamily ATP-dependent helicases
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00039"
FT   misc_feature    151307..151498
FT                   /gene="cheA"
FT                   /locus_tag="BCAL0129"
FT                   /note="HMMPfam hit to PF02895, Signal transducing histidine
FT                   kinase, hom, score 2.7e-24"
FT                   /inference="protein motif:HMMPfam:PF02895"
FT   misc_feature    151631..152050
FT                   /gene="cheA"
FT                   /locus_tag="BCAL0129"
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HS, score 2.6e-26"
FT                   /inference="protein motif:HMMPfam:PF02518"
FT   misc_feature    152063..152449
FT                   /gene="cheA"
FT                   /locus_tag="BCAL0129"
FT                   /note="HMMPfam hit to PF01584, CheW-like domain, score
FT                   1.8e-24"
FT                   /inference="protein motif:HMMPfam:PF01584"
FT   CDS_pept        152554..153069
FT                   /transl_table=11
FT                   /gene="cheW"
FT                   /locus_tag="BCAL0130"
FT                   /product="chemotaxis protein CheW"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0130"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50438"
FT                   /db_xref="GOA:B4EE55"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:B4EE55"
FT                   /protein_id="CAR50438.1"
FT                   /translation="MINPAAANAATSRRDAEQGDATGQEFLVFTLGDEEYGIDILKVQE
FT                   IRGYDSVTRIANAPEFIKGVINLRGIIVPIVDMRIKFHLGRVEYDHQTVVIILNVSNRV
FT                   VGMVVDGVSDVLTLQTDQIMPAPEFGATLTTEYLTGLGTVDGRMLILMDIEKLMSSREM
FT                   ALIETLGG"
FT   misc_feature    152626..153039
FT                   /gene="cheW"
FT                   /locus_tag="BCAL0130"
FT                   /note="HMMPfam hit to PF01584, CheW-like domain, score
FT                   5.9e-35"
FT                   /inference="protein motif:HMMPfam:PF01584"
FT   CDS_pept        153107..155065
FT                   /transl_table=11
FT                   /gene="tar"
FT                   /locus_tag="BCAL0131"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0131"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50439"
FT                   /db_xref="GOA:B4EE56"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR035440"
FT                   /db_xref="UniProtKB/TrEMBL:B4EE56"
FT                   /protein_id="CAR50439.1"
FT                   /translation="MLHNWSIRTTLTAVGLILVCLAAAVGGLGLYALNHASRSLDEIAH
FT                   VDLPAIHTLDDTAAYLLRSRVALDRFRTLTEAGNAADAAKVLDRAQELYAKSNQNWQTF
FT                   QSTPKLGVEQALVDELTARYTTIMKEGVEPEFAAARAGDMAAYHAIADAKISPMFVAFD
FT                   QTAAAVIAALQKRAEERQAATQSQISMMIALIAAGIAIAFVVVIAIRFALRGLIVKPLE
FT                   DAIAHFERIAGGDLTQPVNVFSTNEIGRLFGGIKRMQDAVTTMVQAVHRGTESIDVGAR
FT                   EIATGNIDLSQRTEEQAASLQETASSMEQLTGTVRQNAENARQASQLAVNASDIATQGG
FT                   DVVGQVVSTMQDIAVSSGKVVDIIGTIEGIAFQTNILALNAAVEAARAGEQGRGFAVVA
FT                   GEVRSLAQRSASAAKEIKQLIGDSAEKVDSGSALVARAGATMEEIVQAVRRVTDIMGEI
FT                   SAASDEQSTGIEQVNRAVGQMDAVTQQNAALVEQAAAAAASLEEQTRQMKAIVSGWRVA
FT                   GGIVLAPARSVARPVAHEPAALPSDARHDAPVAALPAPQAAAQPAARRAAPASRAAAAS
FT                   ADHEPKRAADATARTQKDAPASRGGAAAGGYGPRLAKTAAATDKPAAKPALVRPALNGE
FT                   KPALAAAGTSDDDWETF"
FT   sig_peptide     153107..153178
FT                   /gene="tar"
FT                   /locus_tag="BCAL0131"
FT                   /note="Signal peptide predicted for BCAL0131 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.997) with cleavage site
FT                   probability 0.300 between residues 24 and 25"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(153134..153202,153674..153742)
FT                   /gene="tar"
FT                   /locus_tag="BCAL0131"
FT                   /note="2 probable transmembrane helices predicted for
FT                   BCAL0131 by TMHMM2.0 at aa 10-32 and 190-212"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    153689..153898
FT                   /gene="tar"
FT                   /locus_tag="BCAL0131"
FT                   /note="HMMPfam hit to PF00672, HAMP domain, score 6.7e-13"
FT                   /inference="protein motif:HMMPfam:PF00672"
FT   misc_feature    153989..154657
FT                   /gene="tar"
FT                   /locus_tag="BCAL0131"
FT                   /note="HMMPfam hit to PF00015, Methyl-accepting chemotaxis
FT                   protein (MCP) s, score 3.8e-99"
FT                   /inference="protein motif:HMMPfam:PF00015"
FT   CDS_pept        155069..156061
FT                   /transl_table=11
FT                   /gene="cheR"
FT                   /locus_tag="BCAL0132"
FT                   /product="chemotaxis protein methyltransferase"
FT                   /EC_number="2.1.1.80"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0132"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50440"
FT                   /db_xref="GOA:B4EE57"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:B4EE57"
FT                   /protein_id="CAR50440.1"
FT                   /translation="MQHARAPFRPDAPDASPRAGEPGRDFAFTGADFARIRALIHQRAG
FT                   ISLSEHKRDMAYSRLARRLRARGLDTFRDYLDLLEQEDDPLEWEAFTNALTTNLTAFFR
FT                   ESHHFPILSEFVKGRPAPVSVWCSAASTGEEPYSIAITLIEALGETAARSASILATDLD
FT                   TQVLAKAEAGIYTYDQVKHLSPERLKRFFLKGTGAQAGRVKVRPELRAMIRFEQLNLTD
FT                   ADYGIGKPFDAIFCRNVMIYFDKPTQGQVLSRFEPLVKPGGLLFAGHSENFTYVTQAFR
FT                   LRGQTVYELTRDAAQGARSRGAQASAAAAMSSPVRARAAGGAPAYGERG"
FT   misc_feature    155360..155938
FT                   /gene="cheR"
FT                   /locus_tag="BCAL0132"
FT                   /note="HMMPfam hit to PF01739, CheR methyltransferase, SAM
FT                   binding domain, score 1.8e-72"
FT                   /inference="protein motif:HMMPfam:PF01739"
FT   CDS_pept        156058..156816
FT                   /transl_table=11
FT                   /gene="cheD"
FT                   /locus_tag="BCAL0133"
FT                   /product="putative chemoreceptor glutamine deamidase cheD"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0133"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50441"
FT                   /db_xref="GOA:B4EE58"
FT                   /db_xref="InterPro:IPR005659"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038592"
FT                   /db_xref="UniProtKB/TrEMBL:B4EE58"
FT                   /protein_id="CAR50441.1"
FT                   /translation="MSALPIATNRYFDNHFERPGVKLLPNEFYTTSEDMVLMTVLGSCV
FT                   AACLHDPYAGIGGMNHFMLPDDGADPGAAASESMRYGAYAMEVLINELIKAGGRRERFE
FT                   AKVFGGAAVLAGMTTINIGDRNADFVRRYLALERIRITAEDLQGVHPRKVAFMPHSGRA
FT                   MVKKLRLQVPGVTEREAALAREADRLRTARTRAHVELFAAKRPAAPQPARPRIELFGAR
FT                   GAAPAGSGGARTAGPQGSPYAANLSRKQEA"
FT   misc_feature    156244..156582
FT                   /gene="cheD"
FT                   /locus_tag="BCAL0133"
FT                   /note="HMMPfam hit to PF03975, CheD, score 9.6e-40"
FT                   /inference="protein motif:HMMPfam:PF03975"
FT   CDS_pept        156813..157904
FT                   /transl_table=11
FT                   /gene="cheB1"
FT                   /locus_tag="BCAL0134"
FT                   /product="chemotaxis response regulator protein-glutamate
FT                   methylesterase 1"
FT                   /EC_number="3.1.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50442"
FT                   /db_xref="GOA:B4EE59"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:B4EE59"
FT                   /protein_id="CAR50442.1"
FT                   /translation="MTAVQKIKVLCVDDSALIRSLMTEIINSQPDMTVVATAPDPLVAR
FT                   ELIKQHNPDVLTLDVEMPRMDGLDFLEKLMRLRPMPVVMVSSLTERGSEITLRALELGA
FT                   VDFVTKPRVGIRDGMLDYAEKLADKIRAASRARVRQAPQPQAAARTADSAAAAPMINNP
FT                   LVSTEKLIIIGASTGGTEAIREVLTPLPPDAPAVLIAQHMPPGFTKSFAQRLNGLCRIA
FT                   VKEAEHGERVLPGHAYIAPGHAHLLLARSGANYIAQLSDEPPVNRHRPSVDVLFRSAAT
FT                   HAGKNAIGVILTGMGRDGAAGLLEMKRAGAHTFAQDEASCIVFGMPREAIALGGADEIA
FT                   PLADMSRRVMARLATMGDRVQRV"
FT   misc_feature    156831..157160
FT                   /gene="cheB1"
FT                   /locus_tag="BCAL0134"
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 3.9e-30"
FT                   /inference="protein motif:HMMPfam:PF00072"
FT   misc_feature    157320..157868
FT                   /gene="cheB1"
FT                   /locus_tag="BCAL0134"
FT                   /note="HMMPfam hit to PF01339, CheB methylesterase, score
FT                   5.1e-107"
FT                   /inference="protein motif:HMMPfam:PF01339"
FT   CDS_pept        157972..158367
FT                   /transl_table=11
FT                   /gene="cheY"
FT                   /locus_tag="BCAL0135"
FT                   /product="chemotaxis protein CheY"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0135"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50443"
FT                   /db_xref="GOA:B4EE60"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B4EE60"
FT                   /protein_id="CAR50443.1"
FT                   /translation="MDKSMKILVVDDFPTMRRIVRNLLKELGYSNVDEAEDGLAGLARL
FT                   RGGGYDFVISDWNMPNLDGLAMLKEIRADATLTHLPVLMVTAESKKENIIAAAQAGASG
FT                   YVVKPFTAATLDEKLNKIIDKMAKAGS"
FT   misc_feature    157984..158331
FT                   /gene="cheY"
FT                   /locus_tag="BCAL0135"
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 2.1e-43"
FT                   /inference="protein motif:HMMPfam:PF00072"
FT   CDS_pept        158370..159101
FT                   /transl_table=11
FT                   /gene="cheZ"
FT                   /locus_tag="BCAL0136"
FT                   /product="chemotaxis protein CheZ"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0136"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50444"
FT                   /db_xref="GOA:B4EE61"
FT                   /db_xref="InterPro:IPR007439"
FT                   /db_xref="UniProtKB/TrEMBL:B4EE61"
FT                   /protein_id="CAR50444.1"
FT                   /translation="MNEPIHAALAGAAINADGHAEGADYASDRILARIGHVTRTLRDSM
FT                   RELGLDKHVERAAEAVPDARDRLRYVATMTEQAAVRVLNAIEIAKPMQERIQNEAEALD
FT                   ARWAQWYAAPIEHADVRELMDDTRTFLRTLPESTSATRAQLLEIMLAQDFQDLTGQVIK
FT                   KIMDMVYLIEQQLLTVLVENIAPERREQFAATAAAFAAEQMSATGSPESLLNGPQIAPE
FT                   GKSDVVQDQGQVDDLLASLGF"
FT   misc_feature    158430..159098
FT                   /gene="cheZ"
FT                   /locus_tag="BCAL0136"
FT                   /note="HMMPfam hit to PF04344, Chemotaxis phosphatase,
FT                   CheZ, score 3.2e-69"
FT                   /inference="protein motif:HMMPfam:PF04344"
FT   CDS_pept        159361..159864
FT                   /transl_table=11
FT                   /locus_tag="BCAL0137"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0137"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50445"
FT                   /db_xref="InterPro:IPR021267"
FT                   /db_xref="UniProtKB/TrEMBL:B4EE62"
FT                   /protein_id="CAR50445.1"
FT                   /translation="MKLKRLGWTVAHATAAMSVLWAVHAHAELGGAPMSPPADDQAATV
FT                   RALQRAMRSADGVQTSTAAYTVREITLGSGTVIHEYTSAAGSVFGLAWRGPTMPDLASL
FT                   LGSYFPQYTAGVQAAHQARGWRAPVAVETSGLVIRTGGHMGAFSGQAWLPSALPAGVAG
FT                   TDIQ"
FT   CDS_pept        join(159881..160021,160025..161119)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BCAL0138"
FT                   /product="Gly/Ala/Ser-rich lipoprotein (pseudogene)"
FT                   /note="CDS contains a nonsense mutation (amber) after codon
FT                   47. Similar to Burkholderia pseudomallei Gly/Ala/Ser-rich
FT                   lipoprotein UniProt:Q63PS6 (EMBL:BX571965) (434 aa) fasta
FT                   scores: E()=2.6e-79, 55.909% id in 440 aa"
FT                   /db_xref="PSEUDO:CAR50446.1"
FT   CDS_pept        161283..161780
FT                   /transl_table=11
FT                   /locus_tag="BCAL0139"
FT                   /product="putative 3-demethylubiquinone-9
FT                   3-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50447"
FT                   /db_xref="GOA:B4EE64"
FT                   /db_xref="InterPro:IPR009725"
FT                   /db_xref="InterPro:IPR028973"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:B4EE64"
FT                   /protein_id="CAR50447.1"
FT                   /translation="MTQRIQRITPFLWFDRDAEAAAAFYVSVFDNARIVHVARYGKAGA
FT                   HASGNAEGAVMTVAFELDGQAFVALNGGPVFQMTPAVSFVVNCRDQDEIDRYWARLSEG
FT                   GDERAQQCGWLRDRFGVSWQVVPVQMAELMTGDPARAERVMAQVMTMKKLDLDALQRAA
FT                   AG"
FT   misc_feature    161298..161660
FT                   /locus_tag="BCAL0139"
FT                   /note="HMMPfam hit to PF06983, 3-demethylubiquinone-9
FT                   3-methyltransfera, score 2e-71"
FT                   /inference="protein motif:HMMPfam:PF06983"
FT   CDS_pept        162210..163409
FT                   /transl_table=11
FT                   /gene="flhB"
FT                   /locus_tag="BCAL0140"
FT                   /product="flagellar biosynthetic protein FlhB"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0140"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50448"
FT                   /db_xref="GOA:B4EE65"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006136"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:B4EE65"
FT                   /protein_id="CAR50448.1"
FT                   /translation="MADESDLDKTEAATPRRREKAREEGQVARSRELASFALLAAGFYG
FT                   AWLLAGPSGAHLQAMLRGAFTFDRATAFDTHRMLSAAGSASLEGFAALLPLLALTGVAA
FT                   LLAPMALGGWLISQKTFELKFDRLNPISGLGRIFSIQGPIQLGMSIAKTLVVGGIGGIA
FT                   IWRSKDELLGLATQPLGAALPDALHLVAVCCGTTVAGMLVVAGLDVPYQLWQYNKKLRM
FT                   TKEEVKREHRENEGDPHVKGRIRQQQRAIARRRMMAAVPKADVVVTNPTHFAVALQYTD
FT                   GEMRAPKVVAKGVNLVAARIRELAAEHNVPLLEAPPLARALYHNVELEREIPGSLYSAV
FT                   AEVLAWVYQLKRFRSEGGAFPAVPVDLDVPAELDKGTSVAADDEREEAEDTLGKRGTAA
FT                   "
FT   misc_feature    162225..163253
FT                   /gene="flhB"
FT                   /locus_tag="BCAL0140"
FT                   /note="HMMPfam hit to PF01312, FlhB HrpN YscU SpaS Family,
FT                   score 2.9e-140"
FT                   /inference="protein motif:HMMPfam:PF01312"
FT   misc_feature    join(162306..162374,162489..162557,162645..162704,
FT                   162762..162830)
FT                   /gene="flhB"
FT                   /locus_tag="BCAL0140"
FT                   /note="4 probable transmembrane helices predicted for
FT                   BCAL0140 by TMHMM2.0 at aa 33-55, 94-116, 146-165 and
FT                   185-207"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        163406..165508
FT                   /transl_table=11
FT                   /gene="flhA"
FT                   /locus_tag="BCAL0141"
FT                   /product="flagellar biosynthesis protein FlhA"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0141"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50449"
FT                   /db_xref="GOA:B4EE66"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006301"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:B4EE66"
FT                   /protein_id="CAR50449.1"
FT                   /translation="MSTPTTGLFAKRPNLLAGTNLRALAGPILICMILGMMILPLPPML
FT                   LDLLFTFNIALSVMVLLVSMYTMKPLDFAAFPSVLLFSTLLRLSLNVASTRVVLLEGHT
FT                   GPDAAGQVIEAFGHFLVGGNFAVGIVVFVILMIINFMVITKGAGRIAEVSARFTLDAMP
FT                   GKQMAIDADLNAGLINEEQARKRRLAVSQEAEFYGSMDGASKFVRGDAIAGLIIMAINV
FT                   IGGLIVGMVQHDMSFAAAGTNYTLLTIGDGLVAQIPSLVISTAAGVIVSRVATDEDIGT
FT                   QITGQLFTNPRVLTITGAIIVLMGLIPGMPHFAFLALGGGAIWLARTQTRRAAARKAAG
FT                   DVTDIAPPAVLPADSHEATWDDVQLIDPLGLEVGYRLIPLVDKNSDGELLKRIKSIRKK
FT                   FAQEIGFLPPVIHIRDNLELRPNAYRIALKGVEIGAGEVFPGQWLAINPGQVTAALPGA
FT                   VTQDPAFGLPAVWIDVALREQAQVYGYTVVDASTVVATHLNHLVVQHAAELLGRQEVQA
FT                   LVERTGKDAPSLVEDLVPKTISLTTLQKVLQNLLEEGVPIRDMRTILEAVSEHAGRGDA
FT                   FEITAAVRLSLGRAITQQWYPGNGEMQVMGLDANLERVLSQALATGANPGLEPGLAHNL
FT                   LTGTQQAMLRQQNLGLPPVLLVQHALRAMLARFLRRSLPQLKVLSYAEVPDTRTIKVVN
FT                   VIGGSA"
FT   misc_feature    join(163466..163525,163535..163603,163637..163705,
FT                   163763..163831,164036..164104,164162..164230,
FT                   164291..164359)
FT                   /gene="flhA"
FT                   /locus_tag="BCAL0141"
FT                   /note="7 probable transmembrane helices predicted for
FT                   BCAL0141 by TMHMM2.0 at aa 21-40, 44-66, 78-100, 120-142,
FT                   211-233, 253-275 and 296-318"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    163499..165475
FT                   /gene="flhA"
FT                   /locus_tag="BCAL0141"
FT                   /note="HMMPfam hit to PF00771, FHIPEP family, score 0"
FT                   /inference="protein motif:HMMPfam:PF00771"
FT   misc_feature    163850..163921
FT                   /note="PS00994 Bacterial export FHIPEP family signature."
FT                   /inference="protein motif:Prosite:PS00994"
FT   misc_feature    164276..164323
FT                   /note="PS00038 Myc-type, 'helix-loop-helix' dimerization
FT                   domain signature."
FT                   /inference="protein motif:Prosite:PS00038"
FT   CDS_pept        165505..167304
FT                   /transl_table=11
FT                   /locus_tag="BCAL0142"
FT                   /product="putative flagellar biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50450"
FT                   /db_xref="GOA:B4EE67"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR020006"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4EE67"
FT                   /protein_id="CAR50450.1"
FT                   /translation="MNIRKFTGATSRDALRLVREALGADAVVLSNRTLDDGSVEIVALA
FT                   DSDLAAVAPPAARPRVATSRVPESVPAAAVPGIVSRPGIAPRPAVNPYAAGEGGLPDVF
FT                   SSVFGASADAHDADAHSPSSDADAPAAAAPSIVAPAAGTPAPGSPAAPSEPAPWLVEHA
FT                   KRLTQQRDALIARAQAPVEPQPSAPAPRAAASATPPDWARDIVRDAERRMPAAGSLAAG
FT                   SPAAGSPAAAKRASDTGAAYAGRASERTRLSADTAAAVADAVKSRLERIVNDTVMQELG
FT                   ELRGMMQEQFDSLMWHDRQRRSAVHGALTKHLFAAGFSAQLVRMLVDNLPSGDGAQTFG
FT                   QAAEWAQSVLASNLPVLDSEDALMERGGVFALMGPTGVGKTTTTAKLAARCVMRFGASK
FT                   VALLTTDSYRIGGHEQLRIFGKILGVPVHAVKDAGDLALALSELRNKHIVLIDTIGMSQ
FT                   RDRAVSDQIAMLHGANAPVQRLLLLNATSHGDTLNEVVQAYRSAGEHPDLAGCILTKLD
FT                   EATHLGGVLDTVIRYKLPVHYVSTGQKVPENLYVASTKFLLKSAFCVPRDGSPFVPQDE
FT                   DMPTLLSALTARSTAELHEVRFG"
FT   misc_feature    166600..167193
FT                   /locus_tag="BCAL0142"
FT                   /note="HMMPfam hit to PF00448, SRP54-type protein, GTPase
FT                   domain, score 2.6e-23"
FT                   /inference="protein motif:HMMPfam:PF00448"
FT   misc_feature    166624..166647
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        167297..168115
FT                   /transl_table=11
FT                   /locus_tag="BCAL0143"
FT                   /product="putative flagellar biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0143"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50451"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4EE68"
FT                   /protein_id="CAR50451.1"
FT                   /translation="MDKRIIDQAEGLRRLLAGRASRIVAVTGGPAGVGCTSTVVNLAAA
FT                   LASLGKDVLVVDERADVHSASATLAGAWLRDGERTRVAAGFGLCGAARLARAGYSDAQL
FT                   SDFIDGPADIVLVDAQLGADGSFSALAREAHDVLVVTRVAAQAITEAYACMKRLHFAHA
FT                   FAQFRVLTNQVGSHADAKTAFDNLAGVASRYLTVSIADAGCVSADPLVEHARDLMHAVV
FT                   DAFPSSPAARDYRQIAADLLYWPMRPRSGAGRAVHAGGKPSYEAGAAHAA"
FT   misc_feature    167369..167401
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        168141..168872
FT                   /transl_table=11
FT                   /gene="fliA"
FT                   /locus_tag="BCAL0144"
FT                   /product="RNA polymerase sigma factor for flagellar regulon
FT                   FliA"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50452"
FT                   /db_xref="GOA:B4EE69"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR012845"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028617"
FT                   /db_xref="UniProtKB/TrEMBL:B4EE69"
FT                   /protein_id="CAR50452.1"
FT                   /translation="MYNAQGKMSQADVLAQYAPLVRRLGLQLVAKMPASVDLDDLIQAG
FT                   MIGLMDAAGRYKEDQGAQFETYATQRIRGAMLDELRSNDWLPRSLRKTSREVEHAVHQV
FT                   EQHLGRSASETEIAQHLNMPLDEYQGMLQDLHGSQLIYYEDFDRAADDEPFLDRYRVDH
FT                   ADPLSALLDEHLREALVEAIERLPEREKLLMSLYYERGLNLREIGAVLEVSESRVCQLH
FT                   SQAVARLRARLREQAWVGAES"
FT   misc_feature    168177..168398
FT                   /gene="fliA"
FT                   /locus_tag="BCAL0144"
FT                   /note="HMMPfam hit to PF04542, Sigma-70 region, score
FT                   1.9e-18"
FT                   /inference="protein motif:HMMPfam:PF04542"
FT   misc_feature    168258..168299
FT                   /note="PS00715 Sigma-70 factors family signature 1."
FT                   /inference="protein motif:Prosite:PS00715"
FT   misc_feature    168399..168641
FT                   /gene="fliA"
FT                   /locus_tag="BCAL0144"
FT                   /note="HMMPfam hit to PF04539, Sigma-70 region, score
FT                   2.1e-09"
FT                   /inference="protein motif:HMMPfam:PF04539"
FT   misc_feature    168666..168827
FT                   /gene="fliA"
FT                   /locus_tag="BCAL0144"
FT                   /note="HMMPfam hit to PF08281, Sigma-70, region, score
FT                   5.4e-07"
FT                   /inference="protein motif:HMMPfam:PF08281"
FT   misc_feature    168684..168833
FT                   /gene="fliA"
FT                   /locus_tag="BCAL0144"
FT                   /note="HMMPfam hit to PF04545, Sigma-70, region, score
FT                   7.1e-17"
FT                   /inference="protein motif:HMMPfam:PF04545"
FT   misc_feature    168744..168809
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1243.000, SD 3.42 at aa 202-223, sequence
FT                   LNLREIGAVLEVSESRVCQLHS"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    168747..168827
FT                   /note="PS00716 Sigma-70 factors family signature 2."
FT                   /inference="protein motif:Prosite:PS00716"
FT   CDS_pept        169124..170542
FT                   /transl_table=11
FT                   /gene="ahcY"
FT                   /locus_tag="BCAL0145"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0145"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50453"
FT                   /db_xref="GOA:B4EE70"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:B4EE70"
FT                   /protein_id="CAR50453.1"
FT                   /translation="MNAIIDSKASTDYVVADMALAGWGRKELNIAETEMPGLVQIRDEY
FT                   KAQQPLKGARIAGSLHMTIQTGVLIETLKALGADVRWASCNIFSTQDHAAAAIVEAGTP
FT                   VFAFKGESLDEYWEFSHRIFEWPNGEFANMILDDGGDATLLLILGSKAEKDRSVIAKPT
FT                   NEEEVALYKSIAKHLDVDATWYSKRLAHIKGVTEETTTGVHRLYQMEKDGRLPFPAFNV
FT                   NDSVTKSKFDNLYGCRESLVDGIKRATDVMIAGKVAVVAGYGDVGKGCAQSLRGLGATV
FT                   WVTEIDPICALQAAMEGYRVVTMEYAADKADIFVTATGNYHVINHDHMKAMRHNAIVCN
FT                   IGHFDSEIDVASTRQYQWENIKPQVDHIIFPDGKRVILLAEGRLVNLGCATGHPSFVMS
FT                   NSFANQTLAQIELFTRGEQYENKVYVLPKHLDEKVARLHLARIGANLSVLSDEQAAYIG
FT                   VQKDGPFKPNHYRY"
FT   misc_feature    169154..170536
FT                   /gene="ahcY"
FT                   /locus_tag="BCAL0145"
FT                   /note="HMMPfam hit to PF05221, S-adenosyl-L-homocysteine
FT                   hydrolase, score 3.7e-193"
FT                   /inference="protein motif:HMMPfam:PF05221"
FT   misc_feature    169373..169417
FT                   /note="PS00738 S-adenosyl-L-homocysteine hydrolase
FT                   signature 1."
FT                   /inference="protein motif:Prosite:PS00738"
FT   misc_feature    169820..170299
FT                   /gene="ahcY"
FT                   /locus_tag="BCAL0145"
FT                   /note="HMMPfam hit to PF00670, S-adenosyl-L-homocysteine
FT                   hydrolase, NA, score 1.3e-111"
FT                   /inference="protein motif:HMMPfam:PF00670"
FT   misc_feature    169886..169936
FT                   /note="PS00739 S-adenosyl-L-homocysteine hydrolase
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00739"
FT   CDS_pept        170651..171004
FT                   /transl_table=11
FT                   /locus_tag="BCAL0146"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0146"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50454"
FT                   /db_xref="GOA:B4EE71"
FT                   /db_xref="InterPro:IPR007165"
FT                   /db_xref="UniProtKB/TrEMBL:B4EE71"
FT                   /protein_id="CAR50454.1"
FT                   /translation="MSVILTWVINALALLIITYLVPSIHIKSFGTALIIAVVLGLINTV
FT                   IRPVLILLTLPVTIVTLGVFILVVNALCFWFASSLLKGFEVSGFWSAFFGSILYSIVSW
FT                   LLSALIFGQRDIG"
FT   misc_feature    170651..170992
FT                   /locus_tag="BCAL0146"
FT                   /note="HMMPfam hit to PF04020, Membrane protein of unknown
FT                   function, score 6.6e-37"
FT                   /inference="protein motif:HMMPfam:PF04020"
FT   misc_feature    join(170660..170728,170747..170815,170825..170893,
FT                   170912..170980)
FT                   /locus_tag="BCAL0146"
FT                   /note="4 probable transmembrane helices predicted for
FT                   BCAL0146 by TMHMM2.0 at aa 4-26, 33-55, 59-81 and 88-110"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        171035..171865
FT                   /transl_table=11
FT                   /gene="metF"
FT                   /locus_tag="BCAL0147"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /EC_number="1.7.99.5"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0147"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50455"
FT                   /db_xref="GOA:B4EE72"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:B4EE72"
FT                   /protein_id="CAR50455.1"
FT                   /translation="MKPIELSFEFFPPKTADGVEKLRATRAQLLPLKPKFVSVTFGAGG
FT                   STQQGTLDTVLDMQKDGLEAAPHLSCIGSSRDSLRAILDQYRSHGIRHIVALRGDLPSG
FT                   MGEVGELRYASELVSFIRAEHGDWFHIEVAGYPEYHPQSRSPKADLENFARKVKAGANS
FT                   AITQYFFNADAYFRFVDDARKLGVDVPIVPGIMPITNFSQLMRFSEMCGAEVPRWVARR
FT                   LESFGDDRESIRAFGADVVTSLCQRLIDAGVPGLHFYTLNAATATRTICERLAV"
FT   misc_feature    171038..171859
FT                   /gene="metF"
FT                   /locus_tag="BCAL0147"
FT                   /note="HMMPfam hit to PF02219, Methylenetetrahydrofolate
FT                   reductase, score 1.4e-107"
FT                   /inference="protein motif:HMMPfam:PF02219"
FT   CDS_pept        complement(171968..173446)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0148"
FT                   /product="putative amidase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0148"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50456"
FT                   /db_xref="GOA:B4EE73"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:B4EE73"
FT                   /protein_id="CAR50456.1"
FT                   /translation="MHSDYLAHDAIGLAALVRDRQASPRELLDAAIGQAEAVNGAINAI
FT                   VLQDYEAARQRAASAPEPGAATPFAGVPYLVKDLGAAVAGLPLSMGSRHYRYFVPADDS
FT                   PVIARSRAAGLNVFGKTNTSEIGQMPYTEPELFGACRNPWNLDHTPGGSSGGAAAAVAA
FT                   GIVPLAHASDGGGSIRIPASCCGLFGLKPSRNPVLVDLPSNGELVVQHAVSRSVRDSAL
FT                   LLDVTTGQTLPPGAPGTFLGALDTPPGPLRIGLVIDPMLAPALADDTRAALDDAAALLE
FT                   SLGHHVEPTTLQIDYVRAAETFLTLWATIAEEMVLGARELTGRTPRRGEFEAATWAMAV
FT                   VGRRLARTRLPDVLEWQRQLTVQVAGLVSRYDAILCASLAGPPVKIGELQPTPFESAQM
FT                   KLVAALPVKPLLKEMLAKSSEKAFAWAGCTELFNLTGQPAMSVPLYWNARGLPIGVQFA
FT                   ARHADEALLLKLARQLEQARPWFDRRPPLMQAQR"
FT   misc_feature    complement(172043..173371)
FT                   /locus_tag="BCAL0148"
FT                   /note="HMMPfam hit to PF01425, Amidase, score 2.4e-79"
FT                   /inference="protein motif:HMMPfam:PF01425"
FT   misc_feature    complement(172901..172996)
FT                   /note="PS00571 Amidases signature."
FT                   /inference="protein motif:Prosite:PS00571"
FT   misc_feature    complement(173084..173107)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(173527..174219)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0149"
FT                   /product="putative dienelactone hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0149"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50457"
FT                   /db_xref="GOA:B4EE74"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B4EE74"
FT                   /protein_id="CAR50457.1"
FT                   /translation="MTAQWIDIPTGNDSFGGYLALPKRGKGPAVIIIQEIFGVNAHIRA
FT                   VADQYAADGFVALAPDVFWRTQPRVELTYEGADRDKGIELMKKTDVGLAVADIGAAADA
FT                   LRARPEVDGKLAAIGYCFGGQLAYRAAATGKLDAAVSYYGGGIQNALDLAGQVTQPILF
FT                   HYAENDHGIPLTAVDQVKAAFAGHGHASFHVYPGAEHGFNCTDRASYNQRAAALAHGRT
FT                   LTFLAEHL"
FT   misc_feature    complement(173530..174177)
FT                   /locus_tag="BCAL0149"
FT                   /note="HMMPfam hit to PF01738, Dienelactone hydrolase
FT                   family, score 2.7e-68"
FT                   /inference="protein motif:HMMPfam:PF01738"
FT   CDS_pept        174444..175526
FT                   /transl_table=11
FT                   /locus_tag="BCAL0150"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0150"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50458"
FT                   /db_xref="GOA:B4EE75"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B4EE75"
FT                   /protein_id="CAR50458.1"
FT                   /translation="MSARSLSTPFSERFGLRLPLVQAPMVGATTTAMVAAASNAGALGS
FT                   LGAGALAPERIEAEVAAIRAATDRPFAINLFVLPDEAAPDAATVARALAAIDPLNATLG
FT                   LPPGTAPARYAPDFRAQLDALVALRVPVASFTFGVLDAADVARLKAAGTYVIGTATHVA
FT                   EGLAWQAAGADALSAQGAEAGGHRGTFIGSADDALIGTLALVPQLVDATGLPVLAAGGI
FT                   MDGRGIAAALALGAQAAQLGTAFLTCAESAIAADWKARLLASADTSTQVTRAITGRHAR
FT                   GLRNTLMARLGEHVADAAPYPVQNALTQPLRQAAARANDGDYLSLWAGQGAPLARRRGD
FT                   TLTTSQLVAALDAEWRASAA"
FT   sig_peptide     174444..174563
FT                   /locus_tag="BCAL0150"
FT                   /note="Signal peptide predicted for BCAL0150 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.805) with cleavage site
FT                   probability 0.274 between residues 40 and 41"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    174462..175505
FT                   /locus_tag="BCAL0150"
FT                   /note="HMMPfam hit to PF03060, 2-nitropropane dioxygenase,
FT                   score 1.9e-84"
FT                   /inference="protein motif:HMMPfam:PF03060"
FT   CDS_pept        175965..177107
FT                   /transl_table=11
FT                   /locus_tag="BCAL0151"
FT                   /product="extracellular ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0151"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50459"
FT                   /db_xref="GOA:B4EE76"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B4EE76"
FT                   /protein_id="CAR50459.1"
FT                   /translation="MNIKMQKLLPITAAAMLCAAAASNASADQVVKIGHVAPLTGGIAH
FT                   LGKDNENGARLAVEEINAKGLTIGGQKITLQLDPQDDAADPRQATQVAQKLVDDKVVAV
FT                   VGHLNSGTSIPASKIYSDAGVVQISPSATNPAYTQQGFKTTYRVVATDAQQGPALADYA
FT                   HSKGIKSVAVVDDSTAYGQGLANEFEKKAKALGLKVMSHDATNDKAVDFRAILTKIKGE
FT                   NPDAIMYGGMDATGGPFAKQAKQLGLRAKIFAGDGVCTEKLADLAGDATDNIVCSEAGA
FT                   SLEKMPGGAAFKAKYEKRFGQPIQIYAPFTYDAVYIIADAMKRANSTDPAKILAAMPAT
FT                   KYTGVIGTTTFDSKGDLQHGVISLYNYKSGKKSLLDEVKM"
FT   sig_peptide     175965..176045
FT                   /locus_tag="BCAL0151"
FT                   /note="Signal peptide predicted for BCAL0151 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.924 between residues 27 and 28"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    176109..177071
FT                   /locus_tag="BCAL0151"
FT                   /note="HMMPfam hit to PF01094, Receptor family ligand
FT                   binding region, score 1.5e-68"
FT                   /inference="protein motif:HMMPfam:PF01094"
FT   CDS_pept        complement(177197..178414)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0152"
FT                   /product="Major Facilitator Superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0152"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50460"
FT                   /db_xref="GOA:B4EE77"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4EE77"
FT                   /protein_id="CAR50460.1"
FT                   /translation="MSESSSPESSSPFAAPPDAHRVLSLPARQRARTASMALFFVAGMM
FT                   YASWGVHVPTVRDKFALSPGLLSIALFAVAGGSIAAMLTIARWIARVGSRTACLAGGLV
FT                   MSACAALILVVPDYWMLLAVLALFGFSMATLDVAMNAEASAVEIALGKPIMSSLHGMFS
FT                   IGGMAGAAAGGALLSAGMAPVAHLALAAAVSAAVLVAASPAVLPHVPHHEQAHGGGNRW
FT                   RSPALWMLGGIALIALIAEGAMYDWATVYMRDVVAASPALASAAYAAFSGGMALARFAG
FT                   DAVRARFGAPQLVFASASLACAGMIGALLLPYPAAVLTGFTLMGLGLANMMPVLFAAAA
FT                   RVKGIHAAEGLAHVAGLAYFGLLFGPVVIGAVAQAANLTIGLSVVALCAALVALVAPKV
FT                   LSHLKI"
FT   misc_feature    complement(join(177215..177283,177296..177364,
FT                   177401..177469,177482..177550,177584..177652,
FT                   177680..177739,177797..177865,177875..177943,
FT                   178004..178063,178073..178126,178145..178213,
FT                   178256..178324))
FT                   /locus_tag="BCAL0152"
FT                   /note="12 probable transmembrane helices predicted for
FT                   BCAL0152 by TMHMM2.0 at aa 42-64, 79-101, 108-125, 129-148,
FT                   169-191, 195-217, 237-256, 266-288, 300-322, 327-349,
FT                   362-384 and 389-411"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(177293..178303)
FT                   /locus_tag="BCAL0152"
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 4.5e-16"
FT                   /inference="protein motif:HMMPfam:PF07690"
FT   CDS_pept        178647..179306
FT                   /transl_table=11
FT                   /locus_tag="BCAL0153"
FT                   /product="putative FMN flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0153"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50461"
FT                   /db_xref="GOA:B4EE78"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR037119"
FT                   /db_xref="UniProtKB/TrEMBL:B4EE78"
FT                   /protein_id="CAR50461.1"
FT                   /translation="MNIDPAFALHLLHRCALGTLATHAREPQGFPYPTVVPFAPDASHR
FT                   PVILVSGLAEHTRNLVADPRAGFLVVDAGDGDVLNAERATLLGRFVPLGDDPHVTARYL
FT                   RYEPDAARYLALGDFAFWALEIERLRYIGGFGRMGWVDGTQLDALPPLAFDDEQALWHA
FT                   YEAGDARRDGLDLLGVDRHGADWRCDGRRVRTPFDAPSADIGALRDRLIACAQDVT"
FT   misc_feature    178653..178937
FT                   /locus_tag="BCAL0153"
FT                   /note="HMMPfam hit to PF01243, Pyridoxamine 5'-phosphate
FT                   oxidase, score 1.2e-10"
FT                   /inference="protein motif:HMMPfam:PF01243"
FT   CDS_pept        179663..179956
FT                   /transl_table=11
FT                   /locus_tag="BCAL0154"
FT                   /product="histone-like nucleoid-structuring (H-NS) protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0154"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50462"
FT                   /db_xref="GOA:B4EE79"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:B4EE79"
FT                   /protein_id="CAR50462.1"
FT                   /translation="MSSYKDLLAQQEKLEKQIEEAKSREYAEVLNDVKQKIADYGFSLA
FT                   ELGLSRAKAGKVGRPRAGVAAKYRDPETGATWSGRGKPPRWIAGKNREQFAI"
FT   misc_feature    179666..179953
FT                   /locus_tag="BCAL0154"
FT                   /note="HMMPfam hit to PF00816, H-NS histone family, score
FT                   3.9e-20"
FT                   /inference="protein motif:HMMPfam:PF00816"
FT   CDS_pept        180213..181370
FT                   /transl_table=11
FT                   /locus_tag="BCAL0155"
FT                   /product="putative cation efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0155"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50463"
FT                   /db_xref="GOA:B4EE80"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:B4EE80"
FT                   /protein_id="CAR50463.1"
FT                   /translation="MSTFSGDAQSADKHAVARKSTLVSIVLNVVLATFQIVVGVIAHSQ
FT                   ALIADGVHSISDLISDFVVLVANRHSGASPDADHNYGHSRYETVASLFLGAILIAVGIG
FT                   MLWRAGDRLVNLENIPAVHFSALIVALTVLVSKEALFRYMLREARRVRSAMLVANAWHA
FT                   RSDAASSLVVAIGIVGSLAGVRLLDPIAAAIVGFMVARMGWTFGYDALQDLSDRALDTA
FT                   DTAEIRALLAATPGVRDVHDLRTRKMGDAALVDAHILVDPKISVSEGHYIAETARARVL
FT                   SDPRVLDALIHVDPGNDAARRPALALPPRGELAARLEAALAQRGLRAAAINLHYLSTGL
FT                   EVDVTLDSDPHDTDAALAGRLDIETLKREFGARRIGFTRTLPART"
FT   misc_feature    180273..181112
FT                   /locus_tag="BCAL0155"
FT                   /note="HMMPfam hit to PF01545, Cation efflux family, score
FT                   3.6e-73"
FT                   /inference="protein motif:HMMPfam:PF01545"
FT   misc_feature    join(180273..180341,180474..180533,180552..180620)
FT                   /locus_tag="BCAL0155"
FT                   /note="3 probable transmembrane helices predicted for
FT                   BCAL0155 by TMHMM2.0 at aa 21-43, 88-107 and 114-136"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(181422..181892)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0156"
FT                   /product="AnsC family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0156"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50464"
FT                   /db_xref="GOA:B4EE81"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EE81"
FT                   /protein_id="CAR50464.1"
FT                   /translation="MEAQVTLDSFSQKILRLLQLDARRSVQEISDQVGLSSTPCWRRIK
FT                   DMEQSGVIQRYTALLDREKLGLHVCALAHVHLTRHNEGGVEQFEREIATCPEVTECYST
FT                   TGEADYILKIVAPDIKAYDVFLHERIFKIPAVSQVRTSVVLREIKFDTQLPL"
FT   misc_feature    complement(181452..181682)
FT                   /locus_tag="BCAL0156"
FT                   /note="HMMPfam hit to PF01037, AsnC family, score 8.9e-33"
FT                   /inference="protein motif:HMMPfam:PF01037"
FT   misc_feature    complement(181740..181820)
FT                   /note="PS00519 Bacterial regulatory proteins, asnC family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00519"
FT   misc_feature    complement(181758..181823)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1034.000, SD 2.71 at aa 24-45, sequence
FT                   RSVQEISDQVGLSSTPCWRRIK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        complement(181972..182631)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0157"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0157"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50465"
FT                   /db_xref="GOA:B4EE82"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B4EE82"
FT                   /protein_id="CAR50465.1"
FT                   /translation="MNQTAIPEIYVSTDVEADGPIPGPHSMLSFASAAYTEDKQLIATF
FT                   SANLETLPGAHAHPVQEAWWKTEPEAWAACRRDLQTPEAALVAYVEWVEALPGKPVFVA
FT                   MPAGFDFTFMFWYMMRFAGRCPFSWSALDIKTLAFAMTGLPYRKAIKPRFPKHWFDDHP
FT                   HTHVALDDAIEQGALFCNMLADLRRQQAALAGLAVSDTDRSESAGAGQNPTDPRAN"
FT   CDS_pept        complement(182628..183272)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0158"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0158"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50466"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B4EE83"
FT                   /protein_id="CAR50466.1"
FT                   /translation="MKVTLIPVTPFQQNCSLLVCEKTGRAAVVDPGGDLDRIEQEVARQ
FT                   NVQVEKVLLTHGHIDHCAGAKTLATHYGVPIEGPQEEERFWIEKLPMQSERFGFPAADS
FT                   FEPDQWLNDGDTVRFGDETLEVYHCPGHTPGHVVFFSRAHRIAIVGDVLFAGSIGRTDF
FT                   PRGNHEDLVRSIKEKLWPLGDDVTFVPGHGPVSTFGDERRTNPFVSDKVFG"
FT   misc_feature    complement(182697..183239)
FT                   /locus_tag="BCAL0158"
FT                   /note="HMMPfam hit to PF00753, Metallo-beta-lactamase
FT                   superfamily, score 1.8e-37"
FT                   /inference="protein motif:HMMPfam:PF00753"
FT   CDS_pept        183928..184539
FT                   /transl_table=11
FT                   /locus_tag="BCAL0159"
FT                   /product="putative RlpA-like lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0159"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50467"
FT                   /db_xref="GOA:B4EE84"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:B4EE84"
FT                   /protein_id="CAR50467.1"
FT                   /translation="MNLRFPSRFGTIALFFALTGCAVPPSQTTGSVNQKKAVDKTAAAA
FT                   KADDDKQPLSFDSALASMPAADSKDAKKSSLADAEPIDGKDVSDFRQTGRASWYGRDFH
FT                   GRRTANGERFNMNAFTAAHRTLPLSSYIKVTNASTGKWVVVKVNDRGPFKRGRVLDLSY
FT                   AAAKVIGLVHAGTGRVKIEGLSPQEAREARDEMFASISAK"
FT   misc_feature    184198..184470
FT                   /locus_tag="BCAL0159"
FT                   /note="HMMPfam hit to PF03330, Rare lipoprotein A
FT                   (RlpA)-like double-psi be, score 7.4e-40"
FT                   /inference="protein motif:HMMPfam:PF03330"
FT   CDS_pept        complement(184618..185505)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0160"
FT                   /product="putative methylase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0160"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50468"
FT                   /db_xref="GOA:B4EE85"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B4EE85"
FT                   /protein_id="CAR50468.1"
FT                   /translation="MTALLELAHTQHYPDATLYVVATPIGNTADITLRALHVLGLADRI
FT                   AAEDTRNTGQLLARYGISKPLVAVHEHNEREAAQRVIELLRGGERVAYVSDAGTPGISD
FT                   PGARLVDAVRAAGFAVVPLPGASAAVTALSVAGDWAGAFTFAGFLPPKAKQRASALQAL
FT                   VSHPYALVFYEAPHRIAETVAALADAFGPARRLLIARELTKLHEQLFQGTLAEGQGWLA
FT                   GDANRQRGEFVLVVEGAPAASGEADDAAHDALLRLLLEEVPVKSAAKLAAALTGASRNA
FT                   LYARALVLKEGTEG"
FT   misc_feature    complement(184852..185457)
FT                   /locus_tag="BCAL0160"
FT                   /note="HMMPfam hit to PF00590, Tetrapyrrole
FT                   (Corrin/Porphyrin) Methylas, score 3.1e-43"
FT                   /inference="protein motif:HMMPfam:PF00590"
FT   misc_feature    complement(185188..185223)
FT                   /note="PS01296 Uncharacterized protein family UPF0011
FT                   signature."
FT                   /inference="protein motif:Prosite:PS01296"
FT   CDS_pept        185552..185980
FT                   /transl_table=11
FT                   /locus_tag="BCAL0161"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0161"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50469"
FT                   /db_xref="GOA:B4EE86"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:B4EE86"
FT                   /protein_id="CAR50469.1"
FT                   /translation="MCHAAPARPEGARGRPRSGDNFSGAARSKPVGAAFEQRARQFLER
FT                   HGLGFVAANVTMRGGELDLVMREPDGMLVFVEVRARRSTRHGGAAASVGWRKRRRLVAA
FT                   ALQFWSRHGAGAACRFDVVAFEAGRLAWLRDAFRTDDA"
FT   misc_feature    185651..185929
FT                   /locus_tag="BCAL0161"
FT                   /note="HMMPfam hit to PF02021, Uncharacterised protein
FT                   family UPF0102, score 3e-26"
FT                   /inference="protein motif:HMMPfam:PF02021"
FT   CDS_pept        186107..186691
FT                   /transl_table=11
FT                   /gene="gmhA"
FT                   /locus_tag="BCAL0162"
FT                   /product="phosphoheptose isomerase"
FT                   /EC_number="5.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0162"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50470"
FT                   /db_xref="GOA:B4EE87"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="UniProtKB/TrEMBL:B4EE87"
FT                   /protein_id="CAR50470.1"
FT                   /translation="MSVERIQQQFRDSAALHAEAADALSLPIAAAVDAMFAALANGNKI
FT                   VACGDGPSAAAAQYLAASLVGGFERERPGLPAIALATDASQAGLAGAAAAEQLFAQQVR
FT                   VLGQTGDILLVLDAGGASPRVLAAIGEAHEREMTVVALTGGNDHTVAAALSDTDIPISV
FT                   PAVRAARIHEVHLLTIHSLCDGIDAMLLGED"
FT   CDS_pept        186688..187509
FT                   /transl_table=11
FT                   /locus_tag="BCAL0163"
FT                   /product="putative phospholipid-binding lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0163"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50471"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:B4EE88"
FT                   /protein_id="CAR50471.1"
FT                   /translation="MNEGEPSMNQSRVKQTLVRTTLLAALTAGLAVSLQGCVLGVVGAA
FT                   AGGGALIATDRRTLGAQTEDREIQVKSLTQINNGLPDQSHVNVTVFNRRVLLTGEVPND
FT                   ASKQRAEEIVRGINNVNGIVNELSVEPASSLSSRANDSYLEGRVKSELIATKGISANYY
FT                   KVVSERGNLYLMGLVTVDEGNRGAEAASQVPGVEKVVKVFQYVKPQDAQALQDASPASG
FT                   ASGAQAAAAPADNATVGAVPDASVQSTPLQPPAPISNSSSVHPGNPKAKAQ"
FT   sig_peptide     186688..186795
FT                   /locus_tag="BCAL0163"
FT                   /note="Signal peptide predicted for BCAL0163 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.728) with cleavage site
FT                   probability 0.212 between residues 36 and 37"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    186748..186816
FT                   /locus_tag="BCAL0163"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAL0163 by TMHMM2.0 at aa 21-43"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    186766..186798
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    186895..187080
FT                   /locus_tag="BCAL0163"
FT                   /note="HMMPfam hit to PF04972, Putative
FT                   phospholipid-binding domain, score 5.4e-13"
FT                   /inference="protein motif:HMMPfam:PF04972"
FT   misc_feature    187120..187299
FT                   /locus_tag="BCAL0163"
FT                   /note="HMMPfam hit to PF04972, Putative
FT                   phospholipid-binding domain, score 0.00011"
FT                   /inference="protein motif:HMMPfam:PF04972"
FT   CDS_pept        187506..187868
FT                   /transl_table=11
FT                   /locus_tag="BCAL0164"
FT                   /product="putative cytochrome c-551 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0164"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50472"
FT                   /db_xref="GOA:B4EE89"
FT                   /db_xref="InterPro:IPR002324"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B4EE89"
FT                   /protein_id="CAR50472.1"
FT                   /translation="MTGMQIKSMKRRVVQGAAAAALVAGTLGAAHADVGDGLKVARSNA
FT                   CMGCHAVDRKLVGPSFKDIAARYKSDPQAVAKLSKKVKDGGSGVWGAIPMPAHPRMSDA
FT                   DVRSVVEWVLAGAPSK"
FT   sig_peptide     187506..187601
FT                   /locus_tag="BCAL0164"
FT                   /note="Signal peptide predicted for BCAL0164 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.997 between residues 32 and 33"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    187542..187610
FT                   /locus_tag="BCAL0164"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAL0164 by TMHMM2.0 at aa 13-35"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    187605..187856
FT                   /locus_tag="BCAL0164"
FT                   /note="HMMPfam hit to PF00034, Cytochrome c, score 6.5e-07"
FT                   /inference="protein motif:HMMPfam:PF00034"
FT   misc_feature    187641..187658
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00190"
FT   tRNA            187935..188010
FT                   /gene="BCALr0164"
FT                   /note="tRNA Ala anticodon CGC, Cove score 84.28"
FT   repeat_region   187964..188010
FT                   /note="Perfect repeat flanking genomic island"
FT   misc_feature    188011..204429
FT                   /note="BcenGI2"
FT   CDS_pept        188900..189877
FT                   /transl_table=11
FT                   /locus_tag="BCAL0165"
FT                   /product="putative plasmid replication-associated protein"
FT                   /note="Possible alternative translational start site after
FT                   codon 54"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0165"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50473"
FT                   /db_xref="InterPro:IPR018777"
FT                   /db_xref="UniProtKB/TrEMBL:B4EE90"
FT                   /protein_id="CAR50473.1"
FT                   /translation="MQVFIAEATPPASPAEACDASASTYSRLAPLRHRQCDFFVADILD
FT                   ASPKDDLASMEHPLFALRAGDRRIRVYERKETRVTVKPGVDGCATIHDKDLWIYCISQL
FT                   VAAKNRGREITRTVRFTAYDFLHSTNRDTSGRAYIRMGEMLARLTGTRIETNIETAGKR
FT                   ERGFFGLIDSAKVIERDGGDRMVAVEVTLPDWLFRSVDAMQVKTLSPNYFRLRKPLDRR
FT                   IYELACKHCGNQPTWKSSIATLHEKSGSADKLFKFRAAIKALAASGELPDYRMAYDPKA
FT                   DNVTFYANGPKGYRAEIAAIMKGLPHTSVKAREKAHARKRGRPK"
FT   misc_feature    189560..189625
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1060.000, SD 2.80 at aa 221-242, sequence
FT                   RRIYELACKHCGNQPTWKSSIA"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   repeat_region   complement(190258..190260)
FT                   /note="duplicated insertion sequence target"
FT   mobile_element  complement(190261..191699)
FT                   /mobile_element_type="insertion sequence:ISBcen9"
FT                   /note="putative IS element - ISBcen9"
FT   repeat_region   190261..190285
FT                   /note="IS element imperfect inverted repeat region"
FT   CDS_pept        complement(190294..191130)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0166"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0166"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50474"
FT                   /db_xref="GOA:B4E6E8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6E8"
FT                   /protein_id="CAR50474.1"
FT                   /translation="MLELRQQFPLAGLLRVAGLARSTFYYQCKALAAPDRHASVKAKIR
FT                   ALFEQHKGRYGYRRITLALRRLGQMINHKTVARLMRKMQLKSCVRVKKYRAYRGNTCKT
FT                   APHLLQRQFHAARPNEKWVTDITEFSVGGQKLYLSPVLDLYNGEIIAYQTHTRPAFQMV
FT                   TDMLRKALRRLQPDERPMLHSDQGWHYQMPGWRLMLEQRSLAQSMSRKGNCLDNAAMES
FT                   FFGTLKSEFFYLNHFSSIEQLRIGLKRYIRYYNHERIKLKLKGLSPVQYRTQPHPA"
FT   misc_feature    complement(190312..190791)
FT                   /locus_tag="BCAL0166"
FT                   /note="HMMPfam hit to PF00665, Integrase core domain, score
FT                   5.1e-42"
FT                   /inference="protein motif:HMMPfam:PF00665"
FT   CDS_pept        complement(191130..191654)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0167"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0167"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50475"
FT                   /db_xref="GOA:B4E6E7"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6E7"
FT                   /protein_id="CAR50475.1"
FT                   /translation="MARYTEQFKLSVVKRCIGGEAIRAVARTHGLSHSTVSQWYATYQA
FT                   HGKDGVRRKYNSYDVAFRLKVVQHMREHGVSSKEAAARFNIRNPSAVLEWARRYDDGGL
FT                   TALAPRPKGRRPTAMPKTPPAQPLNPTDGTDTRTREDLLQELNYLRMENAYLKKLRALV
FT                   QAQAVPRKKRK"
FT   misc_feature    complement(191532..191597)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1703.000, SD 4.99 at aa 20-41, sequence
FT                   EAIRAVARTHGLSHSTVSQWYA"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   repeat_region   complement(191675..191699)
FT                   /note="IS element imperfect inverted repeat region"
FT   CDS_pept        complement(191700..191987)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BCAL0168"
FT                   /product="hypothetical protein (fragment)"
FT                   /note="CDS is disrupted by the insertion of an IS element
FT                   after codon 95"
FT   repeat_region   complement(191700..191702)
FT                   /note="duplicated insertion sequence target"
FT   CDS_pept        complement(192105..192797)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0169"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50477"
FT                   /db_xref="UniProtKB/TrEMBL:B4EE93"
FT                   /protein_id="CAR50477.1"
FT                   /translation="MARPARSDFEKRRGGMRAAALLHELAARMGAKNPHQFAVCFDNNF
FT                   GMLTQQSGKWRANFGGAKPLSAQQRKLLARLDTDADVLHDDGPAALWKAMWGQLNELQS
FT                   IVSVELEKWLTLDMVLAEFEADLLLAELERAPLSLANLATAVALYRLHLEVEAIVPLGL
FT                   DGKGICRCLRLCLDNDQIQQELSRLGVQHAVDSELTSWIVSRPDLEVAWASSRTRWNVL
FT                   AERLDWVS"
FT   CDS_pept        192918..193169
FT                   /transl_table=11
FT                   /locus_tag="BCAL0170"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0170"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50478"
FT                   /db_xref="UniProtKB/TrEMBL:B4EE94"
FT                   /protein_id="CAR50478.1"
FT                   /translation="MFDILKDRYGAVMTLDQLAAALSRKPEGLRMALLKPKSEWAHCLN
FT                   SHKFYVGRRMYFPTEVVAHLFDSGFELQRGGDDEEFSG"
FT   CDS_pept        193147..193539
FT                   /transl_table=11
FT                   /locus_tag="BCAL0171"
FT                   /product="putative plasmid conjugal transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0171"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50479"
FT                   /db_xref="InterPro:IPR035225"
FT                   /db_xref="UniProtKB/TrEMBL:B4EE95"
FT                   /protein_id="CAR50479.1"
FT                   /translation="MTKNFPDELAAWVAQRRNAAKHKRNEYLVSFLAVRNDVIEATAAG
FT                   YALKTIWEHMQATGRVSFRYETFLKYVRRHIANSSLPGVTPARRGSERGRSDKSKTNEI
FT                   GSSKKGEIPAIGGFSFKATPNGDELL"
FT   CDS_pept        193882..194244
FT                   /transl_table=11
FT                   /locus_tag="BCAL0172"
FT                   /product="putative plasmid conjugal transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0172"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50480"
FT                   /db_xref="UniProtKB/TrEMBL:B4EE96"
FT                   /protein_id="CAR50480.1"
FT                   /translation="MENGKKSMTRKRGLHLRVPVLPDEEAAIRSNAAKAGLSVAAYLRN
FT                   VGLGYEIRGILDYARIADLAKVNGDLGRLGGLLKLWLTNDKRVEGFSQSTILALLAKIE
FT                   GTQNEMRQIMALVVAR"
FT   CDS_pept        194371..195144
FT                   /transl_table=11
FT                   /locus_tag="BCAL0173"
FT                   /product="putative plasmid conjugal transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0173"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50481"
FT                   /db_xref="InterPro:IPR014147"
FT                   /db_xref="UniProtKB/TrEMBL:B4EE97"
FT                   /protein_id="CAR50481.1"
FT                   /translation="MKILAAKTVVLAVAIGGAVSHSALAGGIPVIDVTNVMQTTISAIN
FT                   NVQAVQKQIEQYTTQLQQYQNMLQNTVAPAAYVWDQVNGTINKLLQAQDMLNYYKNQAG
FT                   NIDAYLSRYQDVAYYRSSPCFTATGCTDAQRQALADAQVNGSEAQKRANDAVLKGVDQQ
FT                   QQTLVTDAANLRSLQAQASSAQGQMQAIQAANQLASAQTNQLLQLRGLLVAQQAAAATR
FT                   AQIVADREAQQAAAGVQLRDGSNITHSAPKSWTFQ"
FT   CDS_pept        195154..195345
FT                   /transl_table=11
FT                   /locus_tag="BCAL0173a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0173a"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50482"
FT                   /db_xref="UniProtKB/TrEMBL:B4EE98"
FT                   /protein_id="CAR50482.1"
FT                   /translation="MKVAIWALVSLAMLAGCDDKGASAEAKQAASAAQLRDGSNVVSSP
FT                   PKNWTWGDAPSQQPKKNQ"
FT   CDS_pept        195365..196792
FT                   /transl_table=11
FT                   /locus_tag="BCAL0174"
FT                   /product="putative plasmid conjugal transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0174"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50483"
FT                   /db_xref="GOA:B4EE99"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="InterPro:IPR014150"
FT                   /db_xref="UniProtKB/TrEMBL:B4EE99"
FT                   /protein_id="CAR50483.1"
FT                   /translation="MFFKRGNLFALGLMMLLHVATAFAAPMDVNVVDSVMGKYQSAASS
FT                   WGGVMVSYGSWLFWGLALVSMVWTYGMMAMRRSDIQEFFAESIRFFGTLGFFWWILYNG
FT                   PAIGDAIVKSMWMIGAKAIGQATDFTPGGIVQIGYDIFAKALDQSSVWSPTDSVVGLLM
FT                   ALAVMLVLTIVGVNLLLVFVSAWIVIYGGVFFLGFGGSRWTSDIAISFYKHVLAIGAEL
FT                   MVMLLLIGIGKTFINEYYSSMAAGIDLKEMAVMLIAAFALMYLTNKIPPRIAGIVGVGG
FT                   VGSIGGVGVGSVMAAAAMTASAAASAGSSVMAGATNAAGGASALKAAFQGAQQHMAGGT
FT                   GMFSGSNAASGSLAGGNGGVSSSSGGSGGFSSFMSNAGRFAADMSSNLAKGAGDVAKDK
FT                   AAAMMESAKGNVAQTTGGKIASAIHGGADFRDLTGANTVSFADDSLGASNGRSRQNHMH
FT                   DEVAAFVNKDRSSHEEA"
FT   misc_feature    join(195386..195445,195503..195571,195632..195700,
FT                   195836..195904,195908..195976,196004..196072,
FT                   196091..196159,196187..196255)
FT                   /locus_tag="BCAL0174"
FT                   /note="8 probable transmembrane helices predicted for
FT                   BCAL0174 by TMHMM2.0 at aa 68-87, 107-129, 150-172,
FT                   218-240, 242-264, 274-296, 303-325 and 335-357"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    195527..196222
FT                   /locus_tag="BCAL0174"
FT                   /note="HMMPfam hit to PF04610, TrbL/VirB6 plasmid conjugal
FT                   transfer protein, score 1e-12"
FT                   /inference="protein motif:HMMPfam:PF04610"
FT   CDS_pept        196857..197147
FT                   /transl_table=11
FT                   /locus_tag="BCAL0175"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0175"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50484"
FT                   /db_xref="InterPro:IPR024640"
FT                   /db_xref="UniProtKB/TrEMBL:B4EEA0"
FT                   /protein_id="CAR50484.1"
FT                   /translation="MATMHDTEAREVIHHTAMRLAALEFIDRHAAKDLSQMAEAVANLF
FT                   VVVFYQAETGRATRSDFREAMTAVRQALQQYAEPPKRYDVISGEGANKVWS"
FT   CDS_pept        197138..197497
FT                   /transl_table=11
FT                   /locus_tag="BCAL0176"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0176"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50485"
FT                   /db_xref="GOA:B4EEA1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013430"
FT                   /db_xref="UniProtKB/TrEMBL:B4EEA1"
FT                   /protein_id="CAR50485.1"
FT                   /translation="MVMKNHPHPGELLLEEVRRRFGLDVAGAAKRLNVSCTMLSRVLDG
FT                   RASISPDLAMHLERAGFSSARVWMTLQSDFDQRGAEPELVRMLDGVTPDNLHGEVDFGS
FT                   ATGCKTSDQDKWGRL"
FT   CDS_pept        197494..197796
FT                   /transl_table=11
FT                   /locus_tag="BCAL0177"
FT                   /product="putative plasmid conjugal transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0177"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50486"
FT                   /db_xref="UniProtKB/TrEMBL:B4EEA2"
FT                   /protein_id="CAR50486.1"
FT                   /translation="MIADSNEKQSHVNLSPKPSGGEAIPSHVLADDALSAREGLANRNV
FT                   LADRSDALGPTFVEEIGPLDVIPLFITRANARELFGRRPGETVAQALVRMAEDGW"
FT   CDS_pept        198105..198917
FT                   /transl_table=11
FT                   /locus_tag="BCAL0178"
FT                   /product="putative DNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0178"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50487"
FT                   /db_xref="GOA:B4EEA3"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B4EEA3"
FT                   /protein_id="CAR50487.1"
FT                   /translation="MPDLIKHYSPLRYPGGKSWLAPELREWLAKDGQAELVELFAGGAY
FT                   ASLLAVLEGYVHRATLVEVDPAICAVWRTVFSSDARKLCSRIRAFRFTEENVEELLDKK
FT                   FRTDVGLAFQTIVKNRARRGGILADGAGILRAGERNKGLASRWYPQTLIDRIGRLNGYA
FT                   ESFKVIEGDALEYLALLNRRRRPVKLFVDPPYTKLSEYGVKPLYRFNHIDHAKLFGRLH
FT                   RTSHDVLITYDDSDLVRKKAMQHEFDVKRILMRTAHSVKKYELLLTRR"
FT   misc_feature    198141..198863
FT                   /locus_tag="BCAL0178"
FT                   /note="HMMPfam hit to PF02086, D12 class N6
FT                   adenine-specific DNA met, score 0.0013"
FT                   /inference="protein motif:HMMPfam:PF02086"
FT   misc_feature    198669..198689
FT                   /note="PS00092 N-6 Adenine-specific DNA methylases
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00092"
FT   CDS_pept        complement(198900..201533)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0179"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0179"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50488"
FT                   /db_xref="InterPro:IPR038735"
FT                   /db_xref="UniProtKB/TrEMBL:B4EEA4"
FT                   /protein_id="CAR50488.1"
FT                   /translation="MPIQPQHPITIVDESDTRIISASLITKELVGEKAYGLSCIPSAWT
FT                   LPFVVASSKLYEGYSRATPSAKVELISRWASRVADALSGIGISGDTAVWVRSSGVTETI
FT                   AQRGRFHSEQTTVTDLARALEICLRQISSSLSSSSEQVCLIVQRAVVPISAKGHLSDER
FT                   QYAQEARDWLGEIETPAQDPYFQINLRQWRRRQNEAAFSLPLGCTLRVSISRALEPAAW
FT                   WAYKLDTRAHFEWVWDGKAVYLVQVDEAITRDGFDPTAQTKALQRQKGTTPALRCLKEI
FT                   SEEHARKFHKINNVEIYKKLGLPSCPIFVLDDVDILSEIISGEIRDDLRSDIEKLCEYS
FT                   LVIRTDIETDAQAKRQLLPRTCEVRDSQAALKFLKETLENFKQANITEPVAFIFHNFIP
FT                   AVSSAFAYAAPGARKVHIECLWGLPEGLYYNSHDKIIVDTKKGPITSDSTLDPQKFSIQ
FT                   YKERYKGFCVAPDHDGQWVRMALAEPYDWRRAISKDEWIREIALQSRRIAEMSAEPLSI
FT                   MWFVGVPSRFSSKPTFPWYHEPYLVQEQQRNASRRRKAAWDKTLVIESAADVERLKAEA
FT                   TQEHSQVKQIRLQPADNDLLRNKHLLETVGELAKQIDAVVYLEGGTLSHAYYQLLQTKA
FT                   QIDIAQPFDQLDETQEFHKLVRDGVPRKITSGGEAAKIVRLSGDDFLHALREKLVEEAI
FT                   EALDARGHDKLLEELADVEEVIDGILRQLKISRTELNRLKKQKHAQSGGFEEGVVLVAT
FT                   ANPSRIGQPTESGNLFEDNSTAIAAPSLETVDRRGAVTRRWEDKREHSSKTERVLRVSV
FT                   GLTQDNWTTDSREISVGERGDSAIRARITGRREGSSMTLEVSLYTLPRQLDLFQLEDET
FT                   PSSPRQ"
FT   misc_feature    complement(201126..201191)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1098.000, SD 2.93 at aa 115-136, sequence
FT                   TTVTDLARALEICLRQISSSLS"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        complement(201536..202231)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0180"
FT                   /product="putative membrane protein"
FT                   /note="Possible alternative translational start sites"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0180"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50489"
FT                   /db_xref="GOA:B4EEA5"
FT                   /db_xref="UniProtKB/TrEMBL:B4EEA5"
FT                   /protein_id="CAR50489.1"
FT                   /translation="MRRQTGSEDGATESNGGTGEPVRGSAAEDAASDSPDPDTDPKPKD
FT                   DASSGAKPRSSGPDSGDPTDGRQKFQWQTRYTGGTAWRQISIEAIYTVAVALLSLILIF
FT                   VVWRGIIPKWLDLTAAEAKAFRVYGFYTAAGLLGGTVFCLKYLYRVVARGYWHEDRRLW
FT                   RFISPLIAASVAFAIGALIQSKLISFAVSSRAPGIVGTGFLVGYFGDQAVAKLHEIANV
FT                   LFGTSTRSS"
FT   misc_feature    complement(join(201605..201673,201683..201751,
FT                   201788..201856,201899..201967))
FT                   /locus_tag="BCAL0180"
FT                   /note="4 probable transmembrane helices predicted for
FT                   BCAL0180 by TMHMM2.0 at aa 94-116, 131-153, 166-188 and
FT                   192-214"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(202239..202880)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0181"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0181"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50490"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:B4EEA6"
FT                   /protein_id="CAR50490.1"
FT                   /translation="MKNRCRFCAVSEDQRSFGAADTKLASDGHYFAIPSIGSLVEGWTL
FT                   IVPNEHCVSLRAHYGNSDFGAFVADVAGKVRDIYGSVIAFEHGANHEGSATGCGTDHAH
FT                   LHIVPFDGIDVRDLDSSGVMFHPMDTADIAQVVGSSEYLAFFPDIVAKPTYALVAILDT
FT                   SISQFFRRLIGHKLGLSAEEIDYRKSPRLDVASATVAALTPAFETATENE"
FT   CDS_pept        complement(203211..204338)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0182"
FT                   /product="putative plasmid recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0182"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50491"
FT                   /db_xref="GOA:B4EEA7"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B4EEA7"
FT                   /protein_id="CAR50491.1"
FT                   /translation="MATITKRGPYQWRAQVRRHGYPAQSKTFNTKVEAEAWANMIESEM
FT                   SRGVWISRSEAEATTLFEALKRYEKEVSSMKKGTAQELSVLKACTLVDLAKRPLAAIRS
FT                   ADLAKLRDEWLKDYKPATVLRRLAVLSHVFNIARKEWGMENLSNPVELVRKPQPNNART
FT                   RRITDAEPIVDALAQGESDRRARQGELECLVAASESTFLPSIVWLAVETAMRRGEIVNL
FT                   RWEHVDLKRRVAHLPVTKNGSARDVPLSPRAVAVLQALKDARDGTGSKTTGATDDADVG
FT                   RVFEIRGDAVTRAFERAVVRARTNYLDACREAGQRPDRTFLTDLRFHDLRHEATSRLAS
FT                   IFPMHELTKITGHKDPRMLMRYYHPRAEDLAKRLI"
FT   misc_feature    complement(203223..203762)
FT                   /locus_tag="BCAL0182"
FT                   /note="HMMPfam hit to PF00589, Phage integrase family,
FT                   score 3e-28"
FT                   /inference="protein motif:HMMPfam:PF00589"
FT   repeat_region   204430..204476
FT                   /note="Perfect repeat flanking genomic island, 3-prime
FT                   fragement of tRNA Ala"
FT   CDS_pept        complement(204567..205964)
FT                   /transl_table=11
FT                   /gene="gudD"
FT                   /locus_tag="BCAL0183"
FT                   /product="putative glucarate dehydratase"
FT                   /EC_number="4.2.1.40"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0183"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50492"
FT                   /db_xref="GOA:B4EEA8"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR034598"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:B4EEA8"
FT                   /protein_id="CAR50492.1"
FT                   /translation="MSEPSRAGTPRVTRMQVIPVAGRDSMLLNLCGAHAPYFTRNLVIL
FT                   DDSSGHTGVGEVPGGEGIRHALERMTDLVVGQSIGRYQATLNAVRAALSGAGAGAGRTI
FT                   RHEVTSAGEAAVLRQPHEINLRLDNVITAIEAALLDLLGQHLDVPVAALLGEGQQRDAV
FT                   PMLAYLFYIGDRRRTDLPYRDEAQAPDPWFRLRNEAALTPAAIARQAEAAVERYGFADF
FT                   KLKGGVMAGADEMEAIAAIKARFPDARTTLDPNGAWSLDEAVALCRGQGHLLAYAEDPC
FT                   GPEGGYSGREVMAEFRRATGIPTATNMIATDWRQMDHAVRLQAVDIPLADPHFWTMQGS
FT                   VRLAQLCRDWGLTWGSHSNNHFDVSLAMFTHAAAAAPGKITAIDTHWIWQEGDARLTRE
FT                   SLAIVGGKVAVPERPGLGIELDIAQVEAAHALYNAVGGTARDDAVAMRYLVPGWTYDPK
FT                   RPSLGRV"
FT   CDS_pept        complement(206027..207367)
FT                   /transl_table=11
FT                   /gene="gudP"
FT                   /locus_tag="BCAL0184"
FT                   /product="putative glucarate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0184"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50493"
FT                   /db_xref="GOA:B4EEA9"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4EEA9"
FT                   /protein_id="CAR50493.1"
FT                   /translation="MNPLHALPASASATARRTRVRWLVLAVLFAVTTINYADRAAIAIA
FT                   GPALARSMHLTHVQMGFIFSAFGWSYVVAQLPGGWLLDRFGSRIVYAFSIFFWSLFTLL
FT                   QGGIGFFGGAAAFALLFGLRFLVGAAEAPSFPANSRIVSTWFPAPERGTASAIFNAAQY
FT                   AATVVFAPLMGWLVHAFGWQSVFAVMGVLGFALVLVWNRTMYDPKDHPGINRAELDYLT
FT                   EGGALVNIDQAIGGRDGGPSLHHVKALLRNRMLVGVYVAQYCINALTYFFITWFPVYLV
FT                   QARGMSILNAGLVASIPAVCGFLGGILGGVVSDALLRQGRSLSIARKVPIVIGMLLSMS
FT                   MIVCNYTDSHVLVVVFMALSFFGKGLGALGWAVNADTAPRQIAGLSGALLNTCGNLSSI
FT                   TTPIAIGYIVDRSGSFNGALVYVVAHALVAVICYLFVVGEIRRVELQ"
FT   misc_feature    complement(join(206048..206116,206144..206212,
FT                   206249..206317,206327..206395,206429..206497,
FT                   206540..206608,206765..206833,207017..207085,
FT                   207122..207190,207233..207301))
FT                   /gene="gudP"
FT                   /locus_tag="BCAL0184"
FT                   /note="10 probable transmembrane helices predicted for
FT                   BCAL0184 by TMHMM2.0 at aa 23-45, 60-82, 95-117, 179-201,
FT                   254-276, 291-313, 325-347, 351-373, 386-408 and 418-440"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(206138..207286)
FT                   /gene="gudP"
FT                   /locus_tag="BCAL0184"
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 2.2e-55"
FT                   /inference="protein motif:HMMPfam:PF07690"
FT   CDS_pept        complement(207582..208505)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0185"
FT                   /product="LysR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0185"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50494"
FT                   /db_xref="GOA:B4EEB0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EEB0"
FT                   /protein_id="CAR50494.1"
FT                   /translation="MWTLEVNLNDLYLFVQAVDAGSMSAAARRLDLPKSTVSKRVAELE
FT                   RTLGARLVHRTSRSFRLTPVGAEFFEHARAAVIEADSARDAVLRQAAEPAGVVRITSSV
FT                   PVAQHILAPCLPALAIAHPKLLLQIHASDRLVDIAQEGFDIAVRSHFAPLPDSALVQRP
FT                   LAASPIVVVAAPAYLARAGTPDTPADLAQHDGLHPGPQPWRLQRGGDAVDVTPRLRLQA
FT                   DESTLLLQAATAGLGLACLPDWIAGAALASGTLVRVLPGWCAGTVTTTLLMPHRRGQLP
FT                   GVRAAVEFLAQHVARHHGSGPDDARA"
FT   misc_feature    complement(207621..208235)
FT                   /locus_tag="BCAL0185"
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 2.7e-44"
FT                   /inference="protein motif:HMMPfam:PF03466"
FT   misc_feature    complement(207786..207818)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    complement(208305..208484)
FT                   /locus_tag="BCAL0185"
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix, score 2.5e-18"
FT                   /inference="protein motif:HMMPfam:PF00126"
FT   misc_feature    complement(208350..208442)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00044"
FT   misc_feature    complement(208380..208445)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1533.000, SD 4.41 at aa 21-42, sequence
FT                   GSMSAAARRLDLPKSTVSKRVA"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        208597..209328
FT                   /transl_table=11
FT                   /locus_tag="BCAL0186"
FT                   /product="putative glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0186"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50495"
FT                   /db_xref="GOA:B4EEB1"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B4EEB1"
FT                   /protein_id="CAR50495.1"
FT                   /translation="MSPILLYGIPAGCSFGSIVALEWTGRPYRLSRITMPGAVTSDAFL
FT                   ALNPVAETPAFVTANGDVLTESIAILGHIGAQALDSGLAFRQGSAAFDRLNRMLAWLNT
FT                   TFFNAFGALWYVYEHDTEGAEKAALQAYGRGKVLKAHRQLEALLERGEGPWLLGARRTL
FT                   ADAYFTGIARWADYHAVFEPDAFPRVAALRARLADDAGVQFAHAIEENLPPPASSAFEG
FT                   HVSLDDALASARDIVVSARVV"
FT   sig_peptide     208597..208656
FT                   /locus_tag="BCAL0186"
FT                   /note="Signal peptide predicted for BCAL0186 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.622) with cleavage site
FT                   probability 0.577 between residues 20 and 21"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    208600..208824
FT                   /locus_tag="BCAL0186"
FT                   /note="HMMPfam hit to PF02798, Glutathione S-transferase,
FT                   N-terminal domain, score 0.012"
FT                   /inference="protein motif:HMMPfam:PF02798"
FT   misc_feature    208909..209196
FT                   /locus_tag="BCAL0186"
FT                   /note="HMMPfam hit to PF00043, Glutathione S-transferase,
FT                   C-terminal domain, score 1.3e-05"
FT                   /inference="protein motif:HMMPfam:PF00043"
FT   CDS_pept        209455..210087
FT                   /transl_table=11
FT                   /locus_tag="BCAL0187"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0187"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50496"
FT                   /db_xref="InterPro:IPR018715"
FT                   /db_xref="UniProtKB/TrEMBL:B4EEB2"
FT                   /protein_id="CAR50496.1"
FT                   /translation="MTSPTLLPSYTAFDGHRRLASGPLATVALAVRQAAGDAMPGTILI
FT                   FDDATGRSIDLDLRGTADDIRARYAAPAADASSGAGEPAGAGAAEQRGRGRPKLGVVSR
FT                   EVTLLPRHWEWLGAQPGGASVALRKLVEDARRTHAAADRQRDAQARAYHFMSAMAGDLP
FT                   GFEEAARALYANDAARLAELIAGWPDDVRDHALALARGDLPPAAEDC"
FT   CDS_pept        210103..211440
FT                   /transl_table=11
FT                   /locus_tag="BCAL0188"
FT                   /product="putative dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0188"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50497"
FT                   /db_xref="GOA:B4EEB3"
FT                   /db_xref="InterPro:IPR004294"
FT                   /db_xref="UniProtKB/TrEMBL:B4EEB3"
FT                   /protein_id="CAR50497.1"
FT                   /translation="MTVFDLNRGALAPVADEVDVVELRVTGAIPRELDGTLLRNGPNPP
FT                   GGRFDGNDMLSWWPEAAMLHAIAFDDGRAAGYRNRWARTRRWAAVHAPGQAPQLPDTNP
FT                   NVNVLQHAGELLALAEGGAPLAITAALDSFGAPTRHAGIDGGMTAHPKVDPVTGELILF
FT                   RADWRAPWLRYGVIDATGVTRVDVEIELGAPAMMHDLAITETRSLLLDLNVGYDFSLLQ
FT                   HGHRMPLRWHDDRPARIGVLPRHGGDVRWFGVEPCFIQHVVNAYDCDASCLVLDAVRYP
FT                   SFLRLDARTGRFADNPVGELWRYVIDTANGLIDEGPLADGGIELPRINESRTGRGYRYL
FT                   YAVEQPNNAEMRGVMRFDHARGTTTHYAVPAGDQNGEPVFVPRPGGADEDDGWLLVMVY
FT                   RAATDTSDVVILDARAIDAGPVATVHLPRRVPAGFHGAWVPRERRA"
FT   misc_feature    210103..211425
FT                   /locus_tag="BCAL0188"
FT                   /note="HMMPfam hit to PF03055, Retinal pigment epithelial
FT                   membrane protein, score 9e-87"
FT                   /inference="protein motif:HMMPfam:PF03055"
FT   CDS_pept        complement(211454..212620)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0189"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0189"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50498"
FT                   /db_xref="GOA:B4EEB4"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:B4EEB4"
FT                   /protein_id="CAR50498.1"
FT                   /translation="MAIPLTYIARNLWTRRLTTALTAGGMALVIFVFATVQMLDAGLTK
FT                   TLVSTGEPDNAVVIRKGAETEIQSSIDHQQANALEMHPAVALGPDGRPLVSKEAVVLIS
FT                   LVKTSTGKPSNVVIRGVSPAGLALRPHVKLVAGRPFAPGSSEIVVGSAIAKGFSGTQLG
FT                   DRLHFAQRDWTIVGIFDAGGSGFDSEIWGDVDQLMQSFRRTSYSSMVLRIPSADGFARF
FT                   KADIDVDPRLTDEAKREQTFYGDQSKALSTFINILGITLSTIFSIAAMIGAMITMYASV
FT                   ANRVAEIGTLRALGFKRTSVLAAFLLEALLLGFVGGVAGLACASLMQFASFSTTNFQTF
FT                   SDLSFRFVLTPAIVVKTLVFSLVMGLVGGFLPAMRAARLKIVDALRAQ"
FT   misc_feature    complement(211478..212005)
FT                   /locus_tag="BCAL0189"
FT                   /note="HMMPfam hit to PF02687, Predicted permease, score
FT                   1.9e-29"
FT                   /inference="protein motif:HMMPfam:PF02687"
FT   misc_feature    complement(join(211508..211576,211652..211720,
FT                   211778..211846,212504..212572))
FT                   /locus_tag="BCAL0189"
FT                   /note="4 probable transmembrane helices predicted for
FT                   BCAL0189 by TMHMM2.0 at aa 17-39, 259-281, 301-323 and
FT                   349-371"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(211652..211684)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   sig_peptide     complement(212519..212620)
FT                   /locus_tag="BCAL0189"
FT                   /note="Signal peptide predicted for BCAL0189 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.959) with cleavage site
FT                   probability 0.453 between residues 34 and 35"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(212629..213783)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0190"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0190"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50499"
FT                   /db_xref="GOA:B4EEB5"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:B4EEB5"
FT                   /protein_id="CAR50499.1"
FT                   /translation="MYVLKLIARNALRHRLRTLLTVLGLTIAVLAFGLLHTVVDAWYAG
FT                   AAAASSGRLVTRNAISLVFPLPVSYENRIRGVDGVTAVVRSNWFGGIYRDPKNFFASFA
FT                   VSENYLDLYPEFILPAQQRADYDRDRRGCLVGRQLATQFGFKVGDVIPLKGTIYPGTWD
FT                   FVVRGILDGRDDSTITRQLVFHWDYLNETVRKRTPKQADQVGVFVLGVANPDDGASIAR
FT                   NVDAVFKNSLAETLTETEQAFQLGFVAMSNQIIAAIRLVSYVVILIIMAVMANAMAMSA
FT                   RERTAEYATLKALGFGPGFLALIVFGESVVIAVAGGGLGILATPPAASLFKQAAGGIFP
FT                   VFKVSTETIVLQAACSVAVGLAAALVPAWQAARVRVVEGLRAIG"
FT   misc_feature    complement(212656..213174)
FT                   /locus_tag="BCAL0190"
FT                   /note="HMMPfam hit to PF02687, Predicted permease, score
FT                   2.2e-22"
FT                   /inference="protein motif:HMMPfam:PF02687"
FT   misc_feature    complement(join(212671..212739,212821..212889,
FT                   212950..213018,213655..213723))
FT                   /locus_tag="BCAL0190"
FT                   /note="4 probable transmembrane helices predicted for
FT                   BCAL0190 by TMHMM2.0 at aa 21-43, 256-278, 299-321 and
FT                   349-371"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(213637..213783)
FT                   /locus_tag="BCAL0190"
FT                   /note="Signal peptide predicted for BCAL0190 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.994) with cleavage site
FT                   probability 0.458 between residues 49 and 50"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(213805..214503)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0191"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0191"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50500"
FT                   /db_xref="GOA:B4EEB6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4EEB6"
FT                   /protein_id="CAR50500.1"
FT                   /translation="MNDAPPPLVELSHVAKSYRRGNQIVPVLTDITLDIGEGDFVALMG
FT                   PSGSGKSTLLNLVAGIDRPDSGELRVGGLDISQLAEAQLAEWRAANVGFIFQFYNLMPV
FT                   LTAFENVELPLMLTHLSRRERRERVELVLDMVNLGDRTSHYPSELSGGQQQRVAIARAL
FT                   ITDPVLIVADEPTGDLDRASATDVLAMLQRMNAELGKTIIMVTHDAHAAGAARSLVHLE
FT                   KGELIDGHAG"
FT   misc_feature    complement(213832..214392)
FT                   /locus_tag="BCAL0191"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   4e-62"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    complement(214015..214059)
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    complement(214348..214371)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(214509..215714)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0192"
FT                   /product="transporter system transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0192"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50501"
FT                   /db_xref="GOA:B4EEB7"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B4EEB7"
FT                   /protein_id="CAR50501.1"
FT                   /translation="MPDHNLDKLKIDRRPIAPVPRRRRWARYAVAAALIVVAIVAGLAL
FT                   TGRPTVDTTSVTSAYPYQNDTQLNATGYVVPQRKAAVASKGQGRVEWLGVLEGTRVKKD
FT                   EIIARLESNDVQASLAQARAQVQVSRANFGVAQAELKDAEIALRRTSALAPKGAVPAAQ
FT                   LDTDTARVNKARATLASDQAAIVSAEANAQAAQVAVDQTVIRAPFDGIVLAKHANVGDN
FT                   ITPFSSASDSKGAVVTIADMDTLEVEADVAESNIAKIRAEQPCEIQLDALPDMRFAGRV
FT                   SRIVPTVDRSKATVLVKVRFVDRDERVLPDMSAKIAFLSKPATPQDRQPVTAVQASAVV
FT                   ERDGRPAVFVVKDDSAHAVAVTRGMRIGELVAVRGVKPGDTVVLAPDAKLKDGAKVTVA
FT                   KK"
FT   misc_feature    complement(214698..215483)
FT                   /locus_tag="BCAL0192"
FT                   /note="HMMPfam hit to PF00529, HlyD family secretion
FT                   protein, score 5.5e-05"
FT                   /inference="protein motif:HMMPfam:PF00529"
FT   misc_feature    complement(215574..215642)
FT                   /locus_tag="BCAL0192"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAL0192 by TMHMM2.0 at aa 25-47"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(215577..215714)
FT                   /locus_tag="BCAL0192"
FT                   /note="Signal peptide predicted for BCAL0192 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.678) with cleavage site
FT                   probability 0.506 between residues 46 and 47"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        216073..216306
FT                   /transl_table=11
FT                   /locus_tag="BCAL0193"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0193"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50502"
FT                   /db_xref="UniProtKB/TrEMBL:B4EEB8"
FT                   /protein_id="CAR50502.1"
FT                   /translation="MKKTLASIIAAAFALASVSAFAQASAPAADTSAAAPAPAKKDHSK
FT                   PKHQLKHHGSKKGQAKAAAASAAGTNDAGTQN"
FT   sig_peptide     216073..216138
FT                   /locus_tag="BCAL0193"
FT                   /note="Signal peptide predicted for BCAL0193 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.875 between residues 22 and 23"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    216085..216153
FT                   /locus_tag="BCAL0193"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAL0193 by TMHMM2.0 at aa 5-27"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(216387..217157)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0193a"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0193a"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50503"
FT                   /db_xref="InterPro:IPR002782"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="InterPro:IPR027798"
FT                   /db_xref="UniProtKB/TrEMBL:B4EEB9"
FT                   /protein_id="CAR50503.1"
FT                   /translation="MATATFRFHGELNAFLARPQRDRAFAHACARDATVKHAIEALGVP
FT                   HTEIGRLYVNDAPAALDRPLDDGDRVEVLPERAGPAANGATGPPPAAWRFVADAHLGGL
FT                   AQLLRLAGFDTCYDNHYRDDELAALAERENRIVLTRDRELLKRRAVVRGCYLHAQRPAD
FT                   QLHELFERLDLAPHMRPFRLCLRCNAPLHPLDAAAAAPRVPAGVRLRHRRFAACDVCRR
FT                   VFWEGSHWRRMRAVVDAMRAPPPVRADEPGESGA"
FT   misc_feature    complement(216432..216881)
FT                   /locus_tag="BCAL0193a"
FT                   /note="HMMPfam hit to PF01927, Protein of unknown function
FT                   DUF82, score 1.8e-30"
FT                   /inference="protein motif:HMMPfam:PF01927"
FT   CDS_pept        217254..218123
FT                   /transl_table=11
FT                   /locus_tag="BCAL0194"
FT                   /product="putative oxidoreductase"
FT                   /note="C-terminus is similar to Escherichia coli, and
FT                   Escherichia coli O6 2-hydroxy-3-oxopropionate reductase
FT                   GarR or b3125 or c3880 SWALL:GARR_ECOLI (SWALL:P23523) (294
FT                   aa) fasta scores: E(): 8e-14, 27.66% id in 282 aa, and
FT                   C-terminus is similar to Xanthomonas campestris
FT                   dehydrogenase xcc0308 SWALL:Q8PDM7 (EMBL:AE012127) (291 aa)
FT                   fasta scores: E(): 1.3e-48, 53.1% id in 290 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0194"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50504"
FT                   /db_xref="GOA:B4EEC0"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4EEC0"
FT                   /protein_id="CAR50504.1"
FT                   /translation="MDLGFIGLGEMGQAIATNLLKAGHTVRVWNRSRERAEPLAAFGAQ
FT                   IVDTPADAFRGDAVFSMLGDDAAARAVFDDALLAQAPRGLIHVNMATVSVALAESLAHA
FT                   HASRGIDYVAAPVMGRPDVAAAARLTIMAGGPAEAIDRVQPLFDAIGQKTWRFGSLPQH
FT                   ANVAKIAANFTLASAIETLGEASALLGAHGVAMRDFLDVITSSVFPGPVYEGYGAMIAE
FT                   RRYEPARFKARLGLKDVRLALEAGDATSVPLPVASVVRDSLLDALAHGGGDQDFAVLGE
FT                   AALRRAGR"
FT   misc_feature    217254..217730
FT                   /locus_tag="BCAL0194"
FT                   /note="HMMPfam hit to PF03446, NAD binding domain of
FT                   6-phosphogluconat, score 2.3e-44"
FT                   /inference="protein motif:HMMPfam:PF03446"
FT   misc_feature    217257..217766
FT                   /locus_tag="BCAL0194"
FT                   /note="HMMPfam hit to PF03807, NADP oxidoreductase coenzyme
FT                   F420-depen, score 0.00017"
FT                   /inference="protein motif:HMMPfam:PF03807"
FT   CDS_pept        218197..218832
FT                   /transl_table=11
FT                   /locus_tag="BCAL0195"
FT                   /product="putative amino acid transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0195"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50505"
FT                   /db_xref="GOA:B4EEC1"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B4EEC1"
FT                   /protein_id="CAR50505.1"
FT                   /translation="MNLHTWWLFVATVFVVSAIPGPNMLLVMTHGARHGLRRSSATMAG
FT                   CLSALVLMLAVSAAGLGAVLEAWPAMFNGLRFAGAAYLIYLGVKAWRARVDDTPAADVD
FT                   AVSHGASASRAVLFRNGFLVAGSNPKAILFAAALLPQFINAAEPTLPQFGILVVTFAVI
FT                   EVSWYLVYASFGTRIGATLKSQSVAKVFNRLTGGLFVGFGAMMALVRH"
FT   sig_peptide     218197..218370
FT                   /locus_tag="BCAL0195"
FT                   /note="Signal peptide predicted for BCAL0195 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.661) with cleavage site
FT                   probability 0.311 between residues 58 and 59"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(218209..218277,218314..218382,218395..218454,
FT                   218557..218625,218653..218721,218755..218823)
FT                   /locus_tag="BCAL0195"
FT                   /note="6 probable transmembrane helices predicted for
FT                   BCAL0195 by TMHMM2.0 at aa 5-27, 40-62, 67-86, 121-143,
FT                   153-175 and 187-209"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    218236..218826
FT                   /locus_tag="BCAL0195"
FT                   /note="HMMPfam hit to PF01810, LysE type translocator,
FT                   score 4.5e-32"
FT                   /inference="protein motif:HMMPfam:PF01810"
FT   CDS_pept        complement(218924..220207)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0196"
FT                   /product="Major Facilitator Superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0196"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50506"
FT                   /db_xref="GOA:B4EEC2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4EEC2"
FT                   /protein_id="CAR50506.1"
FT                   /translation="MNCPAHRCTAPVSPSVAAPPALSTGMTLFFAATVGVIVMDLFAAQ
FT                   PLTGPISADLHLPPGLAGLVAMLPQLGYAAGLALLVPLVDLFENRRLIVATLAVCAAAL
FT                   ALPAFTQSGTVFLLATLVAGAASSVIQMLVPMAASMAPEAQRGRAVGNVMSGLMLGILL
FT                   SRPLASLIAGSAGWRAFYLLAALANAAIAVVLALRLPARTPSITAGYRALLASMGRLLA
FT                   DEPVLRRHALSAALAMAAFSAFWTAVGLRLAQPPFALDLHGIALFAFAGASGAIVTPLA
FT                   GRAGDRGHGPAAQRLAHGTMLAALVVLGVAGAGWFGFDAHAHRGVALALLAGGAALLDA
FT                   GVIVDQTIGRREINLLNPAARGRLNGLFVGLFFCGGALGAALAGSAWAWGGWSAVCGVG
FT                   FAFAGATAVFGLVAGRGAGAAALDRPRG"
FT   misc_feature    complement(join(218969..219037,219047..219115,
FT                   219176..219244,219254..219322,219359..219427,
FT                   219464..219532,219617..219685,219695..219763,
FT                   219797..219865,219878..219937,219956..220024,
FT                   220082..220150))
FT                   /locus_tag="BCAL0196"
FT                   /note="12 probable transmembrane helices predicted for
FT                   BCAL0196 by TMHMM2.0 at aa 20-42, 62-84, 91-110, 115-137,
FT                   149-171, 175-197, 226-248, 261-283, 296-318, 322-344,
FT                   365-387 and 391-413"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(219044..220120)
FT                   /locus_tag="BCAL0196"
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 4e-27"
FT                   /inference="protein motif:HMMPfam:PF07690"
FT   misc_feature    complement(219173..219205)
FT                   /note="PS00136 Serine proteases, subtilase family, aspartic
FT                   acid active site."
FT                   /inference="protein motif:Prosite:PS00136"
FT   sig_peptide     complement(220139..220207)
FT                   /locus_tag="BCAL0196"
FT                   /note="Signal peptide predicted for BCAL0196 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.643) with cleavage site
FT                   probability 0.325 between residues 23 and 24"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        220305..221234
FT                   /transl_table=11
FT                   /locus_tag="BCAL0197"
FT                   /product="LysR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0197"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50507"
FT                   /db_xref="GOA:B4EEC3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EEC3"
FT                   /protein_id="CAR50507.1"
FT                   /translation="MNTRDLQAFVAVVDSGSMVAAAAKLHLTQPGLTRRVQNLETLLGV
FT                   PLLERQSKPLKPTAAGRDVYALARNVLGAVDELMAAGAPDSEPSGELRIGVPPFLSELA
FT                   LERPIDRLRDAFPRLTLRVTAGWSPALVQGIERGALDVATVMVPASATLPDALTATLLA
FT                   TQPTVLVAARDFPLPDGPLSLDTLSGFPWVLSQDGCGMRSALSRALGAAGLPFDVAVEA
FT                   FGSELQLSLVARGAGIGIAPPNALARSAHRDALRIVETAGLETRINVWIVHGALPGRLM
FT                   RPVALLRDALGEVLERENGTGSGAVTAD"
FT   misc_feature    220311..220490
FT                   /locus_tag="BCAL0197"
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix, score 6.4e-21"
FT                   /inference="protein motif:HMMPfam:PF00126"
FT   misc_feature    220353..220445
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00044"
FT   misc_feature    220557..221192
FT                   /locus_tag="BCAL0197"
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 2.9e-36"
FT                   /inference="protein motif:HMMPfam:PF03466"
FT   CDS_pept        complement(221419..222255)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0198"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0198"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50508"
FT                   /db_xref="GOA:B4EEC4"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:B4EEC4"
FT                   /protein_id="CAR50508.1"
FT                   /translation="MMKKTLLCAAAGAAAVAPLAAHAQSAGSNVVTLGWFHIMPQQSST
FT                   PMTTNVAPTPINTPLRLPPSFTSPGTGLHTSGADTVGLTVSHFLTDHIAVTSVAGVPPV
FT                   FKVSGQGTIKPPGPAGALGTQNIGLGSVNPIVKSVRQWSPAVILQYYFGQATAKFRPFL
FT                   GLGVSYNWFSDLQLNTNFIKQTQDNLGAILAAGAGKPGTTSVEAKASSSWQPVFNAGLQ
FT                   YNMTEHFGLVASVTYIPLKTTSTVTIKAADGSVLAESKSDLKADPIISYVGMTYKF"
FT   misc_feature    complement(221422..222135)
FT                   /locus_tag="BCAL0198"
FT                   /note="HMMPfam hit to PF03922, OmpW family, score 6.6e-12"
FT                   /inference="protein motif:HMMPfam:PF03922"
FT   sig_peptide     complement(222187..222255)
FT                   /locus_tag="BCAL0198"
FT                   /note="Signal peptide predicted for BCAL0198 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.995 between residues 23 and 24"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(222271..223512)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0199"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0199"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50509"
FT                   /db_xref="InterPro:IPR021340"
FT                   /db_xref="UniProtKB/TrEMBL:B4EEC5"
FT                   /protein_id="CAR50509.1"
FT                   /translation="MKRNLILAAALAAPLLSACGGGSDNPPPLVEDRLCPATLDYNTVF
FT                   TGGAGSGELAKVQLDTTKMTWQVTYVESPVPQKTGTVVPTRAGTVDSGTLTQETLLPTN
FT                   KLNQCAFRLNGASLDASRPARIFVGFGVAGGTIPGKEIQFDGVLGQAAVPDTKFPYYPF
FT                   IGFSSIETDITKVAGTYSHIGFGEVPSQKFAPASIDAKVTINADGTWTKCDTTGQFAGG
FT                   ACVQQGTNFVQSADGSGAFQSNNYRSQLKPTLSATPQGKGFMIVGKLRNQLVPILVRTG
FT                   VANPNPTPDSNGVPGLTADDESSISILAPQTAVAAGSQNGEYIGVDSQFDYRTTALIDK
FT                   QATLLDPFQPSQASLATALDLDYTQKVPGTVTTIHTGSGSTSPTGKFIFTGGVFGFLDN
FT                   AGSTPYFTIGAFVQ"
FT   sig_peptide     complement(223444..223512)
FT                   /locus_tag="BCAL0199"
FT                   /note="Signal peptide predicted for BCAL0199 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.271 between residues 23 and 24"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(223456..223488)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(223661..225091)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0200"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0200"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50510"
FT                   /db_xref="InterPro:IPR021340"
FT                   /db_xref="UniProtKB/TrEMBL:B4EEC6"
FT                   /protein_id="CAR50510.1"
FT                   /translation="MSHALSKGVATAFAIAPFLVACGGGDSGGALAPIDAPQCSGSSCG
FT                   TQGPPPSQPINGALCPANADIVKSTYLGGAGSGEIVSVNIDAVAMTYTLKWLESPIPLK
FT                   TGTVTPSRAGTTITGKVVHPPTGTLPTAEQTRCAFVLTPGTGTAPDGSTYSTAADFNQA
FT                   NPPMLLVGMGVAGGGIPGATVQYDGLTISVIGLPVFQNVGQVPNRHFDFYPFLGFANTT
FT                   TDLTKLPGTYNALLYHLVPSGNYATKGVNSSETFDANGACTSSGSGGCQTTGDPWKTSA
FT                   NGGYFDSTQAPQILPQTKLPLIGATGKSATAHMVIGQLNGATVPVIVRTGYVNLGTPPL
FT                   HTDAKVDDESGIAVLGAATAITSGAIDGGYAGADSNFKYTAALIRGSNASFINPSTQAE
FT                   EDGFTLDYGQATPGLLNAKTTPPSGASYPSASGVVIATGGLYAALIQGTVNGGVTPTSA
FT                   NSTTSSTPYFGVGAQISK"
FT   misc_feature    complement(224282..224314)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   sig_peptide     complement(224996..225091)
FT                   /locus_tag="BCAL0200"
FT                   /note="Signal peptide predicted for BCAL0200 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.906) with cleavage site
FT                   probability 0.516 between residues 32 and 33"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(225026..225058)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(225526..226476)
FT                   /transl_table=11
FT                   /gene="argC"
FT                   /locus_tag="BCAL0201"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0201"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50511"
FT                   /db_xref="GOA:B4EEC7"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR010136"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4EEC7"
FT                   /protein_id="CAR50511.1"
FT                   /translation="MSTKVFVDGQEGTTGLKIFEYLSARSDIEILRIDEAKRKDVDERR
FT                   RLINASDVTFLCLPDVASRESASLVENPNTTLIDASTAFRTHADWAYGLPELTRAQREK
FT                   IRTSKRIAVPGCHASAFVLAMRPLVDAGIVAPTFAAHSYSITGYSGGGKSMIAEYESAA
FT                   PGGKLASPRPYALGLAHKHLPEMAAHTGLANAPIFTPIVGPFLKGLAVTTYFTPGQLAK
FT                   RATPQDVQRVFAEYYADEAFVRVAPFDADANLDSGFFDVQANNDTNRVDLFVFGNAERF
FT                   VTVARLDNLGKGASGAAIQCMNLNIGAAEDAGLKR"
FT   misc_feature    complement(226015..226038)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    complement(226162..226467)
FT                   /gene="argC"
FT                   /locus_tag="BCAL0201"
FT                   /note="HMMPfam hit to PF01118, Semialdehyde dehydrogenase,
FT                   NAD bindin, score 2.8e-06"
FT                   /inference="protein motif:HMMPfam:PF01118"
FT   CDS_pept        complement(226668..227240)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0202"
FT                   /product="putative flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0202"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50512"
FT                   /db_xref="GOA:B4EEC8"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B4EEC8"
FT                   /protein_id="CAR50512.1"
FT                   /translation="MSNIVIVYHSGYGHTQKLAEAVHAGAQDAGAAARLLAVGELDDAG
FT                   WAALDAADAIVFGAPTYMGGPSAQFKQFADATSKPWFTQKWKDKIAAGFTNSATMNGDK
FT                   FSTIQYFVTLAMQHGMVWVGTGMMPANSKAATRNDINYVGGFTGLLAQSPADATPDEGP
FT                   LPGDLDTAKAFGRRVAEATARWVAGGR"
FT   misc_feature    complement(226884..227225)
FT                   /locus_tag="BCAL0202"
FT                   /note="HMMPfam hit to PF00258, Flavodoxin, score 0.0005"
FT                   /inference="protein motif:HMMPfam:PF00258"
FT   misc_feature    complement(227175..227225)
FT                   /note="PS00201 Flavodoxin signature."
FT                   /inference="protein motif:Prosite:PS00201"
FT   CDS_pept        complement(227455..228051)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0203"
FT                   /product="phosphatidylethanolamine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0203"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50513"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:B4E588"
FT                   /protein_id="CAR50513.1"
FT                   /translation="MRVDRRITPPAPSGRPSPLRFSALLCAAVFAALPAHAEGPFTVTS
FT                   DDLTAGARVRPANVFDRGDCKGANRSPQLAWHNPPPGTRGYAVTIFDPDAPGHGWWHWA
FT                   VAGIPATVTSLPADASASGFLRRIGASEARNDFGIDGYGGPCPPPGKPHRYVITVYALK
FT                   GTDLRISQGRPAPMFEHEIGTLAIGTARLTVTYGQ"
FT   misc_feature    complement(227473..227946)
FT                   /locus_tag="BCAL0203"
FT                   /note="HMMPfam hit to PF01161,
FT                   Phosphatidylethanolamine-binding protein, score 1.3e-06"
FT                   /inference="protein motif:HMMPfam:PF01161"
FT   sig_peptide     complement(227941..228051)
FT                   /locus_tag="BCAL0203"
FT                   /note="Signal peptide predicted for BCAL0203 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.998 between residues 37 and 38"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(228292..228978)
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="BCAL0204"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0204"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50514"
FT                   /db_xref="GOA:B4E589"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="PDB:4OHC"
FT                   /db_xref="UniProtKB/TrEMBL:B4E589"
FT                   /protein_id="CAR50514.1"
FT                   /translation="MTGYDRQSISDTTAKILLEVQAVHFNAEKPFIFTSGWASPVYIDC
FT                   RKLISYPRVRRALMEMAETTITRDIGFEQIDAVAGGETAGIPFAAWIADRMMVPMQYVR
FT                   KKPKGFGRNAQIEGHLEEGSRVLLVEDLTTDSRSKINFVNALRTAGATVNHCFVLFHYN
FT                   IFKESVSVLKDIDVDLHALATWWDVLRVAKASGYFETKTLDEVEKFLHAPAEWSAAHGG
FT                   ATAPKE"
FT   misc_feature    complement(228475..228849)
FT                   /gene="pyrE"
FT                   /locus_tag="BCAL0204"
FT                   /note="HMMPfam hit to PF00156, Phosphoribosyl transferase
FT                   domain, score 3.9e-17"
FT                   /inference="protein motif:HMMPfam:PF00156"
FT   CDS_pept        229439..231709
FT                   /transl_table=11
FT                   /locus_tag="BCAL0205"
FT                   /product="NADP-dependent malic enzyme"
FT                   /EC_number="1.1.1.40"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0205"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50515"
FT                   /db_xref="GOA:B4E590"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:B4E590"
FT                   /protein_id="CAR50515.1"
FT                   /translation="MDEQLKQAALAYHLNPKPGKISVTPTKPLSNQLDLSLAYSPGVAA
FT                   ACEAIHADPLDAQKYTSRGNLVGVITNGTAVLGLGNIGPLAAKPVMEGKGCLFKKFAGI
FT                   DVFDIELSESDPDKLVEAIAMLEPTLGGINLEDIKAPECFYIEQKLRERMKIPVFHDDQ
FT                   HGTAIIASAAILNGLKVVGKKLSEVKLVCSGAGAAAIACLDLLVNLGLTKSNILVADSK
FT                   GVIYEGRGNLDPSKQRYAANTDARTLADAIVGADVFLGCSSAGVLKQDMVKTMGDKPLI
FT                   LALANPEPEIRPEDAKAVRPDAIVATGRSDYPNQVNNVLCFPFIFRGALDVGATTITEE
FT                   MKLACVRAIAELAEETDQSEEVAKAYEGHSLEFGPDYLIPKPFDPRLIIKIAPAVAQAA
FT                   MDSGVATRPIQDMDAYREQLGATVYRTGMVMRPVFAAAKQKEARIVFAEGEDERVLRAA
FT                   QFVLLEKIAKPIIVGRPSVVDMRLQKIGSKLKAGVDFEIVDPEDDARYHRYWQAYQEIG
FT                   ARDGVTPEVAKAAMRKFNTLIGAMLVHLGDADGMICGMIDTFHSHLKFIEQVLGRAKGA
FT                   EHFAAMNLLMLPGRNLFVCDTYVNELPSADQLADMTIQAAAEIERFGIAPKAALLSNSN
FT                   FGSAPSASSRRMAEARKLIVERAPNLEVDGEMHGDAALSELIRKQAFPGTTLSGEANLL
FT                   IMPNVEAANIAYNLLKMVGGEGVTVGPFLLGAAKPVHILTPAATVRRIINMTAVAAANV
FT                   NTK"
FT   misc_feature    229493..229921
FT                   /locus_tag="BCAL0205"
FT                   /note="HMMPfam hit to PF00390, Malic enzyme, N-terminal
FT                   domain, score 3.9e-77"
FT                   /inference="protein motif:HMMPfam:PF00390"
FT   misc_feature    229547..229579
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    229925..230638
FT                   /locus_tag="BCAL0205"
FT                   /note="HMMPfam hit to PF03949, Malic enzyme, NAD binding
FT                   domain, score 1.6e-127"
FT                   /inference="protein motif:HMMPfam:PF03949"
FT   misc_feature    230012..230044
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    230720..231688
FT                   /locus_tag="BCAL0205"
FT                   /note="HMMPfam hit to PF01515, Phosphate acetyl/butaryl
FT                   transferase, score 2.1e-108"
FT                   /inference="protein motif:HMMPfam:PF01515"
FT   CDS_pept        complement(231858..235448)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0206"
FT                   /product="putative pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0206"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50516"
FT                   /db_xref="GOA:B4E591"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B4E591"
FT                   /protein_id="CAR50516.1"
FT                   /translation="MNAPLDADQRASLEAALKSVTLDDKYTLERGRAYMSGIQALVRLP
FT                   MLQQERDRAAGLNTAGFISGYRGSPLGGLDLSLWKAKQHLAAHQIVFQPGLNEDLAATA
FT                   VWGSQQVNLYPGAKYDGVFGMWYGKGPGVDRTGDVFKHANSAGSSQHGGVLVLAGDDHA
FT                   AKSSTLAHQSEHIFKACGLPVLFPSNVQEYLDFGLHGWAMSRYSGLWVALKCVTDVVES
FT                   SASVDIDPHRTEIVLPTDFILPEGGLNIRWPDPPLVQEARLLDYKWYAALAYVRANKLD
FT                   RIEIDSPNARFGIMTGGKAYLDVRQALTDLGLDDETCARIGIRLYKVGCVWPLEAQGAQ
FT                   AFARGLDEILVVEEKRQILEYAIKEELYNWPDAQRPRVFGKFDEKDGAGGEWSVPMGNW
FT                   LLPAHYELSPAIIAKAIATRLEKFELPSDVRARIAARLAVINAKEMALAKPHVQTERKP
FT                   WFCSGCPHNTSTNVPEGSRAIAGIGCHYMTVWMDRSTSTFSQMGGEGVPWIGQAPFTDE
FT                   KHVFANLGDGTYFHSGLLAVRAAISSKANITYKILYNDAVAMTGGQPVDGVLTVPQITH
FT                   QLASEGAKKIVIVTDEPEKYDSQKALLAPGVTIHHRDQLDDVQRELREIEGTTILIYDQ
FT                   TCATEKRRRRKRGTYPDPAKRVVINDAVCEGCGDCSVQSNCLSVEPLETEFGTKRQINQ
FT                   SSCNKDFSCVKGFCPSFVTVEGGQLKKPKAVSVDGSALPPIPEPTLPAIDRAYGVLVTG
FT                   VGGTGVVTIGALLGMAAHLENKGVTVLDVTGLAQKGGAVMSHVQISHAPTDIHATRIAM
FT                   GEADLVIGCDAIVTAGDECTSRMRHDTTRVVVNSAQTPTAEFIKNPNWAFPGLSAENDI
FT                   RAAAGVAVDFIDANRFAVALLGDAIYTNPFVLGYAWQKGWLPLTLASLERAIELNAVSV
FT                   DKNRAAFDWGRRAAYDLASVKQAAAGDARPAQGATVISLHTKKAVDALIAKRVEFLSAY
FT                   QNAAYASRYAAFVDKVRATERALADGDTVQEPLTEAVARNLFKLMAYKDEYEVARLQSD
FT                   PAFLARLRAQFEGDWKLKFHLAPPLFAKTDAHGHLVKKAYGPWMMSAFRLLAKAKFLRG
FT                   TALDPFGRTAERRTERALIGEYEALIGEVLAKLNAANRPLALELAALPDGIRGYGHVKE
FT                   NNLRAVRQKWDTLLAKWRSPAGGQSHQQVA"
FT   misc_feature    complement(232623..233186)
FT                   /locus_tag="BCAL0206"
FT                   /note="HMMPfam hit to PF01558, Pyruvate
FT                   ferredoxin/flavodoxin oxidoreductas, score 1.1e-05"
FT                   /inference="protein motif:HMMPfam:PF01558"
FT   CDS_pept        235778..235972
FT                   /transl_table=11
FT                   /locus_tag="BCAL0206A"
FT                   /product="putative outer membrane protein"
FT                   /note="Similar to Burkholderia pseudomallei (strain 1710b)
FT                   putative outer membrane protein UniProt:Q3JYB8
FT                   (EMBL:CP000124) (65 aa) fasta scores: E()=6.9e-06, 45.312%
FT                   id in 64 aa. Possible gene remnant. Similar to the
FT                   N-terminal region of Caulobacter crescentus motA/tolQ/exbB
FT                   proton channel family protein SWALL:Q9A5W1 (EMBL:AE005903)
FT                   (302 aa) fasta scores: E(): 6.2, 43.13% id in 51 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0206A"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50517"
FT                   /db_xref="UniProtKB/TrEMBL:B4E592"
FT                   /protein_id="CAR50517.1"
FT                   /translation="MNTRHIQSFLIVSAAFFSMTGPVHARGASALAAAGAQMQQIVPAQ
FT                   DAAAQPSAERAAESKANVR"
FT   CDS_pept        complement(236106..237203)
FT                   /transl_table=11
FT                   /gene="hppD"
FT                   /locus_tag="BCAL0207"
FT                   /product="4-hydroxyphenylpyruvic acid dioxygenase"
FT                   /EC_number="1.13.11.27"
FT                   /note="CDS is involved in the synthesis of melanin-like
FT                   pigment which is capable of protecting the organism from in
FT                   vitro and in vivo sources of oxidative stress"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0207"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50518"
FT                   /db_xref="GOA:B4E593"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR005956"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041735"
FT                   /db_xref="InterPro:IPR041736"
FT                   /db_xref="UniProtKB/TrEMBL:B4E593"
FT                   /protein_id="CAR50518.1"
FT                   /translation="MQIPTWDNPVGTDGFEFIEYTAPDPKALGHLFERMGFTAIARHRH
FT                   KDVTVYRQGDINFIINAEPDSFAQRFARLHGPSICAIAFRVQDAAKAYQRALELGAWGF
FT                   DNKTGPMELNIPAIKGIGDSLIYFVDRWRGKNGAQPGAIGDISIYDVDFEPIPGANPNP
FT                   VGHGLTYIDHLTHNVHRGRMQEWAEFYERLFNFREVRYFDIEGKVTGVKSKAMTSPCGK
FT                   IRIPINEEGSDTAGQIQEYLDAYHGEGIQHIALGASDIYQAVDGLRSKEVKLLDTIDTY
FT                   YELVDRRVPNHGESLAELKKRKILIDGARDDLLLQIFTENQIGPIFFEIIQRKGNQGFG
FT                   EGNFKALFESIELDQIRRGVVQDKA"
FT   misc_feature    complement(236307..236696)
FT                   /gene="hppD"
FT                   /locus_tag="BCAL0207"
FT                   /note="HMMPfam hit to PF00903, Glyoxalase/Bleomycin
FT                   resistance protein/Di, score 1.1e-11"
FT                   /inference="protein motif:HMMPfam:PF00903"
FT   CDS_pept        237418..237942
FT                   /transl_table=11
FT                   /locus_tag="BCAL0208"
FT                   /product="AnsC family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0208"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50519"
FT                   /db_xref="GOA:B4E594"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4E594"
FT                   /protein_id="CAR50519.1"
FT                   /translation="MAQAELDAIDRRILAILQENGRLSNQEIAERVNLSPSPCLRRIRR
FT                   LEDIGVITGYVALLNPQKLGLDLLAYVSVRLEKRGGLAPVRVDETSARAGATHAELFRA
FT                   AVQAWPEVVACHAMTGDMDYLLRVQVEDMAHFSRFVQEHLLHHPSVIDVKTSFSLDCFK
FT                   ETTALPIRSVR"
FT   misc_feature    237484..237549
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1496.000, SD 4.28 at aa 23-44, sequence
FT                   LSNQEIAERVNLSPSPCLRRIR"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    237487..237567
FT                   /note="PS00519 Bacterial regulatory proteins, asnC family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00519"
FT   misc_feature    237625..237900
FT                   /locus_tag="BCAL0208"
FT                   /note="HMMPfam hit to PF01037, AsnC family, score 2.7e-24"
FT                   /inference="protein motif:HMMPfam:PF01037"
FT   CDS_pept        complement(238009..238656)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0209"
FT                   /product="acetyltransferase (GNAT) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0209"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50520"
FT                   /db_xref="GOA:B4E595"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B4E595"
FT                   /protein_id="CAR50520.1"
FT                   /translation="MNTRSNRRADAVGHAGTAPVLVRELASKDREQMLTHFLSLDEEDR
FT                   LLRFGQVVPDHVIENYVRTIDFGRDTVFGVFDHDLELIGVGHLAYLPAEGDKRTAEFGV
FT                   SVLESARGRGVGSKLFERAAMRSRNTHVTMLYMHCLSRNATMMHIAKKSGMRIEYAYGE
FT                   ADAYLSLPPADHSTIIAEMLQEQAAVFDYAMKRQARRTTKFIESLIPAALTA"
FT   misc_feature    complement(238189..238437)
FT                   /locus_tag="BCAL0209"
FT                   /note="HMMPfam hit to PF00583, Acetyltransferase (GNAT)
FT                   family, score 5.8e-09"
FT                   /inference="protein motif:HMMPfam:PF00583"
FT   CDS_pept        complement(238891..239496)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0210"
FT                   /product="TetR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0210"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50521"
FT                   /db_xref="GOA:B4E596"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:B4E596"
FT                   /protein_id="CAR50521.1"
FT                   /translation="MARTRAPDHESQREQILDLAAEKFAQTSYPSTSMSDLATASGTSK
FT                   ARLYHYYESKEAILFDLLDRYTKRLMLIIAEVEGASQRRGLSERDAFAELVRAFLAEYE
FT                   TSHSRHVALLNDVKYLEDAQREIVLDRQRDIVAAFTRQLARAYPDRISKENQTSVTMMV
FT                   FGMINWTFTWLKPGGRLGYRDFAEQVIDLIERGLSTAA"
FT   misc_feature    complement(239311..239451)
FT                   /locus_tag="BCAL0210"
FT                   /note="HMMPfam hit to PF00440, Bacterial regulatory
FT                   proteins, tetR family, score 7.4e-12"
FT                   /inference="protein motif:HMMPfam:PF00440"
FT   misc_feature    complement(239338..239403)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1303.000, SD 3.62 at aa 32-53, sequence
FT                   TSMSDLATASGTSKARLYHYYE"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        complement(239510..240331)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0211"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0211"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50522"
FT                   /db_xref="InterPro:IPR014973"
FT                   /db_xref="InterPro:IPR022123"
FT                   /db_xref="UniProtKB/TrEMBL:B4E597"
FT                   /protein_id="CAR50522.1"
FT                   /translation="MSTIHVIQGGTAAASLREALVQAGRDERVVGLLDDLGVGPLKGAD
FT                   ETPDTRAAFWQHVLGDQIPDWNAEIEGEFARLDQLAMDTGQVVVWHAPSVGDKLLLRRV
FT                   AYHLRNVPQRLNEVRLSAADLDAAQRASLSRTDQACATGMFSPAELARKRPVAAPISVL
FT                   RIGRLALEWQEAKHLNAELRYWVSNTIKSGHYADLDALIVARAETDWQPARRLVGSIMA
FT                   AADRGGLFVSDSIAWWRCRELAATGRLELQDDAPAALSSTQVRAAPAAAHR"
FT   CDS_pept        complement(240459..241547)
FT                   /transl_table=11
FT                   /gene="paaE"
FT                   /locus_tag="BCAL0212"
FT                   /product="putative phenylacetic acid degradation NADH
FT                   oxidoreductase PaaE"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0212"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50523"
FT                   /db_xref="GOA:B4E598"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR011884"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B4E598"
FT                   /protein_id="CAR50523.1"
FT                   /translation="MATPQFHPLRIRDVRPETADAVTVSFDVPPELRDAYRFTQGQFVT
FT                   LKTHIDGEETRRSYSICVGTTDYDRDGELRIGIKRVRGGRFSNFAFDTLKPGHMIDVMT
FT                   PDGRFFTHLNADHGKQYVAFSGGSGITPVLAIVKTTLELEPRSTFTLIYGNRSVDAIMF
FT                   AEELEDLKNRYMNRFVLYHVLSDDLQDVELFNGVLDQAKCAEFLATLTPADAIDEAFIC
FT                   GPAPMMDAAEAALKAAGVPQAKVHVERFGTPLPQAGAPVVEITDQTPAADLEIVLDGKK
FT                   RKLRLPYEGVSLLDVGLRAGLALPYACKGGVCCTCRAKVVEGEVRMEKNYTLEEHEVED
FT                   GFVLTCQCHPISDKVVVSFDER"
FT   misc_feature    complement(240492..240725)
FT                   /gene="paaE"
FT                   /locus_tag="BCAL0212"
FT                   /note="HMMPfam hit to PF00111, 2Fe-2S iron-sulfur cluster
FT                   binding doma, score 7.4e-17"
FT                   /inference="protein motif:HMMPfam:PF00111"
FT   misc_feature    complement(240849..241184)
FT                   /gene="paaE"
FT                   /locus_tag="BCAL0212"
FT                   /note="HMMPfam hit to PF00175, Oxidoreductase NAD-binding
FT                   domain, score 8.6e-15"
FT                   /inference="protein motif:HMMPfam:PF00175"
FT   misc_feature    complement(241215..241526)
FT                   /gene="paaE"
FT                   /locus_tag="BCAL0212"
FT                   /note="HMMPfam hit to PF00970, Oxidoreductase FAD-binding
FT                   domain, score 2.4e-14"
FT                   /inference="protein motif:HMMPfam:PF00970"
FT   CDS_pept        complement(241550..242104)
FT                   /transl_table=11
FT                   /gene="paaD"
FT                   /locus_tag="BCAL0213"
FT                   /product="phenylacetic acid degradation protein PaaD"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0213"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50524"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR011883"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:B4E599"
FT                   /protein_id="CAR50524.1"
FT                   /translation="MSAQTAAPAPAAHRDDPLLARAWDVLEAVPDPEIPVVSIRELGIL
FT                   RDVRRADDGQLEVVITPTYSGCPAMSQIAEDIAAALQAADLPPHRIETVLAPAWTTDWI
FT                   TQEARDKLRAYGIAPPVGQCGSAAPRENVVRFVPRPVAAPTCPRCGSARTERLAQFAST
FT                   ACKALYRCVDCREPFDYFKPY"
FT   misc_feature    complement(241817..242053)
FT                   /gene="paaD"
FT                   /locus_tag="BCAL0213"
FT                   /note="HMMPfam hit to PF01883, Domain of unknown function
FT                   DUF59, score 6.5e-15"
FT                   /inference="protein motif:HMMPfam:PF01883"
FT   CDS_pept        complement(242130..242933)
FT                   /transl_table=11
FT                   /gene="paaC"
FT                   /locus_tag="BCAL0214"
FT                   /product="phenylacetic acid degradation protein PaaC"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0214"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50525"
FT                   /db_xref="GOA:B4E5A0"
FT                   /db_xref="InterPro:IPR007814"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011882"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:B4E5A0"
FT                   /protein_id="CAR50525.1"
FT                   /translation="MTITPEHLSYVLRLADNALILGQRNAEWCGHGPILEEDIALTNMS
FT                   LDLIGQARMLYTHAAELERQLTGATKTEDDYAYFRTEREFANFTLAELPHYGPVSGTAH
FT                   ADKDYAVTIVRNFLYAALMLHVWSALETSTDTQLAAIAAKSVKETRYHVQHAREWLVRL
FT                   GDGTDESHRRAQAALDYLMPYTREFFAADAIDDAIVAPGIGPAPAAIEAAWRADVDDAL
FT                   AEATLTLPAPVKHVTTGKQGEHSEHMGYLLAEMQSLARQHPGASW"
FT   misc_feature    complement(242133..242933)
FT                   /gene="paaC"
FT                   /locus_tag="BCAL0214"
FT                   /note="HMMPfam hit to PF05138, Phenylacetic acid catabolic
FT                   protein, score 9.9e-52"
FT                   /inference="protein motif:HMMPfam:PF05138"
FT   CDS_pept        complement(242944..243228)
FT                   /transl_table=11
FT                   /gene="paaB"
FT                   /locus_tag="BCAL0215"
FT                   /product="phenylacetic acid degradation protein PaaB"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0215"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50526"
FT                   /db_xref="InterPro:IPR009359"
FT                   /db_xref="InterPro:IPR038693"
FT                   /db_xref="UniProtKB/TrEMBL:B4E5A1"
FT                   /protein_id="CAR50526.1"
FT                   /translation="MNKEWPIWEVFVRSKQGLDHKHCGSLHAADATMALRMARDVYTRR
FT                   QEGVSIWVVPSSAITASDPSEKAELFEPAGDKIYRHPTFYTLPDEVNHM"
FT   misc_feature    complement(242947..243216)
FT                   /gene="paaB"
FT                   /locus_tag="BCAL0215"
FT                   /note="HMMPfam hit to PF06243, Phenylacetic acid
FT                   degradation B, score 8.5e-71"
FT                   /inference="protein motif:HMMPfam:PF06243"
FT   CDS_pept        complement(243264..244262)
FT                   /transl_table=11
FT                   /gene="paaA"
FT                   /locus_tag="BCAL0216"
FT                   /product="phenylacetic acid degradation protein PaaA"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0216"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50527"
FT                   /db_xref="GOA:B4E5A2"
FT                   /db_xref="InterPro:IPR007814"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011881"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:B4E5A2"
FT                   /protein_id="CAR50527.1"
FT                   /translation="MYTQSLDIPGNVAPLDAATESPEQTRFDAVMAADGKIEPQDWMPD
FT                   AYRKTLVRQISQHAHSEVVGMLPEGNWISRAPSLKRKAILLAKVQDEAGHGLYLYSAAE
FT                   TLGVSRDSLIDALHAGKAKYSSIFNYPTPTWADVGVIGWLVDGAAIMNQIPLCRCTYGP
FT                   YARAMIRVCKEESFHQRQGFDALLSMMKGSDAQRAMVQQAVNRWWWPVLMMFGPSDADS
FT                   VHSSQSAKWGIKRISNDDLRQKFVDATVDQAKVLGVTLPDPDLKWNEARGHHDYGAIDW
FT                   DEFWRVVNGDGPCNKERLATRVKAHEDGAWVREAALAHEAKRRARAEQQAA"
FT   misc_feature    complement(243330..244262)
FT                   /gene="paaA"
FT                   /locus_tag="BCAL0216"
FT                   /note="HMMPfam hit to PF05138, Phenylacetic acid catabolic
FT                   protein, score 2.9e-146"
FT                   /inference="protein motif:HMMPfam:PF05138"
FT   CDS_pept        244457..245728
FT                   /transl_table=11
FT                   /locus_tag="BCAL0217"
FT                   /product="putative exported GDSL-like lipase/acylhydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0217"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50528"
FT                   /db_xref="GOA:B4E5A3"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:B4E5A3"
FT                   /protein_id="CAR50528.1"
FT                   /translation="MPMSFRSSFAAAVLGAAVLVSPLAASAAPAGWVAAWATALQPIPD
FT                   LAAPPPLYRAPDVAGRTVRQIVYPTVSGRAARIRVSNAYGRAPLVVEAASLARAGEGAA
FT                   LAGGAAVPVRFGGKASVTLAPGQELESDPVAIGVTAAQPYAISLQMGPNQRMTVWHRVS
FT                   NQFNYVSGPGDHVNDPGAETFRTRFTQYAWVTELAVEAGPAHASVAAIGDSITDGLRSS
FT                   VNRNRRWPDALARRLAAAGADSVGVVNLGISGNRLLSDSACYGTSLASRFERDALSRSG
FT                   VKAAIVLIGINDINFAAMPPRAGLDCDHPHTPVTAASLIDGYRRLIETAHRQGVKVFGA
FT                   TLTPAALPAGREAIRLEVNRWIRSGGGFDGVVDFDAALRDPARPSVLQRRYDSGDGIHP
FT                   SDAGYTAMADAVPIERLQAAAGGS"
FT   sig_peptide     244493..244537
FT                   /locus_tag="BCAL0217"
FT                   /note="Signal peptide predicted for BCAL0217 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.991) with cleavage site
FT                   probability 0.393 between residues 15 and 16"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    245078..245689
FT                   /locus_tag="BCAL0217"
FT                   /note="HMMPfam hit to PF00657, GDSL-like
FT                   Lipase/Acylhydrolase, score 1.5e-22"
FT                   /inference="protein motif:HMMPfam:PF00657"
FT   rRNA            246294..247825
FT                   /note="16S"
FT   tRNA            247890..247966
FT                   /gene="BCALr0217b"
FT                   /note="tRNA Ile anticodon GAT, Cove score 93.29"
FT   tRNA            248006..248081
FT                   /gene="BCALr0217c"
FT                   /note="tRNA Ala anticodon TGC, Cove score 90.89"
FT   rRNA            248361..251237
FT                   /note="23S"
FT   rRNA            251395..251509
FT                   /note="5S"
FT   CDS_pept        253036..253371
FT                   /transl_table=11
FT                   /locus_tag="BCAL0218"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0218"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50529"
FT                   /db_xref="UniProtKB/TrEMBL:B4E5A4"
FT                   /protein_id="CAR50529.1"
FT                   /translation="MSGTKSLPKPRHVAAPQRNAVTDQARHMKEADCRVEMGTGGRPAI
FT                   RDDIVLLGKVIERNRVIEFGDETGSPRSPKGAAKAFVPMLAWIGAGSLQCPLQSRYFLQ
FT                   EALTNLP"
FT   tRNA            253677..253762
FT                   /gene="BCALr0218a"
FT                   /note="tRNA Tyr anticodon GTA, Cove score 66.50"
FT   tRNA            253806..253879
FT                   /gene="BCALr0218b"
FT                   /note="tRNA Gly anticodon TCC, Cove score 82.17"
FT   tRNA            253902..253976
FT                   /gene="BCALr0218c"
FT                   /note="tRNA Thr anticodon GGT, Cove score 90.12"
FT   CDS_pept        254043..255233
FT                   /transl_table=11
FT                   /gene="tufA1"
FT                   /locus_tag="BCAL0219"
FT                   /product="elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0219"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50530"
FT                   /db_xref="GOA:B4E5A5"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:B4E5A5"
FT                   /protein_id="CAR50530.1"
FT                   /translation="MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLTKKFGGEAK
FT                   AYDQIDAAPEEKARGITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCSAADGPMPQTREHILLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYDF
FT                   PGDDTPIVKGSAKLALEGDTGELGEVAIMSLADALDTYIPTPERAVDGAFLMPVEDVFS
FT                   ISGRGTVVTGRVERGIVKVGEEIEIVGIKPTVKTTCTGVEMFRKLLDQGQAGDNVGILL
FT                   RGTKREDVERGQVLAKPGSITPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDV
FT                   TGSIELPKDKEMVMPGDNVSITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIE"
FT   misc_feature    254070..254660
FT                   /gene="tufA1"
FT                   /locus_tag="BCAL0219"
FT                   /note="HMMPfam hit to PF00009, Elongation factor Tu GTP
FT                   binding domain, score 7e-102"
FT                   /inference="protein motif:HMMPfam:PF00009"
FT   misc_feature    254097..254120
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    254193..254240
FT                   /note="PS00301 GTP-binding elongation factors signature."
FT                   /inference="protein motif:Prosite:PS00301"
FT   misc_feature    254721..254930
FT                   /gene="tufA1"
FT                   /locus_tag="BCAL0219"
FT                   /note="HMMPfam hit to PF03144, Elongation factor Tu domain,
FT                   score 7.5e-26"
FT                   /inference="protein motif:HMMPfam:PF03144"
FT   misc_feature    254943..255227
FT                   /gene="tufA1"
FT                   /locus_tag="BCAL0219"
FT                   /note="HMMPfam hit to PF03143, Elongation factor Tu
FT                   C-terminal domain, score 2.5e-62"
FT                   /inference="protein motif:HMMPfam:PF03143"
FT   tRNA            255293..255368
FT                   /gene="BCALr00219"
FT                   /note="tRNA Trp anticodon CCA, Cove score 84.85"
FT   CDS_pept        255411..255791
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="BCAL0220"
FT                   /product="preprotein translocase SecE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0220"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50531"
FT                   /db_xref="GOA:B4E5A6"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:B4E5A6"
FT                   /protein_id="CAR50531.1"
FT                   /translation="MANPSVETVNTSGDKLMLALGVLLVLAGFVGFFWLANQQWYVRGA
FT                   ALAVGIIAGVAVGLMSAPGKSLIAFAKDSYKEVRKVVWPTRKEATQTTLVVFGFVLVMA
FT                   IFLWLSDKSIEWVIFSAILGWK"
FT   misc_feature    join(255453..255521,255555..255623,255681..255740)
FT                   /gene="secE"
FT                   /locus_tag="BCAL0220"
FT                   /note="3 probable transmembrane helices predicted for
FT                   BCAL0220 by TMHMM2.0 at aa 15-37, 49-71 and 91-110"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    255606..255779
FT                   /gene="secE"
FT                   /locus_tag="BCAL0220"
FT                   /note="HMMPfam hit to PF00584, SecE/Sec61-gamma subunits of
FT                   protein translo, score 3.4e-17"
FT                   /inference="protein motif:HMMPfam:PF00584"
FT   CDS_pept        255793..256350
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="BCAL0221"
FT                   /product="transcription antitermination protein NusG"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0221"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50532"
FT                   /db_xref="GOA:B4E5A7"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:B4E5A7"
FT                   /protein_id="CAR50532.1"
FT                   /translation="MSDTPASPSGKRWYVVHAYSGMEKSVQRALQERIERAGMQDKFGQ
FT                   ILVPTEEVVEVKGGHKAVTERRFFPGYVLVEMEMTDETWHLVKNTAKVTGFVGGARNRP
FT                   TPISPKEVEKIMSQMQEGVEKPRPKTLFEVGEMVRVKEGPFTDFNGTVEEVNYEKSRVR
FT                   VSVTIFGRSTPVELEFGQVEKV"
FT   misc_feature    255823..256122
FT                   /gene="nusG"
FT                   /locus_tag="BCAL0221"
FT                   /note="HMMPfam hit to PF02357, Transcription termination
FT                   factor nusG, score 1.4e-54"
FT                   /inference="protein motif:HMMPfam:PF02357"
FT   misc_feature    256186..256299
FT                   /gene="nusG"
FT                   /locus_tag="BCAL0221"
FT                   /note="HMMPfam hit to PF00467, KOW motif, score 7.1e-10"
FT                   /inference="protein motif:HMMPfam:PF00467"
FT   misc_feature    256294..256323
FT                   /note="PS01014 Transcription termination factor nusG
FT                   signature."
FT                   /inference="protein motif:Prosite:PS01014"
FT   CDS_pept        256492..256923
FT                   /transl_table=11
FT                   /gene="relC"
FT                   /gene_synonym="rplK"
FT                   /locus_tag="BCAL0222"
FT                   /product="50S ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0222"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50533"
FT                   /db_xref="GOA:B4E5A8"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E5A8"
FT                   /protein_id="CAR50533.1"
FT                   /translation="MAKKIIGFIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAQ
FT                   TQGMEPGLPVPVVITAFADKSFTFVMKTPPATVLIKKAAKVDKGSSKPHTDKVGSITRA
FT                   QAEEIAKTKMPDLTAADLDAAVRTIAGSARSMGITVEGV"
FT   misc_feature    256513..256692
FT                   /gene="relC"
FT                   /locus_tag="BCAL0222"
FT                   /note="HMMPfam hit to PF03946, Ribosomal protein L11,
FT                   N-terminal dom, score 9e-35"
FT                   /inference="protein motif:HMMPfam:PF03946"
FT   misc_feature    256705..256911
FT                   /gene="relC"
FT                   /locus_tag="BCAL0222"
FT                   /note="HMMPfam hit to PF00298, Ribosomal protein L11, RNA
FT                   binding do, score 2.7e-35"
FT                   /inference="protein motif:HMMPfam:PF00298"
FT   misc_feature    256870..256917
FT                   /note="PS00359 Ribosomal protein L11 signature."
FT                   /inference="protein motif:Prosite:PS00359"
FT   CDS_pept        256924..257622
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="BCAL0223"
FT                   /product="50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0223"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50534"
FT                   /db_xref="GOA:B4E5A9"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E5A9"
FT                   /protein_id="CAR50534.1"
FT                   /translation="MAKISKRRQAFAAKVDRQKLYAIEDALSLVKECASAKFDESIDVA
FT                   VQLGIDAKKSDQVVRGSVVLPAGTGKSVRVAVFAQGEKAEQARAAGAEIVGMEDLAEQI
FT                   KAGQMDFDIVIASPDTMRIVGTLGQILGPRGLMPNPKVGTVTPDVATAVKNAKAGQVQF
FT                   RVDKAGIIHATIGRASFEPTALRSNLSALIEALQKAKPATSKGVYLRKIALSSTMGVGV
FT                   RVDQATLAAQ"
FT   misc_feature    256966..257586
FT                   /gene="rplA"
FT                   /locus_tag="BCAL0223"
FT                   /note="HMMPfam hit to PF00687, Ribosomal protein L1p/L10e
FT                   family, score 1.5e-122"
FT                   /inference="protein motif:HMMPfam:PF00687"
FT   misc_feature    257284..257340
FT                   /note="PS01199 Ribosomal protein L1 signature."
FT                   /inference="protein motif:Prosite:PS01199"
FT   CDS_pept        257932..258429
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="BCAL0224"
FT                   /product="50S ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0224"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50535"
FT                   /db_xref="GOA:B4E5B0"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E5B0"
FT                   /protein_id="CAR50535.1"
FT                   /translation="MPLNREDKQAVVAEVSAQVAKAQTVVLAEYRGIAVGDLTKLRAQA
FT                   REQKVYLRVLKNTLARRAVEGTPFAPLAEQMTGPLIYGISEDAIAAAKVVNDFSKSNDK
FT                   LVIKAGSFDGKVMDKAGVQALASIPSREELLSKLLFVMQAPVSGFARALAALAEKKQAE
FT                   AA"
FT   misc_feature    257938..258231
FT                   /gene="rplJ"
FT                   /locus_tag="BCAL0224"
FT                   /note="HMMPfam hit to PF00466, Ribosomal protein L10, score
FT                   3.8e-20"
FT                   /inference="protein motif:HMMPfam:PF00466"
FT   CDS_pept        258493..258867
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="BCAL0225"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0225"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50536"
FT                   /db_xref="GOA:B4E5B1"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E5B1"
FT                   /protein_id="CAR50536.1"
FT                   /translation="MAIAKEDILAAVEGMTVLELNELVKAFEEKFGVSAAAVAVAGPAG
FT                   GGAAAAAEEKTEFTVVLAEAGANKVSVIKAVRELTGLGLKEAKDLVDGAPKPIKEGVDK
FT                   AAAEEAKKKLEEAGAKVEVK"
FT   sig_peptide     258535..258645
FT                   /gene="rplL"
FT                   /locus_tag="BCAL0225"
FT                   /note="Signal peptide predicted for BCAL0225 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.712) with cleavage site
FT                   probability 0.487 between residues 37 and 38"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    258661..258864
FT                   /gene="rplL"
FT                   /locus_tag="BCAL0225"
FT                   /note="HMMPfam hit to PF00542, Ribosomal protein L7/L12
FT                   C-terminal dom, score 3.4e-38"
FT                   /inference="protein motif:HMMPfam:PF00542"
FT   CDS_pept        259249..263355
FT                   /transl_table=11
FT                   /locus_tag="BCAL0226"
FT                   /product="DNA-directed RNA polymerase beta chain"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0226"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50537"
FT                   /db_xref="GOA:B4E5B2"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E5B2"
FT                   /protein_id="CAR50537.1"
FT                   /translation="MQYSFTEKKRIRKSFAKRPIVHQVPFLLATQLESFSTFLQADVPA
FT                   TQRKPEGLQAAFTSVFPIVSHNGFARLEFVSYALSSPAFNIKECQQRGLTYCSALRAKV
FT                   RLVILDKESPNKPVVKEVKEQEVYMGEIPLMTPTGSFVINGTERVIVSQLHRSPGVFFE
FT                   HDKGKTHSSGKLLFSARIIPYRGSWLDFEFDPKDILYFRVDRRRKMPVTILLKAIGLTP
FT                   EQILANFFVFDNFTLMDEGAQLEFVPERLRGEVARFDITDRDGKVIVQKDKRINAKHIR
FT                   DLEAAKTKFISVPEDYLLGRVLAKNVVDGDTGEVIASANDEVTESVLEKLREAGIKDIQ
FT                   TLYTNDLDQGPYISSTLRVDETTDKTAARIAIHRMMRPGEPPTEEAVEALFNRLFYSEE
FT                   AYDLSKVGRMKFNRRVGRDEIVGPMTLQDDDILATIKILVELRNGKGEVDDIDHLGNRR
FT                   VRCVGELAENQFRAGLVRVERAVKERLGQAESENLMPHDLINSKPISSAIREFFGSSQL
FT                   SQFMDQTNPLSEITHKRRVSALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIG
FT                   LINSLALYAHLNEYGFLETPYRKVVDSKVTDQIDYLSAIEEGRYMIAQANAAIDEDGRL
FT                   IDELVSSREAGETMMVTPDRIQYMDVAPSQIVSVAASLIPFLEHDDANRALMGSNMQRQ
FT                   AVPCLRPEKPVVGTGIERTCAVDSGTTVQAFRGGVVDYVDAGRIVIRVNDDEAVAGEVG
FT                   VDIYNLIKYTRSNQNTNINQRPIVKMGDKVSRGDVLADGASTDLGELALGQNMLIAFMP
FT                   WNGYNFEDSILISEKVVADDRYTSIHIEELNVVARDTKLGPEEITRDISNLAEVQLGRL
FT                   DESGIVYIGAEVEAGDVLVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDTSLRVPSGM
FT                   SGTVIDVQVFTREGIQRDKRAQQIIDDELKRYRLDLNDQLRIVEGDAFQRLARMLVGKV
FT                   ANGGPKKLAKGTKIDQAYLEDLDHYHWFDIRLADDEAAASLEAIKNSIEEKRHQFDLAF
FT                   EEKRKKLTQGDELPPGVLKMVKVYLAVKRRLQPGDKMAGRHGNKGVVSKIVPIEDMPYM
FT                   ADGRPADVVLNPLGVPSRMNVGQVLEVHLGWAAKGLGWRIGEMLQRQAKIEELRTFLTK
FT                   IYNESGRQEDLESFTDDEILELAKNLREGVPFATPVFDGATEEEMGKMLDLAFPDDIAE
FT                   QLGMNPSKNQVRLYDGRTGEMFERRVTLGYMHYLKLHHLVDDKMHARSTGPYSLVTQQP
FT                   LGGKAQFGGQRFGEMEVWALEAYGASYVLQEMLTVKSDDVTGRTKVYENLVKGDHVIDA
FT                   GMPESFNVLVKEIRSLGIDIDLDRN"
FT   sig_peptide     259249..259371
FT                   /locus_tag="BCAL0226"
FT                   /note="Signal peptide predicted for BCAL0226 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.736) with cleavage site
FT                   probability 0.711 between residues 41 and 42"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    259327..260793
FT                   /locus_tag="BCAL0226"
FT                   /note="HMMPfam hit to PF04563, RNA polymerase beta subunit,
FT                   score 2e-28"
FT                   /inference="protein motif:HMMPfam:PF04563"
FT   misc_feature    259714..260628
FT                   /locus_tag="BCAL0226"
FT                   /note="HMMPfam hit to PF04561, RNA polymerase Rpb2, domain,
FT                   score 4.9e-06"
FT                   /inference="protein motif:HMMPfam:PF04561"
FT   misc_feature    260803..261012
FT                   /locus_tag="BCAL0226"
FT                   /note="HMMPfam hit to PF04565, RNA polymerase Rpb2, domain,
FT                   score 1.7e-45"
FT                   /inference="protein motif:HMMPfam:PF04565"
FT   misc_feature    261409..263118
FT                   /locus_tag="BCAL0226"
FT                   /note="HMMPfam hit to PF00562, RNA polymerase Rpb2, domain,
FT                   score 3.2e-184"
FT                   /inference="protein motif:HMMPfam:PF00562"
FT   misc_feature    262492..262530
FT                   /note="PS01166 RNA polymerases beta chain signature."
FT                   /inference="protein motif:Prosite:PS01166"
FT   misc_feature    263122..263352
FT                   /locus_tag="BCAL0226"
FT                   /note="HMMPfam hit to PF04560, RNA polymerase Rpb2, domain,
FT                   score 1.3e-47"
FT                   /inference="protein motif:HMMPfam:PF04560"
FT   CDS_pept        263377..267618
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /gene_synonym="tabB"
FT                   /locus_tag="BCAL0227"
FT                   /product="DNA-directed RNA polymerase beta' chain"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0227"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50538"
FT                   /db_xref="GOA:B4E5B3"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E5B3"
FT                   /protein_id="CAR50538.1"
FT                   /translation="MKALLDLFKQVQQEEVFDAIKIGLASPDKIRSWSFGEVKKPETIN
FT                   YRTFKPERDGLFCAKIFGPIKDYECLCGKYKRLKHRGVICEKCGVEVTLAKVRRERMGH
FT                   IELASPVAHIWFLKSLPSRLGMVLDMTLRDIERVLYFEAYVVIEPGMTPLKARQIMTEE
FT                   DYYNKVEEYGDEFRAEMGAEGVRELLRAINIDEQVETLRTELKNTGSEAKIKKYAKRLK
FT                   VLEAFQRSGIKPEWMILEVLPVLPPELRPLVPLDGGRFATSDLNDLYRRVINRNNRLKR
FT                   LLELKAPEIIVRNEKRMLQEAVDSLLDNGRRGKAMTGANKRPLKSLADMIKGKGGRFRQ
FT                   NLLGKRVDYSGRSVIVVGPTLKLHQCGLPKLMALELFKPFIFNKLEVMGVATTIKAAKK
FT                   EVENQTPVVWDILEEVIREHPVMLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAFN
FT                   ADFDGDQMAVHVPLSLEAQMEARTLMLASNNVLFPANGDPSIVPSQDIVLGLYYATREA
FT                   INGKGEGLSFTGVSEVIRAYENKEVELASRVNVRITEMVRNEDTSEGAPEFVPKITLYA
FT                   TTVGRAILSEILPHGLPFSVLNKPLKKKEISRLINTAFRKCGLRATVVFADQLMQSGFR
FT                   LATRAGISICVDDMLVPPQKETIVGDAAKKVKEYDRQYMSGLVTAQERYNNVVDIWSAT
FT                   SEAVGKAMMEQLSTEPVIDRDGNETRQESFNSIYMMADSGARGSAVQIRQLAGMRGLMA
FT                   KPDGSIIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVTQDL
FT                   VVVEDDCGTSNGVAMKALVEGGEVVEALRDRILGRVAVADVVNPETQETLYESGTLLDE
FT                   TAVEEIERLGIDEVRVRTPLTCETRYGLCAACYGRDLGRGSLVNVGEAVGVIAAQSIGE
FT                   PGTQLTMRTFHIGGAASRAAVASSVEAKSNGIVRFTATMRYVTNAKGEQIVISRSGEAM
FT                   ITDDFGRERERHKVPYGATLLQLDGATIKAGTQLATWDPLTRPIITEYGGTVKFENVEE
FT                   GVTVAKQIDDVTGLSTLVVIDVKRRGSQASKSVRPQVKLLDANGEEVKIPGTEHAVQIG
FT                   FQVGALITVKDGQQVQVGEVLARIPTEAQKTRDITGGLPRVAELFEARSPKDAGILAEV
FT                   TGTTSFGKDTKGKQRLVITDLEGNQHEFLIAKEKQVLVHDAQVVNKGEMIVDGPADPHD
FT                   ILRLQGIEALSRYIVDEVQDVYRLQGVKINDKHIEVIVRQMLRRVQITDNGDTRFIPGE
FT                   QVERSDMLDENDRMIAEGKRPASYDNVLLGITKASLSTDSFISAASFQETTRVLTEAAI
FT                   MGKRDDLRGLKENVIVGRLIPAGTGLAFHKARKAKESSDRERFDQIAAEEAFDFGTPSA
FT                   PAEEPQHPAAE"
FT   misc_feature    263416..264402
FT                   /gene="rpoC"
FT                   /locus_tag="BCAL0227"
FT                   /note="HMMPfam hit to PF04997, RNA polymerase Rpb1, domain,
FT                   score 4.6e-147"
FT                   /inference="protein motif:HMMPfam:PF04997"
FT   misc_feature    264406..264834
FT                   /gene="rpoC"
FT                   /locus_tag="BCAL0227"
FT                   /note="HMMPfam hit to PF00623, RNA polymerase Rpb1, domain,
FT                   score 1.2e-82"
FT                   /inference="protein motif:HMMPfam:PF00623"
FT   misc_feature    264841..265323
FT                   /gene="rpoC"
FT                   /locus_tag="BCAL0227"
FT                   /note="HMMPfam hit to PF04983, RNA polymerase Rpb1, domain,
FT                   score 1.4e-33"
FT                   /inference="protein motif:HMMPfam:PF04983"
FT   misc_feature    265408..265683
FT                   /gene="rpoC"
FT                   /locus_tag="BCAL0227"
FT                   /note="HMMPfam hit to PF05000, RNA polymerase Rpb1, domain,
FT                   score 1.1e-31"
FT                   /inference="protein motif:HMMPfam:PF05000"
FT   misc_feature    265687..267360
FT                   /gene="rpoC"
FT                   /locus_tag="BCAL0227"
FT                   /note="HMMPfam hit to PF04998, RNA polymerase Rpb1, domain,
FT                   score 8.8e-97"
FT                   /inference="protein motif:HMMPfam:PF04998"
FT   CDS_pept        267898..269745
FT                   /transl_table=11
FT                   /gene="recQ"
FT                   /locus_tag="BCAL0228"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0228"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50539"
FT                   /db_xref="GOA:B4E5B4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B4E5B4"
FT                   /protein_id="CAR50539.1"
FT                   /translation="MSRALEILDEVFGYSAFRGQQGEIVEHVAGGGDCLVLMPTGGGKS
FT                   LCYQIPALLRREAGQGAGIVVSPLIALMQDQVAALSEVGVRAAYLNSTLSGAEAAATER
FT                   ALREGEIDLLYVAPERLMTGRFLELLERAKIGLFAIDEAHCVSQWGHDFRPEYIQLSVL
FT                   HERFPSVPRIALTATADAITRDEIIHRLALDDVRVFVSSFDRPNIRYRIVEKDNARAQL
FT                   LDFIRAEHTNADGTTDAGVVYCLSRRKVEETAEWLKAQGVRALPYHAGMEFEVRQKHQE
FT                   MFQREEGIVMCATIAFGMGIDKPDVRFVAHLDLPKSVEGYYQETGRAGRDGMPANAWMA
FT                   YGLGDVVQQRKMIDESDADDAHKRVQTSKLDALLGLCETISCRRVRLLNYFGEASQPCG
FT                   NCDTCLEPPASWDATREAQMALSCVFRAQRASGFNFGSSHLIEILRGGRTEKVLQRGHD
FT                   QLSTFGIGAALSEPEWRAIFRQLVAYGYLAVDHGGFGALMLTEAAKPVLKNEEKVTLRR
FT                   YVKPQRTRQSSSRSGTRVDPTAGMGARERARWDALRAWRAETAKTDGVPAYVIFHDATL
FT                   AEIARNAPETIDDLRHIPGMGVRKLERFGDEIIDVVESA"
FT   misc_feature    267949..268458
FT                   /gene="recQ"
FT                   /locus_tag="BCAL0228"
FT                   /note="HMMPfam hit to PF00270, DEAD/DEAH box helicase,
FT                   score 3.6e-27"
FT                   /inference="protein motif:HMMPfam:PF00270"
FT   misc_feature    268663..268893
FT                   /gene="recQ"
FT                   /locus_tag="BCAL0228"
FT                   /note="HMMPfam hit to PF00271, Helicase conserved
FT                   C-terminal domain, score 6.8e-26"
FT                   /inference="protein motif:HMMPfam:PF00271"
FT   misc_feature    269521..269742
FT                   /gene="recQ"
FT                   /locus_tag="BCAL0228"
FT                   /note="HMMPfam hit to PF00570, HRDC domain, score 1.6e-20"
FT                   /inference="protein motif:HMMPfam:PF00570"
FT   CDS_pept        269972..270352
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="BCAL0229"
FT                   /product="30S ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0229"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50540"
FT                   /db_xref="GOA:B4E5B5"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E5B5"
FT                   /protein_id="CAR50540.1"
FT                   /translation="MPTINQLVRKGRQSETTKSKSPALQDCPQRRGVCTRVYTTTPKKP
FT                   NSALRKVAKVRLTNGFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHMVRGSLDT
FT                   QGVKDRKQARSKYGAKRAKAAK"
FT   misc_feature    269975..270340
FT                   /gene="rpsL"
FT                   /locus_tag="BCAL0229"
FT                   /note="HMMPfam hit to PF00164, Ribosomal protein S12, score
FT                   2.8e-76"
FT                   /inference="protein motif:HMMPfam:PF00164"
FT   misc_feature    270098..270121
FT                   /note="PS00055 Ribosomal protein S12 signature."
FT                   /inference="protein motif:Prosite:PS00055"
FT   CDS_pept        270525..270995
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="BCAL0230"
FT                   /product="30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0230"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50541"
FT                   /db_xref="GOA:B4E5B6"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E5B6"
FT                   /protein_id="CAR50541.1"
FT                   /translation="MPRRREVPKREVLPDPKFGNVDVAKFMNMLMLSGKKSVAERIVYG
FT                   AFEQIQTKGGKDPLEVFTVALNNVKPVVEVKSRRVGGANYQVPVEVRPSRRMALAMRWL
FT                   REAAKKRSEKSMALRLAGELSEAAEGRGGAMKKRDEVHRMAEANRAFSHFRF"
FT   misc_feature    270528..270971
FT                   /gene="rpsG"
FT                   /locus_tag="BCAL0230"
FT                   /note="HMMPfam hit to PF00177, Ribosomal protein S7p/S5e,
FT                   score 5.6e-82"
FT                   /inference="protein motif:HMMPfam:PF00177"
FT   misc_feature    270582..270662
FT                   /note="PS00052 Ribosomal protein S7 signature."
FT                   /inference="protein motif:Prosite:PS00052"
FT   CDS_pept        271119..273221
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="BCAL0231"
FT                   /product="elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0231"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50542"
FT                   /db_xref="GOA:B4E5B7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:B4E5B7"
FT                   /protein_id="CAR50542.1"
FT                   /translation="MARKTPIERYRNIGISAHIDAGKTTTTERILFYTGVNHKIGEVHD
FT                   GAATMDWMEQEQERGITITSAATTAFWKGMGGNYPEHRINIIDTPGHVDFTIEVERSMR
FT                   VLDGACMVYCAVGGVQPQSETVWRQANKYKVPRLAFVNKMDRTGANFFKVYDQLRLRLK
FT                   ANPVPVVVPIGAEENFKGVVDLIKMKAIIWDEASQGTKFDYVDIPAELAETCKEWREKM
FT                   VEVAAEASEDLMNKYLEEGDLPEADIVKALRDRTIACEIQPMLCGTAFKNKGVQRMLDA
FT                   VIDFLPSPVDIPPVKGELENGEEAERKASDEEKFSSLAFKIMTDPFVGQLIFFRVYSGV
FT                   VNSGDTLLNSTKGKKERLGRILQMHANQREEIKEVRAGDIAAAVGLKEATTGDTLCDPA
FT                   NPIVLERMVFPEPVISQAVEPKTKADQEKMGLALNRLAQEDPSFRVQTDEESGQTIISG
FT                   MGELHLEILVDRMKREFGVEATVGKPQVAYRETIRSTAKDVDGKFVKQSGGRGQYGHAV
FT                   ITLEPNEQGKGYEFFDEIKGGVIPREYIPAVDKGIQDTLKSGVLAGFPVVDVKVHLTFG
FT                   SYHDVDSNENAFRMAGSMAFKEAMRKANPVVLEPMMAVEVETPEDYMGNVMGDLSGRRG
FT                   IVQGMEDMVGGGKIVRAEVPLSEMFGYSTSLRSLTQGRATYTMEFKHYAEAPRNVAEAI
FT                   ISAKSK"
FT   misc_feature    271140..271988
FT                   /gene="fusA"
FT                   /locus_tag="BCAL0231"
FT                   /note="HMMPfam hit to PF00009, Elongation factor Tu GTP
FT                   binding domain, score 1.2e-110"
FT                   /inference="protein motif:HMMPfam:PF00009"
FT   misc_feature    271167..271190
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    271269..271316
FT                   /note="PS00301 GTP-binding elongation factors signature."
FT                   /inference="protein motif:Prosite:PS00301"
FT   misc_feature    272103..272306
FT                   /gene="fusA"
FT                   /locus_tag="BCAL0231"
FT                   /note="HMMPfam hit to PF03144, Elongation factor Tu domain,
FT                   score 3.2e-21"
FT                   /inference="protein motif:HMMPfam:PF03144"
FT   misc_feature    272568..272930
FT                   /gene="fusA"
FT                   /locus_tag="BCAL0231"
FT                   /note="HMMPfam hit to PF03764, Elongation factor G, domain
FT                   IV, score 3e-70"
FT                   /inference="protein motif:HMMPfam:PF03764"
FT   misc_feature    272934..273200
FT                   /gene="fusA"
FT                   /locus_tag="BCAL0231"
FT                   /note="HMMPfam hit to PF00679, Elongation factor G
FT                   C-terminus, score 1.2e-50"
FT                   /inference="protein motif:HMMPfam:PF00679"
FT   CDS_pept        273264..274454
FT                   /transl_table=11
FT                   /gene="tuf"
FT                   /locus_tag="BCAL0232"
FT                   /product="elongation factor Tu (EF-Tu)"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0232"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50543"
FT                   /db_xref="GOA:B4E5A5"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:B4E5A5"
FT                   /protein_id="CAR50543.1"
FT                   /translation="MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLTKKFGGEAK
FT                   AYDQIDAAPEEKARGITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCSAADGPMPQTREHILLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYDF
FT                   PGDDTPIVKGSAKLALEGDTGELGEVAIMSLADALDTYIPTPERAVDGAFLMPVEDVFS
FT                   ISGRGTVVTGRVERGIVKVGEEIEIVGIKPTVKTTCTGVEMFRKLLDQGQAGDNVGILL
FT                   RGTKREDVERGQVLAKPGSITPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDV
FT                   TGSIELPKDKEMVMPGDNVSITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIE"
FT   misc_feature    273291..273881
FT                   /gene="tuf"
FT                   /locus_tag="BCAL0232"
FT                   /note="HMMPfam hit to PF00009, Elongation factor Tu GTP
FT                   binding domain, score 7e-102"
FT                   /inference="protein motif:HMMPfam:PF00009"
FT   misc_feature    273318..273341
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    273414..273461
FT                   /note="PS00301 GTP-binding elongation factors signature."
FT                   /inference="protein motif:Prosite:PS00301"
FT   misc_feature    273942..274151
FT                   /gene="tuf"
FT                   /locus_tag="BCAL0232"
FT                   /note="HMMPfam hit to PF03144, Elongation factor Tu domain,
FT                   score 7.5e-26"
FT                   /inference="protein motif:HMMPfam:PF03144"
FT   misc_feature    274164..274448
FT                   /gene="tuf"
FT                   /locus_tag="BCAL0232"
FT                   /note="HMMPfam hit to PF03143, Elongation factor Tu
FT                   C-terminal domain, score 2.5e-62"
FT                   /inference="protein motif:HMMPfam:PF03143"
FT   CDS_pept        274742..275053
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="BCAL0233"
FT                   /product="30s ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0233"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50544"
FT                   /db_xref="GOA:B4E5B9"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E5B9"
FT                   /protein_id="CAR50544.1"
FT                   /translation="MQQQKIRIRLKAFDYRLIDQSAAEIVDTAKRTGAIVRGPVPLPTR
FT                   IQRFDILRSPHVNKTSRDQLEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKLQ"
FT   misc_feature    274754..275041
FT                   /gene="rpsJ"
FT                   /locus_tag="BCAL0233"
FT                   /note="HMMPfam hit to PF00338, Ribosomal protein S10p/S20e,
FT                   score 2.3e-51"
FT                   /inference="protein motif:HMMPfam:PF00338"
FT   misc_feature    274826..274873
FT                   /note="PS00361 Ribosomal protein S10 signature."
FT                   /inference="protein motif:Prosite:PS00361"
FT   CDS_pept        275232..275882
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="BCAL0234"
FT                   /product="50S ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0234"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50545"
FT                   /db_xref="GOA:B4E5C0"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E5C0"
FT                   /protein_id="CAR50545.1"
FT                   /translation="MSLGLVGRKVGMTRIFTAEGDSIPVTVLDVSDNRVTQIKTVETDG
FT                   YTAVQVAFGSRRASRVTKPLAGHLAKAGVEAGEILKEFRIDAAKAAELSNGAVVGADLF
FT                   EVGQKVDVQGVSIGKGYAGTIKRYNFSSGRATHGNSRSHNVPGSIGMAQDPGRVFPGKR
FT                   MTGHMGDVTVTVQNLEIARIDAERKLLLVKGAIPGAKGGKVFVTPAVKTKGAK"
FT   misc_feature    275256..275852
FT                   /gene="rplC"
FT                   /locus_tag="BCAL0234"
FT                   /note="HMMPfam hit to PF00297, Ribosomal protein L3, score
FT                   1.1e-80"
FT                   /inference="protein motif:HMMPfam:PF00297"
FT   misc_feature    275541..275612
FT                   /note="PS00474 Ribosomal protein L3 signature."
FT                   /inference="protein motif:Prosite:PS00474"
FT   CDS_pept        275882..276502
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /gene_synonym="eryA"
FT                   /locus_tag="BCAL0235"
FT                   /product="50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0235"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50546"
FT                   /db_xref="GOA:B4E5C1"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E5C1"
FT                   /protein_id="CAR50546.1"
FT                   /translation="MELKLLNENGQEGAVVNASDVVFGRDYNEALIHQVVIAYQANARQ
FT                   GNRAQKDREQVKHTTKKPWRQKGTGRARAGMSSSPLWRGGGRIFPNSPEENFSHKVNKK
FT                   MHRAGLCSIFSQLAREGRLSVVEDIILEAPKTKLLADKFKTMGLDSVLIITDTVDENLY
FT                   LASRNLPHVAIVEPRYADPLSLIYFKKVLVTKAAVAQIEELLS"
FT   misc_feature    275918..276493
FT                   /gene="rplD"
FT                   /locus_tag="BCAL0235"
FT                   /note="HMMPfam hit to PF00573, Ribosomal protein L4/L1
FT                   family, score 1.9e-46"
FT                   /inference="protein motif:HMMPfam:PF00573"
FT   CDS_pept        276499..276813
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="BCAL0236"
FT                   /product="50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0236"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50547"
FT                   /db_xref="GOA:B4E5C2"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E5C2"
FT                   /protein_id="CAR50547.1"
FT                   /translation="MSEIRKNDHRLMQVLLAPVISEKATLVADKNEQVVFEVAPDATKQ
FT                   EVKAAVELLFKVEVDSVNVLVQKGKQKRFGRSMGRRKDVKKAYVCLKPGQEINFEAEAK
FT                   "
FT   misc_feature    276532..276807
FT                   /gene="rplW"
FT                   /locus_tag="BCAL0236"
FT                   /note="HMMPfam hit to PF00276, Ribosomal protein L23, score
FT                   9.3e-28"
FT                   /inference="protein motif:HMMPfam:PF00276"
FT   CDS_pept        276816..277643
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="BCAL0237"
FT                   /product="50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0237"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50548"
FT                   /db_xref="GOA:B4E5C3"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E5C3"
FT                   /protein_id="CAR50548.1"
FT                   /translation="MAIVKVKPTSPGRRAMVKVVNKNLHQGKPFAALLDSQSSTAGRNN
FT                   NGRITTRHKGGGHKQHYRIVDFRRTKDGIPAKVERLEYDPNRSANIALVLYADGERRYI
FT                   IAPKGLTVGQQLMSGSEAPIRAGNTLPIRNIPVGTTIHCIEMLPGKGAQMARSAGTSAM
FT                   LLAREGVYAQVRLRSGEIRRVHIECRATIGEVGNEEHSLRQIGKAGANRWRGIRPTVRG
FT                   VAMNPVDHPHGGGEGKTAAGRDPVSPWGTPAKGYRTRSNKRTTTMIVQRRHKR"
FT   misc_feature    276939..277169
FT                   /gene="rplB"
FT                   /locus_tag="BCAL0237"
FT                   /note="HMMPfam hit to PF00181, Ribosomal Proteins L2, RNA
FT                   binding dom, score 2.3e-47"
FT                   /inference="protein motif:HMMPfam:PF00181"
FT   misc_feature    277185..277571
FT                   /gene="rplB"
FT                   /locus_tag="BCAL0237"
FT                   /note="HMMPfam hit to PF03947, Ribosomal Proteins L2,
FT                   C-terminal doma, score 8.1e-86"
FT                   /inference="protein motif:HMMPfam:PF03947"
FT   misc_feature    277467..277502
FT                   /note="PS00467 Ribosomal protein L2 signature."
FT                   /inference="protein motif:Prosite:PS00467"
FT   CDS_pept        277654..277929
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="BCAL0238"
FT                   /product="30S ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0238"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50549"
FT                   /db_xref="GOA:B4E5C4"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E5C4"
FT                   /protein_id="CAR50549.1"
FT                   /translation="MARSVKKGPFCDAHLLKKVEAAAASRDKKPIKTWSRRSTILPDFI
FT                   GLTIAVHNGRQHVPVYISENMVGHKLGEFALTRTFKGHAADKKAKK"
FT   misc_feature    277660..277902
FT                   /gene="rpsS"
FT                   /locus_tag="BCAL0238"
FT                   /note="HMMPfam hit to PF00203, Ribosomal protein S19, score
FT                   3.5e-52"
FT                   /inference="protein motif:HMMPfam:PF00203"
FT   misc_feature    277810..277884
FT                   /note="PS00323 Ribosomal protein S19 signature."
FT                   /inference="protein motif:Prosite:PS00323"
FT   CDS_pept        277942..278271
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /gene_synonym="eryB"
FT                   /locus_tag="BCAL0239"
FT                   /product="50S ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0239"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50550"
FT                   /db_xref="GOA:B4E5C5"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E5C5"
FT                   /protein_id="CAR50550.1"
FT                   /translation="MEVKAIHRGARISAQKTRLVADQIRGLPVDKALNVLTFSPKKAAG
FT                   IVKKVVLSAIANAEHNEGADIDELKIKSIYVDKAASLKRFTARAKGRGNRIEKQSCHIT
FT                   VTVGN"
FT   misc_feature    277954..278268
FT                   /gene="rplV"
FT                   /locus_tag="BCAL0239"
FT                   /note="HMMPfam hit to PF00237, Ribosomal protein L22p/L17e,
FT                   score 1.1e-44"
FT                   /inference="protein motif:HMMPfam:PF00237"
FT   misc_feature    278188..278262
FT                   /note="PS00464 Ribosomal protein L22 signature."
FT                   /inference="protein motif:Prosite:PS00464"
FT   CDS_pept        278283..279083
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="BCAL0240"
FT                   /product="30S ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0240"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50551"
FT                   /db_xref="GOA:B4E5C6"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E5C6"
FT                   /protein_id="CAR50551.1"
FT                   /translation="MGQKIHPTGFRLAVSRNWASRWYANNNNFAAMLQEDIGVREYLKK
FT                   KLKNASVGRVVIERPAKNARITIYSSRPGVVIGKKGEDIEQLKTELQRRMGVPVHVNIE
FT                   EIRKPETDAQLIADSITQQLERRIMFRRAMKRAMQNAMRLGAQGIKIMSAGRLNGIEIA
FT                   RTEWYREGRVPLHTLRADIDYATSEAKTTYGIIGVKVWVYKGDTLGRNDAPVVEEVAED
FT                   KRPRRNARPGDRRPRRDGEGGAPGARRGAPRRGAGKPEDGKTGE"
FT   misc_feature    278283..278468
FT                   /gene="rpsC"
FT                   /locus_tag="BCAL0240"
FT                   /note="HMMPfam hit to PF00417, Ribosomal protein S3,
FT                   N-terminal domai, score 1.3e-26"
FT                   /inference="protein motif:HMMPfam:PF00417"
FT   misc_feature    278469..278633
FT                   /gene="rpsC"
FT                   /locus_tag="BCAL0240"
FT                   /note="HMMPfam hit to PF07650, KH domain, score 3.2e-22"
FT                   /inference="protein motif:HMMPfam:PF07650"
FT   misc_feature    278637..278888
FT                   /gene="rpsC"
FT                   /locus_tag="BCAL0240"
FT                   /note="HMMPfam hit to PF00189, Ribosomal protein S3,
FT                   C-terminal domai, score 1.4e-51"
FT                   /inference="protein motif:HMMPfam:PF00189"
FT   misc_feature    278769..278873
FT                   /note="PS00548 Ribosomal protein S3 signature."
FT                   /inference="protein motif:Prosite:PS00548"
FT   misc_feature    279051..279074
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        279086..279502
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="BCAL0241"
FT                   /product="50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0241"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50552"
FT                   /db_xref="GOA:B4E5C7"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E5C7"
FT                   /protein_id="CAR50552.1"
FT                   /translation="MLQPKRRKYRKEQKGRNTGKATRGNAVSFGEFGLKAIGRGRLTAR
FT                   QIEAARRAMTRHIKRGGRIWIRIFPDKPISQKPAEVRMGNGKGNPEYYVAEIQPGKMLY
FT                   EMDGVTEELAREAFRLAAAKLPLKTAFIVRQLGA"
FT   misc_feature    279086..279481
FT                   /gene="rplP"
FT                   /locus_tag="BCAL0241"
FT                   /note="HMMPfam hit to PF00252, Ribosomal protein L16, score
FT                   2.6e-86"
FT                   /inference="protein motif:HMMPfam:PF00252"
FT   misc_feature    279260..279295
FT                   /note="PS00586 Ribosomal protein L16 signature 1."
FT                   /inference="protein motif:Prosite:PS00586"
FT   CDS_pept        279512..279706
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="BCAL0242"
FT                   /product="50S ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0242"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50553"
FT                   /db_xref="GOA:B4E5C8"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E5C8"
FT                   /protein_id="CAR50553.1"
FT                   /translation="MKASELLQKDQAALNKELADLLKAQFGLRMQLATQQLTNTSQLKK
FT                   VRRDIARVRTVMTQKANQK"
FT   misc_feature    279518..279691
FT                   /gene="rpmC"
FT                   /locus_tag="BCAL0242"
FT                   /note="HMMPfam hit to PF00831, Ribosomal L29 protein, score
FT                   3.2e-21"
FT                   /inference="protein motif:HMMPfam:PF00831"
FT   misc_feature    279626..279670
FT                   /note="PS00579 Ribosomal protein L29 signature."
FT                   /inference="protein motif:Prosite:PS00579"
FT   CDS_pept        279703..279975
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /gene_synonym="neaA"
FT                   /locus_tag="BCAL0243"
FT                   /product="30S ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0243"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50554"
FT                   /db_xref="GOA:B4E5C9"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E5C9"
FT                   /protein_id="CAR50554.1"
FT                   /translation="MNDSVKTSLKRTLVGRVVSNKMDKTVTVLIEHRVKHPIYGKYVVR
FT                   SKKYHAHDEANTYNEGDLVEIQETRPVSKTKAWTVSRLVEAARVI"
FT   misc_feature    279745..279951
FT                   /gene="rpsQ"
FT                   /locus_tag="BCAL0243"
FT                   /note="HMMPfam hit to PF00366, Ribosomal protein S17, score
FT                   1.8e-35"
FT                   /inference="protein motif:HMMPfam:PF00366"
FT   misc_feature    279883..279921
FT                   /note="PS00056 Ribosomal protein S17 signature."
FT                   /inference="protein motif:Prosite:PS00056"
FT   CDS_pept        280285..280653
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="BCAL0244"
FT                   /product="50S ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0244"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50555"
FT                   /db_xref="GOA:B4E5D0"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E5D0"
FT                   /protein_id="CAR50555.1"
FT                   /translation="MIQTESRLEVADNTGAREVLCIKVLGGSKRRYAGIGDIIKVSVKE
FT                   ATPRGRVKKGEIYNAVVVRTAKGVRRQDGSLIKFDGNAAVLLNNKLEPIGTRIFGPVTR
FT                   ELRSERFMKIVSLAPEVL"
FT   misc_feature    280285..280650
FT                   /gene="rplN"
FT                   /locus_tag="BCAL0244"
FT                   /note="HMMPfam hit to PF00238, Ribosomal protein L14p/L23e,
FT                   score 6.6e-76"
FT                   /inference="protein motif:HMMPfam:PF00238"
FT   misc_feature    280462..280542
FT                   /note="PS00049 Ribosomal protein L14 signature."
FT                   /inference="protein motif:Prosite:PS00049"
FT   CDS_pept        280663..280971
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="BCAL0245"
FT                   /product="50S ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0245"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50556"
FT                   /db_xref="GOA:B4E5D1"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E5D1"
FT                   /protein_id="CAR50556.1"
FT                   /translation="MNKIRKGDEVIVVTGKDKGKRGVVLAVGAEHVTVEGINLVKKHVK
FT                   PNPMKGTTGGVEAKTMPLHISNVALVDANGKASRVGIKVEEGKKVRFLKTTGAVLSA"
FT   misc_feature    280672..280767
FT                   /gene="rplX"
FT                   /locus_tag="BCAL0245"
FT                   /note="HMMPfam hit to PF00467, KOW motif, score 7.1e-06"
FT                   /inference="protein motif:HMMPfam:PF00467"
FT   misc_feature    280681..280734
FT                   /note="PS01108 Ribosomal protein L24 signature."
FT                   /inference="protein motif:Prosite:PS01108"
FT   CDS_pept        280988..281527
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="BCAL0246"
FT                   /product="50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0246"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50557"
FT                   /db_xref="GOA:B4E5D2"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E5D2"
FT                   /protein_id="CAR50557.1"
FT                   /translation="MARFQEFYKEKVVPGLIEKFGYKSVMEVPRITKITLNMGLGEAIA
FT                   DKKIIENAVGDLTKIAGQKPVVTKARKAIAGFKIRQGYPIGAMVTLRGRAMYEFLDRFV
FT                   TVALPRVRDFRGVSGRAFDGRGNYNIGVKEQIIFPEIDYDKIDALRGLNISITTTAKTD
FT                   DEAKALLASFKFPFRN"
FT   misc_feature    281057..281227
FT                   /gene="rplE"
FT                   /locus_tag="BCAL0246"
FT                   /note="HMMPfam hit to PF00281, Ribosomal protein L5, score
FT                   5.8e-31"
FT                   /inference="protein motif:HMMPfam:PF00281"
FT   misc_feature    281156..281206
FT                   /note="PS00358 Ribosomal protein L5 signature."
FT                   /inference="protein motif:Prosite:PS00358"
FT   misc_feature    281237..281521
FT                   /gene="rplE"
FT                   /locus_tag="BCAL0246"
FT                   /note="HMMPfam hit to PF00673, ribosomal L5P family
FT                   C-terminus, score 5.2e-50"
FT                   /inference="protein motif:HMMPfam:PF00673"
FT   CDS_pept        281535..281840
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="BCAL0247"
FT                   /product="30S ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0247"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50558"
FT                   /db_xref="GOA:B4E5D3"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E5D3"
FT                   /protein_id="CAR50558.1"
FT                   /translation="MAKLALIEREKKRARLVAKFAAKREALKAIVEDQSKSEEERYEAR
FT                   LELQQLPRNANPTRQRNRCAITGRPRGTFRKFGLARNKIREIAFRGEIPGLTKASW"
FT   misc_feature    281670..281834
FT                   /gene="rpsN"
FT                   /locus_tag="BCAL0247"
FT                   /note="HMMPfam hit to PF00253, Ribosomal protein S14p/S29e,
FT                   score 1.4e-20"
FT                   /inference="protein motif:HMMPfam:PF00253"
FT   CDS_pept        281855..282250
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="BCAL0248"
FT                   /product="30S ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0248"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50559"
FT                   /db_xref="GOA:B4E5D4"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E5D4"
FT                   /protein_id="CAR50559.1"
FT                   /translation="MSMSDPIADMLTRIRNAQMVEKVSVAMPSSKVKVAIAQVLKDEGY
FT                   IDDFAVKAEGAKSELNIALKYYAGRPVIERLERVSKPGLRVYRGRNDIPQVMNGLGVAI
FT                   VSTPKGVMTDRKARATGVGGEVICYVA"
FT   misc_feature    281867..282247
FT                   /gene="rpsH"
FT                   /locus_tag="BCAL0248"
FT                   /note="HMMPfam hit to PF00410, Ribosomal protein S8, score
FT                   2.2e-64"
FT                   /inference="protein motif:HMMPfam:PF00410"
FT   misc_feature    282155..282208
FT                   /note="PS00053 Ribosomal protein S8 signature."
FT                   /inference="protein motif:Prosite:PS00053"
FT   misc_feature    282236..282247
FT                   /note="PS00294 Prenyl group binding site (CAAX box)."
FT                   /inference="protein motif:Prosite:PS00294"
FT   CDS_pept        282269..282799
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="BCAL0249"
FT                   /product="50S ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0249"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50560"
FT                   /db_xref="GOA:B4E5D5"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E5D5"
FT                   /protein_id="CAR50560.1"
FT                   /translation="MSRVGKSPIALQGAEVKLADGAITVKGPLGTITQAINPLVNVANN
FT                   DGTLNLSPVDESREANALSGTMRAIIANAVHGVTKGFERKLTLVGVGYRAQAQGDKLNL
FT                   SLGFSHPVVHQMPEGVKAETPTQTEIVIKGINKQQVGQVAAEVRGYRPPEPYKGKGVRY
FT                   ADEVVILKETKKK"
FT   misc_feature    282302..282511
FT                   /gene="rplF"
FT                   /locus_tag="BCAL0249"
FT                   /note="HMMPfam hit to PF00347, Ribosomal protein L6, score
FT                   6.7e-13"
FT                   /inference="protein motif:HMMPfam:PF00347"
FT   misc_feature    282533..282760
FT                   /gene="rplF"
FT                   /locus_tag="BCAL0249"
FT                   /note="HMMPfam hit to PF00347, Ribosomal protein L6, score
FT                   7.6e-32"
FT                   /inference="protein motif:HMMPfam:PF00347"
FT   misc_feature    282725..282751
FT                   /note="PS00525 Ribosomal protein L6 signature 1."
FT                   /inference="protein motif:Prosite:PS00525"
FT   CDS_pept        282812..283177
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="BCAL0250"
FT                   /product="50S ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0250"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50561"
FT                   /db_xref="GOA:B4E5D6"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E5D6"
FT                   /protein_id="CAR50561.1"
FT                   /translation="MDKTQSRLRRARQTRIKIAELQVARLAVHRTNTHIYAQVFSPCGT
FT                   KVLASASTLEAEVRAELADKSGKGGNVNAATLIGKRIAEKAKAAGIESVAFDRSGFRYH
FT                   GRVKALAEAAREAGLKF"
FT   misc_feature    282812..283174
FT                   /gene="rplR"
FT                   /locus_tag="BCAL0250"
FT                   /note="HMMPfam hit to PF00861, Ribosomal L18p/L5e family,
FT                   score 3.8e-37"
FT                   /inference="protein motif:HMMPfam:PF00861"
FT   CDS_pept        283192..283710
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="BCAL0251"
FT                   /product="30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0251"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50562"
FT                   /db_xref="GOA:B4E5D7"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E5D7"
FT                   /protein_id="CAR50562.1"
FT                   /translation="MAKMQAKVQADERDDGLREKMISVNRVTKVVKGGRILGFAALTVV
FT                   GDGDGRIGMGKGKAKEVPVAVQKAMEQARRNMFKVPLKNGTLQHEVHGKHGASAVLLAP
FT                   AKAGTGVIAGGPMRAVFDVMGVQNVVAKSHGSTNPYNLVRATLDGLRKQSTPADIAAKR
FT                   GKSVEEILG"
FT   misc_feature    283237..283437
FT                   /gene="rpsE"
FT                   /locus_tag="BCAL0251"
FT                   /note="HMMPfam hit to PF00333, Ribosomal protein S5,
FT                   N-terminal domai, score 3.2e-31"
FT                   /inference="protein motif:HMMPfam:PF00333"
FT   misc_feature    283291..283389
FT                   /note="PS00585 Ribosomal protein S5 signature."
FT                   /inference="protein motif:Prosite:PS00585"
FT   misc_feature    283462..283683
FT                   /gene="rpsE"
FT                   /locus_tag="BCAL0251"
FT                   /note="HMMPfam hit to PF03719, Ribosomal protein S5,
FT                   C-terminal domai, score 3.5e-29"
FT                   /inference="protein motif:HMMPfam:PF03719"
FT   CDS_pept        283726..283908
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="BCAL0252"
FT                   /product="50S ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0252"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50563"
FT                   /db_xref="GOA:B4E5D8"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E5D8"
FT                   /protein_id="CAR50563.1"
FT                   /translation="MSEKTVKVQLVKSLIGTRESHRATVRGLGLRRLNSVSELQDTPAV
FT                   RGMINKVSYLVKVIA"
FT   misc_feature    283735..283893
FT                   /gene="rpmD"
FT                   /locus_tag="BCAL0252"
FT                   /note="HMMPfam hit to PF00327, Ribosomal protein L30p/L7e,
FT                   score 2.1e-13"
FT                   /inference="protein motif:HMMPfam:PF00327"
FT   CDS_pept        283935..284369
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="BCAL0253"
FT                   /product="50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0253"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50564"
FT                   /db_xref="GOA:B4E5D9"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E5D9"
FT                   /protein_id="CAR50564.1"
FT                   /translation="MELNNLKPAAGAKHAKRRVGRGIGSGLGKTAGRGHKGQKSRSGGF
FT                   HKVGFEGGQMPLQRRLPKRGFTSLTKEFVGEVRLGDLEKLPVDEIDLLALKQAGLVGEL
FT                   TKSAKIIATGELKRKIVVKGLGATKGARAAIEAAGGSFAE"
FT   misc_feature    283935..284237
FT                   /gene="rplO"
FT                   /locus_tag="BCAL0253"
FT                   /note="HMMPfam hit to PF01305, Ribosomal protein L15 amino
FT                   terminal re, score 3.2e-47"
FT                   /inference="protein motif:HMMPfam:PF01305"
FT   misc_feature    284259..284354
FT                   /gene="rplO"
FT                   /locus_tag="BCAL0253"
FT                   /note="HMMPfam hit to PF00256, Ribosomal protein L15, score
FT                   8.7e-09"
FT                   /inference="protein motif:HMMPfam:PF00256"
FT   misc_feature    284259..284351
FT                   /note="PS00475 Ribosomal protein L15 signature."
FT                   /inference="protein motif:Prosite:PS00475"
FT   CDS_pept        284412..285761
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="BCAL0254"
FT                   /product="preprotein translocase SecY subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0254"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50565"
FT                   /db_xref="GOA:B4E5E0"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:B4E5E0"
FT                   /protein_id="CAR50565.1"
FT                   /translation="MANSPSLAKPGRSTAKFGDLRRRAMFLLLALIVYRIGAHIPVPGI
FT                   DPDQLAKLFQSQAGGILGMFNMFSGGALSRFTIFALGIMPYISASIIMQLLAIVSPQLE
FT                   ALKKEGQAGQRKITQYTRYFTVVLATFQAFGIAAALENQPGLVTDPGMLFRLTTVVTLV
FT                   TGTMFLMWLGEQITERGLGNGISIIIFGGIAAGFPNAVGGLFELVRTGSMSIISAIIIV
FT                   VLIAAVTYLVVFIERGQRKILVNYAKRQVGNKIYGGQSSHLPLKLNMSGVIPPIFASSI
FT                   ILFPATILGWFSTGQPTGSWISNTLHNVAEALKPGQPVYVLLYTLAIVFFCFFYTALVF
FT                   NSRETADNLKKSGAFVPGIRPGDQTARYIDRILTRLTLAGAIYIVFVCLLPEFLVLRWN
FT                   VPFYFGGTSLLIIVVVTMDFMAQVQSYVMSQQYESLLKKANFKGGNIPMR"
FT   misc_feature    join(284487..284546,284637..284705,284766..284834,
FT                   284862..284930,284949..285017,285045..285113,
FT                   285219..285287,285366..285434,285525..285593,
FT                   285606..285674)
FT                   /gene="secY"
FT                   /locus_tag="BCAL0254"
FT                   /note="10 probable transmembrane helices predicted for
FT                   BCAL0254 by TMHMM2.0 at aa 26-45, 76-98, 119-141, 151-173,
FT                   180-202, 212-234, 270-292, 319-341, 372-394 and 399-421"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    284640..285677
FT                   /gene="secY"
FT                   /locus_tag="BCAL0254"
FT                   /note="HMMPfam hit to PF00344, eubacterial secY protein,
FT                   score 3.2e-173"
FT                   /inference="protein motif:HMMPfam:PF00344"
FT   misc_feature    284640..284699
FT                   /note="PS00755 Protein secY signature 1."
FT                   /inference="protein motif:Prosite:PS00755"
FT   misc_feature    284922..284978
FT                   /note="PS00756 Protein secY signature 2."
FT                   /inference="protein motif:Prosite:PS00756"
FT   CDS_pept        285769..285987
FT                   /transl_table=11
FT                   /gene="infA1"
FT                   /locus_tag="BCAL0255"
FT                   /product="translation initiation factor IF-1 1"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0255"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50566"
FT                   /db_xref="GOA:B4E5E1"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B4E5E1"
FT                   /protein_id="CAR50566.1"
FT                   /translation="MAKDDVIQMQGEVIENLPNATFRVKLENGHVVLGHISGKMRMHYI
FT                   RILPGDKVTVELTPYDLSRARIVFRAK"
FT   misc_feature    285772..285984
FT                   /gene="infA1"
FT                   /locus_tag="BCAL0255"
FT                   /note="HMMPfam hit to PF00575, S1 RNA binding domain, score
FT                   2.4e-08"
FT                   /inference="protein motif:HMMPfam:PF00575"
FT   misc_feature    285781..285978
FT                   /gene="infA1"
FT                   /locus_tag="BCAL0255"
FT                   /note="HMMPfam hit to PF01176, Translation initiation
FT                   factor 1A / IF-1, score 2.7e-36"
FT                   /inference="protein motif:HMMPfam:PF01176"
FT   CDS_pept        286008..286124
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="BCAL0256"
FT                   /product="50S ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0256"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50567"
FT                   /db_xref="GOA:B4E5E2"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E5E2"
FT                   /protein_id="CAR50567.1"
FT                   /translation="MKVMASVKRICRNCKIIKRKGVVRVICSSDPRHKQRQG"
FT   misc_feature    286008..286121
FT                   /gene="rpmJ"
FT                   /locus_tag="BCAL0256"
FT                   /note="HMMPfam hit to PF00444, Ribosomal protein L36, score
FT                   1.2e-15"
FT                   /inference="protein motif:HMMPfam:PF00444"
FT   misc_feature    286038..286118
FT                   /note="PS00828 Ribosomal protein L36 signature."
FT                   /inference="protein motif:Prosite:PS00828"
FT   CDS_pept        286163..286528
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="BCAL0257"
FT                   /product="30S ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0257"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50568"
FT                   /db_xref="GOA:B4E5E3"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E5E3"
FT                   /protein_id="CAR50568.1"
FT                   /translation="MARIAGVNIPNHQHTEIGLTAIFGIGRTRSRSICVAAGVDFSKKV
FT                   KDLTDADLEKLREEVGKFVVEGDLRREVTMNIKRLMDLGCYRGVRHRKGLPMRGQRTRT
FT                   NARTRKGPRRAAQALKK"
FT   misc_feature    286169..286486
FT                   /gene="rpsM"
FT                   /locus_tag="BCAL0257"
FT                   /note="HMMPfam hit to PF00416, Ribosomal protein S13/S18,
FT                   score 1.3e-55"
FT                   /inference="protein motif:HMMPfam:PF00416"
FT   misc_feature    286421..286462
FT                   /note="PS00646 Ribosomal protein S13 signature."
FT                   /inference="protein motif:Prosite:PS00646"
FT   CDS_pept        286557..286958
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="BCAL0258"
FT                   /product="30S ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0258"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50569"
FT                   /db_xref="GOA:B4E5E4"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E5E4"
FT                   /protein_id="CAR50569.1"
FT                   /translation="MAKASNTAAQRVRKKVKKNVAEGVVHVHASFNNTIITITDRQGNA
FT                   LAWATSGGQGFKGSRKSTPFAAQVAAESAGRVAMEYGVKNLEVRIKGPGPGRESAVRAL
FT                   HGLGIKITAISDVTPIPHNGCRPPKRRRI"
FT   misc_feature    286623..286952
FT                   /gene="rpsK"
FT                   /locus_tag="BCAL0258"
FT                   /note="HMMPfam hit to PF00411, Ribosomal protein S11, score
FT                   1.6e-70"
FT                   /inference="protein motif:HMMPfam:PF00411"
FT   misc_feature    286857..286925
FT                   /note="PS00054 Ribosomal protein S11 signature."
FT                   /inference="protein motif:Prosite:PS00054"
FT   CDS_pept        287113..287736
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="BCAL0259"
FT                   /product="30S ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0259"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50570"
FT                   /db_xref="GOA:B4E5E5"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E5E5"
FT                   /protein_id="CAR50570.1"
FT                   /translation="MARYIGPKAKLSRREGTDLFLKSARRSLADKCKLDSKPGQHGRTS
FT                   GARTSDYGTQLREKQKVKRIYGVLERQFRRYFAEADRRKGNTGENLLQLLESRLDNVVY
FT                   RMGFGSTRAEARQLVSHKSITVNGVVANVPSQQVKAGDVVAIREKAKKQARIVEALSLA
FT                   EQGGMPSWVAVDAKKFEGTFKQMPERAEIAGDINESLIVELYSR"
FT   misc_feature    287116..287400
FT                   /gene="rpsD"
FT                   /locus_tag="BCAL0259"
FT                   /note="HMMPfam hit to PF00163, Ribosomal protein S4/S9
FT                   N-terminal domai, score 1.9e-31"
FT                   /inference="protein motif:HMMPfam:PF00163"
FT   misc_feature    287281..287346
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1167.000, SD 3.16 at aa 57-78, sequence
FT                   REKQKVKRIYGVLERQFRRYFA"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    287395..287469
FT                   /note="PS00632 Ribosomal protein S4 signature."
FT                   /inference="protein motif:Prosite:PS00632"
FT   misc_feature    287401..287544
FT                   /gene="rpsD"
FT                   /locus_tag="BCAL0259"
FT                   /note="HMMPfam hit to PF01479, S4 domain, score 3e-20"
FT                   /inference="protein motif:HMMPfam:PF01479"
FT   CDS_pept        287861..288838
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="BCAL0260"
FT                   /product="DNA-directed RNA polymerase alpha chain"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0260"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50571"
FT                   /db_xref="GOA:B4E5E6"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E5E6"
FT                   /protein_id="CAR50571.1"
FT                   /translation="MQTSLLKPKIIAVESLGENHARVVMEPFERGYGHTLGNALRRVLL
FT                   SSMVGYAPTEVTIAGVVHEYSTLDGVQEDVVNLLLNLKGVVFKLHNRDEVTVTLRKEGE
FT                   GVVTAGDIELAHDCEVINPNHVIAHLSKGGKLDVQIKIEKGRGYVPGNVRRYGEDTAKI
FT                   IGRIVLDASFSPVRRVSYAVESARVEQRTDLDKLVMNIETSGVITPEEAIRQSARILVD
FT                   QLSVFAALEGTETAAEAPSRAPQIDPILLRPVDDLELTVRSANCLKAENIYYIGDLIQR
FT                   TENELLKTPNLGRKSLNEIKEVLASRGLTLGMKLENWPPAGLDK"
FT   misc_feature    287912..288547
FT                   /gene="rpoA"
FT                   /locus_tag="BCAL0260"
FT                   /note="HMMPfam hit to PF01193, RNA polymerase Rpb3/Rpb11
FT                   dimerisation, score 2.1e-20"
FT                   /inference="protein motif:HMMPfam:PF01193"
FT   misc_feature    288026..288382
FT                   /gene="rpoA"
FT                   /locus_tag="BCAL0260"
FT                   /note="HMMPfam hit to PF01000, RNA polymerase Rpb3/RpoA
FT                   insert domain, score 3.7e-48"
FT                   /inference="protein motif:HMMPfam:PF01000"
FT   misc_feature    288578..288778
FT                   /gene="rpoA"
FT                   /locus_tag="BCAL0260"
FT                   /note="HMMPfam hit to PF03118, Bacterial RNA polymerase,
FT                   alpha chain C, score 9.3e-28"
FT                   /inference="protein motif:HMMPfam:PF03118"
FT   CDS_pept        288977..289372
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="BCAL0261"
FT                   /product="50S ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0261"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50572"
FT                   /db_xref="GOA:B4E5E7"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E5E7"
FT                   /protein_id="CAR50572.1"
FT                   /translation="MRHRHGLRKLNRTSSHRLAMLRNMSNSLIEHEVIKTTLPKAKELR
FT                   KVVEPLITLGKKPSLANRRLAFNRLRDRDSVAKLFDVLGPRFANRPGGYLRVLKFGFRV
FT                   GDNAPMALVELLDRPEVDETENVQEAE"
FT   misc_feature    289034..289324
FT                   /gene="rplQ"
FT                   /locus_tag="BCAL0261"
FT                   /note="HMMPfam hit to PF01196, Ribosomal protein L17, score
FT                   4.8e-53"
FT                   /inference="protein motif:HMMPfam:PF01196"
FT   misc_feature    289076..289144
FT                   /note="PS01167 Ribosomal protein L17 signature."
FT                   /inference="protein motif:Prosite:PS01167"
FT   CDS_pept        289576..289902
FT                   /transl_table=11
FT                   /gene="cutA"
FT                   /locus_tag="BCAL0262"
FT                   /product="putative divalent-cation tolerance protein CutA"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0262"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50573"
FT                   /db_xref="GOA:B4E5E8"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:B4E5E8"
FT                   /protein_id="CAR50573.1"
FT                   /translation="MIVVLMLTTVPDAATAAALADGALDARLAACVSELGTIKSRYHWQ
FT                   GKVETAEEIQLLFKTSPVRALELERFIVAHHPYETPEIVSWQTTASAAYGQWVTNETQR
FT                   LFHV"
FT   sig_peptide     289576..289635
FT                   /gene="cutA"
FT                   /locus_tag="BCAL0262"
FT                   /note="Signal peptide predicted for BCAL0262 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.881) with cleavage site
FT                   probability 0.825 between residues 20 and 21"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    289582..289884
FT                   /gene="cutA"
FT                   /locus_tag="BCAL0262"
FT                   /note="HMMPfam hit to PF03091, CutA1 divalent ion tolerance
FT                   protein, score 1.1e-19"
FT                   /inference="protein motif:HMMPfam:PF03091"
FT   CDS_pept        289895..291739
FT                   /transl_table=11
FT                   /gene="dsbD"
FT                   /locus_tag="BCAL0263"
FT                   /product="thiol:disulfide interchange protein DsbD"
FT                   /EC_number="1.8.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0263"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50574"
FT                   /db_xref="GOA:B4E5E9"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR022910"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036929"
FT                   /db_xref="UniProtKB/TrEMBL:B4E5E9"
FT                   /protein_id="CAR50574.1"
FT                   /translation="MFNGMALSVRVRALRFVAVLLSFVFVLGGLSVARAADDFLDPSVA
FT                   FKFSASESPGQVDVRFKIANGYYMYRERFAFAVKSGQATLGEPQFPAGHVKFDQTFQKD
FT                   VETYRDEVVVHVPVKQAAGPFELAVTSQGCADEGICYPPAEHVMKVDGAALGAASSSGD
FT                   TAAAGSWFDKVTSADFAQSLLEGHGFFTIVALYFVAGVVLSLLPCSYPMIPIVSAIIIG
FT                   QGTRATHARGFALSLTYVVGMALVYTVLGIAAALVGQSLGAWLQNPWVLGAFGVLLTAF
FT                   AVSLISGKDIALPERWQNGAAEASSARQGGHFVAVAAMGALSALVVGACMTAPLFAVLA
FT                   FIAHTGNALLGGAALFAMGLGLGVPLLVVGVGAGTVLPRAGAWMDGVKVFFGIVLLAAA
FT                   LWIVWPVLAGGLKMVLAALWLLIAAAALGLFTPNAGAASIWRRLGRGVGAALAIWAATL
FT                   LVGLAAGSTDPVKPLAVLAARTVASGGAATAGAAAADGPAFAPVRSSGELDALLKTSGR
FT                   PVMLDFYADWCVSCKEMEHLTFTDARVQARLARLHLVRADVTANNPDDQALLKRFNLFG
FT                   PPGIIFFDRNGNEIGRVVGYQAADTFLRSLDRAAVPTV"
FT   sig_peptide     289895..289999
FT                   /gene="dsbD"
FT                   /locus_tag="BCAL0263"
FT                   /note="Signal peptide predicted for BCAL0263 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.992) with cleavage site
FT                   probability 0.466 between residues 35 and 36"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(289931..289999,290459..290527,290588..290656,
FT                   290699..290758,290858..290926,290954..291022,
FT                   291059..291127,291137..291205,291224..291292)
FT                   /gene="dsbD"
FT                   /locus_tag="BCAL0263"
FT                   /note="9 probable transmembrane helices predicted for
FT                   BCAL0263 by TMHMM2.0 at aa 13-35, 189-211, 232-254,
FT                   269-288, 322-344, 354-376, 389-411, 415-437 and 444-466"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    290480..291106
FT                   /gene="dsbD"
FT                   /locus_tag="BCAL0263"
FT                   /note="HMMPfam hit to PF02683, Cytochrome C biogenesis
FT                   protein transmemb, score 2.8e-06"
FT                   /inference="protein motif:HMMPfam:PF02683"
FT   misc_feature    290852..290884
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    291389..291721
FT                   /gene="dsbD"
FT                   /locus_tag="BCAL0263"
FT                   /note="HMMPfam hit to PF00085, Thioredoxin, score 0.00091"
FT                   /inference="protein motif:HMMPfam:PF00085"
FT   misc_feature    291452..291508
FT                   /note="PS00194 Thioredoxin family active site."
FT                   /inference="protein motif:Prosite:PS00194"
FT   CDS_pept        complement(291869..292867)
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="BCAL0264"
FT                   /product="delta-aminolevulinic acid dehydratase"
FT                   /EC_number="4.2.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0264"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50575"
FT                   /db_xref="GOA:B4E5Y8"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:B4E5Y8"
FT                   /protein_id="CAR50575.1"
FT                   /translation="MSFHPLHRPRRMRRDDFSRRLMRENRLTTDDLIYPVFVVEGTQQR
FT                   QPIPSMPGVERVSVDLLMQVAEQCVELGVPVLSLFPAIEPSLKTPDGREAANPEGLIPR
FT                   AVRELKKRFPELGVLTDVALDPYTSHGQDGVLDENGYVINDDTIEILIEQARAQAEAGV
FT                   DIVAPSDMMDGRIGAIREMLESDGHIHTRIMAYSAKFASAFYGPFRDAVGSASNLGKGN
FT                   KMTYQMDPANSDEALREVRLDIDEGADMVMVKPGMPYLDIVRRVKDEFRFPTYVYQVSG
FT                   EYAMLKAAAMNGWLDHDKVVLESLLAFKRAGADGVLTYFALDAARLLKAQR"
FT   misc_feature    complement(291884..292858)
FT                   /gene="hemB"
FT                   /locus_tag="BCAL0264"
FT                   /note="HMMPfam hit to PF00490, Delta-aminolevulinic acid
FT                   dehydratase, score 1e-200"
FT                   /inference="protein motif:HMMPfam:PF00490"
FT   misc_feature    complement(292091..292129)
FT                   /note="PS00169 Delta-aminolevulinic acid dehydratase active
FT                   site."
FT                   /inference="protein motif:Prosite:PS00169"
FT   CDS_pept        complement(293120..293779)
FT                   /transl_table=11
FT                   /gene="engB"
FT                   /locus_tag="BCAL0265"
FT                   /product="putative GTP-binding cell division protein EngB"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0265"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50576"
FT                   /db_xref="GOA:B4E5Y9"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E5Y9"
FT                   /protein_id="CAR50576.1"
FT                   /translation="MAFLLHQARFYTTVNHLRDLPPTVQPEIAFAGRSNAGKSTAINVL
FT                   CNQKRLAFASKTPGRTQHINYFSVGPAAEPVANLVDLPGYGYAEVPGAAKAHWEMLLSS
FT                   YLATRSQLCGLILMMDSRRPLTDLDRRMIEWFAPTGKPIHTLLTKCDKLTRQESINALR
FT                   NTQKGLDAYRDQGVKGKLTVQLFSALKRTGLDEAHELIESWLRPSVADEKSEPVAQ"
FT   misc_feature    complement(293327..293704)
FT                   /gene="engB"
FT                   /locus_tag="BCAL0265"
FT                   /note="HMMPfam hit to PF01926, GTPase of unknown function,
FT                   score 1e-27"
FT                   /inference="protein motif:HMMPfam:PF01926"
FT   misc_feature    complement(293663..293686)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        293994..294647
FT                   /transl_table=11
FT                   /locus_tag="BCAL0266"
FT                   /product="putative cytochrome c4"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0266"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50577"
FT                   /db_xref="GOA:B4E5Z0"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B4E5Z0"
FT                   /protein_id="CAR50577.1"
FT                   /translation="MNRLCKSLMVLQVAAGFVGFVAEANAADAAKPDLDRGKAIAGQVC
FT                   ASCHGADGNSASGSFPKLAGQHPEYLVKQLNDFKTQPGAKGPVRNNAVMVGFASALSAD
FT                   DMRNVAAYYGSQTTKLGTARNAATVPVGQKIYRGGIAEKGVPACASCHGPTGQGIPVQY
FT                   PRLSGQWADYTVAQLTAFQQGAGARNNNEAMHQIASRLSDTEIKAVADYIAGLR"
FT   sig_peptide     293994..294071
FT                   /locus_tag="BCAL0266"
FT                   /note="Signal peptide predicted for BCAL0266 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.893 between residues 26 and 27"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    294093..294344
FT                   /locus_tag="BCAL0266"
FT                   /note="HMMPfam hit to PF00034, Cytochrome c, score 3e-09"
FT                   /inference="protein motif:HMMPfam:PF00034"
FT   misc_feature    294126..294143
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00190"
FT   misc_feature    294414..294644
FT                   /locus_tag="BCAL0266"
FT                   /note="HMMPfam hit to PF00034, Cytochrome c, score 0.0016"
FT                   /inference="protein motif:HMMPfam:PF00034"
FT   misc_feature    294435..294452
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00190"
FT   CDS_pept        294848..297061
FT                   /transl_table=11
FT                   /locus_tag="BCAL0267"
FT                   /product="putative cytochrome c biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0267"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50578"
FT                   /db_xref="GOA:B4E5Z1"
FT                   /db_xref="InterPro:IPR007816"
FT                   /db_xref="UniProtKB/TrEMBL:B4E5Z1"
FT                   /protein_id="CAR50578.1"
FT                   /translation="MSVTTSGLQSKSSQGASKRAVELLSSMRFAIALLVVLSIASIIGT
FT                   VLTQDDPYPNYVNQFGPFWADIFRSLGLYNVYSAWWFMLILIFLVVSISLCVIRNAPKM
FT                   LADAKSWKDKVREGSLRAFHHKAEYTASGTRATVAATLATFVTKAGYKHVVRETDGATL
FT                   ISAKRGAMTKWGYISAHLAIVVICIGGLLDSNLPIKFQMWMFGKSPVNTSATISEISPD
FT                   HRLSASNPTFRGYAWVPEGQFVSTAILNQPSGSLIQDLPFSIQLDKFIVDYYTTGMPKL
FT                   FASDIVVIDRETGRKIPARVEVNKPFTYKGVSIYQSSFQDGGSQMQMTAYPMTGSHAAT
FT                   VPVKGTIGSSAPLQVPGADGDTIEFSDFRAINVENMADANGKPDVRGVATTSSLKEVFD
FT                   ERLGSGAKTSKPTQLHNIGPSVQYKIRGKDGQAREFNNYMLPVDMNGERVFLAGVRASP
FT                   NDPFRYMRIPADSQDSIGEWMRLRAALEDPAVRTEAAARFAQRSLPGDASLRGRLQDSA
FT                   SKVLTLFAASDDSVGRGADGQPVGGFQAVATFIDRSVPKGEQEKAASLLLRMLEGSMWE
FT                   VWQIARERAGEPAAQQGTDTIRFVQNAINALSDSFLYGSPVYLQLDSFKQVQASVFQLT
FT                   RAPGKNLVYLGSLLLVVGIFSMFYVRERRLWFWLKDAGSGVDVVMAMSTARKTFDFEKE
FT                   FVQTRDAAGAALRAAPRDAAPAGAASTARPPVGGGSDSENSTR"
FT   misc_feature    294926..296938
FT                   /locus_tag="BCAL0267"
FT                   /note="HMMPfam hit to PF05140, ResB-like family, score
FT                   3.3e-123"
FT                   /inference="protein motif:HMMPfam:PF05140"
FT   sig_peptide     294926..294991
FT                   /locus_tag="BCAL0267"
FT                   /note="Signal peptide predicted for BCAL0267 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.984 between residues 22 and 23"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(294938..294991,295073..295141,295367..295435,
FT                   296771..296827)
FT                   /locus_tag="BCAL0267"
FT                   /note="4 probable transmembrane helices predicted for
FT                   BCAL0267 by TMHMM2.0 at aa 5-22, 50-72, 148-170 and
FT                   616-634"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        297066..298256
FT                   /transl_table=11
FT                   /locus_tag="BCAL0268"
FT                   /product="putative cytochrome c biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0268"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50579"
FT                   /db_xref="GOA:B4E5Z2"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR017562"
FT                   /db_xref="UniProtKB/TrEMBL:B4E5Z2"
FT                   /protein_id="CAR50579.1"
FT                   /translation="MDLTQVSSSRTASAPAPASSPLFDERPFLARLSLFDWLFALALVA
FT                   GAGYALVHYNAHMDYYDKAVMIGTVPALVALGWRWKPARLMMASISVLSLLSIQIYQGD
FT                   LARADSAFFLKYFLSSQSAILWMSAMFVLATIFYWIGLLARAETGAAIGQKLTWVAVLM
FT                   GFTGLMVRWYESYLIGADVGHIPVSNLYEVFVLFSLITALLYLYYEGHYGTRSLGAFVL
FT                   LVISAAVGFLMWYSVARDAQQIQPLVPALQSWWMKIHVPANFIGYGSFALSAMVSVAYL
FT                   MKERGILADRLPTLEVLDDVMYKSIAVGFAFFTIATILGALWAAEAWGGYWSWDPKETW
FT                   ALIVWLNYAAWLHMRLMKGLRGAVAAWWALTGLLVTTFAFLGVNMFLSGLHSYGKL"
FT   misc_feature    join(297165..297233,297318..297371,297429..297497,
FT                   297531..297590,297633..297692,297711..297779,
FT                   297837..297905,297966..298034,298077..298136,
FT                   298155..298223)
FT                   /locus_tag="BCAL0268"
FT                   /note="10 probable transmembrane helices predicted for
FT                   BCAL0268 by TMHMM2.0 at aa 34-56, 85-102, 122-144, 156-175,
FT                   190-209, 216-238, 258-280, 301-323, 338-357 and 364-386"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    297624..298238
FT                   /locus_tag="BCAL0268"
FT                   /note="HMMPfam hit to PF01578, Cytochrome C assembly
FT                   protein, score 1.2e-55"
FT                   /inference="protein motif:HMMPfam:PF01578"
FT   CDS_pept        298415..299410
FT                   /transl_table=11
FT                   /locus_tag="BCAL0269"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0269"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50580"
FT                   /db_xref="GOA:B4E5Z3"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR022867"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:B4E5Z3"
FT                   /protein_id="CAR50580.1"
FT                   /translation="MWIKRPLRNVLTGADIAPSEITPRAVFENRRRVLQAAGLAAAGGL
FT                   FGTSGAALAAYASPDARAAKLAAKTNPTFVAIDKVTPFKDITSYNNFYEFGTDKSDPAQ
FT                   NAGTLRPRPWRVSVEGKVQHPKVFDLDELLKLAPLEERVYRLRCVEGWSMVIPWIGVPL
FT                   SELIKRVQPTGNAKYVQFVTLADPSQMPGLSTPVLDWPYSEGLRMDEAMNPLTLLTMGV
FT                   YGQVLPNQNGAPVRIVVPWKYGFKSAKSLVKIRFVDKQPKTSWNTYAANEYGFYSNVNP
FT                   NVDHPRWSQATERRIGEDGFFTPKRKTLMFNGYGDLVASMYQGMDLKKNF"
FT   sig_peptide     298415..298576
FT                   /locus_tag="BCAL0269"
FT                   /note="Signal peptide predicted for BCAL0269 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.944) with cleavage site
FT                   probability 0.804 between residues 54 and 55"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    298514..298582
FT                   /locus_tag="BCAL0269"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAL0269 by TMHMM2.0 at aa 34-56"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    298691..299215
FT                   /locus_tag="BCAL0269"
FT                   /note="HMMPfam hit to PF00174, Oxidoreductase molybdopterin
FT                   binding d, score 8.4e-68"
FT                   /inference="protein motif:HMMPfam:PF00174"
FT   CDS_pept        299431..300117
FT                   /transl_table=11
FT                   /locus_tag="BCAL0270"
FT                   /product="ferric reductase-like transmembrane component"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0270"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50581"
FT                   /db_xref="GOA:B4E5Z4"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR022837"
FT                   /db_xref="UniProtKB/TrEMBL:B4E5Z4"
FT                   /protein_id="CAR50581.1"
FT                   /translation="MHPSTLTPARAAGAGQAARTARAGANRPAAPRWLAPAKVLVFAAG
FT                   LYPLARIVLFGLTDRLGANPIEFITRSTGLWTLVLLCITLAVTPLRRITGFAPLLRFRR
FT                   MIGLFAFFYATLHFTTYLWFDKWFDVVAILKDVGKRPFITVGFAAFVLLIPLAATSPRA
FT                   MVRRLGRHWATLHSAIYAIALFGVLHFWWMRAGKHDLAQPKLYAAIVAALLGWRLVTWG
FT                   WRRVRA"
FT   misc_feature    join(299527..299595,299632..299700,299743..299802,
FT                   299839..299907,299950..300009,300043..300099)
FT                   /locus_tag="BCAL0270"
FT                   /note="6 probable transmembrane helices predicted for
FT                   BCAL0270 by TMHMM2.0 at aa 33-55, 68-90, 105-124, 137-159,
FT                   174-193 and 205-223"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    299593..299991
FT                   /locus_tag="BCAL0270"
FT                   /note="HMMPfam hit to PF01794, Ferric reductase like
FT                   transmembrane com, score 5.2e-32"
FT                   /inference="protein motif:HMMPfam:PF01794"
FT   CDS_pept        complement(300200..300475)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0272"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0272"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50582"
FT                   /db_xref="InterPro:IPR032831"
FT                   /db_xref="UniProtKB/TrEMBL:B4E5Z5"
FT                   /protein_id="CAR50582.1"
FT                   /translation="MRVVFRMSAIVAALAILAGCGQSGALYLPTVPPMPKPIQPQNTPP
FT                   SDVKPTDENASSDESPDTSGSPLTLSPELSSTSTMPAPASGPAATK"
FT   misc_feature    complement(300389..300457)
FT                   /locus_tag="BCAL0272"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAL0272 by TMHMM2.0 at aa 7-29"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(300401..300475)
FT                   /locus_tag="BCAL0272"
FT                   /note="Signal peptide predicted for BCAL0272 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.892 between residues 25 and 26"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(300416..300448)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        300512..300838
FT                   /transl_table=11
FT                   /gene="cyaY"
FT                   /locus_tag="BCAL0273"
FT                   /product="protein CyaY"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0273"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50583"
FT                   /db_xref="GOA:B4E5Z6"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="PDB:4JPD"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E5Z6"
FT                   /protein_id="CAR50583.1"
FT                   /translation="MSDTEYLARAEAVLAAVERTVDVANDGDHDIDLERNGSVLTLTFE
FT                   NGSKIIVNLQPPMKEVWIAAKAGGFHYRFIDGEWRDTRTGTEFFSALTDYATQQAGLPI
FT                   TFSA"
FT   misc_feature    300512..300832
FT                   /gene="cyaY"
FT                   /locus_tag="BCAL0273"
FT                   /note="HMMPfam hit to PF01491, Frataxin-like domain, score
FT                   2.7e-35"
FT                   /inference="protein motif:HMMPfam:PF01491"
FT   CDS_pept        complement(300917..303304)
FT                   /transl_table=11
FT                   /gene="mrcA"
FT                   /locus_tag="BCAL0274"
FT                   /product="penicillin-binding protein 1A"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0274"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50584"
FT                   /db_xref="GOA:B4E5Z7"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:B4E5Z7"
FT                   /protein_id="CAR50584.1"
FT                   /translation="MQSTTPTSPPPAPEPKKRPWWQKVLLGFAAMCVALVVAGGLVLGY
FT                   ALVVAWPNMPSLDALTDYRPKVPLRIYTSDHVLIGEFGEERRDVVHFKDVPDSLKKAIL
FT                   AIEDARFYDHGGVDLTGIIRAGFVALTNGHASQGASTITMQVARNFFLSSEKTYTRKIY
FT                   EMLLAYRIERALTKDQILEVYMNQIYLGQRAYGFASAARVYFGKDLKDITLAEAAMLAG
FT                   LPKAPSAYNPVVNPKRAKVRQEYILQRMLELNFITREQYDEAAAQPLVVKGPGRDFSVH
FT                   AEYVAEMVRQMMYAQYREETYTRGFNVVTTIDSADQQVAYTALRKGIMDYERRHGYRGP
FT                   EGFIELPAGADDREQAIDDALLEHPDNGELIAAVVTAASPRQITVAFIDGSTATIEGDN
FT                   LRFASGALSANAQPSRRIRPGAIIRVVKNDAGKWSITQLPQVEGAFLSIVPQDGAIRSL
FT                   VGGFDYNKNKFNHVTQAWRQPGSSFKPFIYSASLDKGLGPATVINDGPLYFSAAETGGQ
FT                   PWEPKNYGGGFEGPMSMRTALQRSRNLVSIRILNHIGTKYAQQYITRFGFDAERHPAYL
FT                   PMALGAGQVTPLQMAGAYSVFANGGYRVNPYLIAEVTDPNGAVVARAQPLVAEQNAPRA
FT                   IDARNAYVMNSLLQSVAQRGTGARTNVLKRTDLAGKTGTTNDSHDAWFAGYQHTLAAIA
FT                   WIGYDNPRSLGDRETGGGLSLPVWIDYMGAALKGVPEFKPTVPEGVESLGGELYFTEFT
FT                   PGHGFVSTVGVPQAPAAQNVDEAVPHVDEQEKQDIMNLFRGH"
FT   misc_feature    complement(301136..301978)
FT                   /gene="mrcA"
FT                   /locus_tag="BCAL0274"
FT                   /note="HMMPfam hit to PF00905, Penicillin binding protein
FT                   transpeptid, score 3.4e-39"
FT                   /inference="protein motif:HMMPfam:PF00905"
FT   misc_feature    complement(302597..303100)
FT                   /gene="mrcA"
FT                   /locus_tag="BCAL0274"
FT                   /note="HMMPfam hit to PF00912, Transglycosylase, score
FT                   1.8e-90"
FT                   /inference="protein motif:HMMPfam:PF00912"
FT   misc_feature    complement(303164..303232)
FT                   /gene="mrcA"
FT                   /locus_tag="BCAL0274"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAL0274 by TMHMM2.0 at aa 25-47"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(303191..303304)
FT                   /gene="mrcA"
FT                   /locus_tag="BCAL0274"
FT                   /note="Signal peptide predicted for BCAL0274 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.775) with cleavage site
FT                   probability 0.414 between residues 38 and 39"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        303531..304454
FT                   /transl_table=11
FT                   /locus_tag="BCAL0275"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0275"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50585"
FT                   /db_xref="UniProtKB/TrEMBL:B4E5Z8"
FT                   /protein_id="CAR50585.1"
FT                   /translation="MAGRWVARFAQGRHRSTGIDVGAHEVRVAVLSRRGRDADVRVEGL
FT                   EREPVGLAGGPEDARWAAVARSLAAAVSRLSAAEVRCDACGVMALHDDEMRTATLDLAG
FT                   RGDIPDAARQAAERISGLAPDSLAFDWRHYGGVRSGEIAVAVAPLALLERRIDVAAQAG
FT                   IDLTVIDGESAAVLRALRYAAQFELDAQGAYAALWFCDAGVCGWRIEGSSAIPVLTLSG
FT                   TLPEALPDALRRRALGAVHCVFVAGDERCIARFDTSVAEIGDVLGTAVVPFDCTGWDGQ
FT                   PCARAGMPGGPAFAVAFGLALRGVWE"
FT   CDS_pept        304451..305095
FT                   /transl_table=11
FT                   /locus_tag="BCAL0276"
FT                   /product="putative type IV pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0276"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50586"
FT                   /db_xref="GOA:B4E5Z9"
FT                   /db_xref="UniProtKB/TrEMBL:B4E5Z9"
FT                   /protein_id="CAR50586.1"
FT                   /translation="MTAAHVSASEGAAAAEQAILGDFNLLPYRERLAQALRRRRVAQCG
FT                   VAMLLGVLGAGLWTGAAVLSRWRVDAERASVETRLRQLQPQVAAATRAVDATAAIARRD
FT                   AQAAALAAPYRRMAGLLATLKQVRADRIRLDALRMTSTGAVLEARAESYRAAARWLAAM
FT                   AREQRDWRIDIETLKPASDAPAPTAGMPFRFSVQLRWHDPMASRTMSGGGA"
FT   misc_feature    304517..305008
FT                   /locus_tag="BCAL0276"
FT                   /note="HMMPfam hit to PF05137, Fimbrial assembly protein
FT                   (PilN), score 0.034"
FT                   /inference="protein motif:HMMPfam:PF05137"
FT   misc_feature    304571..304639
FT                   /locus_tag="BCAL0276"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAL0276 by TMHMM2.0 at aa 43-65"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        305092..305958
FT                   /transl_table=11
FT                   /locus_tag="BCAL0277"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0277"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50587"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:B4E600"
FT                   /protein_id="CAR50587.1"
FT                   /translation="MTTLVHRPALGGGVGPGGMPRVSPAAAHAAGCVLAFAAVLGGGIH
FT                   LANAADWSGLAHSRALLAAAQARAADAQRVLASAGQRRDGHRALMRDDRLPHAPEWAAL
FT                   MLELADLAASSGLSGVSVEPQRADGAAPDGRRTVHIAADGGFRALLHMVGGLARFPVLA
FT                   VPSALRIERGTSAARVDMSVDVFPALPATTTADGNTPVRVAAPDADPFGDARAAEAAGH
FT                   AARFAGTIRDARAGLALFDDGDGAFTAVAPGDVLGAARVVRIDRAAVTLATADGSQRLV
FT                   LDDGGRP"
FT   sig_peptide     305092..305178
FT                   /locus_tag="BCAL0277"
FT                   /note="Signal peptide predicted for BCAL0277 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.649) with cleavage site
FT                   probability 0.449 between residues 29 and 30"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        305955..307580
FT                   /transl_table=11
FT                   /locus_tag="BCAL0278"
FT                   /product="putative type IV pilus secretin"
FT                   /note="C-terminial region is similar to the C-terminus of
FT                   Francisella novicida PilQ UniProt:Q09WI1 (EMBL:DQ230372
FT                   (594 aa) fasta scores: E()=5.8e-35, 32.930% id in 413 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0278"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50588"
FT                   /db_xref="GOA:B4E601"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013355"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:B4E601"
FT                   /protein_id="CAR50588.1"
FT                   /translation="MTKHRCWVLALWAGVTAAGASASLPPLPAVWPAGSTDVSVPGLPL
FT                   RVADGVDSAATEDAGPPPFDQAARAARQTETAAPGPALEGPPIPLAPPARMSDAAARQP
FT                   GDADDARRISLNLQGVGLAAAFDAIARFTGLNIVVGEQVRGTVTLRLNNVRWREAFDTL
FT                   LDMHGLAMSRRGNVIWVTPAAELAARERERFDMHARAADLEPLASRTFMLHYPRAQDVQ
FT                   RLLAGATGQRLLSKRGAAAADPRTNLLFVTDLAPRIVQIAGLIDAIDRPSRQVRIEARI
FT                   VEGEQGFSRNLGARVALRAQGRPPSAEGTSFTADARNALDLAARPLGGFDAATAGFTLF
FT                   AAPLSRVLDIELSALEAQGRGQIVSRPRVVTADRVKAIVEQGSELPYQAKVGNGMSGVQ
FT                   FRRATLKLEVEPQITPDGRVVLDLDVTKDSVGEPTAAGPAIHTKHVQTRVEVENGGTVA
FT                   IGGIYEQLNRNDVTRVPLLGKIPILGALFRHRAQRDQRNELVVFITPTVVDPRCGAPGA
FT                   GDEDAEKTGPEAAGAGSTRQPLCQ"
FT   sig_peptide     305955..306020
FT                   /locus_tag="BCAL0278"
FT                   /note="Signal peptide predicted for BCAL0278 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.824 between residues 22 and 23"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    305973..306041
FT                   /locus_tag="BCAL0278"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAL0278 by TMHMM2.0 at aa 7-29"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    306357..306503
FT                   /locus_tag="BCAL0278"
FT                   /note="HMMPfam hit to PF07660, Secretin and TonB N terminus
FT                   short domain, score 2.7e-12"
FT                   /inference="protein motif:HMMPfam:PF07660"
FT   misc_feature    306576..306776
FT                   /locus_tag="BCAL0278"
FT                   /note="HMMPfam hit to PF03958, Bacterial type II/III
FT                   secretion system sho, score 3.4e-07"
FT                   /inference="protein motif:HMMPfam:PF03958"
FT   misc_feature    306780..307481
FT                   /locus_tag="BCAL0278"
FT                   /note="HMMPfam hit to PF00263, Bacterial type II and III
FT                   secretion system, score 3.6e-64"
FT                   /inference="protein motif:HMMPfam:PF00263"
FT   misc_feature    307314..307415
FT                   /note="PS00875 Bacterial type II secretion system protein D
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00875"
FT   CDS_pept        307621..308175
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="BCAL0279"
FT                   /product="shikimate kinase I"
FT                   /EC_number="2.7.1.71"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0279"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50589"
FT                   /db_xref="GOA:B4E602"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:B4E602"
FT                   /protein_id="CAR50589.1"
FT                   /translation="MQARDPHANVFFVGLMGAGKTTVGRAVARRLDRTFFDSDHEIEAR
FT                   TGARIPVIFELEGEAGFRDRETQVIADLTQRENIVLATGGGAVLRPENRDSLKTNGIVV
FT                   YLRANPHDLWLRTRKDKNRPLLRTDDPKGRLEALYEVRDPLYRECADFVIETGRPSVNG
FT                   LVNMVLMQLELAGVIAKPLQA"
FT   misc_feature    307654..307671
FT                   /note="PS00267 Tachykinin family signature."
FT                   /inference="protein motif:Prosite:PS00267"
FT   misc_feature    307660..307683
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    307666..308139
FT                   /gene="aroK"
FT                   /locus_tag="BCAL0279"
FT                   /note="HMMPfam hit to PF01202, Shikimate kinase, score
FT                   5.5e-77"
FT                   /inference="protein motif:HMMPfam:PF01202"
FT   misc_feature    307807..307884
FT                   /note="PS01128 Shikimate kinase signature."
FT                   /inference="protein motif:Prosite:PS01128"
FT   CDS_pept        308172..309251
FT                   /transl_table=11
FT                   /gene="aroB"
FT                   /locus_tag="BCAL0280"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0280"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50590"
FT                   /db_xref="GOA:B4E603"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E603"
FT                   /protein_id="CAR50590.1"
FT                   /translation="MITVNVDLGDRAYPIHIGAGLIGRTELFAPHIKGSSVTIVTNTTV
FT                   DPLYGDALRAALAPLGKRVSTVVLPDGEAYKNWETLNLIFDGLLTDHADRKTTLVALGG
FT                   GVVGDMTGFAAACYMRGVPFIQVPTTLLSQVDSSVGGKTGINHPLGKNMIGAFYQPQAV
FT                   IADIGALTTLPDRELAAGVAEVIKTGAIADAEFFDWIEANVEALNRREPAALAHAVKRS
FT                   CEIKASVVAADEREGGLRAILNFGHTFGHAIEAGLGYGEWLHGEAVGCGMVMAGDLSVR
FT                   LGLLDEASRQRLDAVIAAAHLPTRAPALGDARYMDLMRVDKKAEAGAIKFILLKRFGDT
FT                   LITQAPDEAVFATLAQTTR"
FT   misc_feature    308220..309146
FT                   /gene="aroB"
FT                   /locus_tag="BCAL0280"
FT                   /note="HMMPfam hit to PF01761, 3-dehydroquinate synthase,
FT                   score 3.6e-175"
FT                   /inference="protein motif:HMMPfam:PF01761"
FT   CDS_pept        309350..310501
FT                   /transl_table=11
FT                   /locus_tag="BCAL0281"
FT                   /product="putative phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0281"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50591"
FT                   /db_xref="GOA:B4E604"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR023023"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/TrEMBL:B4E604"
FT                   /protein_id="CAR50591.1"
FT                   /translation="MAEPPTLAALEAHLAPYAAHASQSRGRRHPETPPAARTEFQRDRD
FT                   RIVHSTAFRRLEYKTQVFVNHEGDLFRTRLTHSLEVAQIARSVARNLRLNEDLVEAISL
FT                   AHDLGHTPFGHAGQDALNACMREHGGFEHNLQSLAVVDELEEHYGAFNGLNLCFETREG
FT                   ILKHCSRENARKLGALGERFLQGRQPSLEAQLANIADEIAYNNHDVDDGLRSGLITIEQ
FT                   LAEVELWQRHYEAALAEFSHLEGRRLVHETVRRIINTLIVDLIDETTRNLARVAPASLD
FT                   DVRAAPPLVSHSPAVAAQAAALKRFLFKNLYRHYKVMRMASKAQRVVTGLFDAFIDDPR
FT                   LLPPPYQSDDAAQQPRLVAHYIAGMTDRFALKEYQRLFVISDN"
FT   misc_feature    309569..309964
FT                   /locus_tag="BCAL0281"
FT                   /note="HMMPfam hit to PF01966, HD domain, score 1.3e-16"
FT                   /inference="protein motif:HMMPfam:PF01966"
FT   CDS_pept        310590..311924
FT                   /transl_table=11
FT                   /locus_tag="BCAL0282"
FT                   /product="putative ABC transporter extracellular
FT                   solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0282"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50592"
FT                   /db_xref="GOA:B4E605"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:B4E605"
FT                   /protein_id="CAR50592.1"
FT                   /translation="MKKKPAGTLVRSIALGGALMFGAQHVALAATEIQFWHAMEAALGE
FT                   RVNAIADQFNASQSDYKIVPVFKGTYDQALAAGIAAYRSGNAPAILQVYEVGTATMMQA
FT                   KKAVVPVYDVFKQAGVTLDEKAFVPTIASYYSDAKTGHLVSMPFNSSTPVLYYNKDAFK
FT                   KAGLDPNQPPKTWADVKADAEKLRKAGMACGFTTGWQGWIQLENYSAWHGLPFASRNNG
FT                   FDGTDAVLEFNKPQQIAHLSFLQQMAKDGTFTYAGRKDEASAKFYSGDCGILTTSSGAL
FT                   ANVQKFAKFSYGTGMMPYDANVKGAPQNAIIGGASLWVLAGKDPATYKGVAKFLAYLAS
FT                   PAVAAKWHQDTGYLPVTTAAYDLTRQQGFYAKNPSAETAIKQMLNKPPLPYTKGLRLGN
FT                   MPQIRTVVDEEFEQVWAQKKAPKDALDSAASRGDELLRRFEKSGG"
FT   sig_peptide     310590..310676
FT                   /locus_tag="BCAL0282"
FT                   /note="Signal peptide predicted for BCAL0282 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.995 between residues 29 and 30"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    310608..310676
FT                   /locus_tag="BCAL0282"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAL0282 by TMHMM2.0 at aa 7-29"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    310617..311624
FT                   /locus_tag="BCAL0282"
FT                   /note="HMMPfam hit to PF01547, Bacterial extracellular
FT                   solute-binding prot, score 7.8e-20"
FT                   /inference="protein motif:HMMPfam:PF01547"
FT   misc_feature    311028..311081
FT                   /note="PS01037 Bacterial extracellular solute-binding
FT                   proteins, family 1 signature."
FT                   /inference="protein motif:Prosite:PS01037"
FT   CDS_pept        312021..312905
FT                   /transl_table=11
FT                   /locus_tag="BCAL0283"
FT                   /product="putative ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0283"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50593"
FT                   /db_xref="GOA:B4E606"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B4E606"
FT                   /protein_id="CAR50593.1"
FT                   /translation="MQSRSRFGTSPVPYLLIAPQLAITAVFFLWPAGVALWQSTQMQDA
FT                   FGTSSEFVGFANFTHLFADPLYLDSFRTTLVFSSLVTVSGLVVSLLLAACADRVIRGAR
FT                   AYRTLLIWPYAVAPTIAAVLWAFLFNPSIGLITYALAKGGIVWNHALNGGQAMFLVVLA
FT                   SVWKQVSYNFLFFYAGLQAIPRSLIEAAAIDGAGPVRRFFNIVLPLLSPTSFFLLVVNL
FT                   VYAFFDTFPVIDAATGGGPAQSTKTLIYKIFAEGFQGLDIGSSGAQSVVLMIIVVGLTV
FT                   IQFRFVERRVQYA"
FT   misc_feature    join(312054..312122,312240..312308,312345..312407,
FT                   312450..312518,312633..312701,312813..312881)
FT                   /locus_tag="BCAL0283"
FT                   /note="6 probable transmembrane helices predicted for
FT                   BCAL0283 by TMHMM2.0 at aa 12-34, 74-96, 109-129, 144-166,
FT                   205-227 and 265-287"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    312219..312899
FT                   /locus_tag="BCAL0283"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 6.3e-13"
FT                   /inference="protein motif:HMMPfam:PF00528"
FT   misc_feature    312273..312305
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    312558..312644
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT                   /inference="protein motif:Prosite:PS00402"
FT   CDS_pept        312902..313747
FT                   /transl_table=11
FT                   /locus_tag="BCAL0284"
FT                   /product="putative ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0284"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50594"
FT                   /db_xref="GOA:B4E607"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR030165"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B4E607"
FT                   /protein_id="CAR50594.1"
FT                   /translation="MIENRKGFDLFCHAVLIAGVVLIVFPVYVAFCAATMNAQEVFTVP
FT                   LSLVPSTHLFENIAYIWGHGSGGTTAPFGRLLVNSFAMALGIAVGKIAVSILSAYAIVY
FT                   FRFPFRNTAFWLIFVTLMLPVEVRIFPTVQVVSTLHLTNTYAGLTMPLIASATATFLFR
FT                   QFFMTLPDELMDAARIDGAGPLRFFWDVVLPLSKTSIAALFVITFIYGWNQYLWPILIT
FT                   TEASLSTAVVGIKTMIASGDAATEWQYVMAATLLAMIPPLVVVLAMQRWFVRGLVDSEK
FT                   "
FT   misc_feature    join(312929..312997,313022..313090,313148..313216,
FT                   313235..313291,313334..313402,313463..313531,
FT                   313544..313603,313640..313708)
FT                   /locus_tag="BCAL0284"
FT                   /note="8 probable transmembrane helices predicted for
FT                   BCAL0284 by TMHMM2.0 at aa 10-32, 41-63, 83-105, 112-130,
FT                   145-167, 188-210, 215-234 and 247-269"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    313118..313735
FT                   /locus_tag="BCAL0284"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 8.9e-23"
FT                   /inference="protein motif:HMMPfam:PF00528"
FT   CDS_pept        313779..314864
FT                   /transl_table=11
FT                   /locus_tag="BCAL0285"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0285"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50595"
FT                   /db_xref="GOA:B4E608"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017922"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:B4E608"
FT                   /protein_id="CAR50595.1"
FT                   /translation="MAALSLKGVRKSYDGKQHVLHGIDVEIADGEFIVLVGPSGCGKST
FT                   LLRMIAGLETVTDGEIAIGDRVVNTLEPKDRDIAMVFQNYALYPHMTVAQNMGYGLKIR
FT                   GIERATIDARVAAAAKILELEPLLARRPRELSGGQRQRVAMGRAIVREPSVFLFDEPLS
FT                   NLDAKLRVQMRLEIQRLHARLATTSVYVTHDQIEAMTLAQRVIVMNRGYAEQIGAPVDV
FT                   YEKPATVFVAGFIGSPAMNLMHGRLSEDGATFTVAGGGPALPVAGAPGIGSEIATGRDW
FT                   VLGVRPEHMTPQPGVAQATLPVDSCELLGADNLAHGRWGNHDVAVRLPHADRPARGTAL
FT                   AAALPAHRLHFFDPETGKRAG"
FT   misc_feature    313866..314411
FT                   /locus_tag="BCAL0285"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   1.1e-57"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    313887..313910
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    314181..314225
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    314625..314834
FT                   /locus_tag="BCAL0285"
FT                   /note="HMMPfam hit to PF08402, TOBE domain, score 5.6e-08"
FT                   /inference="protein motif:HMMPfam:PF08402"
FT   CDS_pept        314891..315661
FT                   /transl_table=11
FT                   /gene="ugpQ"
FT                   /locus_tag="BCAL0286"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /EC_number="3.1.4.46"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0286"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50596"
FT                   /db_xref="GOA:B4E609"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:B4E609"
FT                   /protein_id="CAR50596.1"
FT                   /translation="MTIRTDWPYPRVVAHRGGGTLAPENTLAALDEGARRGHRMVEFDA
FT                   KLSADDVTFLLHDDTVDRTSNGHGAAAGMRYAALAALDAGAWRDARFAGERMPTLEAAA
FT                   ARCIAHGLAANVEIKPCPGRERETGQRVAADAAAYWRDAAVAPLLSSFSFDALRQARAT
FT                   APALPRGMLYEVVPDDWHAQVIDALDCVSLHADHTRLDESLVRAIKAAGLRILVYTVND
FT                   LERARELARWGVDAVCTDRIDLIAPDALDDIDVV"
FT   misc_feature    314933..315622
FT                   /gene="ugpQ"
FT                   /locus_tag="BCAL0286"
FT                   /note="HMMPfam hit to PF03009, Glycerophosphoryl diester
FT                   phosphodiesterase, score 1.6e-57"
FT                   /inference="protein motif:HMMPfam:PF03009"
FT   CDS_pept        complement(315844..316575)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0287"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0287"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50597"
FT                   /db_xref="GOA:B4E610"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:B4E610"
FT                   /protein_id="CAR50597.1"
FT                   /translation="MKRKLAITGAAALAFTFAGGTAHAQSAGDFYVSTGWLHLAPQDSS
FT                   DPLFVYGVGGTPVNQSIPNTGAGISDADTLALATGYFVTDHIATEFIAGIPPKFDITGK
FT                   GQFSKFGTLGRAYQWSPALLLKYYFNDANAKFRPYVGVGATYIWFTGAKITNSTFENGV
FT                   LGGPTSATTSNQWAPVFNAGFTYNFTKHWFAGFSMSYIPVSVTATFTTARRTPVGTLTE
FT                   TSKAHISLNPIVTYLNVGYRF"
FT   misc_feature    complement(315847..316500)
FT                   /locus_tag="BCAL0287"
FT                   /note="HMMPfam hit to PF03922, OmpW family, score 2.8e-14"
FT                   /inference="protein motif:HMMPfam:PF03922"
FT   misc_feature    complement(316495..316563)
FT                   /locus_tag="BCAL0287"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAL0287 by TMHMM2.0 at aa 5-27"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(316504..316575)
FT                   /locus_tag="BCAL0287"
FT                   /note="Signal peptide predicted for BCAL0287 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.992 between residues 24 and 25"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        316769..317482
FT                   /transl_table=11
FT                   /locus_tag="BCAL0288"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0288"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50598"
FT                   /db_xref="GOA:B4E611"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:B4E611"
FT                   /protein_id="CAR50598.1"
FT                   /translation="MARLARLYVPDQPQHVILRRLDQQPAFVDDQDYELFIDCLKAAAR
FT                   DHHLAVHAYVLLPRQVQLLVTPSDEASLPKAMQAVGRRYVAHFNRRYSRRGTLWEGRYR
FT                   ATVIEGERYFLLASRVVEMSPVRSQLVATPEAYRWSSYRHHVGLTVDSLITDHPLYWAL
FT                   GNTPFDRQRAYKELCEQPLDERQADQLQQATLKGWVLGGENYREWAARTANRRVSPLPR
FT                   GRPRKVRENTPPIQQ"
FT   misc_feature    316925..317077
FT                   /locus_tag="BCAL0288"
FT                   /note="HMMPfam hit to PF07605, Protein of unknown function
FT                   (DUF1568), score 1.1e-08"
FT                   /inference="protein motif:HMMPfam:PF07605"
FT   CDS_pept        317651..322474
FT                   /transl_table=11
FT                   /gene="glt1"
FT                   /locus_tag="BCAL0289"
FT                   /product="glutamate synthase large subunit"
FT                   /EC_number="1.4.7.1"
FT                   /note="family C44 cysteine peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0289"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50599"
FT                   /db_xref="GOA:B4E612"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:B4E612"
FT                   /protein_id="CAR50599.1"
FT                   /translation="MARAKPAQPLSAVPSPVGSGLDGNKKTVQRPPGPLYDGVPMNDHQ
FT                   QPLAAVPAAQGLYDPQNEHDACGVGFVAHIKGKKSHEIIQQGLKILENLDHRGAVGADP
FT                   LMGDGAGILIQIPDAFYREEMAKQGVNLPPAGEYGVGMIFLPKENASRLACEQELERTV
FT                   KAEGQVVLGWRDVPVDHAMPISPTVKASEPLIRQIFIGRGKDIMVTDALERKLYVIRKT
FT                   ASHRIQALKLKHGKEYFVPSMSARTVVYKGLLLAGQVGVYYRDLQDERVVSALALVHQR
FT                   FSTNTFPAWELAHPYRMIAHNGEINTVKGNVNWLNARTGAIASHVLADDLPKLWPLIYP
FT                   GQSDTASFDNCLELLVMAGYPLVHAVMMMIPEAWEQHTLMDENRRAFYEYHAAMMEPWD
FT                   GPAAIAFTDGRQIGATLDRNGLRPARYIVTDDDLVIMASEAGTLPIPESKIVKKWRLQP
FT                   GKMFLIDMEHGRIIDDKELKDNLANAKPYKSWIDAVRIKLDEIEPKAEEVAAGRTQGAA
FT                   LLDRQQAFGYTQEDLKFLMAPMAAQGEEAVGSMGNDSPLAVMSNKNKTLYHYFKQLFAQ
FT                   VTNPPIDPIRENMVMSLVSFIGPKPNLLDTNNINPPMRLEVSQPVLDFKDIAKIRAIDQ
FT                   YTGGKFSAYELNICYPVAWGKEGIEARLASLCAEAVDAVKSGYNILIVSDRKTDAEHVA
FT                   IPALLATSAIHTHLVQQGLRTSTGLVVETGSARETHHFALLAGYGAEAVHPYLAMETLA
FT                   KMAEGLPGDLSPEKAVYNFTKAVGKGLQKVMSKMGISTYMSYTGAQIFEALGLSSDLVE
FT                   KYFKGTASKVGGIGLFEVAEEAIRLHRDAFGDNPVLRDMLDAGGEYAYRVRGEDHMWTP
FT                   DSIAKLQHATRSNSYQTYKEYAHLINDQTKRHMTFRGLFEFKVEPTKAIPIDDVEPAKE
FT                   IVKRFATGAMSLGSISTEAHATLAIAMNRIGGKSNTGEGGEDEKRYRNELRGIPIKSGE
FT                   TLKSVIGDEIVSDIALKDGDSLRSKIKQVASGRFGVTAEYLASADQIQIKMAQGAKPGE
FT                   GGQLPGHKVSEYIGKLRYSVPGVGLISPPPHHDIYSIEDLAQLIHDLKNVNPSASISVK
FT                   LVSEVGVGTVAAGVAKAKADHVVIAGHDGGTGASPLSSVKHAGTPWELGLAETQQTLVL
FT                   NRLRGRIRVQADGQMKTGRDVVIGALLGADEFGFATAPLVVEGCIMMRKCHLNTCPVGV
FT                   ATQDPVLRAKFKGQPEHVVNYFFFVAEEVREIMAQLGVAKFDDLIGRADLLDTRKGIEH
FT                   WKAKGLDFSRVFYQPEECEDVAPRHVDVQDHGLERALDHVLIEKAKAAIENGEHVSFIQ
FT                   PVRNVNRTVGAMLSGVIAKKHGHDGLADDAVHIQLKGTAGQSFGAFLAKGVTLDLVGDG
FT                   NDYVGKGLSGGRIIIRPTNDFRGKSEENIICGNTVMYGAIEGEAFFRGVAGERFCVRNS
FT                   GATAVVEGTGDHGCEYMTGGTVVVLGETGRNFAAGMSGGLAYIYDPEGTFAAKCNKSMV
FT                   ALEPVLQQAEQERTVDRALWHAGTTDEALLKGLVERHFQFTGSPRAKSLLENWDAARRQ
FT                   FVKVFPHEYKRALGEIGAKKAAKEVLAA"
FT   misc_feature    317849..318970
FT                   /gene="glt1"
FT                   /locus_tag="BCAL0289"
FT                   /note="HMMPfam hit to PF00310, Glutamine amidotransferases
FT                   class-II, score 4.7e-224"
FT                   /inference="protein motif:HMMPfam:PF00310"
FT   misc_feature    319202..320074
FT                   /gene="glt1"
FT                   /locus_tag="BCAL0289"
FT                   /note="HMMPfam hit to PF04898, Glutamate synthase central
FT                   domain, score 6.7e-175"
FT                   /inference="protein motif:HMMPfam:PF04898"
FT   misc_feature    320249..321442
FT                   /gene="glt1"
FT                   /locus_tag="BCAL0289"
FT                   /note="HMMPfam hit to PF01645, Conserved region in
FT                   glutamate synthas, score 1.6e-232"
FT                   /inference="protein motif:HMMPfam:PF01645"
FT   misc_feature    321671..322264
FT                   /gene="glt1"
FT                   /locus_tag="BCAL0289"
FT                   /note="HMMPfam hit to PF01493, GXGXG motif, score 1.8e-91"
FT                   /inference="protein motif:HMMPfam:PF01493"
FT   CDS_pept        322560..324026
FT                   /transl_table=11
FT                   /gene="glt2"
FT                   /locus_tag="BCAL0290"
FT                   /product="glutamate synthase small subunit"
FT                   /EC_number="1.4.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0290"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50600"
FT                   /db_xref="GOA:B4E613"
FT                   /db_xref="InterPro:IPR006005"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B4E613"
FT                   /protein_id="CAR50600.1"
FT                   /translation="MGKATGFLEFERRHEAYEAPLTRVKHYKEFVAALTDADAKVQGAR
FT                   CMDCGIPFCNNGCPVNNIIPDFNDLVYRQDWQQAIEVLHSTNNFPEFTGRICPAPCEAA
FT                   CTLGINNDPVGIKSIEHAIIDKAWAEGWVKPLPAEHKTGKKVAVVGSGPAGLAAAQQLA
FT                   RAGHDVTVFEKNDRIGGLLRYGIPDFKLEKWLIDRRMRQMEAEGVRFRTSVFIGKEPLP
FT                   ESIGSLAKETISPDTLKEEFDAVVIAGGSETPRDLPVPGRELAGVHFAMDFLPQQNRVN
FT                   AGDKLADQLLAKGKHVIVIGGGDTGSDCVGTSNRHGAKQVTQFELLPQPPEEENKPLVW
FT                   PYWPIKLRTSSSHEEGCERDWAVATKRLEGKNGKVEKLIAVRVEWKDGKMQEVPGSEFE
FT                   MKADLVLLAMGFTQPAAPVLDAFGVAKDARGNARATTEGDRSYYTSVDKVFAAGDMRRG
FT                   QSLVVWAIREGRQCARSVDTYLMGHSELPR"
FT   misc_feature    322992..323939
FT                   /gene="glt2"
FT                   /locus_tag="BCAL0290"
FT                   /note="HMMPfam hit to PF07992, Pyridine
FT                   nucleotide-disulphide oxidoreduc, score 6.9e-25"
FT                   /inference="protein motif:HMMPfam:PF07992"
FT   misc_feature    322992..323309
FT                   /gene="glt2"
FT                   /locus_tag="BCAL0290"
FT                   /note="HMMPfam hit to PF00070, Pyridine
FT                   nucleotide-disulphide oxidoreduc, score 0.002"
FT                   /inference="protein motif:HMMPfam:PF00070"
FT   CDS_pept        324402..325892
FT                   /transl_table=11
FT                   /locus_tag="BCAL0291"
FT                   /product="sodium:amino acid symporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0291"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50601"
FT                   /db_xref="GOA:B4E614"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:B4E614"
FT                   /protein_id="CAR50601.1"
FT                   /translation="MEAFVHGLIDAVNGVLWNYVLIALLLGAGAWFTLRFRMIQLKALF
FT                   LSMKLVGSKGEPGSISSFQAFATGLASRVGTGNIAGVAVALTVGGPGAIFWMWMTALVG
FT                   MSSAFVEATLAQIFKVSHPDGSYRGGPAYYIQTGLRSRGFGVLFSLSLILAFGFVFNAV
FT                   QANAIADAFHTSFGWRRETVGLGLVLLSAPIIFGGIRRIATVAQVIVPLMAIGYLALAV
FT                   YAVATHITLVPGVIALIVKSAFGLEQAAGGLTGYAVSQAIAIGVKRGLFSNEAGMGSAP
FT                   NAAATASTRHPVTQGLIQMLGVFVDTIVICSATAFVILLSGQYELGTGMEGAALTQRAI
FT                   SSHVGDWGGIYMAVAIFFLAFSSVIGNYAYAEGNVEFITKRRGVLPLFRIAVLGMVMFG
FT                   SVGQLPLVWAMADTSMGLMAIINLIAILALGRYAHAAWADYRRQRAAGVADPVFTRNTI
FT                   PELARVLPADVWGEHGPLPQRPPSADAVAEVRVTVRES"
FT   misc_feature    join(324444..324503,324630..324698,324822..324890,
FT                   324951..325010,325053..325121,325299..325367,
FT                   325446..325514,325551..325619,325647..325706)
FT                   /locus_tag="BCAL0291"
FT                   /note="9 probable transmembrane helices predicted for
FT                   BCAL0291 by TMHMM2.0 at aa 15-34, 77-99, 141-163, 184-203,
FT                   218-240, 300-322, 349-371, 384-406 and 416-435"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    324522..325775
FT                   /locus_tag="BCAL0291"
FT                   /note="HMMPfam hit to PF01235, Sodium:alanine symporter
FT                   family, score 6.4e-197"
FT                   /inference="protein motif:HMMPfam:PF01235"
FT   misc_feature    324666..324713
FT                   /note="PS00873 Sodium:alanine symporter family signature."
FT                   /inference="protein motif:Prosite:PS00873"
FT   CDS_pept        325889..326455
FT                   /transl_table=11
FT                   /locus_tag="BCAL0292"
FT                   /product="2',5' RNA ligase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0292"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50602"
FT                   /db_xref="GOA:B4E615"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="InterPro:IPR014051"
FT                   /db_xref="UniProtKB/TrEMBL:B4E615"
FT                   /protein_id="CAR50602.1"
FT                   /translation="MNGDRLRAFVALMPDAASRDALHALPVTRGARRPPPAQLHMTLAF
FT                   IGAIERERCDALAAHLPALAAAHALPPMPVERIAWWPSLPRARLIVAELAVDAACVALN
FT                   AGLAALLCELGVPADRRPFRPHVTLARLPHDAVGQPAHGGAPGRPVDVRVEALTLFESR
FT                   LSHEGVSHRPIVSVPIARADDSVGA"
FT   misc_feature    325916..326161
FT                   /locus_tag="BCAL0292"
FT                   /note="HMMPfam hit to PF02834, 2',5' RNA ligase family,
FT                   score 1.1e-05"
FT                   /inference="protein motif:HMMPfam:PF02834"
FT   misc_feature    326168..326401
FT                   /locus_tag="BCAL0292"
FT                   /note="HMMPfam hit to PF02834, 2',5' RNA ligase family,
FT                   score 0.0057"
FT                   /inference="protein motif:HMMPfam:PF02834"
FT   CDS_pept        complement(326488..327771)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0293"
FT                   /product="putative D-amino acid dehydrogenase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0293"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50603"
FT                   /db_xref="GOA:B4E616"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B4E616"
FT                   /protein_id="CAR50603.1"
FT                   /translation="MHVIVLGAGVIGVTTAWHLREAGCDVTVIEREADVAQATSLGNAG
FT                   VIAPGYVTPWAAPGMPGKILKYLFKPASPLIFRPTLDAAQWRWIARWLRECEFERFRVN
FT                   KQRMQRIAYYSRACLHAFRDRYPFDYGASRGYLQLLRSAFDVEMVQPALKVLRDAGIAF
FT                   RELDAAGCTAIEPGLRWARQAPVGGIYLPDDEAGDCARFTRELRARCEANGVTFRFRTA
FT                   IRALDVAGGEVRGVRIDSLDAGAAARRDALLAADAIVVALGVDSAGLLRPLGIDVPLYP
FT                   VKGYSATLAVVDDEKAPCAALMDESLKTAITRFGPTLRVAGTAELGNRHAALRQQALDT
FT                   LMKVLDDWFPHAADRASARFWVGRRPMTPDGPPLLGASGIDGLWLNVGHGSTGWAMSMG
FT                   SGKVVADLVTGRAPEIDLAGLTLARYDR"
FT   misc_feature    complement(326551..327768)
FT                   /locus_tag="BCAL0293"
FT                   /note="HMMPfam hit to PF01266, FAD dependent
FT                   oxidoreductase, score 6.5e-88"
FT                   /inference="protein motif:HMMPfam:PF01266"
FT   CDS_pept        complement(327797..329059)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0294"
FT                   /product="Major Facilitator Superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0294"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50604"
FT                   /db_xref="GOA:B4E617"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4E617"
FT                   /protein_id="CAR50604.1"
FT                   /translation="MQAFQWFNELSTRERRTLYAGFGGYAVDAFDFMIYSFLIPTLIAT
FT                   WGMTKSEAGMIATSSLISSAIGGWVAGILADRYGRVRMLQWTIATFALFTCLSGFTHSF
FT                   WQLLATRTLQGFGFGGEWSVVTIMMAETIRSPEHRAKAVGTVQSSWSFGWGAAAILYWA
FT                   FFALLPEQIAWRACFWIGIVPALWILYIRRNVSDPDIYTATRRARDEGRVSGHFLEIFS
FT                   PPHLRATLFGSALCTGMLGGYYAITTWLPTYLKTVRHLSVFNTSGYLVVLIVGSFVGYV
FT                   VGAMLSDRLGRRASFILFAVGSFSLGMAYTMLPITDTAMLLLGFPLGIVVQGIFAGVGA
FT                   YLSELYPGAIRGSGQGFCYNLGRGLGSFFPILVGALSQSMSLVKAIGLVAGGGYLLVIV
FT                   AALVLPETRGKSLADDPAIAS"
FT   misc_feature    complement(327803..329014)
FT                   /locus_tag="BCAL0294"
FT                   /note="HMMPfam hit to PF00083, Sugar (and other)
FT                   transporter, score 1.4e-07"
FT                   /inference="protein motif:HMMPfam:PF00083"
FT   misc_feature    complement(join(327848..327916,327926..327994,
FT                   328031..328099,328112..328180,328199..328267,
FT                   328310..328378,328487..328546,328556..328615,
FT                   328835..328903,328931..328999))
FT                   /locus_tag="BCAL0294"
FT                   /note="10 probable transmembrane helices predicted for
FT                   BCAL0294 by TMHMM2.0 at aa 21-43, 53-75, 149-168, 172-191,
FT                   228-250, 265-287, 294-316, 321-343, 356-378 and 382-404"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(327926..328999)
FT                   /locus_tag="BCAL0294"
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 2.4e-43"
FT                   /inference="protein motif:HMMPfam:PF07690"
FT   misc_feature    complement(328160..328213)
FT                   /note="PS00216 Sugar transport proteins signature 1."
FT                   /inference="protein motif:Prosite:PS00216"
FT   CDS_pept        complement(329188..329964)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0295"
FT                   /product="putative dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0295"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50605"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4E618"
FT                   /protein_id="CAR50605.1"
FT                   /translation="MNARAAHVARIALITGAGSGIGAALARRLAAPGVALALHARGADD
FT                   AARARLAAVAQACTAAGAECVTLTGDLAEPGVAATLVDAVATRFGGLDQLVANAGFAAR
FT                   QSFSELSADALASAFAAMPGAFSALAGRARPLLEASIAPRIVAVSSFVAHRYRADAPFA
FT                   ATAAAKAALESLVRTAAAEFAARGITVNAVAPGFTRKDHGPSAGNAAAWAQAEQATPLG
FT                   RIAEPDDVAALIAFLLSDAARQITGQVIHVDGGLTL"
FT   misc_feature    complement(329206..329931)
FT                   /locus_tag="BCAL0295"
FT                   /note="HMMPfam hit to PF01370, NAD dependent
FT                   epimerase/dehydratase family, score 0.0012"
FT                   /inference="protein motif:HMMPfam:PF01370"
FT   misc_feature    complement(329413..329937)
FT                   /locus_tag="BCAL0295"
FT                   /note="HMMPfam hit to PF00106, short chain dehydrogenase,
FT                   score 4.4e-08"
FT                   /inference="protein motif:HMMPfam:PF00106"
FT   sig_peptide     complement(329887..329964)
FT                   /locus_tag="BCAL0295"
FT                   /note="Signal peptide predicted for BCAL0295 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.724) with cleavage site
FT                   probability 0.486 between residues 26 and 27"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(329887..329946)
FT                   /locus_tag="BCAL0295"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAL0295 by TMHMM2.0 at aa 7-26"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(329961..331730)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0296"
FT                   /product="ABC transporter ATP-binding membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0296"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50606"
FT                   /db_xref="GOA:B4E619"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:B4E619"
FT                   /protein_id="CAR50606.1"
FT                   /translation="MTQSIDPVRSASDAPQDERPVSAWSLIKPYWVSSEWKIAWGLLVT
FT                   IIAINLCVVWINVKLNKWNAQFYNALQSKDVHDFPNLLMQFSALAFGFIILAVYGRYLR
FT                   QMLGFRWRQWLTDRFLGQWLGDRAFYRIERDRLADNPDQRITDDLQSFATTTLALSLDL
FT                   LSTVVTLVSFITILWSLAGALTFTLGATPIAIPGYMVWAAALYAVIGSLIIQKVGHPLV
FT                   SINYQQQRVEADFRFGLIRVRENAEQIAFYDGEKTEAGNAQSLFMRIRDNWWRVMKYTK
FT                   RLTFVLSFYGQIAIIFPLVVAAPRYFAGAFSFGVLMQISSAFGTVSDSFSWFINSYSTL
FT                   VEWRATVNRLREFKRVMGTSHLKESLSPATEHGGINLHYIDAAKLSTSSLKLALPNGNA
FT                   LANIGDVTIEPGSRWLVVGKSGSGKSTFMRALAGLWPFGDGAIDAPVGARMMFVPQTSY
FT                   LPIGTLKAALTYPATPDTFSDEACRDALRACRLEDYVERLDETAHWTRVLSPGEQQRLA
FT                   GARVLLHKPDFLFLDEATSALDADNEARLYHLFAERLPKAAIVSIAHRESLAAFHVGTI
FT                   NVERVSSDDKVAA"
FT   misc_feature    complement(330009..330500)
FT                   /locus_tag="BCAL0296"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   3.2e-26"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    complement(330456..330479)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    complement(330810..331694)
FT                   /locus_tag="BCAL0296"
FT                   /note="HMMPfam hit to PF06472, ABC transporter
FT                   transmembrane region, score 1.9e-71"
FT                   /inference="protein motif:HMMPfam:PF06472"
FT   misc_feature    complement(join(330810..330878,331089..331157,
FT                   331185..331244,331422..331490,331557..331625))
FT                   /locus_tag="BCAL0296"
FT                   /note="5 probable transmembrane helices predicted for
FT                   BCAL0296 by TMHMM2.0 at aa 36-58, 81-103, 163-182, 192-214
FT                   and 285-307"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_RNA        332001..332124
FT                   /gene="BCALr0296"
FT                   /note="TPP riboswitch (RF00059) as predicted by Rfam, score
FT                   76.39"
FT   CDS_pept        332350..333486
FT                   /transl_table=11
FT                   /gene="thiO"
FT                   /locus_tag="BCAL0297"
FT                   /product="putative thiamine biosynthesis oxidoreductase
FT                   ThiO"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0297"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50607"
FT                   /db_xref="GOA:B4E620"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR023209"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B4E620"
FT                   /protein_id="CAR50607.1"
FT                   /translation="MNVRDARPDFAVLGGGLVGRLIAWRLAGDGHRVALYERGGPDGEQ
FT                   SAAWIAAAMLAPLAEAASAELLITELGAASLARWPQWLAELPEPVFFQHRGTLVVWHHA
FT                   DRAEAPLFERRVRANAPAELFDGGFVTLAGAQVDAAEPALAGRFARGLMLPREGQLDNR
FT                   QALRALAAGLAERGVALHWHAAVDDANLPAAHVTIDCRGLGAKPALPALRGIRGEVARV
FT                   HAPGIGLTRPVRLLHPRYPLYIAPKQDDLYVIGATEVEGEDMSPVSVRSALELLSAAFS
FT                   VHPAFGEARILELNAQCRPTLPDHRPAVIWDGASTLAVNGLYRHGFMIAPEVAQAAVAC
FT                   AQAALGGTLGDPDAFAAWRATARWPTLLHHRNDAHQPA"
FT   misc_feature    332374..333369
FT                   /gene="thiO"
FT                   /locus_tag="BCAL0297"
FT                   /note="HMMPfam hit to PF01266, FAD dependent
FT                   oxidoreductase, score 1.2e-42"
FT                   /inference="protein motif:HMMPfam:PF01266"
FT   CDS_pept        333519..333716
FT                   /transl_table=11
FT                   /gene="thiS"
FT                   /locus_tag="BCAL0298"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0298"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50608"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:B4E621"
FT                   /protein_id="CAR50608.1"
FT                   /translation="MDIQINQQTLTLPDGATVADALAAYGARPPYAVALNGNFVARTQH
FT                   AARALAAGDRLDVVHPVAGG"
FT   misc_feature    333525..333713
FT                   /gene="thiS"
FT                   /locus_tag="BCAL0298"
FT                   /note="HMMPfam hit to PF02597, ThiS family, score 3.4e-13"
FT                   /inference="protein motif:HMMPfam:PF02597"
FT   CDS_pept        333755..334570
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="BCAL0299"
FT                   /product="thiazole biosynthesis protein ThiG"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0299"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50609"
FT                   /db_xref="GOA:B4E622"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:B4E622"
FT                   /protein_id="CAR50609.1"
FT                   /translation="MTSPTSADTLTLYGETFASRVLLGTSRYPSLQSLSDSIAASRPGM
FT                   VTVALRRQMTGGTAEAGFFDLLKRHAVPLLPNTAGCQTVAEAVTTAHMAREVFGTDWIK
FT                   LELIGDDYTLQPDPVGLIDAAAQLVKDGFKVLPYCTEDLVIGRRLLDVGCEALMPWGAP
FT                   IGTGKGVVNPYGLRVLRERLPDVPLIVDAGLGVPSHACQVMEWGFDGVLLNTAVSQATH
FT                   PEIMARAFAQGVEAGRAAYLAGPMDARETAHASTPVVGMPFWHQDGGGA"
FT   misc_feature    333779..334543
FT                   /gene="thiG"
FT                   /locus_tag="BCAL0299"
FT                   /note="HMMPfam hit to PF05690, Thiazole biosynthesis
FT                   protein ThiG, score 2.2e-159"
FT                   /inference="protein motif:HMMPfam:PF05690"
FT   misc_feature    334511..334543
FT                   /note="PS00133 Zinc carboxypeptidases, zinc-binding region
FT                   2 signature."
FT                   /inference="protein motif:Prosite:PS00133"
FT   CDS_pept        334567..335691
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="BCAL0300"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0300"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50610"
FT                   /db_xref="GOA:B4E623"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:B4E623"
FT                   /protein_id="CAR50610.1"
FT                   /translation="MSARFADAFWPPADELAEAAERIRARLGDWPDGVAPWRLCVAAPD
FT                   VPADGDVLIVSAGDRAAQARASAVSRPASPDAVAIEFDERSAVLHAAGVRYALDAAHPL
FT                   ADDWIAALAAFLDCGFAPVDALVLALAWRDGDETHAADAWPVDAERFPCVAGLPPAPEP
FT                   AFPPCPAQLGLYPVVPSAEWVERVLDGGARTVQLRVKDATPDTLRQEIARAVAAGRRYP
FT                   DARVFINDHWQIAAEEGAYGVHLGQEDLETADLAAIARAGLRLGLSSHGYYEMLRALHE
FT                   RPSYLALGPVYATATKAVAAPPQGLARIARYARFAGARAPLVAIGGVGLDALPAVLATG
FT                   VGSVAVVSAVTGAADYRTALIALQQCFAGQFDNR"
FT   misc_feature    335086..335616
FT                   /gene="thiE"
FT                   /locus_tag="BCAL0300"
FT                   /note="HMMPfam hit to PF02581, Thiamine monophosphate
FT                   synthase/TENI, score 1.2e-65"
FT                   /inference="protein motif:HMMPfam:PF02581"
FT   CDS_pept        335776..336597
FT                   /transl_table=11
FT                   /locus_tag="BCAL0301"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0301"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50611"
FT                   /db_xref="GOA:B4E624"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030296"
FT                   /db_xref="UniProtKB/TrEMBL:B4E624"
FT                   /protein_id="CAR50611.1"
FT                   /translation="MSPTPTETLLELRDVDFGYGDRLVLSNLNLRFGRGQVVAVMGGSG
FT                   CGKTTVLRLIGGLVRARRGQVLFDGADVGAQTRDGLYALRRKMGMLFQFGALFTDMSVF
FT                   ENVAFALREHTDLPEDLIRDLVLMKLNAVGLRGARDLMPSEVSGGMARRIALARAIALD
FT                   PQLIMYDEPFAGLDPISLGITANLIRTLNQALGATSILVTHDVPESFAIADYVYFLANG
FT                   GVLAQGTPDELRASTDPSVRQFIDGAPDGPFKFHYTSPPLAADFGLGGGRA"
FT   misc_feature    335878..336441
FT                   /locus_tag="BCAL0301"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   4.7e-52"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    335881..335913
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    335899..335922
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    336211..336255
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        336594..337361
FT                   /transl_table=11
FT                   /locus_tag="BCAL0302"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0302"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50612"
FT                   /db_xref="GOA:B4E625"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:B4E625"
FT                   /protein_id="CAR50612.1"
FT                   /translation="MISAIGRYVIGGLERAGYGTRLFVRLVLEFFPLLRRPRLVTKQIH
FT                   FLGNYSFVIIAVSGLFVGFVLGLQGYYTLNRYGSEQALGLLVALSLVRELGPVVTALLF
FT                   AGRAGTSLTAEIGLMKAGEQLTALEMMAVDPIKNVIAPRMWAGIIAMPLLAAIFNAVGV
FT                   LGGYFVGVVLIGVDPGAFWSQMQGGVQVWADVGNGVIKSIVFGFAVTFIALYQGYEAKP
FT                   TPEGVSRATTKTVVFASLAVLGLDFLLTALMFS"
FT   misc_feature    336618..337355
FT                   /locus_tag="BCAL0302"
FT                   /note="HMMPfam hit to PF02405, Domain of unknown function
FT                   DUF140, score 3.4e-95"
FT                   /inference="protein motif:HMMPfam:PF02405"
FT   misc_feature    join(336729..336797,336840..336908,337050..337118,
FT                   337176..337235,337296..337355)
FT                   /locus_tag="BCAL0302"
FT                   /note="5 probable transmembrane helices predicted for
FT                   BCAL0302 by TMHMM2.0 at aa 46-68, 83-105, 153-175, 195-214
FT                   and 235-254"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        337386..337946
FT                   /transl_table=11
FT                   /locus_tag="BCAL0303"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0303"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50613"
FT                   /db_xref="GOA:B4E626"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR030970"
FT                   /db_xref="UniProtKB/TrEMBL:B4E626"
FT                   /protein_id="CAR50613.1"
FT                   /translation="MTMKKTALDFWVGLFVVVGFLAVLFLALKVGNMSSLSFQPTYSVR
FT                   MKFDNIGGLKPRAAVKSAGVVVGRVKSIGFDTNTYQALVTIDVDGQYQFPKDSSAKILT
FT                   SGLLGEQYIGLDPGGDTEMLKAGDTITMTQSAIVLENLIGQFLYSKAADAGGAKPAAGA
FT                   SAAPAAPAPVAVPASAVSGSAGQ"
FT   misc_feature    337404..337469
FT                   /locus_tag="BCAL0303"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAL0303 by TMHMM2.0 at aa 7-28"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    337503..337739
FT                   /locus_tag="BCAL0303"
FT                   /note="HMMPfam hit to PF02470, mce related protein, score
FT                   2.2e-27"
FT                   /inference="protein motif:HMMPfam:PF02470"
FT   CDS_pept        337972..338940
FT                   /transl_table=11
FT                   /locus_tag="BCAL0304"
FT                   /product="VacJ-like lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0304"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50614"
FT                   /db_xref="GOA:B4E627"
FT                   /db_xref="InterPro:IPR007428"
FT                   /db_xref="UniProtKB/TrEMBL:B4E627"
FT                   /protein_id="CAR50614.1"
FT                   /translation="MTMHTIRIRHAALAVAAVAALSGCATVQTPTKGDPLEGFNRTMYK
FT                   FNDTVDTYALKPVAKGYQYVVPQPVRDSVTNFFSNIGDVYIAANNIVQLRIADGVGDIM
FT                   RVVINTVFGVGGLFDVATIAKLPKHTADFGITMGRYGMPSGPYLVLPLLGPSTLRDTAG
FT                   LGVDYVGNPLTYVKPDGLSWGLFGVNLVNTRANLLGAGDVLDAAALDKYSFVRNAYLQR
FT                   RQALISNARGEAAVTSNNDALPKYDLPEDGAAPAAAGAAGTAGAAAVGGAAPAGASGAA
FT                   VAAPASGTAESPNPASETNVPAMQVAPPSPGGFRFPSIRLH"
FT   sig_peptide     337972..338052
FT                   /locus_tag="BCAL0304"
FT                   /note="Signal peptide predicted for BCAL0304 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.844 between residues 27 and 28"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    338011..338043
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    338053..338655
FT                   /locus_tag="BCAL0304"
FT                   /note="HMMPfam hit to PF04333, VacJ like lipoprotein, score
FT                   3.2e-91"
FT                   /inference="protein motif:HMMPfam:PF04333"
FT   CDS_pept        339052..339681
FT                   /transl_table=11
FT                   /locus_tag="BCAL0305"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0305"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50615"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="UniProtKB/TrEMBL:B4E628"
FT                   /protein_id="CAR50615.1"
FT                   /translation="MKKLFLIPVFAALFSFGSAAHAQVDQSNPQALIKTATQQVLDEVK
FT                   QQTIKQGDTNRIISIVNKDILPYTDFRRTTQLAMGRNWRTATAEQQQQVQEQFKLLLIR
FT                   TYSGALAQLKPDQQIQYPPFRADPADTDVVVKTVAMNNGQPVQIDYRLYKTANGWKVYD
FT                   LNVLGAWLIQTYQQQFNEKIQQSGVEGLIQFLTQRNQQLAAGKQAS"
FT   sig_peptide     339052..339117
FT                   /locus_tag="BCAL0305"
FT                   /note="Signal peptide predicted for BCAL0305 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.985 between residues 22 and 23"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    339112..339648
FT                   /locus_tag="BCAL0305"
FT                   /note="HMMPfam hit to PF05494, Toluene tolerance, Ttg2,
FT                   score 2.9e-49"
FT                   /inference="protein motif:HMMPfam:PF05494"
FT   CDS_pept        339678..339953
FT                   /transl_table=11
FT                   /locus_tag="BCAL0306"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0306"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50616"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:B4E629"
FT                   /protein_id="CAR50616.1"
FT                   /translation="MSGFEAGSSLTVASAKSALAAGLARIGAGATAVDCAALTQFDSSA
FT                   LAVLLAWQRAAKARGATLDILNLPPKLASLAHAYGVDALIEGTGRH"
FT   sig_peptide     339678..339737
FT                   /locus_tag="BCAL0306"
FT                   /note="Signal peptide predicted for BCAL0306 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.942) with cleavage site
FT                   probability 0.930 between residues 20 and 21"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        340146..341072
FT                   /transl_table=11
FT                   /locus_tag="BCAL0307"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0307"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50617"
FT                   /db_xref="GOA:B4E630"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4E630"
FT                   /protein_id="CAR50617.1"
FT                   /translation="MSAIEIRHVKKRYKSLQALKGVSLSVEEGEFFGLLGPNGAGKTTL
FT                   ISILAGLARADEGSISVRGHDVVQDFRNARRALGVVPQELVFDPFFTVRETLRIQSGYF
FT                   GLRRNDDWIDEVMANLDLTEKADANMRALSGGMKRRVLVAQALVHRPPVIVLDEPTAGV
FT                   DVELRQTLWKFISRLNREGHTIVLTTHYLEEAESLCDRIAMLRRGEVVALDRTDALLRR
FT                   FAGLQLYLRFATGALPAELRGLETDPAARAPGEHLLRLGSYDEVERILAQCRAAGCTFD
FT                   EIEVRKADLEDVFVQVMNGAEVIEGLA"
FT   misc_feature    340230..340769
FT                   /locus_tag="BCAL0307"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   5e-59"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    340251..340274
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    340542..340586
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        341069..341890
FT                   /transl_table=11
FT                   /locus_tag="BCAL0308"
FT                   /product="ABC-2 type transporter, membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0308"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50618"
FT                   /db_xref="GOA:B4E631"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:B4E631"
FT                   /protein_id="CAR50618.1"
FT                   /translation="MNQHSPRELRSLTSEGTARRVPGSGFRTLFYKELLRFWKVSFQTV
FT                   LAPIVTALLYLTIFGHALSGRVEVYPGVEYVSFLVPGLVMMSVLQNAFANSSSSLIQSK
FT                   ITGNLVFMLLPPLSYRDIFGAYVLASVVRGLAVGTGVFVVTIWFIPMHFAAPLFIIAFA
FT                   LLGSAILGTLGLIAGIWAEKFDQLAAFQNFLIMPLTFLSGVFYSTHSLPPVWREVSRLN
FT                   PFFYMIDGFRFGFFGASDINPFASLAIVTGFFVLLALIAMRLLATGYKLRH"
FT   misc_feature    341138..341776
FT                   /locus_tag="BCAL0308"
FT                   /note="HMMPfam hit to PF01061, ABC-2 type transporter,
FT                   score 5.7e-42"
FT                   /inference="protein motif:HMMPfam:PF01061"
FT   misc_feature    join(341186..341254,341282..341350,341447..341515,
FT                   341543..341611,341645..341713,341798..341866)
FT                   /locus_tag="BCAL0308"
FT                   /note="6 probable transmembrane helices predicted for
FT                   BCAL0308 by TMHMM2.0 at aa 20-42, 52-74, 107-129, 139-161,
FT                   173-195 and 224-246"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    341651..341764
FT                   /note="PS00890 ABC-2 type transport system integral
FT                   membrane proteins signature."
FT                   /inference="protein motif:Prosite:PS00890"
FT   CDS_pept        341944..342183
FT                   /transl_table=11
FT                   /locus_tag="BCAL0309"
FT                   /product="BolA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0309"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50619"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:B4E632"
FT                   /protein_id="CAR50619.1"
FT                   /translation="MLPTPEQVKQYIAGGLACTHLEVEGDGQHFFATIVSAAFEGKRPI
FT                   QRHQLVYAALGDRMKQEIHALSMKTLTPAEWQNA"
FT   misc_feature    341950..342171
FT                   /locus_tag="BCAL0309"
FT                   /note="HMMPfam hit to PF01722, BolA-like protein, score
FT                   1.2e-21"
FT                   /inference="protein motif:HMMPfam:PF01722"
FT   CDS_pept        342198..343547
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="BCAL0310"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0310"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50620"
FT                   /db_xref="GOA:B4E633"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:B4E633"
FT                   /protein_id="CAR50620.1"
FT                   /translation="MQVTVNERDAVQSVATAHPAANGESQGQGMDKLAIEGGRRLSGEI
FT                   VVSGAKNAALPILCAGLLTADPVDLDNVPNLKDVRTTLKVLNQMGVKSETDGCRVQLDA
FT                   SRVDNLVAPYELVKTMRASILVLGPLLARFGEAKVSLPGGCAIGARPVDQHIKGLQAMG
FT                   AEISIEHGFIEARAKRLKGARIVTDMITVTGTENLLMAATLADGETVIENAAREPEVSD
FT                   LAHLLVAMGAKIDGIGTDRLVIQGVERLHGARHAVIPDRIEAGTFLCAVAAAGGDVMLT
FT                   GVRPHILDAVIDKLREAGVSIEEGDSWLRVKMDRRPSAVTIRTSEYPAFPTDMQAQFMA
FT                   LNTVATGTAQVVETIFENRFMHVQELNRLGANITIDGNTALVTGVDKLSGANVMATDLR
FT                   ASASLVIAGLRADGETLVDRIYHLDRGYDRMEAKLTAVGANVRRLSGSQA"
FT   misc_feature    342300..343499
FT                   /gene="murA"
FT                   /locus_tag="BCAL0310"
FT                   /note="HMMPfam hit to PF00275, EPSP synthase
FT                   (3-phosphoshikimate 1-car, score 1.8e-144"
FT                   /inference="protein motif:HMMPfam:PF00275"
FT   CDS_pept        343544..344197
FT                   /transl_table=11
FT                   /gene="hisG"
FT                   /locus_tag="BCAL0311"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0311"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50621"
FT                   /db_xref="GOA:B4E634"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR024893"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E634"
FT                   /protein_id="CAR50621.1"
FT                   /translation="MTAPLTLALSKGRIFEETLPLLAAAGVQVAEDPETSRKLILPTTD
FT                   PNLRVIIVRASDVPTYVEYGAADFGVAGKDVLVEHGGSGLYQPIDLNIARCRMSVAVPA
FT                   GFDYANAVRQGARLRVATKYVETAREHFAAKGVHVDLIKLYGSMELAPLVGLADAIVDL
FT                   VSSGGTLKANNLVEVEEIMAISSRLVVNQAALKLKRAALKPILDAFERASQNGG"
FT   misc_feature    343700..344182
FT                   /gene="hisG"
FT                   /locus_tag="BCAL0311"
FT                   /note="HMMPfam hit to PF01634, ATP
FT                   phosphoribosyltransferase, score 4.1e-53"
FT                   /inference="protein motif:HMMPfam:PF01634"
FT   misc_feature    343988..344053
FT                   /note="PS01316 ATP phosphoribosyltransferase signature."
FT                   /inference="protein motif:Prosite:PS01316"
FT   CDS_pept        344222..345538
FT                   /transl_table=11
FT                   /gene="hisD"
FT                   /locus_tag="BCAL0312"
FT                   /product="histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0312"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50622"
FT                   /db_xref="GOA:B4E635"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:B4E635"
FT                   /protein_id="CAR50622.1"
FT                   /translation="MSITIRKLDSTNEGFGAALRAVLAFEASEDEAIEQSVAQILADVK
FT                   SRGDAAVLEYTNRFDRLSANSVAALELPQDALQTALDGLAPKARAALEAAAARVRAYHE
FT                   KQKIECGTHSWQYTESDGTVLGQKVTPLDRVGLYVPGGKAAYPSSVLMNAIPARVAGVG
FT                   EIVMVVPTPDGVKNDLVLAAALLGGVDRVFTIGGAQAVGALAYGTETVPAVDKICGPGN
FT                   AYVASAKRRVFGTVGIDMIAGPSEILVLCDGTTDPNWVAMDLFSQAEHDELAQSILLCP
FT                   DGAFLDRVEKAIDELLPTMPRQDVIRASLEGRGALIKVRDMAEACRIANDIAPEHLEIS
FT                   ALEPQQWGQQIRHAGAIFLGRYTSESLGDYCAGPNHVLPTSRTARFSSPLGVYDFIKRS
FT                   SLIEVSAEGAQTLGEIASELAYGEGLQAHARSAEFRMKG"
FT   misc_feature    344276..345532
FT                   /gene="hisD"
FT                   /locus_tag="BCAL0312"
FT                   /note="HMMPfam hit to PF00815, Histidinol dehydrogenase,
FT                   score 1.7e-187"
FT                   /inference="protein motif:HMMPfam:PF00815"
FT   misc_feature    344777..344806
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00339"
FT   CDS_pept        345637..346710
FT                   /transl_table=11
FT                   /gene="hisC"
FT                   /locus_tag="BCAL0313"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /EC_number="2.6.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0313"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50623"
FT                   /db_xref="GOA:B4E636"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B4E636"
FT                   /protein_id="CAR50623.1"
FT                   /translation="MTTPQDIIRRDVLAMTSYPVPDASGFVKLDAMENPYPLPAPLAAA
FT                   LGERLAQVALNRYPAPRPAALLDKLRHAMRVPAGCDVLLGNGSDEIISMISVACAQPGA
FT                   KVLAPVPGFVMYELSAKFAQLEFVGVPLQADLTLDVDAMLAAIAEHRPAIVYLAYPNNP
FT                   TGTLYDDADVERIVAAARHSLIVIDEAYQPFAERSWLPRAAEFDNVVVMRTVSKLGLAG
FT                   IRLGYLVGLPAWLNEFDKVRPPYNINVLTQATADFLLDHLDVLDAQAAELRAERARLAQ
FT                   AVAALPGATVFPSAGNFLLVRVPDAAAVFDALLTERVLVKNVSKMHPLLAECVRLTVGS
FT                   PDENARLLAALKLALPG"
FT   misc_feature    345706..346689
FT                   /gene="hisC"
FT                   /locus_tag="BCAL0313"
FT                   /note="HMMPfam hit to PF00155, Aminotransferase class I and
FT                   II, score 9.7e-45"
FT                   /inference="protein motif:HMMPfam:PF00155"
FT   CDS_pept        346776..347363
FT                   /transl_table=11
FT                   /gene="hisB"
FT                   /locus_tag="BCAL0314"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0314"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50624"
FT                   /db_xref="GOA:B4E637"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E637"
FT                   /protein_id="CAR50624.1"
FT                   /translation="MRVAEVVRNTSETQIRVKLDLDGTGQQKLATGVPFLDHMLDQIAR
FT                   HGLVDLEVEAHGDTHIDDHHTVEDVGITLGQAVAKAIGDRKGIRRYGHSYVPLDEALSR
FT                   VVIDFSGRPGLEFHVPFTRARIGTFDVDLSIEFFRGFVNHAGVTLHIDNLRGINAHHQL
FT                   ETVFKAFGRALRAAVELDERAAGQIPSTKGSL"
FT   misc_feature    346866..347300
FT                   /gene="hisB"
FT                   /locus_tag="BCAL0314"
FT                   /note="HMMPfam hit to PF00475, Imidazoleglycerol-phosphate
FT                   dehydratase, score 4e-91"
FT                   /inference="protein motif:HMMPfam:PF00475"
FT   misc_feature    346956..346997
FT                   /note="PS00954 Imidazoleglycerol-phosphate dehydratase
FT                   signature 1."
FT                   /inference="protein motif:Prosite:PS00954"
FT   misc_feature    347241..347279
FT                   /note="PS00955 Imidazoleglycerol-phosphate dehydratase
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00955"
FT   CDS_pept        347425..348045
FT                   /transl_table=11
FT                   /locus_tag="BCAL0315"
FT                   /product="MarC-family integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0315"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50625"
FT                   /db_xref="GOA:B4E638"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:B4E638"
FT                   /protein_id="CAR50625.1"
FT                   /translation="MDLLKSFISLLALINPVGAVPFFLSLTAQQTDDERRRTIRIASVS
FT                   VFCVMTVTALLGQQIINFFGISVGSLEVGGGIIMLLMAINMLNAQIGNTRSTPEERHEA
FT                   ELKDNIAVVPLAIPLLTGPGSISTVIIYAANAHHWYERAGLVAIGAVLAFLCFVAMRLA
FT                   EPIANWIGRTGINIATRLMGLMLSALAVEFIVNGLRALLPALR"
FT   sig_peptide     347425..347508
FT                   /locus_tag="BCAL0315"
FT                   /note="Signal peptide predicted for BCAL0315 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.951) with cleavage site
FT                   probability 0.574 between residues 28 and 29"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    347431..348030
FT                   /locus_tag="BCAL0315"
FT                   /note="HMMPfam hit to PF01914, MarC family integral
FT                   membrane protein, score 2.1e-71"
FT                   /inference="protein motif:HMMPfam:PF01914"
FT   misc_feature    join(347434..347502,347539..347607,347617..347685,
FT                   347755..347823,347851..347904,347965..348033)
FT                   /locus_tag="BCAL0315"
FT                   /note="6 probable transmembrane helices predicted for
FT                   BCAL0315 by TMHMM2.0 at aa 4-26, 39-61, 65-87, 111-133,
FT                   143-160 and 181-203"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        348042..348683
FT                   /transl_table=11
FT                   /gene="hisH"
FT                   /locus_tag="BCAL0316"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   HisH"
FT                   /EC_number="2.4.2.-"
FT                   /note="family C26 cysteine peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0316"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50626"
FT                   /db_xref="GOA:B4E639"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B4E639"
FT                   /protein_id="CAR50626.1"
FT                   /translation="MKTSIAIVDYGMGNLRSVAQALKKAEPAADVAIVDTPAAIRAADR
FT                   VVLPGQGAMPDCMRCLGESGLQEAVIEASRTKPLLGVCVGEQMLFDWSAEGDTKGLGLL
FT                   PGKVVRFELDGRVQDDGSRFKVPQMGWNRVRQAQPHPLWDGVPDDAYFYFVHSYYVTPD
FT                   NPAHTVGETAYGAPFTSAVARDNLFATQFHPEKSAEVGLRLYRNFVHWKP"
FT   misc_feature    348057..348674
FT                   /gene="hisH"
FT                   /locus_tag="BCAL0316"
FT                   /note="HMMPfam hit to PF00117, Glutamine amidotransferase
FT                   class-I, score 4.5e-31"
FT                   /inference="protein motif:HMMPfam:PF00117"
FT   misc_feature    348273..348308
FT                   /note="PS00442 Glutamine amidotransferases class-I active
FT                   site."
FT                   /inference="protein motif:Prosite:PS00442"
FT   CDS_pept        348847..349602
FT                   /transl_table=11
FT                   /gene="hisA"
FT                   /locus_tag="BCAL0317"
FT                   /product="phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0317"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50627"
FT                   /db_xref="GOA:B4E640"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E640"
FT                   /protein_id="CAR50627.1"
FT                   /translation="MLLIPAIDLKDGQCVRLKQGDMDQATIFSEDPAAMARKWVDLGAR
FT                   RLHLVDLNGAFAGKPKNLEAIEAILDEVGDEIPVQLGGGIRSLETIEKYLDAGLSYVII
FT                   GTAAVKNPGFLQDACTAFSGSIIVGLDAKDGKVATDGWSKLTGHEVIDLAKKFEDYGVE
FT                   SIVYTDIGRDGMLQGINIDATVKLAQAVGIPVIASGGLSNLTDIESLCEVEEHGVEGVI
FT                   CGRAIYSGDLDFAAAQKRADELNGELDNA"
FT   misc_feature    348850..349545
FT                   /gene="hisA"
FT                   /locus_tag="BCAL0317"
FT                   /note="HMMPfam hit to PF00977, Histidine biosynthesis
FT                   protein, score 4e-121"
FT                   /inference="protein motif:HMMPfam:PF00977"
FT   CDS_pept        349709..350482
FT                   /transl_table=11
FT                   /gene="hisF"
FT                   /locus_tag="BCAL0318"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   HisF"
FT                   /EC_number="4.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0318"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50628"
FT                   /db_xref="GOA:B4E641"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E641"
FT                   /protein_id="CAR50628.1"
FT                   /translation="MALAKRIIPCLDVTAGRVVKGVNFVELRDAGDPVEIARRYDDQGA
FT                   DELTFLDITATSDQRDLILPIIEAVASQVFIPLTVGGGVRAVEDVRRLLNAGADKVSMN
FT                   SSAVANPQLVRDAADKYGSQCIVVAIDAKRVSADGEAPRWEVFTHGGRKNTGLDAIEWA
FT                   RKMAELGAGEILLTSMDRDGTKSGFDLALTRGVSDAVPVPVIASGGVGSLQHLADGIKD
FT                   GRADAVLAASIFHYGEHTVGEAKRFMSDQGIAVRL"
FT   misc_feature    349724..350428
FT                   /gene="hisF"
FT                   /locus_tag="BCAL0318"
FT                   /note="HMMPfam hit to PF00977, Histidine biosynthesis
FT                   protein, score 5.4e-138"
FT                   /inference="protein motif:HMMPfam:PF00977"
FT   CDS_pept        350482..350898
FT                   /transl_table=11
FT                   /gene="hisI"
FT                   /locus_tag="BCAL0319"
FT                   /product="phosphoribosyl-AMP cyclohydrolase"
FT                   /EC_number="3.5.4.19"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0319"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50629"
FT                   /db_xref="GOA:B4E642"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E642"
FT                   /protein_id="CAR50629.1"
FT                   /translation="MNTETKSLPAWLDKVRWDDNGLVPVIAQEASTNDVLMFAWMNREA
FT                   LAKTVETRRAVYYSRSRKRLWFKGEESGHVQHLHEVRLDCDEDVVLLKVEQVSGIACHT
FT                   GRHSCFFQKFEGNVDSGDWVAVEPVLKDPEHIYK"
FT   misc_feature    350590..350817
FT                   /gene="hisI"
FT                   /locus_tag="BCAL0319"
FT                   /note="HMMPfam hit to PF01502, Phosphoribosyl-AMP
FT                   cyclohydrolase, score 9.8e-53"
FT                   /inference="protein motif:HMMPfam:PF01502"
FT   CDS_pept        350895..351260
FT                   /transl_table=11
FT                   /gene="hisE"
FT                   /locus_tag="BCAL0320"
FT                   /product="phosphoribosyl-ATP pyrophosphatase"
FT                   /EC_number="3.6.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0320"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50630"
FT                   /db_xref="GOA:B4E643"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E643"
FT                   /protein_id="CAR50630.1"
FT                   /translation="MTQSTEDTLLRLAAVIDSRKGGDPDQSYVSRLFHKGDDAVLKKIG
FT                   EEATEVVLAAKDVRQGGAPTALVGEVADLWFHCLVMLSHFDLSPADVIAELERREGLSG
FT                   IEEKALRKRREREENGG"
FT   misc_feature    350919..351197
FT                   /gene="hisE"
FT                   /locus_tag="BCAL0320"
FT                   /note="HMMPfam hit to PF01503, Phosphoribosyl-ATP
FT                   pyrophosphohydrolase, score 6.2e-36"
FT                   /inference="protein motif:HMMPfam:PF01503"
FT   CDS_pept        351331..351723
FT                   /transl_table=11
FT                   /locus_tag="BCAL0321"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0321"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50631"
FT                   /db_xref="GOA:B4E644"
FT                   /db_xref="UniProtKB/TrEMBL:B4E644"
FT                   /protein_id="CAR50631.1"
FT                   /translation="MNDTSNQFPTPAVPGAADAERLNGLRTLTHVLYGLYAIHWLTGGV
FT                   TGIIAIIINYVKRGDVAGTPYADHFEWQIRTFWRALIAYVIGIALLFVGVGFVIMFVTW
FT                   IWTLYRIIKGWLYLNDNKALDPQAWF"
FT   misc_feature    join(351421..351489,351568..351636)
FT                   /locus_tag="BCAL0321"
FT                   /note="2 probable transmembrane helices predicted for
FT                   BCAL0321 by TMHMM2.0 at aa 39-61 and 88-110"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        351755..352120
FT                   /transl_table=11
FT                   /locus_tag="BCAL0322"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0322"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50632"
FT                   /db_xref="GOA:B4E645"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:B4E645"
FT                   /protein_id="CAR50632.1"
FT                   /translation="MSHDPNCLFCKIAAGEIPSTKVHEDDEFVAFRDIRPAADTHVLVI
FT                   PRQHLPTLSAASDADAPMLGRLMLLVARLADQLGVAYTGGETGFRTVINTGPGGGQEVY
FT                   HLHAHILAGPRPWQRMG"
FT   misc_feature    351773..352102
FT                   /locus_tag="BCAL0322"
FT                   /note="HMMPfam hit to PF01230, HIT domain, score 1.1e-40"
FT                   /inference="protein motif:HMMPfam:PF01230"
FT   CDS_pept        352214..352444
FT                   /transl_table=11
FT                   /gene="tatA"
FT                   /locus_tag="BCAL0323"
FT                   /product="Sec-independent protein translocase protein TatA"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0323"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50633"
FT                   /db_xref="GOA:B4E646"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E646"
FT                   /protein_id="CAR50633.1"
FT                   /translation="MGGLSIWHWLIVLLIVALVFGTKKLRNIGNDLGSAVKGFKDGMKE
FT                   GETPADAQQLPRSGAVDVNAKETTRSDSNKA"
FT   misc_feature    352223..352414
FT                   /gene="tatA"
FT                   /locus_tag="BCAL0323"
FT                   /note="HMMPfam hit to PF02416, mttA/Hcf106 family, score
FT                   6.4e-08"
FT                   /inference="protein motif:HMMPfam:PF02416"
FT   misc_feature    352223..352276
FT                   /gene="tatA"
FT                   /locus_tag="BCAL0323"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAL0323 by TMHMM2.0 at aa 4-21"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        352471..353010
FT                   /transl_table=11
FT                   /gene="tatB"
FT                   /locus_tag="BCAL0324"
FT                   /product="Sec-independent protein translocase protein TatB"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0324"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50634"
FT                   /db_xref="GOA:B4E647"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/TrEMBL:B4E647"
FT                   /protein_id="CAR50634.1"
FT                   /translation="MLDLGLSKMALIGVVALVVLGPERLPRVARTAGALFGRAQRYIND
FT                   VKAEVSREIELDALRTMKTDFESAARNVETTIHDNLREHEKALNDTWHSAVGGLDGAAG
FT                   DAGSVGSPGSDTPAAPSWRGSSAALAPKRRNWRIKQAATPVWYKRATTRRTHVQSGAAR
FT                   VARHQPASLRRPTRFF"
FT   misc_feature    352480..352629
FT                   /gene="tatB"
FT                   /locus_tag="BCAL0324"
FT                   /note="HMMPfam hit to PF02416, mttA/Hcf106 family, score
FT                   0.0002"
FT                   /inference="protein motif:HMMPfam:PF02416"
FT   CDS_pept        353052..353840
FT                   /transl_table=11
FT                   /gene="tatC"
FT                   /locus_tag="BCAL0325"
FT                   /product="Sec-independent protein translocase protein TatC"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0325"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50635"
FT                   /db_xref="GOA:B4E648"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="UniProtKB/TrEMBL:B4E648"
FT                   /protein_id="CAR50635.1"
FT                   /translation="MSDPQQNPGDAPEETFISHLVELRDRIIRAGLAVIVVFLGLVYWA
FT                   PDIFKLLARPLMDNLPKDGKMIVTDVTGSFFVPMKVTMLVALVIALPIVLYQIWAFVAP
FT                   GLYQHEKKLVAPLVGSSYFLFLCGMAFAYFLVFPTIFRVMAHYNAPLGAEMTTDIDNYL
FT                   SFVLGMFIAFGVTFEVPIVVVLLVRMGVLSLKKLKEMRPYVIVGAFVVAAVVTPPDVFS
FT                   QLMLALPLVVLFEIGLLAARFFVPKKPAEEGEAGNGEAAG"
FT   misc_feature    353124..353738
FT                   /gene="tatC"
FT                   /locus_tag="BCAL0325"
FT                   /note="HMMPfam hit to PF00902, Sec-independent protein
FT                   translocase protein, score 1.1e-92"
FT                   /inference="protein motif:HMMPfam:PF00902"
FT   misc_feature    join(353130..353198,353292..353360,353418..353486,
FT                   353544..353612,353649..353705,353718..353786)
FT                   /gene="tatC"
FT                   /locus_tag="BCAL0325"
FT                   /note="6 probable transmembrane helices predicted for
FT                   BCAL0325 by TMHMM2.0 at aa 27-49, 81-103, 123-145, 165-187,
FT                   200-218 and 223-245"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(354050..355255)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0326"
FT                   /product="serine peptidase, subfamily S1B"
FT                   /note="subfamily S1B serine peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0326"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50636"
FT                   /db_xref="GOA:B4E649"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B4E649"
FT                   /protein_id="CAR50636.1"
FT                   /translation="MLRRFWLFFAQAVTVLLALMFIVVTLKPQWLQRQGQLGKQLATPI
FT                   VALREVAPGIGGAPATTSYAEAAQKAMPAVVNVFSSKDGSLPPDPRAKDPLFRYFFGDR
FT                   NARKQQDEPAANLGSGVIVSPEGYILTNQHVVDGADQIEVALADGRTATAKVIGSDPET
FT                   DLAVLKINMTNLPTITLGRSDQSRVGDVVLAIGNPFGVGQTVTMGIISALGRNHLGINT
FT                   FENFIQTDAPINPGNSGGALVDVNGNLLGINTAIYSRSGGSLGIGFAIPVSTARTVLES
FT                   IITTGSVTRGWIGVEPQDVTPEIAESFGLQQKSGAIVAGVLQGGPADKAGIKPGDILVS
FT                   VNGEDITDTTKLLNVVAQIKPGTPTKVHVVRKGKQFDVNIVIGKRPPPPKQTLDEQDSD
FT                   SE"
FT   misc_feature    complement(354146..354418)
FT                   /locus_tag="BCAL0326"
FT                   /note="HMMPfam hit to PF00595, PDZ domain (Also known as
FT                   DHR or GLGF), score 1.1e-13"
FT                   /inference="protein motif:HMMPfam:PF00595"
FT   misc_feature    complement(354419..354949)
FT                   /locus_tag="BCAL0326"
FT                   /note="HMMPfam hit to PF00089, Trypsin, score 4.5e-18"
FT                   /inference="protein motif:HMMPfam:PF00089"
FT   sig_peptide     complement(355181..355255)
FT                   /locus_tag="BCAL0326"
FT                   /note="Signal peptide predicted for BCAL0326 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.825) with cleavage site
FT                   probability 0.452 between residues 25 and 26"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(355184..355243)
FT                   /locus_tag="BCAL0326"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAL0326 by TMHMM2.0 at aa 5-24"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        355277..356023
FT                   /transl_table=11
FT                   /locus_tag="BCAL0327"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0327"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50637"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:B4E650"
FT                   /protein_id="CAR50637.1"
FT                   /translation="MDRIELELYLNNTLETARFKDYCPNGLQVEGRRKIEKIATGVTAS
FT                   VAFLEAALEWGADAVLVHHGYFWRNEAPQITGRKYQRLKLLLANDLNLFAFHLPLDAHP
FT                   EFGNNAQLGEKLGLIGEQRFGEGDLGWMATLPMPVTLEHFVAKVENTLGRTPLVLGDPD
FT                   TQLRRIAWCTGAAQSYFDAAIDAGADVFLTGEVSESTTHAAAESGVAFVAAGHHATERY
FT                   GIQALGRHLSEEFDLEHLFIDIHNPV"
FT   misc_feature    355304..356008
FT                   /locus_tag="BCAL0327"
FT                   /note="HMMPfam hit to PF01784, NIF3 (NGG1p interacting
FT                   factor 3), score 1.1e-93"
FT                   /inference="protein motif:HMMPfam:PF01784"
FT   CDS_pept        356242..356862
FT                   /transl_table=11
FT                   /gene="petA"
FT                   /locus_tag="BCAL0328"
FT                   /product="ubiquinol-cytochrome c reductase iron-sulfur
FT                   subunit"
FT                   /EC_number="1.10.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0328"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50638"
FT                   /db_xref="GOA:B4E651"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006317"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR019470"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B4E651"
FT                   /protein_id="CAR50638.1"
FT                   /translation="MRDKEEKRVDSGRRTWLIATSVAGGVGGVATVIPFAASLAPSAKA
FT                   KAAGAPVEVDISGLKPGEMVTVPWRGKPVWILNRTDSMLADVVKADKEVADPATKSPYS
FT                   MPLPAYCANEYRSRADRKNILVVMAVCTHLGCTPSQRFTPGPQPNLPDDWPGGFLCPCH
FT                   GSTYDLAGRVFKNKPAPQNLDIPPYMFTSATTLVIGKDEKGEA"
FT   misc_feature    356287..356355
FT                   /gene="petA"
FT                   /locus_tag="BCAL0328"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAL0328 by TMHMM2.0 at aa 17-39"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    356473..356814
FT                   /gene="petA"
FT                   /locus_tag="BCAL0328"
FT                   /note="HMMPfam hit to PF00355, Rieske [2Fe-2S] domain,
FT                   score 2e-05"
FT                   /inference="protein motif:HMMPfam:PF00355"
FT   misc_feature    356632..356652
FT                   /note="PS00199 Rieske iron-sulfur protein signature 1."
FT                   /inference="protein motif:Prosite:PS00199"
FT   misc_feature    356719..356736
FT                   /note="PS00200 Rieske iron-sulfur protein signature 2."
FT                   /inference="protein motif:Prosite:PS00200"
FT   CDS_pept        356862..358244
FT                   /transl_table=11
FT                   /gene="petB"
FT                   /locus_tag="BCAL0329"
FT                   /product="cytochrome b"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0329"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50639"
FT                   /db_xref="GOA:B4E6Q1"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR030689"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6Q1"
FT                   /protein_id="CAR50639.1"
FT                   /translation="MAADNKEVSTTGFTGWIDQRFPLTSTWKKHVSEYYAPKNFNFWYF
FT                   FGSLALLVLVNQIVTGIFLTMNYKPDSMLAFASVEYIMREVPWGWLIRYMHSTGASMFF
FT                   VVVYLHMFRGLLYGSYRKPRELVWIFGCAIFLCLMAEAFFGYLLPWGQMSFWGAQVIVN
FT                   LFSAIPFVGPDLSLWIRGDYVVSDVTLNRFFAFHVIAIPLVLVGLVVAHLVALHEVGSN
FT                   NPDGIEIKAKKDENGIPLDGIPFHPYYSVHDFLGVCVFLMVFALIVFFSPEMGGYFLEA
FT                   NNFVPANPLQTPPEIAPVWYFTAFYAMLRATTDPFKIVLMIVIALLGVLALIRARGKWK
FT                   VGLPVLAAAIVVFMYLTESKFWGVVVMGSAVISLFFLPWLDRSPVKSIRYRPLFHKVFL
FT                   GIFVAAFLTLAFLGTRPPSPAATLIAQFCALIYFAFFLGMPVWTPLGTFKQPPERVRFK
FT                   PH"
FT   misc_feature    356925..357521
FT                   /gene="petB"
FT                   /locus_tag="BCAL0329"
FT                   /note="HMMPfam hit to PF00033, Cytochrome
FT                   b(N-terminal)/b6/petB, score 1.9e-86"
FT                   /inference="protein motif:HMMPfam:PF00033"
FT   misc_feature    join(356985..357053,357126..357194,357237..357305,
FT                   357339..357398,357441..357509,357621..357689,
FT                   357792..357860,357879..357932,357942..358001,
FT                   358035..358103,358131..358199)
FT                   /gene="petB"
FT                   /locus_tag="BCAL0329"
FT                   /note="11 probable transmembrane helices predicted for
FT                   BCAL0329 by TMHMM2.0 at aa 42-64, 89-111, 126-148, 160-179,
FT                   194-216, 254-276, 311-333, 340-357, 361-380, 392-414 and
FT                   424-446"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    357114..357149
FT                   /note="PS00192 Cytochrome b/b6 heme-ligand signature."
FT                   /inference="protein motif:Prosite:PS00192"
FT   CDS_pept        358266..359024
FT                   /transl_table=11
FT                   /gene="petC"
FT                   /locus_tag="BCAL0330"
FT                   /product="cytochrome c1 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0330"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50640"
FT                   /db_xref="GOA:B4E6Q2"
FT                   /db_xref="InterPro:IPR002326"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6Q2"
FT                   /protein_id="CAR50640.1"
FT                   /translation="MKKLLSTLALIGATACALLAAPAVRAEGNFPLDRAPDNTENLVSL
FT                   QHGAQLFVNYCLNCHSANLMRYNRLTDLGISQKEIETNLLFTTDKVGNTMSVAMRPDDA
FT                   KNWLGTTPPDLSVEERARGRDWLYTYLRSFYRDDTRPTGWNNAVFENVGMPHVLWQLQG
FT                   QRVAKFEDKTDEETGEKAHVLVGFQQVTPGTLSSPDYDAAVADLVAYMTWMSEPAQQTR
FT                   KRLGVWVLIFLGVLTFLAWRLNAAYWKDIK"
FT   sig_peptide     358266..358340
FT                   /gene="petC"
FT                   /locus_tag="BCAL0330"
FT                   /note="Signal peptide predicted for BCAL0330 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.539 between residues 25 and 26"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    358281..358313
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    358338..359021
FT                   /gene="petC"
FT                   /locus_tag="BCAL0330"
FT                   /note="HMMPfam hit to PF02167, Cytochrome C1 family, score
FT                   4.6e-07"
FT                   /inference="protein motif:HMMPfam:PF02167"
FT   misc_feature    358431..358448
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00190"
FT   misc_feature    358935..359003
FT                   /gene="petC"
FT                   /locus_tag="BCAL0330"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAL0330 by TMHMM2.0 at aa 224-246"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        359119..359730
FT                   /transl_table=11
FT                   /locus_tag="BCAL0331"
FT                   /product="putative stringent starvation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0331"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50641"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034341"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="PDB:4QQ7"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6Q3"
FT                   /protein_id="CAR50641.1"
FT                   /translation="MMVLYSGTTCPFSQRCRLVLFEKGMDFEIRDVDLFNKPEDISVMN
FT                   PYGQVPILVERDLILYESNIINEYIDERFPHPQLMPADPVQRARARLFLLNFEKELFVH
FT                   VSTLENEKGKAAEKNHEKARLAIRDRLTQLAPIFVKNKYMLGEEFSMLDVAIAPLLWRL
FT                   DHYGIELSKNAAPLMKYAERIFSRPAYIEALTPSEKVMRR"
FT   misc_feature    359122..359334
FT                   /locus_tag="BCAL0331"
FT                   /note="HMMPfam hit to PF02798, Glutathione S-transferase,
FT                   N-terminal do, score 2.9e-17"
FT                   /inference="protein motif:HMMPfam:PF02798"
FT   misc_feature    359122..359295
FT                   /locus_tag="BCAL0331"
FT                   /note="HMMPfam hit to PF00462, Glutaredoxin, score 0.004"
FT                   /inference="protein motif:HMMPfam:PF00462"
FT   CDS_pept        359799..360323
FT                   /transl_table=11
FT                   /locus_tag="BCAL0332"
FT                   /product="putative stringent starvation protein B"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0332"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50642"
FT                   /db_xref="InterPro:IPR007481"
FT                   /db_xref="InterPro:IPR036760"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6Q4"
FT                   /protein_id="CAR50642.1"
FT                   /translation="MMQEISTKPYLLRALYEWCTDNGYTPHIAVRVDNSTRVPRQFVRD
FT                   GEIVLNISFEATSQLQMGNEWIEFTARFSGKAHKIEIPVANVLAIYARENGQGMAFQVD
FT                   AVAGEGEDSGAFDDDAAQADDAQRDESVSPLAPVADSGANEEPSEGADEPPKTDGDGSK
FT                   GGSRPRLKIVK"
FT   misc_feature    359814..360320
FT                   /locus_tag="BCAL0332"
FT                   /note="HMMPfam hit to PF04386, Stringent starvation protein
FT                   B, score 4.9e-52"
FT                   /inference="protein motif:HMMPfam:PF04386"
FT   tRNA            360342..360417
FT                   /gene="BCALr0332"
FT                   /note="tRNA Thr anticodon TGT, Cove score 81.30"
FT   CDS_pept        360772..360975
FT                   /transl_table=11
FT                   /locus_tag="BCAL0333"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0333"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50643"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6Q5"
FT                   /protein_id="CAR50643.1"
FT                   /translation="MLSPHEFSMLLRIARAPDSVDLANPAFAVLVEKRLVDDAQVRMNA
FT                   IAARPALTPIGQLLLARFDEAA"
FT   CDS_pept        complement(361085..361885)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0334"
FT                   /product="periplasmic solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0334"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50644"
FT                   /db_xref="GOA:B4E6Q6"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6Q6"
FT                   /protein_id="CAR50644.1"
FT                   /translation="MKRSKFLLSGLLLASALGFTAVAAHAEDLLDSVKKAGVLRVGLEG
FT                   TYPPFNSRGTSGQLEGFDVDVANAVAGKLGVKTQFIPTEWSGIIAGLQAGKFDVIVNQV
FT                   TITPQRKEALDFSEPYTYSAAQLIQRKDDTRNFKSLDDFKGKKLGVTLGTNYDQMARTV
FT                   PGIEVQTYPGAPEKLRDLAAGRIEATLDDRLMLPYMIKTSNLPLRAGAVLNGGKQEMAI
FT                   PFRKGNPKFEKAINDALESLRKDGTLKKISTHWFGSDVTVPVAQ"
FT   misc_feature    complement(361112..361771)
FT                   /locus_tag="BCAL0334"
FT                   /note="HMMPfam hit to PF00497, Bacterial extracellular
FT                   solute-binding prot, score 9.3e-93"
FT                   /inference="protein motif:HMMPfam:PF00497"
FT   misc_feature    complement(361664..361705)
FT                   /note="PS01039 Bacterial extracellular solute-binding
FT                   proteins, family 3 signature."
FT                   /inference="protein motif:Prosite:PS01039"
FT   sig_peptide     complement(361808..361885)
FT                   /locus_tag="BCAL0334"
FT                   /note="Signal peptide predicted for BCAL0334 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.988 between residues 26 and 27"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(361808..361867)
FT                   /locus_tag="BCAL0334"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAL0334 by TMHMM2.0 at aa 7-26"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        362167..362484
FT                   /transl_table=11
FT                   /locus_tag="BCAL0335"
FT                   /product="conserved hypothetical protein"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0335"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50645"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6Q7"
FT                   /protein_id="CAR50645.1"
FT                   /translation="MSTDSPTAASLHHILERPGDFSGWLYLPPMPWTLDTEGAFLEDAD
FT                   DAEADVAPAIAAQPGWKATLDSATIEDIVINAHDQVDEPSVAQLLDAFVFYVENDAFIL
FT                   F"
FT   CDS_pept        362566..362901
FT                   /transl_table=11
FT                   /locus_tag="BCAL0336"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0336"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50646"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6Q8"
FT                   /protein_id="CAR50646.1"
FT                   /translation="MADDPAALRTQQEALCARHGLQAVEPEEMVAVAMSTLGRMPIYGT
FT                   RIALSEGDNVSWFFHCGEYSDADDFYQPLHAAHLSTYLPSVLPYLRLPPGARFIIDAAG
FT                   YEDIWMA"
FT   CDS_pept        complement(363015..363797)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0337"
FT                   /product="putative type VI secretion system protein TssL"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0337"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50647"
FT                   /db_xref="GOA:B4E6Q9"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6Q9"
FT                   /protein_id="CAR50647.1"
FT                   /translation="MSYAPSLFGDNAPAPLHTPASTDSAFQARSLLDLLYDGFFMLFLL
FT                   KNGREPDSASEFSTRIQEFLSDFERGAKKLNIAAEDVYGAKFAFCAAIDEMVLSSQFKI
FT                   RADWERRPLQLVLFGEQLAGEKFFQYLEEGRAQGAARLQSLEVFHMCLLLGFQGKYLLE
FT                   GPEKLAYLTARLGDEIAHMKGKRAPFAPHWPLPDQIAHRLKREVPVWAIGTVFALVALL
FT                   GYLGLNTYLKDKTLQALAPYSQVIKVGPESANLTISLP"
FT   misc_feature    complement(363105..363173)
FT                   /locus_tag="BCAL0337"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAL0337 by TMHMM2.0 at aa 209-231"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(363794..365140)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0338"
FT                   /product="putative type VI secretion system protein TssK"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0338"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50648"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6R0"
FT                   /protein_id="CAR50648.1"
FT                   /translation="MSYSAKVLWGEGLFLRPQHFQRQDAYHEARLFESIQAIQPYNWGV
FT                   RSVRIDRDALGSNVLRVAELALVFPDGALYAAPQADDLPPPIALDTLPDGINEFVFYLA
FT                   LHPLRENGTNYSDDPAAGFMTRFVSEQTSVADNFTDAAEADITFLKTQVKLIAHSEPRD
FT                   QLLSVPLVRVRRTATSGFEIDDSFVPPCLAIEASPILHQRLRQLVDALQAKVNALYGFH
FT                   REPSKNIIEFRSGDIASFWLLHTANAAFATLAHLHQHAALHPERLFQELLRLAGQLMTF
FT                   SKGYTLADLPVYRHDDPGPSFARLDLMLRELLDTVISTRYFAITLDEVRPSFHLGRLDS
FT                   GKIDDKTEFYLAVSADMPSVELVDAVPARFKVGAPDDVDKLVLSAMPGVRLSYTPQVPP
FT                   AIPVRPGACYFALDSRSPLYERMLQAQSAMIYAPTGINDLKFELIAVTS"
FT   misc_feature    complement(363797..365128)
FT                   /locus_tag="BCAL0338"
FT                   /note="HMMPfam hit to PF05936, Bacterial protein of unknown
FT                   function (DUF87, score 9.6e-179"
FT                   /inference="protein motif:HMMPfam:PF05936"
FT   CDS_pept        complement(365246..365845)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0339"
FT                   /product="putative type VI secretion system protein TssJ"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0339"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50649"
FT                   /db_xref="InterPro:IPR017734"
FT                   /db_xref="InterPro:IPR038706"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6R1"
FT                   /protein_id="CAR50649.1"
FT                   /translation="MIRYALPLLACALLAGCAAAPLLGSAASAVMSAAGIGKPEVPDAQ
FT                   KPPRNIGLTLAAAPNLNAATDNKPLALVVRLYALKDPTSFQQAPFDAFTDPAKEKTALG
FT                   ADLLNVREITLIPGQRYTATEKVSREAQAFGIVALFRDPALQRWKLTFDPVKSEKSGII
FT                   IGLHNCAMTVTDGTVIAPQQGAPSQPLNMLSSVSCG"
FT   misc_feature    complement(365252..365284)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   sig_peptide     complement(365750..365845)
FT                   /locus_tag="BCAL0339"
FT                   /note="Signal peptide predicted for BCAL0339 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.438 between residues 32 and 33"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(365765..365833)
FT                   /locus_tag="BCAL0339"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAL0339 by TMHMM2.0 at aa 5-27"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(365795..365827)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        366232..366858
FT                   /transl_table=11
FT                   /locus_tag="BCAL0340"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0340"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50650"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6R2"
FT                   /protein_id="CAR50650.1"
FT                   /translation="MKDRLFAKLSGVVVACGVIAGCASQPPAPPTAEVFNKSLADADAV
FT                   AKAGGQDKALGLYQQLAKSDPTREEPWSRIAQIQFAQNHYGQAIVAAQEALQRDATDRQ
FT                   AKSVLAVAGLRIATQSLGELRQDASLAGDAKSDAQALAKQLRDTLGESALFPPETKIAK
FT                   PRPPRRVVHRAKAAAAPAAEAAASAAPTPPAAQKGSADPFGALRN"
FT   sig_peptide     366232..366303
FT                   /locus_tag="BCAL0340"
FT                   /note="Signal peptide predicted for BCAL0340 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.854) with cleavage site
FT                   probability 0.369 between residues 24 and 25"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    366265..366297
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    366436..366537
FT                   /locus_tag="BCAL0340"
FT                   /note="HMMPfam hit to PF07719, Tetratricopeptide repeat,
FT                   score 0.0047"
FT                   /inference="protein motif:HMMPfam:PF07719"
FT   CDS_pept        366905..367420
FT                   /transl_table=11
FT                   /locus_tag="BCAL0341"
FT                   /product="putative type VI secretion system protein TssB"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0341"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50651"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6R3"
FT                   /protein_id="CAR50651.1"
FT                   /translation="MAKKESIQKSLQKIRPPRVQLTYEVEKGDAIEVKELPFVVGVVGD
FT                   LAGQSEIEQPKLRDRKFVNIDRDNFDDVMKAIEPRAAFQVENRLSPEGGKFAVDLKFRS
FT                   LSDFSPDEVVEQVEPLRRLLEARSKLADLRNKLAGNDKLEDLLSEVLKNTQQLQELAKG
FT                   TGGDKDGE"
FT   misc_feature    366926..367405
FT                   /locus_tag="BCAL0341"
FT                   /note="HMMPfam hit to PF05591, Protein of unknown function
FT                   (DUF770), score 2e-88"
FT                   /inference="protein motif:HMMPfam:PF05591"
FT   CDS_pept        367436..368926
FT                   /transl_table=11
FT                   /locus_tag="BCAL0342"
FT                   /product="putative type VI secretion system protein TssC"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0342"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50652"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6R4"
FT                   /protein_id="CAR50652.1"
FT                   /translation="MNQQTAAAQASGAEYAAGTSLLDDIVEKSKVAKSDSEHARAKDLI
FT                   GELVHQVLDGTVIVSDNLSATIDARVAELDRLISTQLSAVMHAPEFQRLESTWRGLDYL
FT                   VKESNTGQTIKIKALHAPKRDLVRDFKGASEFDQSALFKKVYEEEFGTFGGSPFGALIG
FT                   DYEISRQPEDMYFIEQMSHVAAAAHAPFIASASPELLGLESFSDLGKPRDLGKVFDTVE
FT                   YAKWKSFRDAEDSRYVGLTLPRFLGRLPFNPKDGQTAENFNFVEDVDGTDHDKYLWCNA
FT                   AWAFAARLTAAFDDFGWCAAIRGVEGGGLVEDLPTHTFKTDDGEVALKCPTEIAITDRR
FT                   EKELSDLGFIPLVHCKNSDYAAFFAAQSVQKPKKYSTDSANANAVLSAQLQYIFSVSRV
FT                   AHYLKAMMRDKIGSFASAQNVETFLNRWISQYVLLDDNASQEQKAQFPLREASIQVSEI
FT                   PGKPGSYRSVAFLRPHFQLDELSISLRLVADLPKPANS"
FT   misc_feature    367502..368911
FT                   /locus_tag="BCAL0342"
FT                   /note="HMMPfam hit to PF05943, Protein of unknown function
FT                   (DUF877), score 0"
FT                   /inference="protein motif:HMMPfam:PF05943"
FT   CDS_pept        368997..369500
FT                   /transl_table=11
FT                   /locus_tag="BCAL0343"
FT                   /product="putative type VI secretion system protein TssD"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0343"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50653"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6R5"
FT                   /protein_id="CAR50653.1"
FT                   /translation="MLHMHLQFGSPAVKGESADKDHQGWIELKSWDHSIVQPRSATAST
FT                   AGGHTMTRCEHGDMIFTKEIDSSSPLLYQHASGGTTFDEVTVHFSRADGEGKRVQYLEV
FT                   KLKYVIISSIAPSVREEGLPLETFSLKYAAVQWKQTQQKIGGNQGGNTQGAWSLTKNDK
FT                   TYAV"
FT   misc_feature    369003..369416
FT                   /locus_tag="BCAL0343"
FT                   /note="HMMPfam hit to PF05638, Protein of unknown function
FT                   (DUF796), score 8.2e-50"
FT                   /inference="protein motif:HMMPfam:PF05638"
FT   CDS_pept        369563..370048
FT                   /transl_table=11
FT                   /locus_tag="BCAL0344"
FT                   /product="putative type VI secretion system protein TssE"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0344"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50654"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR017737"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6R6"
FT                   /protein_id="CAR50654.1"
FT                   /translation="MKRFEPSFLDKLFDDEPHLPASAAMRQLSLDELKNTVARDVEAIL
FT                   NTRIAHTENELAALPECQKSVLTYGLNDFAGLSLASHYDRAFICKSIQQAIARHEPRLQ
FT                   QVQVTFELNEQATNALYFAIQALLVVHPAEEPVSFDAMLQPSTLQYSVTRARAARMQ"
FT   misc_feature    369578..370000
FT                   /locus_tag="BCAL0344"
FT                   /note="HMMPfam hit to PF07025, Protein of unknown function
FT                   (DUF1316), score 3e-53"
FT                   /inference="protein motif:HMMPfam:PF07025"
FT   CDS_pept        370125..371960
FT                   /transl_table=11
FT                   /locus_tag="BCAL0345"
FT                   /product="putative type VI secretion system protein TssF"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0345"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50655"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6R7"
FT                   /protein_id="CAR50655.1"
FT                   /translation="MEELLPYYERELSFLRRYSRDFAERYPKIAARLALSGEHCEDPHV
FT                   ERMIESFALLGARINKKLDDDYPEFTEALLEVLYPHYLRPFPSCSIAQFTPASPGQQTE
FT                   PVVIERGTELKSRPIRGVQCRFRTAYDVTLAPIRISEARYTPVALAPSATVLPSNATGV
FT                   ISITFESLAAQLDLGALKLSTLRAHLHGEQSFVAALTDCLFVNVLGAYVEPERNGRWTA
FT                   LRKLPIAQAGFAEDDALIDYPAKSHPAYRLLTEYFAFPDKFDFVDFDLAAIARASGRCQ
FT                   RATLHLVLQDVRSDSHVARLLELLMASHFRLFCTPIVNLFRQHGEPIRITHRAVSYPVI
FT                   AEARRAFAYEVYSIDSVKLVRQQAHEESVIEFRPFYSLHHGEAARIGHYWFARRNDWVA
FT                   QKSPGYETEISIVDIDFEPTSPQTDTLSLDLTCTNRDLPAMLAFGLEGGDLFQEGGAQT
FT                   SGISLLRRPTQSVRFERGRAAHWRLVSHLALNHVSLVAHGLAPLKEMLTLYDLRRTAVS
FT                   MRQIDGLVGVEQRGAVQWLPGKPFATFVRGIEIRLTIDEEHFVGASLASFVRVLDSFFG
FT                   LYVHLNSFVQLVVVSKRTGEEIIRCKPRTGESILA"
FT   misc_feature    370125..371957
FT                   /locus_tag="BCAL0345"
FT                   /note="HMMPfam hit to PF05947, Bacterial protein of unknown
FT                   function (DUF87, score 1.4e-240"
FT                   /inference="protein motif:HMMPfam:PF05947"
FT   CDS_pept        371924..373024
FT                   /transl_table=11
FT                   /locus_tag="BCAL0346"
FT                   /product="putative type VI secretion system protein TssG"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0346"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50656"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6R8"
FT                   /protein_id="CAR50656.1"
FT                   /translation="MQAPNRRIDPGVVDALLDEPHRFEFFQAVRVLEGLFARQASDAPG
FT                   AWRQGDVVAQRIAFRNTLSLGFPPSEIEGARSFDDDGASLSSDEQRGAALAAGELGRVE
FT                   LTPAFFGLLGGQGALPLHYTEQIVAREHLRRDHAARAFFDVFSNRATALFYAAWKKYRL
FT                   PFHYELDRDERYLPLLLAIAGVPSDEVRDSLAAGAGGVLDEAVAGYALAARHRPMSAAY
FT                   LQRTLSDYFRVPVKIDQFVGKWYDVPPDQLSVLGEVNAVLGATALVGERVWQRDMRARI
FT                   VVGPLSKRDYEAFLPGGAQAVALERMLTLLAGVTLEYEVKLVLKRTEVGASVLGAGSRL
FT                   GWDAFLCTRDAAEDRSDARYELHVIH"
FT   misc_feature    371972..372967
FT                   /locus_tag="BCAL0346"
FT                   /note="HMMPfam hit to PF06996, Protein of unknown function
FT                   (DUF1305), score 1.7e-93"
FT                   /inference="protein motif:HMMPfam:PF06996"
FT   misc_feature    372824..372853
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00339"
FT   CDS_pept        373066..375735
FT                   /transl_table=11
FT                   /gene="clpB"
FT                   /locus_tag="BCAL0347"
FT                   /product="putative type VI secretion system protein TssH"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0347"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50657"
FT                   /db_xref="GOA:B4E6R9"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017729"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6R9"
FT                   /protein_id="CAR50657.1"
FT                   /translation="MSTPLKTLITKLNPLCRHATERAASACLARGHYEVDLEHLFLALL
FT                   DEATGDLPLALRASRVDPHALHADLERELTRLKTGNTRTPVFSVHLIALFEQAWLIASL
FT                   DSQLGRIRSGHLLLALLTAPDLAQFAQRMSSRFAEMNVTDLKHKFDEIMAGSSEAEPRQ
FT                   TDDEGSDVAPAADGMAPAAGPSKTPALDTYTTNLTQRARDGKIDPVIGREAEIRQAIDI
FT                   LMRRRQNNPIMTGEAGVGKTAVVEGLALRIAADDVPPPLRGVALHVLDMGLLQAGASVK
FT                   GEFENRLKSVIDEVKKSAHPIILFIDEAHTIIGAGGQAGQNDAANLLKPALARGELRTI
FT                   AATTWSEYKKYFEKDAALARRFQVVKVEEPSEPLAAAMLRGMSGLMEKHFNVRILDDAI
FT                   TEAVRLSHRYISGRQLPDKAISVLDTACAKVALAHSATPAAIDDTKKRIERIDAEIASL
FT                   EREVAGGAAHDERLGELRGARDTALEQLAKDEERYEAERVIVAEITELRDALDRARGPS
FT                   EDGQPVDVQATRDKLAERVAALHALQGSEPMVPLQVDGHVVAEIVAAWTGIPLGRMVKD
FT                   EIDTVLNLQPLLSARVIGQDHALEAIAQRVRTATANLEDPNKPRGVFMFVGPSGVGKTE
FT                   TALALADILYGGERKMVTINMSEYQEAHSVSGLKGSPPGYVGYGEGGVLTEAVRRNPYS
FT                   VVLLDEVEKAHPDVLEMFFQVFDKGTMDDAEGREIDFRNTLIILTSNVGSAAVMQACLN
FT                   KPAEELPDPDTLAETLRPQLYKTFKPAFLGRMKVVPYYPISDDVLAEIIELKLERIRRR
FT                   IEANHKAAFEWDESLVDAVLARCTEVDSGARNVDHILNGTLLPEIAGHVLGRIADGAAI
FT                   ARIAVRADEAGEFAYTVE"
FT   misc_feature    373132..373290
FT                   /gene="clpB"
FT                   /locus_tag="BCAL0347"
FT                   /note="HMMPfam hit to PF02861, Clp amino terminal domain,
FT                   score 1.2e-08"
FT                   /inference="protein motif:HMMPfam:PF02861"
FT   misc_feature    373753..374337
FT                   /gene="clpB"
FT                   /locus_tag="BCAL0347"
FT                   /note="HMMPfam hit to PF00004, ATPase family associated
FT                   with various cellul, score 1.1e-06"
FT                   /inference="protein motif:HMMPfam:PF00004"
FT   misc_feature    373768..373791
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    374032..374070
FT                   /note="PS00870 Chaperonins clpA/B signature 1."
FT                   /inference="protein motif:Prosite:PS00870"
FT   misc_feature    374917..375429
FT                   /gene="clpB"
FT                   /locus_tag="BCAL0347"
FT                   /note="HMMPfam hit to PF07724, ATPase family associated
FT                   with various cellul, score 5.9e-89"
FT                   /inference="protein motif:HMMPfam:PF07724"
FT   misc_feature    374929..375444
FT                   /gene="clpB"
FT                   /locus_tag="BCAL0347"
FT                   /note="HMMPfam hit to PF07728, ATPase family associated
FT                   with various cellul, score 3.2e-05"
FT                   /inference="protein motif:HMMPfam:PF07728"
FT   misc_feature    374944..374967
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    375286..375318
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        375780..376901
FT                   /transl_table=11
FT                   /locus_tag="BCAL0348"
FT                   /product="putative type VI secretion system protein TssA"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0348"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50658"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR017740"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6S0"
FT                   /protein_id="CAR50658.1"
FT                   /translation="MPINLPELLTPISEASPSGDDLLFSNEFDAIQDARRYDDPTLDQG
FT                   EWVTEIKEADWGFVVDHAGELLRTRTKDLRLAVWLTEALALEDGITGLTEGYALLEGLC
FT                   REFWDTFHPLPEDDDIEHRLGNVAWLSGRTAELLRAVPLTDGASNAFSTLDWEVAQHVA
FT                   QSIKRDPEHADDIARGKPSIEQIDASRRVTSIAFYTALLANLKAFEFALDAFEERLVER
FT                   AGDSAPSFRQARDAFETVYRLAERFAREQGYTGSAPHTQAVQQAQPERIEPVFGQPIQT
FT                   EETHVQQQTASRPPVTQTIAGIQNRAQAVDQLRAVARYFRQTEPHSPVAYLADKAAEWA
FT                   DMPLHKWLESVVKDDGSLSHIRELLGVRPDEQS"
FT   misc_feature    375942..376127
FT                   /locus_tag="BCAL0348"
FT                   /note="HMMPfam hit to PF06812, ImpA-related N-terminal,
FT                   score 1.2e-24"
FT                   /inference="protein motif:HMMPfam:PF06812"
FT   CDS_pept        complement(376995..377945)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0349"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0349"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50659"
FT                   /db_xref="GOA:B4E6S1"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6S1"
FT                   /protein_id="CAR50659.1"
FT                   /translation="MHRTIQVRRARLSAAVSPALAALFAAGLVASGAAFAQNTGATVTP
FT                   VGNGTVATTALPQANPNAGGASGTVVHGTAGTLTPPPANAAPGQVVVGGKVPDEATKAA
FT                   VLQKLRDTYGATNVVDQIEVGDVATPPNWSANVQKLLGAQLKQISKGQLKINGTQIEMK
FT                   GEVHNEAQRQQLASDMANTLNPTYTIKNGLRVSASEQGVLDQTLANRTIEFETGSATLT
FT                   PQGKLILDQMAAALAKMQNRTVDIIGHTDNSGNRTSNIALSQARADAVKGYLITKSIPP
FT                   QQMTTTGVGPDQPIAPNDTADGRARNRRIEFRVGQ"
FT   misc_feature    complement(377022..377309)
FT                   /locus_tag="BCAL0349"
FT                   /note="HMMPfam hit to PF00691, OmpA family, score 1.8e-35"
FT                   /inference="protein motif:HMMPfam:PF00691"
FT   sig_peptide     complement(377838..377945)
FT                   /locus_tag="BCAL0349"
FT                   /note="Signal peptide predicted for BCAL0349 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.997 between residues 36 and 37"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(377844..377912)
FT                   /locus_tag="BCAL0349"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAL0349 by TMHMM2.0 at aa 12-34"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(377950..378939)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0350"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0350"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50660"
FT                   /db_xref="InterPro:IPR017748"
FT                   /db_xref="InterPro:IPR038225"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6S2"
FT                   /protein_id="CAR50660.1"
FT                   /translation="MTQTVQAQIAYFGKIPSRGDFVKSAHNPQLLQTLDRWIAQALELL
FT                   AEDPRWKIVYEDAKPMHFAFLGSRSKLAIAGHMVASHDVSMRRFPFLGATALEVDRPVA
FT                   FLARSPLAFARLWSRVAAQIPPLLGKDEPPGALQALGDTQVPIDIGGPGTSHDGTFNDF
FT                   VEHQTLHGLQEMLLESGHPVRLRGAMLALGSLLRPVMQSGSSHIERGLTLPLPVDPFYR
FT                   SLVAAFWLELIAPFVAQADFELAIFIGTIAERERLVIGFNGASAKTLLSVVDPQTYAAH
FT                   NIDIDDPEWIDAHAQNDHQISKLVSYLDQPQLSLRVAIDAFREAFIGG"
FT   CDS_pept        complement(378936..382880)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0351"
FT                   /product="putative type VI secretion system protein TssM"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0351"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50661"
FT                   /db_xref="GOA:B4E6S3"
FT                   /db_xref="InterPro:IPR009612"
FT                   /db_xref="InterPro:IPR010623"
FT                   /db_xref="InterPro:IPR017731"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6S3"
FT                   /protein_id="CAR50661.1"
FT                   /translation="MQRILNVLTHPRTLSIVGIVALAAILFIVADMLQLPLLWAATAFA
FT                   AILALWLVVALWRRWRVKRANQQLGQVLEEQAETGKIAAPAAAALAPDAKTADLDVLRT
FT                   RLSDAVKTIKTSKIGQVSGGSALYELPWYIVIGNPAAGKSSAVLNSGLQFPFADKNSAV
FT                   IHGIGGTRNCDWFFTTEGILLDTAGRYSVHEEDRSEWLGFLGLLKRYRPKAPINGIIVT
FT                   ASIAELTGNRPEFAINLAKNLRQRVQELTEKLEVFAPVYVMFTKADLITGFTEFFSSSD
FT                   KHEYDRVWGATLPYEPDDKRDVVAQFDTHFEELYEGLKEISVAQLSLSRGNQLSPGQLS
FT                   FPLEFSTIKPSLRAFLATLFENNPFQYKPIFRGFYFTSALQEGETNSAAAQRIAHRFGL
FT                   DGNALPKPHSAFSKNGFFLRDLFSKVIFADRQTVRQFASPTKTRLRYATFFGFVAALAL
FT                   ALGGWTWSTIGNQQLVANVQADLDNVTRLQQGRNDLQSRLQAMDILEDRIEQLEQFRRD
FT                   KPMSVSLGLYQGDRLEQHLLTEYYNGVRQILLAPVSQNLASFMKDVNAHPEQLVPMTRP
FT                   PESGAVPGGTIPVSTNAAGAAPQAGAALAASGTAPATAPQQAAAPQGGLYSDASPTNVQ
FT                   DAYNALKTYLMLSDKRHVEQAHLTDQLARFWRGWLETNRGNMPRDEMIRSAERMISFYL
FT                   SRVNDNDWPMIDANLALVDQTRENLRRVVRGMPARQRVYEEIKARASTRFAPMTIARIV
FT                   GDGNQGLVAGSYAIPGTFTREAWFDYVQPAIRDAATKELQAKDWVLNTSTQDDLTLEGS
FT                   PEQIQKTLVGMYKTEYAQHWQKFMQGIAVQGFTSFGQAVDGMNRLGDPQDSPIRKILET
FT                   AYDQTSWDNPSLANVTIKKAQTGVVNWVKQLFSRSQAGQVAAANIDINGNPAEVPMGPI
FT                   GQEFVGLARIVATHDGTSMLKGYMESLSKVRTRFNVIKNQGDPGPGARQLMQQTLDGSG
FT                   SELADSLKLVDEQMLTGLTDSQRKSLRPLLVRPLMQAFAVVIQPASAEVNKVWNAQVYQ
FT                   PFQSSLATKYPFAANAKVEAGAGEIAQVFGPDGSIAKFVGTTLGPLAVRRGDTLAARTW
FT                   GDMGIGLTPDFTNGFARWVAPLAGGAAGSAAASAEPQTVFQILPQPSTGTTEYTIAIDG
FT                   QQLRYRNTPPQWTNFVWPNPQGSPGATLSATTFDGRTVQLVNEPGRYGLEKLINSAQRK
FT                   RRPDGTFDLTWAQGSVNVSVTMRIISTSQPSAGGGDQPQQQSLRGLQLPSSVADASAGA
FT                   AQNATQAGTGTPGAAPAVAAANATNAQRAQ"
FT   misc_feature    complement(379503..379895)
FT                   /locus_tag="BCAL0351"
FT                   /note="HMMPfam hit to PF06744, Protein of unknown function
FT                   (DUF1215), score 1.6e-35"
FT                   /inference="protein motif:HMMPfam:PF06744"
FT   misc_feature    complement(380247..381203)
FT                   /locus_tag="BCAL0351"
FT                   /note="HMMPfam hit to PF06761, ImcF-related, score 6.8e-76"
FT                   /inference="protein motif:HMMPfam:PF06761"
FT   misc_feature    complement(join(381483..381551,382710..382778,
FT                   382791..382844))
FT                   /locus_tag="BCAL0351"
FT                   /note="3 probable transmembrane helices predicted for
FT                   BCAL0351 by TMHMM2.0 at aa 13-30, 35-57 and 444-466"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(381624..381647)
FT                   /note="PS00242 Integrins alpha chain signature."
FT                   /inference="protein motif:Prosite:PS00242"
FT   misc_feature    complement(382449..382472)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   sig_peptide     complement(382746..382880)
FT                   /locus_tag="BCAL0351"
FT                   /note="Signal peptide predicted for BCAL0351 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.955 between residues 45 and 46"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(383182..384027)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0352"
FT                   /product="metallo peptidase, subfamily M15C"
FT                   /note="subfamily M15C metallo peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0352"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50662"
FT                   /db_xref="GOA:B4E6S4"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR039561"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6S4"
FT                   /protein_id="CAR50662.1"
FT                   /translation="MIAVALVAYFALAVAVAALLLLPGIRATVFESVAQFHGRLTRRAN
FT                   DRAARTRSQIVKSASVTRGALNDVQNLLVRRRLMIMVSAGILATPPLVAIALRGRQLFQ
FT                   YDDTARVPDEKIAALLQGEQLVPPPPLPPEVFATKEVEQVRPALKDASRDWNLLDPDFR
FT                   TRLLLVYKIMHEQHGYEMALLEGYRSPERQNRLAQMGSNVTNAAAFQSYHQFGLAADNA
FT                   FLRDGKLVISEKDPWAMRGYQLYGQVAEQVGLTWGGRWKMMDLGHVEYHKPGFKLGRGS
FT                   "
FT   misc_feature    complement(383209..383565)
FT                   /locus_tag="BCAL0352"
FT                   /note="HMMPfam hit to PF02557, D-alanyl-D-alanine
FT                   carboxypeptidase, score 0.00022"
FT                   /inference="protein motif:HMMPfam:PF02557"
FT   misc_feature    complement(join(383737..383796,383941..384009))
FT                   /locus_tag="BCAL0352"
FT                   /note="2 probable transmembrane helices predicted for
FT                   BCAL0352 by TMHMM2.0 at aa 7-29 and 78-97"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(383977..384027)
FT                   /locus_tag="BCAL0352"
FT                   /note="Signal peptide predicted for BCAL0352 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.950) with cleavage site
FT                   probability 0.496 between residues 17 and 18"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        384149..385141
FT                   /transl_table=11
FT                   /locus_tag="BCAL0353"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0353"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50663"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6S5"
FT                   /protein_id="CAR50663.1"
FT                   /translation="MSAPENSNSKTPPSLLSDTKPAGEGGPRQSRILADLEGRVTPPAE
FT                   PPRRSLKAPIAAVVALVVAVGGWGAWRMQQSSGEQPAVVAAATAPAAAAPDKAAPASGA
FT                   AAQVAQNGASAASAVQPATIVNDDSASQAVASASASAASAADNSRLSRALANGAEEGSG
FT                   GAAAAGVAATAAAAAATSKTAKADASKSTKVAAHGKTDTKTEAKVDTKAEARKHRKEQQ
FT                   AELAQAKKRREATSTRTAKAAGKDDPDADLLAALVARTKPADKKLAAQKGQAVPTKTAA
FT                   TTGGSLASRVKECSERGFFEDQLCRWRVCDGHWGKDPACPSAAQSETRQ"
FT   CDS_pept        385353..386381
FT                   /transl_table=11
FT                   /locus_tag="BCAL0354"
FT                   /product="putative cation transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0354"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50664"
FT                   /db_xref="GOA:B4E6S6"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6S6"
FT                   /protein_id="CAR50664.1"
FT                   /translation="MDLIVQTYGADTSGMVCGFRFDPGGAGALLDADAAAAWLRTCREH
FT                   GAAASGDFVWLHFNLAHGASERWMRTHLGLPDSFFEFLHEGSRSTRIEQEDGALRAIVN
FT                   DVMFNLELTPSEIATLFVHVERRIMVTARLKPLRSVDTLRACVRDGEQFRSPAELLVHL
FT                   LRDQADLLIQIMRRTSIDVDRIEDRFLSQRLTSSRIELGAMRRTLTRLQRMLAPEPGSI
FT                   FRLLAKPPAWLHTEDVQELRESTEEFSLVLADLAGLNERIKLLQEEIGSRLDEQNNRTL
FT                   FTLTLVTVIALPINIVAGFFGMNVGGVPFSENKHGFWLMVLLVAGFTALAAWWAFRRRD
FT                   DR"
FT   misc_feature    385500..386375
FT                   /locus_tag="BCAL0354"
FT                   /note="HMMPfam hit to PF01544, CorA-like Mg2+ transporter
FT                   protein, score 0.00037"
FT                   /inference="protein motif:HMMPfam:PF01544"
FT   misc_feature    join(386190..386258,386301..386360)
FT                   /locus_tag="BCAL0354"
FT                   /note="2 probable transmembrane helices predicted for
FT                   BCAL0354 by TMHMM2.0 at aa 280-302 and 317-336"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(386409..386561)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BCAL0355"
FT                   /product="putative membrane protein (fragment)"
FT                   /note="Probable gene remnant. Similar to the N-terminal
FT                   regions of several proteins, for example, Ralstonia
FT                   eutropha (strain JMP134) (Alcaligenes eutrophus)
FT                   hypothetical protein UniProt:Q46RN6 (EMBL:CP000091) (97 aa)
FT                   fasta scores: E()=5.9e-07, 56.000% id in 50 aa, and
FT                   Pseudomonas aeruginosa hypothetical protein UniProt:Q9I0E5
FT                   (EMBL:AE004698) (93 aa) fasta scores: E()=4.4e-06, 65.217%
FT                   id in 46 aa"
FT                   /db_xref="PSEUDO:CAR50665.1"
FT   CDS_pept        complement(386586..387563)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0356"
FT                   /product="putative quinone oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0356"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50666"
FT                   /db_xref="GOA:B4E6S8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6S8"
FT                   /protein_id="CAR50666.1"
FT                   /translation="MRSIRFDSPAADIESLDARVRDIAPPVPADGQMLIEVRAAGVNPS
FT                   DVKAALGRMPHAVWPRTPGRDWAGIVRSGPDNWIGAPVWGSGGDLGVGRDGSHAEWLVL
FT                   DAAHVRRKPGVLTLDEAAGVGVPFVTAYEGLRRAGMPTADDVVLVFGANGKVGQAAIQL
FT                   ATARGATVIGVERGPGAYRGHASGDVPMIDASSRTVADAVRKLTGGHGADIVYNTVGSP
FT                   YFEAANASMAIGARQIFISTIERSVPFDIFAFYRGQHTFVGIDSLQLGAAAVAQILDTL
FT                   APGFGNGTLRPFPIGDDYVYPLERAHDAYRAVLAGARERVILKP"
FT   misc_feature    complement(386715..387137)
FT                   /locus_tag="BCAL0356"
FT                   /note="HMMPfam hit to PF00107, Zinc-binding dehydrogenase,
FT                   score 1.5e-14"
FT                   /inference="protein motif:HMMPfam:PF00107"
FT   misc_feature    complement(387228..387476)
FT                   /locus_tag="BCAL0356"
FT                   /note="HMMPfam hit to PF08240, Alcohol dehydrogenase
FT                   GroES-like domain, score 2.1e-08"
FT                   /inference="protein motif:HMMPfam:PF08240"
FT   CDS_pept        387689..388645
FT                   /transl_table=11
FT                   /locus_tag="BCAL0357"
FT                   /product="LysR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0357"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50667"
FT                   /db_xref="GOA:B4E6S9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6S9"
FT                   /protein_id="CAR50667.1"
FT                   /translation="MRIPHSPSTGSRMDDFLSPHLALFVDVVDQQSFSAAARRLGVAAS
FT                   SVTRRIDRLETQLGIRLLHRTTHALRPTEAGQLLYGRATRMLAELRGLQEDLHSQHDEP
FT                   GGLLRVDCPAPFGRRHLMAALAAFMQRYPALQVDLVLTDSMVDLQGARLGSDVDLAVRI
FT                   GPLEDTRFVATVLAPQRRVLCASAAYLARRGEPASPDALAGHDCLAWHGAPPPGAWRFG
FT                   ERRHVPAQPRFRSNHSEALLEAAIDGLGLAHLPTWLAADALRDGRLRALLPQYAAAPEP
FT                   ATIHVLRQQARGSARTSRLVAFLATWFAQPAWDAAWA"
FT   misc_feature    387740..387919
FT                   /locus_tag="BCAL0357"
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix, score 5.1e-19"
FT                   /inference="protein motif:HMMPfam:PF00126"
FT   misc_feature    387779..387844
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1234.000, SD 3.39 at aa 31-52, sequence
FT                   QSFSAAARRLGVAASSVTRRID"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    387782..387874
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00044"
FT   misc_feature    387989..388615
FT                   /locus_tag="BCAL0357"
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 2.3e-43"
FT                   /inference="protein motif:HMMPfam:PF03466"
FT   CDS_pept        complement(388768..390936)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0358"
FT                   /product="metallo peptidase, family M1"
FT                   /note="family M1 metallo peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0358"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50668"
FT                   /db_xref="GOA:B4E6T0"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR034016"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6T0"
FT                   /protein_id="CAR50668.1"
FT                   /translation="MSIHIRKMRYLPLVAALALAGCGGDDGGAGSASALSSAGAPHTGS
FT                   SPTVAAPPSASNVDKSVSPVELPDTVVPVNYRLWFRPNEALNAFDGRADVEIKVLKPVN
FT                   NIVIAGHRIKFTNGRITLQPGNIQLIATPQDKGDFYQLRPVSGSISPGNYSLHMEWSGI
FT                   INFKSYDDPVNHTGGSCGDDPYPGCSAAEGVFRVDLKGTDGKTSGAILTQGETNLSRQW
FT                   FPGWDEPAFRPTYEVTAEVPQSWRVVSNAAEKPSTNVGGGYKLVQFEKTPPMPSYLLFF
FT                   GGGMFDTYEDDFTSPLPGGKGGLHLRVFTPPGMSEWAKPAMDRTKQALDYYYRYTGIPL
FT                   PLTKFDTVAANDAFKEQKDLNFGGMENWGSILEFADDILPQPGQPMSHYGNEVLTHEVA
FT                   HQWFGDLVTTDWWDNVWLNESFATFFETKTTIQFFPDEFSWLDQVKNKYRVINRDIGPN
FT                   AFPVAPNFNDWASNDFVLSASAFTYDKGGHVLKTLENYLGEQTLRKGLQQYLVDYSFGN
FT                   GTPKRLWDALSKESGQAVGPIGDSYVRQTGVPLISLDTQCDLTKNQTVVTLKQQPFPNK
FT                   NAYPGLQWTVPLTLAYGQGLAKRTTLALKDTQTQTRIDGCTGVVADPSGLDYYVVNYSD
FT                   AAWSGLLTQINSSTDPVLLANLKSEAALLVANNLAPASRSTSIGSVASPAAMKLRQTPS
FT                   FGGIEPVTKQRPALQYQGIFKPRKVVTQ"
FT   misc_feature    complement(389479..390738)
FT                   /locus_tag="BCAL0358"
FT                   /note="HMMPfam hit to PF01433, Peptidase family M1, score
FT                   5.7e-59"
FT                   /inference="protein motif:HMMPfam:PF01433"
FT   misc_feature    complement(389731..389760)
FT                   /note="PS00142 Neutral zinc metallopeptidases, zinc-binding
FT                   region signature."
FT                   /inference="protein motif:Prosite:PS00142"
FT   sig_peptide     complement(390787..390915)
FT                   /locus_tag="BCAL0358"
FT                   /note="Signal peptide predicted for BCAL0358 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.606 between residues 43 and 44"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(390871..390903)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        391579..392073
FT                   /transl_table=11
FT                   /locus_tag="BCAL0359"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0359"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50669"
FT                   /db_xref="GOA:B4E6T1"
FT                   /db_xref="InterPro:IPR004864"
FT                   /db_xref="InterPro:IPR013990"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6T1"
FT                   /protein_id="CAR50669.1"
FT                   /translation="MPRALFRIAPLRAVLLLFATVFLLGGCAALTREPVRVSVAGLDPL
FT                   VGQGLEMRFSLKLRVQNPNDAPIDYDGISVALDLNGAPFASGVSDRAGTVPRFGEAVLD
FT                   VPVSVSAFAAARQAWNLPGAAANGELPYALRGRLAGSVLGTVRFNDAGTLRLPTMPGWG
FT                   G"
FT   misc_feature    391600..391668
FT                   /locus_tag="BCAL0359"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAL0359 by TMHMM2.0 at aa 27-49"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    391627..391659
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        392228..392560
FT                   /transl_table=11
FT                   /locus_tag="BCAL0360"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0360"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50670"
FT                   /db_xref="InterPro:IPR010879"
FT                   /db_xref="InterPro:IPR036913"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6T2"
FT                   /protein_id="CAR50670.1"
FT                   /translation="MAAKFELKKATNGQYYFHLKSANGEIILASERYEEKSGARNGIAS
FT                   VRDNAPLDERYERKLAHNGEPMFNLKAANHQVIGTSETYSSVQARENGIAAVKRDAPIA
FT                   ETVDLA"
FT   misc_feature    392255..392401
FT                   /locus_tag="BCAL0360"
FT                   /note="HMMPfam hit to PF07411, Domain of unknown function
FT                   (DUF1508), score 3.5e-20"
FT                   /inference="protein motif:HMMPfam:PF07411"
FT   misc_feature    392408..392554
FT                   /locus_tag="BCAL0360"
FT                   /note="HMMPfam hit to PF07411, Domain of unknown function
FT                   (DUF1508), score 5.5e-24"
FT                   /inference="protein motif:HMMPfam:PF07411"
FT   CDS_pept        392698..393831
FT                   /transl_table=11
FT                   /locus_tag="BCAL0361"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0361"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50671"
FT                   /db_xref="GOA:B4E6T3"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6T3"
FT                   /protein_id="CAR50671.1"
FT                   /translation="MTDSPVFHWTDADGVDHVVRWRSEAGVQPPKRAVPADDRLTADAA
FT                   YRLACEGTALVWQGDFQNARQLVQAMARRVERKPKKAKAAAGVDAFNLHRLAQSQRART
FT                   LGMLLIPLDADYTIPLRRAPDVRAACEEAYGPGGAPSVVSLRELLGLVGAHEWRKKGVP
FT                   IPALGGAPIHPHYGVFSPVRGEYVELVARAPLPATSLAFDIGTGTGVLAAVLASRGVEH
FT                   IVATDQDLRALACARENVARLGHAGQVEIVEANLFPPGRAPLVVCNPPWVPARPSAPIE
FT                   YAVYDPDSRMLRGFLAGLAAHLEPGGEGWLILSDFAEHLGLRPRETLLQWIDEAGLVVL
FT                   GRDDIRPAHPKSTDADDPLHAARRAEITSLWRLGARA"
FT   misc_feature    393079..393114
FT                   /note="PS00296 Chaperonins cpn60 signature."
FT                   /inference="protein motif:Prosite:PS00296"
FT   misc_feature    393202..393720
FT                   /locus_tag="BCAL0361"
FT                   /note="HMMPfam hit to PF05175, Methyltransferase small
FT                   domain, score 4.5e-09"
FT                   /inference="protein motif:HMMPfam:PF05175"
FT   misc_feature    393490..393510
FT                   /note="PS00092 N-6 Adenine-specific DNA methylases
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00092"
FT   CDS_pept        393921..394811
FT                   /transl_table=11
FT                   /locus_tag="BCAL0362"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0362"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50672"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6T4"
FT                   /protein_id="CAR50672.1"
FT                   /translation="MSNKTHEIRPEQSVELLKELHILTRDGKLNQDSRRRLKQVYHLFQ
FT                   FIEPLLAGVQADKGHVTLVDHGAGKSYLGFILYDLFFKQQPGHGTPAFASHVYGIETRE
FT                   ELVTRSTELAARLGFGGMSFLNLSVADSITSPQLPDTVDVVTALHACDTATDDAIRFAL
FT                   AKRAQHIVLVPCCQAEVAGVLRKNKGKSLANALTEVWRHPLHTREFGSQITNVLRCLQL
FT                   EAHGYQVSVTELVGWEHSMKNELIIAQYKNLPRRRPGERLNEILGMFGLAELNERFFVA
FT                   QAAPASDAAVEPAEG"
FT   CDS_pept        complement(394872..395444)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0363"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0363"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50673"
FT                   /db_xref="InterPro:IPR009858"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6T5"
FT                   /protein_id="CAR50673.1"
FT                   /translation="MTDTHPDSHDDILAATRHWLARAVIGLNLCPFAKSVYVKEQVRYA
FT                   ISEATTLEDALAELETELRLLDAADPQQVDTTLVIYPHAFADFVDYNDALFFAERLVQQ
FT                   LRLDGVLQIASFHPQYRFDGTEPDDIENYTNRAPYPILHLLREDSIARAVDAFPDASAI
FT                   YEKNQETLRRLGHEGWREWMRRPGDDV"
FT   misc_feature    complement(394899..395420)
FT                   /locus_tag="BCAL0363"
FT                   /note="HMMPfam hit to PF07209, Protein of unknown function
FT                   (DUF1415), score 4.2e-95"
FT                   /inference="protein motif:HMMPfam:PF07209"
FT   CDS_pept        complement(395521..396141)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0364"
FT                   /product="TetR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0364"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50674"
FT                   /db_xref="GOA:B4E6T6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6T6"
FT                   /protein_id="CAR50674.1"
FT                   /translation="MSGIEVAKPPARRTRRPIDGATAQEHLLRAAEELFYKEGVRTVGV
FT                   EAVVERAGVNKMSLYRQFSSKDELILAYLERMDACFFERLDTSAAKHPGQPKAQLIQYF
FT                   VDLAERATQKDYRGCPFVNVAAEFPDASHPARERVAQNKEQLMKRLVALCEGAGARQPK
FT                   ALADALALVVEGIYAASQTYRHGETPIGTAPALVTQLIEAACA"
FT   misc_feature    complement(395923..396063)
FT                   /locus_tag="BCAL0364"
FT                   /note="HMMPfam hit to PF00440, Bacterial regulatory
FT                   proteins, tetR family, score 3.2e-16"
FT                   /inference="protein motif:HMMPfam:PF00440"
FT   misc_feature    complement(395950..396015)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1033.000, SD 2.71 at aa 43-64, sequence
FT                   VGVEAVVERAGVNKMSLYRQFS"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        396361..397644
FT                   /transl_table=11
FT                   /locus_tag="BCAL0365"
FT                   /product="Major Facilitator Superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0365"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50675"
FT                   /db_xref="GOA:B4E6T7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6T7"
FT                   /protein_id="CAR50675.1"
FT                   /translation="MNWAVTRIGGRFHYGWLAAAVVFLILLAAAGTRATPSVLMVPLER
FT                   ELGWSRAAISLAISVNIALYGLTGPFAAAAMQRFGLRPTILTALVTMSAGVALSSMMTQ
FT                   SWQMVVIWGLMVGCSTGVVALTLSATFVTRWFHARRGLVMGILTASTATGQLVFLPMLA
FT                   AIAQRHGWRPVVLVVAVAAAIVIPLVAFLLPERPADVRLRPYGEPADAPPAPDATKENP
FT                   LAVAFRTLLMASRSRDFWLLFFSFFICGASTNGYVGTHLIAMCSDYGMTEVQGASLLAA
FT                   MGVFDLFGTTLSGWLSDRYDNRVLLFWYYGLRGLSLIYLPHAFGIDFFGLPLFAMFYGL
FT                   DWIATVPPTVRLATDVFGKAAAPVVFGWIVAGHQLGAAFAALGAGLLRASLGTYTIASM
FT                   ISGGLCIVGALIVLRINRGPSRAAAQAA"
FT   sig_peptide     396361..396462
FT                   /locus_tag="BCAL0365"
FT                   /note="Signal peptide predicted for BCAL0365 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.965) with cleavage site
FT                   probability 0.477 between residues 34 and 35"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(396397..396456,396514..396582,396595..396654,
FT                   396682..396750,396784..396852,396880..396939,
FT                   397081..397149,397192..397251,397270..397338,
FT                   397351..397419,397453..397521,397531..397599)
FT                   /locus_tag="BCAL0365"
FT                   /note="12 probable transmembrane helices predicted for
FT                   BCAL0365 by TMHMM2.0 at aa 13-32, 52-74, 79-98, 108-130,
FT                   142-164, 174-193, 241-263, 278-297, 304-326, 331-353,
FT                   365-387 and 391-413"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    396424..397527
FT                   /locus_tag="BCAL0365"
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 2.2e-46"
FT                   /inference="protein motif:HMMPfam:PF07690"
FT   misc_feature    396682..396714
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    397246..397296
FT                   /note="PS00283 Soybean trypsin inhibitor (Kunitz) protease
FT                   inhibitors family signature."
FT                   /inference="protein motif:Prosite:PS00283"
FT   CDS_pept        397800..398405
FT                   /transl_table=11
FT                   /locus_tag="BCAL0366"
FT                   /product="nitroreductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0366"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50676"
FT                   /db_xref="GOA:B4E6T8"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6T8"
FT                   /protein_id="CAR50676.1"
FT                   /translation="MSVKPAPTTVSIHDLIAGRWSPRAYSDEPVSAGDLHAVLEAARWA
FT                   PSAYNAQPWRFIVFDRTQDEDAFKRAFATLVPFNQGWNAPAPVLIAVTAHTLTPKGEPA
FT                   PTALYDAGAAAMSLVLQAHALGLAAHQMSGFDPKAFRDAFAIPADVAIVSIISLGHYGN
FT                   VDKLDPVLRDREKAPRTRHAIGEVVYAGAWKKSFDAAA"
FT   misc_feature    397845..398279
FT                   /locus_tag="BCAL0366"
FT                   /note="HMMPfam hit to PF00881, Nitroreductase family, score
FT                   2.4e-22"
FT                   /inference="protein motif:HMMPfam:PF00881"
FT   CDS_pept        398595..399845
FT                   /transl_table=11
FT                   /locus_tag="BCAL0367"
FT                   /product="putative chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0367"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50677"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR042054"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6T9"
FT                   /protein_id="CAR50677.1"
FT                   /translation="MTYCAIDFGTSNSAVALPDGDGMRLAPVEGDHLTLPTAIFFNNDE
FT                   ETVEYGRAALASYIDGFDGRLMRSMKSILGSPLAETTTDLGDGSAIAYTDIIARFLTHL
FT                   KRKAEARAGAPIGRAVLGRPVFFVDDDPRADRLAQDQLEAAARSVGFADVHFQYEPIAA
FT                   AFDYESRQQAERLVLVADIGGGTSDFSLVRVGPQRMARLERKDDVLAHHGVHVAGTDYD
FT                   RRVELAAILPAFGYRSLDPEGRELPNKIYLDLATWHLINTVYTPKRVGELKLMKHLYQD
FT                   VRQYDRLTSVVEQRLGHALMARAEEAKIGVAAGGETMIDLNDVEEDLLIAFDADRLVDA
FT                   SQDDTARIVDAARETVRLAGVAPRDVGALYFTGGSTGLAFLSGALAGAFPDAQPVFGDR
FT                   LASVATGLGIHAQRLFG"
FT   misc_feature    399222..399254
FT                   /note="PS00639 Eukaryotic thiol (cysteine) proteases
FT                   histidine active site."
FT                   /inference="protein motif:Prosite:PS00639"
FT   CDS_pept        complement(399947..400150)
FT                   /transl_table=11
FT                   /gene="cspD"
FT                   /locus_tag="BCAL0368"
FT                   /product="cold shock-like protein CspD"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0368"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50678"
FT                   /db_xref="GOA:B4E6U0"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6U0"
FT                   /protein_id="CAR50678.1"
FT                   /translation="MATGTVKWFNDAKGFGFITPEGGGDDLFAHFSEIRVEGFKTLQEN
FT                   QKVEFEVKTGPKGLQAANIRPV"
FT   misc_feature    complement(399950..400150)
FT                   /gene="cspD"
FT                   /locus_tag="BCAL0368"
FT                   /note="HMMPfam hit to PF00313, 'Cold-shock' DNA-binding
FT                   domain, score 2.9e-40"
FT                   /inference="protein motif:HMMPfam:PF00313"
FT   misc_feature    complement(400049..400108)
FT                   /note="PS00352 'Cold-shock' DNA-binding domain signature."
FT                   /inference="protein motif:Prosite:PS00352"
FT   CDS_pept        400571..402169
FT                   /transl_table=11
FT                   /locus_tag="BCAL0369"
FT                   /product="putative amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0369"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50679"
FT                   /db_xref="GOA:B4E6U1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6U1"
FT                   /protein_id="CAR50679.1"
FT                   /translation="MKSSIQRNIGPFALMLTGLGSIIGSGWLFGAWKAAKIAGPAAICA
FT                   WIIGAVVILAIALTYAELGAMFPESGGMVRYARYSHGSLVGFISAWANWIAIVSVIPIE
FT                   AEASIQYMSTWPYPWAHALFVNGELQTLGLLLSAVLVVVYFLLNYWGVKAFARANTAIT
FT                   IFKFLIPGLTILGLMLTSFHAENLGTASNTSFAPYGWSAVLTAVATSGIVFAFNGFQSP
FT                   VNLAGEARNPARSVPFAVITSILLALVIYVLLQMAYIGSVNPADVAKGWAHFNFSSPFA
FT                   ELAIALNLNWLAILLYVDAFISPSGTGTTYMATTTRMIYAMERNNTMPKMFGNVHPIYG
FT                   VPRQAMWFNLLVSFIFLFFFRGWSSLAAVISVATVISYLTGPISLMALRRSATDIERPL
FT                   SIPLMKLIAPFAFVCASLILYWAKWPLTGEIILLMIVALPVYFFFQAKSGWTGWGADLK
FT                   AAWWLVAYLPTMAVLSLIGSKEFGGYGLLPYGWDMLVVAAISLVFYFWGVNTGYRTQYL
FT                   DERESHDEILEGVGA"
FT   sig_peptide     400571..400669
FT                   /locus_tag="BCAL0369"
FT                   /note="Signal peptide predicted for BCAL0369 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.925) with cleavage site
FT                   probability 0.469 between residues 33 and 34"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(400595..400663,400706..400774,400811..400879,
FT                   400955..401023,401042..401110,401153..401221,
FT                   401282..401350,401408..401476,401603..401656,
FT                   401666..401734,401768..401836,401846..401902,
FT                   401939..401998,402026..402094)
FT                   /locus_tag="BCAL0369"
FT                   /note="14 probable transmembrane helices predicted for
FT                   BCAL0369 by TMHMM2.0 at aa 9-31, 46-68, 81-103, 129-151,
FT                   158-180, 195-217, 238-260, 280-302, 345-362, 366-388,
FT                   400-422, 426-444, 457-476 and 486-508"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    400607..401962
FT                   /locus_tag="BCAL0369"
FT                   /note="HMMPfam hit to PF00324, Amino acid permease, score
FT                   1.3e-15"
FT                   /inference="protein motif:HMMPfam:PF00324"
FT   CDS_pept        complement(402281..403072)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0370"
FT                   /product="putative dioxygenase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0370"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50680"
FT                   /db_xref="GOA:B4E6U2"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR014436"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6U2"
FT                   /protein_id="CAR50680.1"
FT                   /translation="MNRLPSLYLSHGAPTLPIDPALPSGAFTHLGAELPRPRAVLMLSA
FT                   HWGTQRPVASVAAHPDTIHDFYGFPQALYDIRYPAPGAPDVAERAAALLNAAGIATATT
FT                   EHGLDHGAWVPMLLMFPEADVPVAQLSIQPRADAAHHFALGRALRPLRDEGVMVIGSGQ
FT                   ITHNLRAADFGAAPEDADPRVAEFTDWFEAKLAARDVDALLDYRRQAPHAALMHPTDEH
FT                   LLPVFTALGAADDDYRLGIQSLGTYQRVLAMTNYVFASAGA"
FT   misc_feature    complement(402296..403060)
FT                   /locus_tag="BCAL0370"
FT                   /note="HMMPfam hit to PF02900, Catalytic LigB subunit of
FT                   aromatic ring-open, score 6.7e-86"
FT                   /inference="protein motif:HMMPfam:PF02900"
FT   CDS_pept        complement(403275..403871)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0371"
FT                   /product="putative aromatic acid decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0371"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50681"
FT                   /db_xref="GOA:B4E6U3"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6U3"
FT                   /protein_id="CAR50681.1"
FT                   /translation="MASSSAPPRRLIVAITGATGAIYGVRLLDLLRAAGGVETHLLISN
FT                   AGWLNIQHELKLPKADVESRADVVHSVRDVGATIASGSFATDGMVIAPCSMKTLASVAH
FT                   GLSDNLITRAADVTLKERRRLVLMVRETPFNLAHLRNMTAVTEMGGIVFPPLPAFYAMP
FT                   KTIEELVDQTVTRVLDLFALSAPLTTPWAGIRHAQ"
FT   misc_feature    complement(403482..403847)
FT                   /locus_tag="BCAL0371"
FT                   /note="HMMPfam hit to PF02441, Flavoprotein, score 1.4e-49"
FT                   /inference="protein motif:HMMPfam:PF02441"
FT   CDS_pept        complement(403896..404207)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0372"
FT                   /product="putative glutaredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0372"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50682"
FT                   /db_xref="GOA:B4E6U4"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR014434"
FT                   /db_xref="InterPro:IPR033658"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6U4"
FT                   /protein_id="CAR50682.1"
FT                   /translation="MDTQQRIKQIVDENQVVLFMKGNAQFPMCGFSGRAVQVLKACGVD
FT                   QFKTVNVLEDDEIRQGIKAFSNWPTIPQLYVKGEFIGGSDIMMEMYQSGELQQLFAAA"
FT   misc_feature    complement(403965..404162)
FT                   /locus_tag="BCAL0372"
FT                   /note="HMMPfam hit to PF00462, Glutaredoxin, score 3.1e-31"
FT                   /inference="protein motif:HMMPfam:PF00462"
FT   CDS_pept        complement(404275..405117)
FT                   /transl_table=11
FT                   /gene="hemK"
FT                   /locus_tag="BCAL0373"
FT                   /product="protein methyltransferase HemK"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0373"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50683"
FT                   /db_xref="GOA:B4E6U5"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6U5"
FT                   /protein_id="CAR50683.1"
FT                   /translation="MPDTTADALLRTSPLDAVDARVLLAHALGWTRTQLITRGDAPLDA
FT                   AAVERYRALEARRVAGEPVAQLVGMREFFGRPFDVTPDVLIPRPETELLVEAALDAIDG
FT                   LPHAAVLDLGTGSGAIAVSIAAERPDARVWALDRSPAALAVAQRNADKLLDAQRPGGPL
FT                   HWLQSDWYAALDPALAFDAIVSNPPYIAQHDPHLAQGDLRFEPRGALTDDADGLSAIRT
FT                   IVAGAGAHLKPGGTLWIEHGYDQAEAVRAILVSHGFVAVESLTDLAAIERTTGGRLPG"
FT   misc_feature    complement(404332..404847)
FT                   /gene="hemK"
FT                   /locus_tag="BCAL0373"
FT                   /note="HMMPfam hit to PF05175, Methyltransferase small
FT                   domain, score 5.3e-10"
FT                   /inference="protein motif:HMMPfam:PF05175"
FT   misc_feature    complement(404407..404787)
FT                   /gene="hemK"
FT                   /locus_tag="BCAL0373"
FT                   /note="HMMPfam hit to PF08242, Methyltransferase domain,
FT                   score 0.00082"
FT                   /inference="protein motif:HMMPfam:PF08242"
FT   misc_feature    complement(404551..404571)
FT                   /note="PS00092 N-6 Adenine-specific DNA methylases
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00092"
FT   CDS_pept        complement(405125..406207)
FT                   /transl_table=11
FT                   /gene="prfA"
FT                   /locus_tag="BCAL0374"
FT                   /product="peptide chain release factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0374"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50684"
FT                   /db_xref="GOA:B4E6U6"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E6U6"
FT                   /protein_id="CAR50684.1"
FT                   /translation="MKTSMQRKLDQLSTRLAELNDLLSRENVTADLDQYRKLTREHAEL
FT                   GPVVEQYALWRQSRSDEAAAQELLADPSMRDFAEDEIRSAREGMARLETELQKMLLPKD
FT                   PNDDRNIFLEIRAGTGGDESALFAGDLLRMYLRFAERQRWQVEMMSESASDLGGYKEVI
FT                   VRIAGQGAYSRLKFESGGHRVQRVPATETQGRIHTSACTVAVMPEADEIGEVEINPADL
FT                   RIDTFRASGAGGQHINKTDSAVRVTHIPTGIVVECQDDRSQHKNKDRALKVLAARIKDK
FT                   QYHEQHAKEAATRKSLIGSGDRSERIRTYNFPQGRMTDHRINLTLYRLEAIMDGDLDEL
FT                   IGALVTEHQAELLASLGEAD"
FT   misc_feature    complement(405245..405586)
FT                   /gene="prfA"
FT                   /locus_tag="BCAL0374"
FT                   /note="HMMPfam hit to PF00472, Peptidyl-tRNA hydrolase
FT                   domain, score 1.3e-72"
FT                   /inference="protein motif:HMMPfam:PF00472"
FT   misc_feature    complement(405674..406021)
FT                   /gene="prfA"
FT                   /locus_tag="BCAL0374"
FT                   /note="HMMPfam hit to PF03462, PCRF domain, score 4e-62"
FT                   /inference="protein motif:HMMPfam:PF03462"
FT   CDS_pept        complement(406300..407598)
FT                   /transl_table=11
FT                   /gene="hemA"
FT                   /locus_tag="BCAL0375"
FT                   /product="glutamyl-tRNA reductase"
FT                   /EC_number="1.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0375"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50685"
FT                   /db_xref="GOA:B4E6U7"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E6U7"
FT                   /protein_id="CAR50685.1"
FT                   /translation="MQLLTIGINHHTAPVALRERVAFPLEQIKPALVTFKNVFLGPQAP
FT                   NTPEAAILSTCNRTELYCATDDRAAREGALRWLSEYHRIPVDELAPHVYALPQSEAVRH
FT                   AFRVASGLDSMVLGETQILGQMKDAVRTATEAGALGTYLNQLFQRTFAVAKEVRGTTEI
FT                   GTQSVSMAAAAVRLAQRIFEKVSDQRVLFIGAGEMIELCATHFAAQGPRELVVANRTAE
FT                   RGQRLAERFNGRAMPLADLPTRMHEFDIIVSCTASTLPIIGLGAVERAVKARRHRPIFM
FT                   VDLAVPRDIEPEVGKLKDVFLYTVDDLGAIVREGNASRQAAVAQAEAIIETRVQNFMQW
FT                   LDTRSVVPVIRHMHTQADALRRAEVEKAQKLLARGDDPAAVLEALSQALTNKLIHGPTS
FT                   ALNRVNGADRDSLIDLMRGFYQHAPRSNDQSGH"
FT   misc_feature    complement(406330..406629)
FT                   /gene="hemA"
FT                   /locus_tag="BCAL0375"
FT                   /note="HMMPfam hit to PF00745, Glutamyl-tRNAGlu reductase,
FT                   dimerisation, score 2.9e-25"
FT                   /inference="protein motif:HMMPfam:PF00745"
FT   misc_feature    complement(406666..407103)
FT                   /gene="hemA"
FT                   /locus_tag="BCAL0375"
FT                   /note="HMMPfam hit to PF01488, Shikimate / quinate
FT                   5-dehydrogenase, score 3.4e-65"
FT                   /inference="protein motif:HMMPfam:PF01488"
FT   misc_feature    complement(407113..407583)
FT                   /gene="hemA"
FT                   /locus_tag="BCAL0375"
FT                   /note="HMMPfam hit to PF05201, Glutamyl-tRNAGlu reductase,
FT                   N-terminal d, score 1.9e-66"
FT                   /inference="protein motif:HMMPfam:PF05201"
FT   CDS_pept        complement(407625..408389)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0376"
FT                   /product="two-component regulatory system, response
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0376"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50686"
FT                   /db_xref="GOA:B4E6U8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6U8"
FT                   /protein_id="CAR50686.1"
FT                   /translation="MRIALIDPESRHTALLNRLLFAGGHVCHAFPSSAAFFEWLAADNT
FT                   CDMLVTGHWAGDQPAQEVIPRAQAVLPGLPAIAVMQSARESEIVSCLHAGADDCLVRPV
FT                   SGPELPARVNALSRRAGVRRPPTRSREMYGEYAFDATHCLVRFGDAIVSLTPKEFRFAQ
FT                   LLFTNLSRPVSRAHILETVWARRRDMKSRTLDTHASRLRSKLQLLPERGYRLLPLYGFG
FT                   YQLDRVPIEPPNSRPRHADARYAASEEIAETL"
FT   misc_feature    complement(407745..407948)
FT                   /locus_tag="BCAL0376"
FT                   /note="HMMPfam hit to PF00486, Transcriptional regulatory
FT                   protein, C te, score 4.9e-12"
FT                   /inference="protein motif:HMMPfam:PF00486"
FT   misc_feature    complement(408048..408389)
FT                   /locus_tag="BCAL0376"
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 0.0012"
FT                   /inference="protein motif:HMMPfam:PF00072"
FT   CDS_pept        408561..408815
FT                   /transl_table=11
FT                   /locus_tag="BCAL0376a"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0376a"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50687"
FT                   /db_xref="GOA:B4E6U9"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6U9"
FT                   /protein_id="CAR50687.1"
FT                   /translation="MNWFGILVLGAAVGLFGRWLHPMRRTGRPAWWIAVLVGIVGAAAA
FT                   RMVGNLSGLFYDGETLEWPVCTGVAFLAVAVTVALSARR"
FT   misc_feature    join(408570..408623,408642..408710,408738..408806)
FT                   /locus_tag="BCAL0376a"
FT                   /note="3 probable transmembrane helices predicted for
FT                   BCAL0376a by TMHMM2.0 at aa 4-21, 28-50 and 60-82"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        408834..410648
FT                   /transl_table=11
FT                   /locus_tag="BCAL0377"
FT                   /product="metallo peptidase, subfamily M24B"
FT                   /note="subfamily M24B metallo peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0377"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50688"
FT                   /db_xref="GOA:B4E6V0"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR032416"
FT                   /db_xref="InterPro:IPR033740"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6V0"
FT                   /protein_id="CAR50688.1"
FT                   /translation="MNARLPEVSPVPARLALLRDAMVRENLAAYLVPSADPHLSEYLPE
FT                   RWQARRWLSGFTGSVGTLVVTADFAGLWVDSRYWVQADAELAGTGVQLMKMTGGQQSAP
FT                   HVDWLAQNVAAGATVGVDGAVLGVTAARGLTAALSARGIALRTDVDLLDAIWPERPGLP
FT                   GDAVFEHVAPQADTTRASKLADVRRAMHAQGAQWHFVSTLDDLAWLFNLRGADVNFNPV
FT                   FVAHAMIGTDRATLFVADGKVPPALAASLAQDGVDVRAYDAARASLAALPDGATLLIDP
FT                   RRVTFGTLEAVPAGVKLVEAVNPSTFAKSRKTTAEIEHVRVTMEHDGAALAEFFAWFEQ
FT                   AVNRETITELTIEEKLTAARARRPGYVSASFATIAGFNANGAMPHYHATRESHATIAGD
FT                   GLLLIDSGGQYVTGTTDITRVVPVGTVSDLQRRDFTIVLKSMMALSRARFPRGIRSPML
FT                   DAIARAPMWAAGLDYGHGTGHGVGYFLNVHEGPQVISHYAPAEPYTAMEEGMITSIEPG
FT                   VYRPGQWGIRIENLVVNRAAGQTEFGDFLAFETLTLCPIDTRCVLIEMLHDEERAWLNT
FT                   YHATVRERVGRHVSGDAKAWLDARTQPI"
FT   misc_feature    409797..410492
FT                   /locus_tag="BCAL0377"
FT                   /note="HMMPfam hit to PF00557, metallopeptidase family M24,
FT                   score 8.1e-11"
FT                   /inference="protein motif:HMMPfam:PF00557"
FT   CDS_pept        410746..411297
FT                   /transl_table=11
FT                   /locus_tag="BCAL0378"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0378"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50689"
FT                   /db_xref="GOA:B4E6V1"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6V1"
FT                   /protein_id="CAR50689.1"
FT                   /translation="MADTAVIVVDMQRGLVERARPAYRLDDVVSGINRLTAAARAANAP
FT                   VCFVQHDGDADDDVVPGTPGWELHAGLVVGRDDWRVRKQASDAFHDTPLAAQLDRHGIR
FT                   SVLICGYATEFCVDSAARRAALLGYRTTVVSDLHTTNERVHLSAAQIVAHHHFIWNNNS
FT                   LSGNAVTPRPLADVLATEFA"
FT   misc_feature    410746..411279
FT                   /locus_tag="BCAL0378"
FT                   /note="HMMPfam hit to PF00857, Isochorismatase family,
FT                   score 2.4e-11"
FT                   /inference="protein motif:HMMPfam:PF00857"
FT   CDS_pept        411294..411917
FT                   /transl_table=11
FT                   /locus_tag="BCAL0379"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0379"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50690"
FT                   /db_xref="GOA:B4E6V2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6V2"
FT                   /protein_id="CAR50690.1"
FT                   /translation="MTIKAVVFDFGGVLIDWSPEYLYRELIPDDAERRWFLTHVCAMDW
FT                   VVRQDGGQTIEEGTAELVAKFPEHEALIRVFYARWHEMIGGVLEEGADLVDRLDAQGMP
FT                   LFGLTNWSAQTFPYAWDNFPVLRRFKDIVVSGRVKLVKPDPAIYREMHARIEPHLPGIA
FT                   SHELVFIDDNAKNAAAATALGWHGIHHTSAAATEARLRELGALV"
FT   misc_feature    411300..411872
FT                   /locus_tag="BCAL0379"
FT                   /note="HMMPfam hit to PF00702, haloacid dehalogenase-like
FT                   hydrolase, score 0.00075"
FT                   /inference="protein motif:HMMPfam:PF00702"
FT   CDS_pept        complement(412058..413725)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0380"
FT                   /product="ABC transporter ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0380"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50691"
FT                   /db_xref="GOA:B4E6V3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6V3"
FT                   /protein_id="CAR50691.1"
FT                   /translation="MAQYVFTMNRVGKIVPPKRQILKDISLSFFPGAKIGVLGLNGSGK
FT                   STLIRIMAGVDKDIEGEATPMPNLNIGYLPQEPQLDPTKTVREAVEEGLGDLFQANKKL
FT                   EEIYAAYAEPDADFDALAAEQAKYEAILASSDGGSPEQQLEVAADALRLPPWDAKIEHL
FT                   SGGEKRRVALCKLLLEKPDMLLLDEPTNHLDAESVDWLEQFLVRFPGTVVAVTHDRYFL
FT                   DNAAEWILELDRGHGIPWKGNYSSWLDQKEERLKQEEASESARQKAIKKELEWVRQNPK
FT                   GRQAKSKARIARFEELSSQEYQKRNETQEIFIPAGERLGNEVIEFKNVSKSFGDRLLID
FT                   NLSFKIPAGAIVGIIGPKGAGKSTLFKMLTGKEQPDSGEVVMGPTVKLAYVDQSRDALD
FT                   GSKTVFEEISGGADVLTVGKYETPSRAYIGRFNFKGGDQQKIVGNLSGGERGRLHLAKT
FT                   LISGGNVLLLDEPSNDLDVETLRALEDALLEFAGSVMVISHDRWFLDRIATHILAFEGD
FT                   SQVTFFDGNYQEYEADKRARLGEEAAKPKRLRYKPISR"
FT   misc_feature    complement(412175..412681)
FT                   /locus_tag="BCAL0380"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   1.3e-47"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    complement(412637..412660)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    complement(413021..413632)
FT                   /locus_tag="BCAL0380"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   2.1e-55"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    complement(413195..413239)
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    complement(413588..413611)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(413894..414202)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0381"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0381"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50692"
FT                   /db_xref="InterPro:IPR022236"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6V4"
FT                   /protein_id="CAR50692.1"
FT                   /translation="MRALLRRATHVATLSAALFVACTALPPAAHAYRASPGYGDEADLD
FT                   RHDTYRNRDGETVHAPAHSKSGRVPDGASARCRDGTYSFSRHRRGTCSGHGGVAAWL"
FT   sig_peptide     complement(414110..414202)
FT                   /locus_tag="BCAL0381"
FT                   /note="Signal peptide predicted for BCAL0381 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.983 between residues 31 and 32"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(414137..414169)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(414292..415209)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0382"
FT                   /product="LysR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0382"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50693"
FT                   /db_xref="GOA:B4E6V5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6V5"
FT                   /protein_id="CAR50693.1"
FT                   /translation="MNRSRLPPLNALRAFEAAARHLSVKSAAEELSVTPGAVSQMIRTL
FT                   ETHLGVQLFERVNRGILLTAAGRDYLPPVRNAFRQIADASQRVSGAADSGVLTVSVTPF
FT                   FASAWLVPRLAQFRQACPDVDLQVVTSHALADFARDGVDVAIRHGLGRYIGLCSERLLT
FT                   VEIVALASPDLVARLGMPATPAELVGWPQLHDAERKGWHIWFGAQRIDDFGPPRGPAFD
FT                   DSGLLLQAIVAGQGAGLLPAAMVRGELASGRLVQLADVAWLDDFAYYLVYPPHHAERPK
FT                   VAAFRRWILDAAQADGAASMAGAA"
FT   misc_feature    complement(414328..414942)
FT                   /locus_tag="BCAL0382"
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 7.3e-43"
FT                   /inference="protein motif:HMMPfam:PF03466"
FT   misc_feature    complement(415006..415185)
FT                   /locus_tag="BCAL0382"
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix, score 2.4e-19"
FT                   /inference="protein motif:HMMPfam:PF00126"
FT   misc_feature    complement(415051..415143)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00044"
FT   misc_feature    complement(415081..415146)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1614.000, SD 4.68 at aa 22-43, sequence
FT                   LSVKSAAEELSVTPGAVSQMIR"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        415379..416671
FT                   /transl_table=11
FT                   /locus_tag="BCAL0383"
FT                   /product="Major Facilitator Superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0383"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50694"
FT                   /db_xref="GOA:B4E6V6"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6V6"
FT                   /protein_id="CAR50694.1"
FT                   /translation="MEPERSIVMNRPSASRLFYGWYVVAAAFAVTFVGFGSAYTFSAFV
FT                   ESLQRDFAASRGQISLVFSLAGFLYFGFGIVSGPLADRFGSRRLAVVGMLLTGAGLAAA
FT                   GAARTLLQVYVAYGLGVGFGVGCAYVPAVGAVQRWFVRRRGFASGLAVAGIGVGTLVMP
FT                   PLASALIAQVGWRGAYFTLAAIALVLGAGMSLLIENDPRGRGLLPDGEVARDGGGRHAG
FT                   ASPAAANAPAGATVREAVTSRPFASLYAACLVCSFGVFVPFVHLVPYALDHGVAPSTAV
FT                   LLLGAIGVGSTAGRFFLGGLADRFGRRASLLAMFAGMAVALVAWAGAGTVATLAAFALV
FT                   FGVFYGGWVAVLPAVVMDYFGGRNVSAIIGILYTSVAFGTLVGPAAAGFIYDAGGGYLV
FT                   PILASAAANAIAFAIVATTGRAPAAARAAGG"
FT   misc_feature    join(415427..415495,415553..415621,415640..415708,
FT                   415718..415786,415823..415891,415901..415969,
FT                   416111..416179,416207..416275,416309..416365,
FT                   416378..416446,416480..416548,416558..416626)
FT                   /locus_tag="BCAL0383"
FT                   /note="12 probable transmembrane helices predicted for
FT                   BCAL0383 by TMHMM2.0 at aa 17-39, 59-81, 88-110, 114-136,
FT                   149-171, 175-197, 245-267, 277-299, 311-329, 334-356,
FT                   368-390 and 394-416"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    415454..416554
FT                   /locus_tag="BCAL0383"
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 1.8e-56"
FT                   /inference="protein motif:HMMPfam:PF07690"
FT   misc_feature    415727..415759
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    416270..416317
FT                   /note="PS00216 Sugar transport proteins signature 1."
FT                   /inference="protein motif:Prosite:PS00216"
FT   CDS_pept        416753..417100
FT                   /transl_table=11
FT                   /locus_tag="BCAL0384"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0384"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50695"
FT                   /db_xref="InterPro:IPR007351"
FT                   /db_xref="InterPro:IPR038056"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6V7"
FT                   /protein_id="CAR50695.1"
FT                   /translation="MTFDEVRQIALAWRGVEEGTSYGTPALKVKGKLLARLREDGDTLV
FT                   VKGVGPDERAWLIESAPDVYYVTDHYVGWPIVLVRLSAAHPDAVKNLLLREWHAIVPAQ
FT                   WRNEAAARDAN"
FT   misc_feature    416753..417088
FT                   /locus_tag="BCAL0384"
FT                   /note="HMMPfam hit to PF04944, Uncharacterised BCR
FT                   (COG3801), score 2.3e-34"
FT                   /inference="protein motif:HMMPfam:PF04944"
FT   CDS_pept        417477..418868
FT                   /transl_table=11
FT                   /locus_tag="BCAL0385"
FT                   /product="putative amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0385"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50696"
FT                   /db_xref="GOA:B4E6V8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="InterPro:IPR011265"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6V8"
FT                   /protein_id="CAR50696.1"
FT                   /translation="MSGSNTGLGTGLKQRHVTMMSIAGVIGAGLFVGSGHAIAEAGPAS
FT                   ILAYAIAGVLVVLVMRMLGEMAVAHPDSGSFSTYADRAIGHWAGFTIGWLYWWFWVLVI
FT                   PIEATAAATILNAWFPGIATWIFALGITLLLTITNLFSVKNYGEFEFWFALIKVVAIVV
FT                   FLCIGGAAIVGIIPAPSVSGVSNLFVHDGFMPHGASAVLAAMLTTMFSFLGTEIVTIAA
FT                   AESDNPQRQIVRATNSVIWRITLFYLGSILVVAAIVPWNDPLLPKHGSYQRAMELIGIP
FT                   NAKAIIDVIVLVSVASCLNSALYTASRMLFSLSRRKDAPAFLHRTDSTGTPRAAVLAST
FT                   AFGFLTVIANYLMPEQVFGFLLATSGAIALLVYLVIAISQLRMRKTLEAGGADLTLRMW
FT                   LFPWLTWAVILFICGTLTVMFVSEEHRMEVGATAVLALIVLFASWLNKRGRDAQANAGR
FT                   RVSAT"
FT   sig_peptide     417477..417593
FT                   /locus_tag="BCAL0385"
FT                   /note="Signal peptide predicted for BCAL0385 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.805) with cleavage site
FT                   probability 0.658 between residues 39 and 40"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    417522..418844
FT                   /locus_tag="BCAL0385"
FT                   /note="HMMPfam hit to PF00324, Amino acid permease, score
FT                   4.6e-146"
FT                   /inference="protein motif:HMMPfam:PF00324"
FT   misc_feature    join(417525..417593,417606..417665,417726..417794,
FT                   417837..417905,417939..418007,418050..418118,
FT                   418188..418256,418329..418397,418476..418535,
FT                   418545..418613,418671..418739,418752..418811)
FT                   /locus_tag="BCAL0385"
FT                   /note="12 probable transmembrane helices predicted for
FT                   BCAL0385 by TMHMM2.0 at aa 17-39, 44-63, 84-106, 121-143,
FT                   155-177, 192-214, 238-260, 285-307, 334-353, 357-379,
FT                   399-421 and 426-445"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    417597..417689
FT                   /note="PS00218 Amino acid permeases signature."
FT                   /inference="protein motif:Prosite:PS00218"
FT   CDS_pept        419122..420333
FT                   /transl_table=11
FT                   /locus_tag="BCAL0386"
FT                   /product="putative exported metallo-beta-lactamase
FT                   superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0386"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50697"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6V9"
FT                   /protein_id="CAR50697.1"
FT                   /translation="MSIRHLFSSALAATALLGAASASIAAPLTVDVYNPGAHAIFPVSS
FT                   EIVSGKTEAILIDAQFQRNDAQALVSRIKASGKTLKAVYVSHSDPDYYFGLETIHAAFP
FT                   DAKIVATPQTVAAIAASKDGKLAYWGPILKDNAPASVIVPQPLDGNTLRVDGEPLRIVG
FT                   LDGPTPDRTFVWIPSARTVVGGIPVAANIHVWMADTQTPLSHANWLATLDRIDALKPAR
FT                   VVPGHFLPNRDGSQPFTTGVAFTRNYVKAFDQEAARAKDSTTLIAAMEARYPDLGEKPS
FT                   LELSAKVAKGEMQWPAPAPFPAAGKTVRVQFGATAFDLNFKDDRTMSFVGTAGQFKGVT
FT                   DTVQYTAREVRPQVYMVYWHEPSTGSNVVHVEDFERGAVDTNIAMKDGQFLHLSGTLKV
FT                   VGRE"
FT   sig_peptide     419122..419196
FT                   /locus_tag="BCAL0386"
FT                   /note="Signal peptide predicted for BCAL0386 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.988 between residues 25 and 26"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    419245..419802
FT                   /locus_tag="BCAL0386"
FT                   /note="HMMPfam hit to PF00753, Metallo-beta-lactamase
FT                   superfamily, score 5.6e-17"
FT                   /inference="protein motif:HMMPfam:PF00753"
FT   misc_feature    419746..419775
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00339"
FT   CDS_pept        complement(420407..421501)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0387"
FT                   /product="putative GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0387"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50698"
FT                   /db_xref="GOA:B4E6W0"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6W0"
FT                   /protein_id="CAR50698.1"
FT                   /translation="MSLKCGIVGLPNVGKSTLFNALTKAGIAAENYPFCTIEPNVGIVE
FT                   VPDTRLKALSEIVKPERVVPAVVEFVDIAGLVAGASKGEGLGNQFLANIRETDAITHVV
FT                   RCFEDENVIHVAGKVSPIDDIEVINTELALADLGTIEKALTRYSKAAKSGNDKEAAKLV
FT                   AVLEKVRAQLDQGKAVRGLALSDDEQALIKPFCLITAKPAMYVANVKDDGFENNPHLEA
FT                   VRKYAESENAPVVAVCAAIEAEIADLDDADKEAFLADMGMEEPGLDRVIRAGFKLLGLQ
FT                   TYFTAGVKEVRAWTIHIGDTAPQAAGVIHTDFERGFIRAQTIAFDDFVTYKGEQGAKEA
FT                   GKMRAEGKEYVVHDGDVMNFLFNV"
FT   misc_feature    complement(420413..420664)
FT                   /locus_tag="BCAL0387"
FT                   /note="HMMPfam hit to PF06071, Protein of unknown function
FT                   (DUF933), score 2.7e-59"
FT                   /inference="protein motif:HMMPfam:PF06071"
FT   misc_feature    complement(421133..421495)
FT                   /locus_tag="BCAL0387"
FT                   /note="HMMPfam hit to PF01926, GTPase of unknown function,
FT                   score 1.6e-31"
FT                   /inference="protein motif:HMMPfam:PF01926"
FT   misc_feature    complement(421454..421477)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    complement(421475..421501)
FT                   /note="PS00443 Glutamine amidotransferases class-II active
FT                   site."
FT                   /inference="protein motif:Prosite:PS00443"
FT   CDS_pept        421748..422926
FT                   /transl_table=11
FT                   /locus_tag="BCAL0388"
FT                   /product="putative monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0388"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50699"
FT                   /db_xref="GOA:B4E6W1"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6W1"
FT                   /protein_id="CAR50699.1"
FT                   /translation="MPAMTAHHSFDVAVVGGGLVGKTAALALTQSGYKTALLAQPATPR
FT                   AADLAFDTRVYALSSSSQALLERLRVWQALDHSRLAPVYDMRVYGDAHAELHFSAYQAS
FT                   VPQLAWIAESSLVEASLDAALRFQPNLTWFDARAQGFDVRDDAAVLTLSSGQVLEADLV
FT                   VGADGAHSWVRSQMGARVERRDYRQTGVVANFKASLPHRETAYQWFHEGEIIALLPLPD
FT                   GHVSLVWSAHTAHADALLALDPAQLAAEVERVSHGQVGALECVTPAAGFPLALQTVDKL
FT                   IAPRVALVGDAAHLIHPLAGQGMNLGLRDVAALADAIAGKESFRNLGDTVLLRRYERSR
FT                   REDIRALMVATDGLQRLFAVPGSLAKAVRNAGMAFVGAQPLVKRWLVSAALG"
FT   misc_feature    421772..422800
FT                   /locus_tag="BCAL0388"
FT                   /note="HMMPfam hit to PF01494, FAD binding domain, score
FT                   3e-10"
FT                   /inference="protein motif:HMMPfam:PF01494"
FT   misc_feature    421793..421816
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    422636..422677
FT                   /note="PS01304 ubiH/COQ6 monooxygenase family signature."
FT                   /inference="protein motif:Prosite:PS01304"
FT   CDS_pept        423017..423745
FT                   /transl_table=11
FT                   /gene="dsbC"
FT                   /locus_tag="BCAL0389"
FT                   /product="thiol:disulfide interchange protein DsbC"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0389"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50700"
FT                   /db_xref="GOA:B4E6W2"
FT                   /db_xref="InterPro:IPR009094"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR018950"
FT                   /db_xref="InterPro:IPR033954"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6W2"
FT                   /protein_id="CAR50700.1"
FT                   /translation="MKKTIRIASLALAVTMATLGCTAQADQTTDKLKATLQARLGNDAP
FT                   IKSVSKSPVAGLYEVNLGSQIIYSDAAGDYVLLGDLVDAKTHKNLTDARLSEINKIDFA
FT                   SLPFANAIKVVKGNGARKIAVFSDPNCPYCKKLETTLQSVDNVTVYTFLYPVLSPDSTA
FT                   KSKAIWCATDRAKTWESWMLDHRAPSGAGTCDTSALDKNLALGRGMNVTGTPTIFLPDG
FT                   RRLPGAVSADQLNQALASSK"
FT   sig_peptide     423017..423091
FT                   /gene="dsbC"
FT                   /locus_tag="BCAL0389"
FT                   /note="Signal peptide predicted for BCAL0389 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.981 between residues 25 and 26"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    423047..423079
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    423383..423439
FT                   /note="PS00194 Thioredoxin family active site."
FT                   /inference="protein motif:Prosite:PS00194"
FT   CDS_pept        423851..425650
FT                   /transl_table=11
FT                   /locus_tag="BCAL0390"
FT                   /product="metallo peptidase, family M61"
FT                   /note="family M61 metallo peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0390"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50701"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR007963"
FT                   /db_xref="InterPro:IPR024191"
FT                   /db_xref="InterPro:IPR034019"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR040756"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6W3"
FT                   /protein_id="CAR50701.1"
FT                   /translation="MTQPIRYSIVPKDLAAHLFEVTVTVADPDPEGQRFSLPVWIPGSY
FT                   LVREFARNIVTLRAFNDAGRKVRIAKTDKHTWQAAPVTGALTLRYDVYAWDLSVRSAYL
FT                   DESGGFFNATAVFLSVAGREDAPCEVDIAKPAGAAFRTWRVGTALPEAGGTRRYGFGAY
FT                   RAANYDELSDHPVTIGEFALATFDAHGVPHDIVIAGRVTQLDLERLRNDLKRVCEAQIA
FT                   LFEPKSKKAPMDRYVFMTLAVSDGYGGLEHRASTALICNRTDLPVKGRPETTEGYRTYL
FT                   GLCSHEYFHTWNVKRIKPAAFVPYDLTRENYTSLLWLFEGFTSYYDDLMLVRSGLMSQD
FT                   DYFAALGRTVGGVLRGTGRLKQSVAESSFDAWIKYYRQDENATNAIVSYYTKGSLVALA
FT                   FDLAIRAQTRNRKSLDDVMRLLWQRYGRDFYRGKQAGVEENEVETLIEEATGVALGRLF
FT                   ADAVHGTRDLPLAELLAPFGVTLTPDVATGAAAKPTIGARPRGGADCTLAAVYEGGAAH
FT                   RAGLSAGDTLIAVDGLRVTGTNLDALLARYRPGDKVEVHAFRRDELRTAKLKLDGPEVT
FT                   RYRLTAAAKPAAATKAREAWLKG"
FT   misc_feature    424679..425041
FT                   /locus_tag="BCAL0390"
FT                   /note="HMMPfam hit to PF05299, M61 glycyl aminopeptidase,
FT                   score 6.5e-71"
FT                   /inference="protein motif:HMMPfam:PF05299"
FT   misc_feature    424697..424726
FT                   /note="PS00142 Neutral zinc metallopeptidases, zinc-binding
FT                   region signature."
FT                   /inference="protein motif:Prosite:PS00142"
FT   misc_feature    425252..425524
FT                   /locus_tag="BCAL0390"
FT                   /note="HMMPfam hit to PF00595, PDZ domain (Also known as
FT                   DHR or GLGF), score 0.018"
FT                   /inference="protein motif:HMMPfam:PF00595"
FT   CDS_pept        425798..426394
FT                   /transl_table=11
FT                   /gene="acpD"
FT                   /locus_tag="BCAL0391"
FT                   /product="acyl carrier protein phosphodiesterase"
FT                   /EC_number="3.1.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0391"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50702"
FT                   /db_xref="GOA:B4E6W4"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6W4"
FT                   /protein_id="CAR50702.1"
FT                   /translation="MTTILQINSAARSQGAQSTLLANELTAKLQQSNPGANVVVRDLLA
FT                   DALPHLDESVLGAFFTPADKRTAEQNAIVAKSDALIAELQAADIIVIGAPMYNFGVSSQ
FT                   LKTYFDWIARAGVTFRYTENGPEGLIKGKKVHVVTARGGKYLGTPNDSHTPYLRSFLGF
FT                   IGLTDVNFIHAEGLNLGPDAQSAALASAREAIAAA"
FT   misc_feature    425801..426388
FT                   /gene="acpD"
FT                   /locus_tag="BCAL0391"
FT                   /note="HMMPfam hit to PF03358, NADPH-dependent FMN
FT                   reductase, score 0.00038"
FT                   /inference="protein motif:HMMPfam:PF03358"
FT   repeat_region   426460..426463
FT                   /note="duplicated insertion sequence target"
FT   mobile_element  426464..427902
FT                   /mobile_element_type="insertion sequence:ISBcen9"
FT                   /note="putative IS element - ISBcen9"
FT   repeat_region   426464..426488
FT                   /note="IS element imperfect inverted repeat region"
FT   CDS_pept        426509..427033
FT                   /transl_table=11
FT                   /locus_tag="BCAL0392"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0392"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50703"
FT                   /db_xref="GOA:B4E6E7"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6E7"
FT                   /protein_id="CAR50703.1"
FT                   /translation="MARYTEQFKLSVVKRCIGGEAIRAVARTHGLSHSTVSQWYATYQA
FT                   HGKDGVRRKYNSYDVAFRLKVVQHMREHGVSSKEAAARFNIRNPSAVLEWARRYDDGGL
FT                   TALAPRPKGRRPTAMPKTPPAQPLNPTDGTDTRTREDLLQELNYLRMENAYLKKLRALV
FT                   QAQAVPRKKRK"
FT   misc_feature    426566..426631
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1703.000, SD 4.99 at aa 20-41, sequence
FT                   EAIRAVARTHGLSHSTVSQWYA"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        427033..427869
FT                   /transl_table=11
FT                   /locus_tag="BCAL0393"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0393"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50704"
FT                   /db_xref="GOA:B4E6E8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6E8"
FT                   /protein_id="CAR50704.1"
FT                   /translation="MLELRQQFPLAGLLRVAGLARSTFYYQCKALAAPDRHASVKAKIR
FT                   ALFEQHKGRYGYRRITLALRRLGQMINHKTVARLMRKMQLKSCVRVKKYRAYRGNTCKT
FT                   APHLLQRQFHAARPNEKWVTDITEFSVGGQKLYLSPVLDLYNGEIIAYQTHTRPAFQMV
FT                   TDMLRKALRRLQPDERPMLHSDQGWHYQMPGWRLMLEQRSLAQSMSRKGNCLDNAAMES
FT                   FFGTLKSEFFYLNHFSSIEQLRIGLKRYIRYYNHERIKLKLKGLSPVQYRTQPHPA"
FT   misc_feature    427372..427851
FT                   /locus_tag="BCAL0393"
FT                   /note="HMMPfam hit to PF00665, Integrase core domain, score
FT                   5.1e-42"
FT                   /inference="protein motif:HMMPfam:PF00665"
FT   repeat_region   complement(427878..427902)
FT                   /note="IS element imperfect inverted repeat region"
FT   repeat_region   427903..427906
FT                   /note="duplicated insertion sequence target"
FT   CDS_pept        complement(427963..428823)
FT                   /transl_table=11
FT                   /gene="ung"
FT                   /locus_tag="BCAL0394"
FT                   /product="uracil-DNA glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /note="Similar to Escherichia coli uracil-DNA glycosylase
FT                   Udg UniProt:P12295 (EMBL:ECRBAB) (228 aa) fasta scores:
FT                   E()=2.4e-40, 56.306% id in 222 aa. CDS is extended at the
FT                   N-terminus in comparison to orthologues. Possible
FT                   alternative upstream translational start site"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0394"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50705"
FT                   /db_xref="GOA:B4E6W7"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:B4E6W7"
FT                   /protein_id="CAR50705.1"
FT                   /translation="MPETAPADLPSPASEPPAAARKAAKKTAPPASAPTPAAAAPQSVA
FT                   ADVPHLAAQFDALPAVWRDVLKPFIDSDAYAPLCRFVDDERAAGKTVYPTDVFRALRLT
FT                   HPDDVKVVILGQDPYHGDDRGTPQAHGLAFSVPPAVRTPPSLRNIFKEIAANFGHDTPR
FT                   HGCLDTWARQGVLLLNTVLTVERGAAASHAKRGWEQCTDTLIRELANRHRGLVFMLWGA
FT                   HAQAKRALFDPSEHCVLEAPHPSPLSAHRGFLGCRHFALANDYLVDAGRAPIDWRLPDV
FT                   AETFA"
FT   misc_feature    complement(428023..428520)
FT                   /gene="ung"
FT                   /locus_tag="BCAL0394"
FT                   /note="HMMPfam hit to PF03167, Uracil DNA glycosylase
FT                   superfamily, score 2.1e-71"
FT                   /inference="protein motif:HMMPfam:PF03167"
FT   misc_feature    complement(428467..428496)
FT                   /note="PS00130 Uracil-DNA glycosylase signature."
FT                   /inference="protein motif:Prosite:PS00130"
FT   CDS_pept        complement(428894..429520)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0395"
FT                   /product="putative adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0395"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50706"
FT                   /db_xref="GOA:B4E7A6"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="InterPro:IPR039013"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7A6"
FT                   /protein_id="CAR50706.1"
FT                   /translation="MAIEKEIKLALPAGQADAARRFFETLTGEPGHAITLANVYYDTPD
FT                   LALARSKSAVRVRRTPDGWLQTFKTVGSAEGGLHRRHEWELPVAGDALEIDALVAACDV
FT                   PEAAAALNDAAGALYALFRTDFSRTLWRIAIGGATVEAAVDLGEIVVQAERDTRREPIS
FT                   EIELELIDGPETALATLAAELQQALPGLVPENISKAQRGYRLRAQ"
FT   misc_feature    complement(428897..429517)
FT                   /locus_tag="BCAL0395"
FT                   /note="HMMPfam hit to PF01928, CYTH domain, score 2.2e-40"
FT                   /inference="protein motif:HMMPfam:PF01928"
FT   CDS_pept        complement(429520..430305)
FT                   /transl_table=11
FT                   /gene="trpC"
FT                   /locus_tag="BCAL0396"
FT                   /product="indole-3-glycerol phosphate synthase"
FT                   /EC_number="4.1.1.48"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0396"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50707"
FT                   /db_xref="GOA:B4E7A7"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7A7"
FT                   /protein_id="CAR50707.1"
FT                   /translation="MSDILDRIIAVKREEVATAMRSTPLEALKLDASARDLRDFVGALR
FT                   AKHAAGNAAVIAEIKKASPSKGVLREHFVPADIARSYAAHGAACLSVLTDEQFFQGGVR
FT                   YLEEARAACSLPVLRKDFIVDAYQIVEARAMGADAILLIAAALDTPLMQDLEAYAHSLG
FT                   LAVLVEVHDRHEMEQALTLKTPLLGINNRNLRTFETSIQTTLDMLDMIPADRIVVTESG
FT                   ILSRTDVDTMRAANVNTFLVGEAFMRADQPGEELARMFF"
FT   misc_feature    complement(429529..430296)
FT                   /gene="trpC"
FT                   /locus_tag="BCAL0396"
FT                   /note="HMMPfam hit to PF00218, Indole-3-glycerol phosphate
FT                   synthase, score 8.4e-129"
FT                   /inference="protein motif:HMMPfam:PF00218"
FT   misc_feature    complement(430099..430143)
FT                   /note="PS00614 Indole-3-glycerol phosphate synthase
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00614"
FT   CDS_pept        complement(430334..431365)
FT                   /transl_table=11
FT                   /gene="trpD"
FT                   /locus_tag="BCAL0397"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.18"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0397"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50708"
FT                   /db_xref="GOA:B4E7A8"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E7A8"
FT                   /protein_id="CAR50708.1"
FT                   /translation="MTITPQEALQRTIEHREIFHDEMLHLMRLIMRGDLSPVMAAAIIT
FT                   GLRVKKETIGEIAAAATVMREFANHVEVQDNSNFVDIVGTGGDGSHTFNISTASMFVTA
FT                   AAGAKVAKHGNRGVSSKSGSADVLEALGVNIDLQSDQVAASIAETGMGFMFAPNHHPAM
FT                   KNIAAVRRELGVRTIFNILGPLTNPAGAPNQLMGVFHADLVGIQVRVMQRLGAQHVLVV
FT                   YGKDGMDEVSLGAATLVGELRDGKVHEYEIHPEDFGLQMVSNRTLKVENADESRTMLLG
FT                   ALDNQPGVAREIVTLNAGTALYAANVAESIADGIQLAREAIASGKARAKVDELVRFTQQ
FT                   FKR"
FT   misc_feature    complement(430382..431140)
FT                   /gene="trpD"
FT                   /locus_tag="BCAL0397"
FT                   /note="HMMPfam hit to PF00591, Glycosyl transferase family,
FT                   a/b doma, score 9.1e-126"
FT                   /inference="protein motif:HMMPfam:PF00591"
FT   misc_feature    complement(431159..431356)
FT                   /gene="trpD"
FT                   /locus_tag="BCAL0397"
FT                   /note="HMMPfam hit to PF02885, Glycosyl transferase family,
FT                   helical, score 2.6e-09"
FT                   /inference="protein motif:HMMPfam:PF02885"
FT   CDS_pept        complement(431379..431978)
FT                   /transl_table=11
FT                   /gene="trpG"
FT                   /locus_tag="BCAL0398"
FT                   /product="anthranilate synthase component II"
FT                   /EC_number="4.1.3.27"
FT                   /note="family C26 cysteine peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0398"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50709"
FT                   /db_xref="GOA:B4E7A9"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7A9"
FT                   /protein_id="CAR50709.1"
FT                   /translation="MLLMIDNYDSFTYNLVQYFGELGEDVRTYRNDEITLDDIARLNPD
FT                   AICLSPGPSNPQHAGITLDVLREFAGKKPILGVCLGHQAIGEAFGGRVVRAKTIMHGKV
FT                   SRIETDCRGVFADLPKHFDVTRYHSLAIERESLPDCLEVSAWTDDGEIMGVRHKTLPVE
FT                   GVQFHPESILSEHGHALLENFLKQTRGAARAAAPTA"
FT   misc_feature    complement(431415..431972)
FT                   /gene="trpG"
FT                   /locus_tag="BCAL0398"
FT                   /note="HMMPfam hit to PF00117, Glutamine amidotransferase
FT                   class-I, score 5.5e-89"
FT                   /inference="protein motif:HMMPfam:PF00117"
FT   misc_feature    complement(431724..431759)
FT                   /note="PS00442 Glutamine amidotransferases class-I active
FT                   site."
FT                   /inference="protein motif:Prosite:PS00442"
FT   CDS_pept        complement(431992..433485)
FT                   /transl_table=11
FT                   /gene="trpE"
FT                   /locus_tag="BCAL0399"
FT                   /product="anthranilate synthase component I"
FT                   /EC_number="4.1.3.27"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0399"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50710"
FT                   /db_xref="GOA:B4E7B0"
FT                   /db_xref="InterPro:IPR005256"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7B0"
FT                   /protein_id="CAR50710.1"
FT                   /translation="MTELEFQSLANEGYNRIPLIAEALADLETPLSLYLKLAQPERAGA
FT                   NSFLLESVVGGERFGRYSFIGLPARTLVRTRNGVSEVVRDGQVVETHDGDPFQFIESFQ
FT                   ARFKVAQRPGLPRFCGGLAGYFGYDAVRYIEKKLANTAPRDDLGLPDIQLLLTEEVAVI
FT                   DNLAGKLYLIIYADPGQPEAYAKAKQRLRELKQRLRTTVQPPVTSASVRTETFREFKKD
FT                   DYLAAVRQAKEYIAAGELMQIQVGQRLTKPYRDNPLSLYRALRSLNPSPYMYYYNFGDF
FT                   HVVGASPEILVRQEKRGEDQIVTIRPLAGTRPRGNTPERDAELATELLNDPKEIAEHVM
FT                   LIDLARNDVGRIAEIGSVQVTDQMVIEKYSHVQHIVSSVEGKLKPGMTNYDVLRATFPA
FT                   GTLSGAPKVRAMELIDELEPVKRGLYGGAVGYLSFSGEMDLAIAIRTGLIHNGNLYVQA
FT                   AAGVVADSVPESEWQETENKARAVLRAAEQVQDGLDSDF"
FT   misc_feature    complement(432028..432828)
FT                   /gene="trpE"
FT                   /locus_tag="BCAL0399"
FT                   /note="HMMPfam hit to PF00425, chorismate binding enzyme,
FT                   score 4e-154"
FT                   /inference="protein motif:HMMPfam:PF00425"
FT   misc_feature    complement(432970..433431)
FT                   /gene="trpE"
FT                   /locus_tag="BCAL0399"
FT                   /note="HMMPfam hit to PF04715, Anthranilate synthase
FT                   component I, N, score 1.6e-53"
FT                   /inference="protein motif:HMMPfam:PF04715"
FT   CDS_pept        complement(433843..434607)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0400"
FT                   /product="putative phosphoglycolate phosphatase"
FT                   /EC_number="3.1.3.18"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0400"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50711"
FT                   /db_xref="GOA:B4E7B1"
FT                   /db_xref="InterPro:IPR006346"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037512"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7B1"
FT                   /protein_id="CAR50711.1"
FT                   /translation="MADSSFAGRAPAEAATDAAPIRFAAPRIDAALIDLDGTMVDTADD
FT                   FTAGLNGMLAQLGAPATSRDEVIGYVGKGSEHLIQSVLKPRFPADEAHARFDDALAIYQ
FT                   SEYAKINGRHTRLYPDVAAGLDALRAAGIRLACVTNKPHRFAVELLEQYGLAGCFGIVL
FT                   GGDSVARKKPDPLPMLTACDALGVAPDAAVAIGDSENDALAGRAAGMATLTVPYGYNHG
FT                   KAIQTINSDGIVDSLLVAARAISAHNAGRPTI"
FT   misc_feature    complement(433954..434526)
FT                   /locus_tag="BCAL0400"
FT                   /note="HMMPfam hit to PF00702, haloacid dehalogenase-like
FT                   hydrolase, score 7.3e-38"
FT                   /inference="protein motif:HMMPfam:PF00702"
FT   CDS_pept        complement(434612..435298)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0401"
FT                   /product="putative ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0401"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50712"
FT                   /db_xref="GOA:B4E7B2"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7B2"
FT                   /protein_id="CAR50712.1"
FT                   /translation="MTQFRIAPSILSADFARLGEEVRNVVAAGADWIHFDVMDNHYVPN
FT                   LTIGPLVCEAIRPHVQVPIDVHLMVRPVDRIVPDFAKAGANLISFHPEGSDHIDRTLSL
FT                   IRDHGCKAGLVFNPATPLNYLDHVMDRLDFVLLMSVNPGFGGQSFIPETLNKLREARAR
FT                   IDAYTERTGREILLEVDGGVKADNIAEIAAAGADTFVAGSAIFGKPDYRKVIDEMRAAL
FT                   ATVERS"
FT   misc_feature    complement(434645..435127)
FT                   /locus_tag="BCAL0401"
FT                   /note="HMMPfam hit to PF00215, Orotidine 5'-phosphate
FT                   decarboxylase /, score 0.0029"
FT                   /inference="protein motif:HMMPfam:PF00215"
FT   misc_feature    complement(434672..435286)
FT                   /locus_tag="BCAL0401"
FT                   /note="HMMPfam hit to PF00834, Ribulose-phosphate 3
FT                   epimerase family, score 4.3e-140"
FT                   /inference="protein motif:HMMPfam:PF00834"
FT   misc_feature    complement(434828..434896)
FT                   /note="PS01086 Ribulose-phosphate 3-epimerase family
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS01086"
FT   misc_feature    complement(435158..435202)
FT                   /note="PS01085 Ribulose-phosphate 3-epimerase family
FT                   signature 1."
FT                   /inference="protein motif:Prosite:PS01085"
FT   CDS_pept        435477..435851
FT                   /transl_table=11
FT                   /locus_tag="BCAL0402"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0402"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50713"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7B3"
FT                   /protein_id="CAR50713.1"
FT                   /translation="MSQYQFTVSVKTSYLPEQSDPDHRQYAFAYTLTIRNTGQVAAQLI
FT                   ARHWIITDSESHVQEVKGLGVVGHQPLLQPGEHFEYTSWAVIATPVGTMRGAYFCVAED
FT                   GERFEAPVDEFALHMPRTLH"
FT   misc_feature    435480..435836
FT                   /locus_tag="BCAL0402"
FT                   /note="HMMPfam hit to PF04379, Protein of unknown function
FT                   (DUF525), score 2.3e-50"
FT                   /inference="protein motif:HMMPfam:PF04379"
FT   CDS_pept        436015..437169
FT                   /transl_table=11
FT                   /locus_tag="BCAL0403"
FT                   /product="putative outer membrane-bound lytic murein
FT                   transglycosylase"
FT                   /EC_number="3.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0403"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50714"
FT                   /db_xref="GOA:B4E7B4"
FT                   /db_xref="InterPro:IPR005300"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR026044"
FT                   /db_xref="InterPro:IPR034654"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7B4"
FT                   /protein_id="CAR50714.1"
FT                   /translation="MAVSIKNGHCMWFGPRLAGWMAAAAAAALLAACGGAPTRTSALKP
FT                   PTGAAIVPGQVAAKRLTPVAWQQVPGWQDDSLIGATAALRQNCARLARQPAWARACAAA
FT                   DRLDELDVSSARTFFETYFTPFQLANTDGTLDGLVTGYYEPLLHGSRVRRGPYQYALYR
FT                   WPAGYRAGAPLPARAQLERAGILNGNELVWVDDPIEAFFLQVQGSGRVLLDDGSVMRVG
FT                   FGGTNNQPYRSIGKWLLDRGELTPAQATMQGIKAWAKANPTRVDALLDTNPRFVFFRDM
FT                   PTKEDAPHGGADGPIGALGVPLTPERSIAVDPSSIPLGTPVFLQTTRPLTNTPMNRLVF
FT                   AQDTGSAIKGGVRADYFWGLGDDAGDQAGRMKQVGRMWLLFPNS"
FT   sig_peptide     436015..436137
FT                   /locus_tag="BCAL0403"
FT                   /note="Signal peptide predicted for BCAL0403 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.959) with cleavage site
FT                   probability 0.274 between residues 41 and 42"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    436048..436116
FT                   /locus_tag="BCAL0403"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAL0403 by TMHMM2.0 at aa 12-34"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    436081..436113
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    436351..436923
FT                   /locus_tag="BCAL0403"
FT                   /note="HMMPfam hit to PF03562, MltA N-terminal domain,
FT                   score 3.9e-83"
FT                   /inference="protein motif:HMMPfam:PF03562"
FT   misc_feature    436933..437157
FT                   /locus_tag="BCAL0403"
FT                   /note="HMMPfam hit to PF06725, 3D domain, score 4.1e-33"
FT                   /inference="protein motif:HMMPfam:PF06725"
FT   CDS_pept        complement(437425..438723)
FT                   /transl_table=11
FT                   /gene="paaK"
FT                   /locus_tag="BCAL0404"
FT                   /product="phenylacetate-coenzyme A ligase"
FT                   /EC_number="6.2.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0404"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50715"
FT                   /db_xref="GOA:B4E7B5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011880"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="PDB:2Y27"
FT                   /db_xref="PDB:2Y4N"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7B5"
FT                   /protein_id="CAR50715.1"
FT                   /translation="MTTPLPLEPIETASRDELTALQLERLKWSLRHAYDHSPVYRRKFD
FT                   EAGVHPDDLKTLADLSRFPFTTKGDLRDSYPFGMFAVPQDRISRIHASSGTTGKPTVVG
FT                   YTAADIDTWANLVARSIRAAGARRGDKVHVSYGYGLFTGGLGAHYGAERAGLTVIPFGG
FT                   GQTEKQVQLIQDFRPDIIMVTPSYMLSIADEIERQGLDPVQSSLRIGIFGAEPWTNDMR
FT                   VAIEQRMGIDAVDIYGLSEVMGPGVASECVETKDGPTIWEDHFYPEIIDPETGEVLPDG
FT                   ELGELVFTSLTKEALPIIRYRTRDLTRLLPGTARTMRRMEKITGRSDDMMIVRGVNVFP
FT                   TQIEEQLLKQRALAPHYQIVLTKEGPLDVLTLNVEPCPETAPDTAAIQVAKQALAYDIK
FT                   SLIGVTAVINVLPVNGIERSVGKARRVVDKRKG"
FT   CDS_pept        complement(438762..439214)
FT                   /transl_table=11
FT                   /gene="paaI"
FT                   /locus_tag="BCAL0405"
FT                   /product="phenylacetic acid degradation protein PaaI"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0405"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50716"
FT                   /db_xref="GOA:B4E7B6"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR011973"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7B6"
FT                   /protein_id="CAR50716.1"
FT                   /translation="MTNATATLAPDALARATAQAMYDADACSRAFGMEIAEVRAGYARL
FT                   QMRVRPEFLNGHQTCHGGIIFTLADSTFAFACNSYNLSAVAAGCSIEFLRPVHGGDVLT
FT                   AEAIEQARAGRHGIYDIRVTNQTGDTVAMFRGKSAQIKGTVIPEDR"
FT   misc_feature    complement(438819..439046)
FT                   /gene="paaI"
FT                   /locus_tag="BCAL0405"
FT                   /note="HMMPfam hit to PF03061, Thioesterase superfamily,
FT                   score 9.9e-17"
FT                   /inference="protein motif:HMMPfam:PF03061"
FT   misc_feature    complement(438948..438980)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(439216..440007)
FT                   /transl_table=11
FT                   /gene="paaG"
FT                   /locus_tag="BCAL0406"
FT                   /product="probable enoyl-CoA hydratase PaaG"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0406"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50717"
FT                   /db_xref="GOA:B4E7B7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR011968"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7B7"
FT                   /protein_id="CAR50717.1"
FT                   /translation="MSYQAIQLDIDQAAGVATITLNRPDKLNSFTRAMHRELQSALDEV
FT                   EAAGARALILTGAGRGFCAGQDLADLDFTPGASTDLGTLIDEHFNPLIRRLQRLPIPVI
FT                   AAVNGTAAGAGANLALACDLVFAARSSSFIQAFVKIGLVPDSGGTWFLPQRVGMARALG
FT                   LALTGDKLGAEQAEQWGLIWRAVDDEALVATTRQLATQLAQQPTLAIASIKQSMRDSVT
FT                   NTLDQQLDLERDLQRKLGQSHDYAEGVQAFIGKRAPRFEGR"
FT   misc_feature    complement(439447..439959)
FT                   /gene="paaG"
FT                   /locus_tag="BCAL0406"
FT                   /note="HMMPfam hit to PF00378, Enoyl-CoA
FT                   hydratase/isomerase family, score 9.6e-58"
FT                   /inference="protein motif:HMMPfam:PF00378"
FT   misc_feature    complement(439636..439698)
FT                   /note="PS00166 Enoyl-CoA hydratase/isomerase signature."
FT                   /inference="protein motif:Prosite:PS00166"
FT   misc_feature    complement(439642..439674)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(440053..441255)
FT                   /transl_table=11
FT                   /gene="pcaF"
FT                   /locus_tag="BCAL0407"
FT                   /product="beta-ketoadipyl CoA thiolase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0407"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50718"
FT                   /db_xref="GOA:B4E7B8"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012793"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7B8"
FT                   /protein_id="CAR50718.1"
FT                   /translation="MTDAYICDAIRTPIGRYGGALKDVRADDLGAVPLKALIERNRDVD
FT                   WAAIDDVVYGCANQAGEDNRNVARMSALLAGLPTAVPGTTLNRLCGSGMDAVGTAARAI
FT                   KAGEARLMIAGGVESMTRAPFVMGKAASAFARQANIFDTTIGWRFVNPLMKQLYGVDSM
FT                   PETAENVALDYDISRADQDLFALRSQQKAARAQQDGTLAEEIVAVTIPQKKGDAIVVSR
FT                   DEHPRETSLEALAKLKGVVRPDGSVTAGNASGVNDGACALLLANAQAADQYGLRRRARV
FT                   VGMATAGVEPRVMGIGPAPATQKLLHQLGMRIDQFDVIELNEAFASQGLAVLRMLGVAD
FT                   DDPRVNPNGGAIALGHPLGASGARLVTTALHQLERTGGRFALCTMCIGVGQGIAIAIER
FT                   V"
FT   misc_feature    complement(440059..440433)
FT                   /gene="pcaF"
FT                   /locus_tag="BCAL0407"
FT                   /note="HMMPfam hit to PF02803, Thiolase, C-terminal domain,
FT                   score 1.7e-62"
FT                   /inference="protein motif:HMMPfam:PF02803"
FT   misc_feature    complement(440074..440115)
FT                   /note="PS00099 Thiolases active site."
FT                   /inference="protein motif:Prosite:PS00099"
FT   misc_feature    complement(440170..440220)
FT                   /note="PS00737 Thiolases signature 2."
FT                   /inference="protein motif:Prosite:PS00737"
FT   misc_feature    complement(440452..441255)
FT                   /gene="pcaF"
FT                   /locus_tag="BCAL0407"
FT                   /note="HMMPfam hit to PF00108, Thiolase, N-terminal domain,
FT                   score 8.2e-101"
FT                   /inference="protein motif:HMMPfam:PF00108"
FT   misc_feature    complement(440944..441000)
FT                   /note="PS00098 Thiolases acyl-enzyme intermediate
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00098"
FT   CDS_pept        complement(441343..443049)
FT                   /transl_table=11
FT                   /gene="paaZ"
FT                   /locus_tag="BCAL0408"
FT                   /product="putative phenylacetic acid degradation
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0408"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50719"
FT                   /db_xref="GOA:B4E7B9"
FT                   /db_xref="InterPro:IPR011975"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7B9"
FT                   /protein_id="CAR50719.1"
FT                   /translation="MTHALFTKHEDTLKHALAAIESRGYWSPFAEMPSPKVYGESASAD
FT                   GEAAFKSHLDTTFVLDQPATGETVGAERSPYGIALGVRYPKSTPDALIAAAAAAQRTWR
FT                   EAGPSAWVGVSLEILARLNRASFEIAYSVMHTTGQAFMMAFQAGGPHAQDRALEAVAYA
FT                   WDELRRIPADAHWEKPQGKNPPLAMHKRYTIVPRGTGLVLGCCTFPTWNGYPGLFADLA
FT                   TGNTVIVKPHPGAILPLAITVRIARDVLREAGFDPNVVTLLATEPNDGALVQELALRPE
FT                   IKLIDFTGSTQNGTWLERHAHQAQVYTEKAGVNQIVIDSTDDLKAAAKNIAFSLALYSG
FT                   QMCTAPQNIYVPRDGIRTADGHASFDEVAQAIAVAVQKLTGDPARSVELIGAIQNDGVT
FT                   ARIDDARKLGRVLADSQTLQHPAFPDARVRTPLVLQLDVADREKFTQEWFGPISFVIST
FT                   DSTAQSLDLAGEIAAEHGALTLSVYSTDDAIVDAAHDAAVRGGVALSINLTGGVFVNQS
FT                   AAFSDFHGTGANPAANAALADPAFVANRFRVVQSRVHVAPKAVPAEAGQTA"
FT   misc_feature    complement(441427..442872)
FT                   /gene="paaZ"
FT                   /locus_tag="BCAL0408"
FT                   /note="HMMPfam hit to PF00171, Aldehyde dehydrogenase
FT                   family, score 2e-10"
FT                   /inference="protein motif:HMMPfam:PF00171"
FT   CDS_pept        443179..443955
FT                   /transl_table=11
FT                   /gene="paaF"
FT                   /locus_tag="BCAL0409"
FT                   /product="putative phenylacetic acid degradation enoyl-CoA
FT                   hydratase PaaF"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0409"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50720"
FT                   /db_xref="GOA:B4E7C0"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7C0"
FT                   /protein_id="CAR50720.1"
FT                   /translation="MAYENILVETRGRVGLVTLNRPKALNALNDALMDELGAALKAFDA
FT                   DDDIGAIVVTGSEKAFAAGADIGMMATYSYMDVYRGDYITRNWETVREIRKPIIAAVSG
FT                   FALGGGCELAMMCDIIFAADTAKFGQPEIKLGVMPGAGGTQRLPRAVSKAKAMDMCLTA
FT                   RFMDAVEAERAGLVSRVLPADKLLDEAIAAATTIAEFSLPAVMMVKESVNRAYETTLAE
FT                   GVHFERRLFHSLFATEDQKEGMAAFVEKRKPVFKHR"
FT   misc_feature    443221..443724
FT                   /gene="paaF"
FT                   /locus_tag="BCAL0409"
FT                   /note="HMMPfam hit to PF00378, Enoyl-CoA
FT                   hydratase/isomerase family, score 5.6e-74"
FT                   /inference="protein motif:HMMPfam:PF00378"
FT   misc_feature    443473..443535
FT                   /note="PS00166 Enoyl-CoA hydratase/isomerase signature."
FT                   /inference="protein motif:Prosite:PS00166"
FT   misc_feature    443479..443511
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   rRNA            444523..446054
FT                   /note="16S"
FT   tRNA            446119..446195
FT                   /gene="BCALr0409b"
FT                   /note="tRNA Ile anticodon GAT, Cove score 93.29"
FT   tRNA            446234..446309
FT                   /gene="BCALr0409c"
FT                   /note="tRNA Ala anticodon TGC, Cove score 90.89"
FT   rRNA            446586..449462
FT                   /note="23S"
FT   rRNA            449618..449732
FT                   /note="5S"
FT   CDS_pept        complement(449975..450307)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0409a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0409a"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50721"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7C1"
FT                   /protein_id="CAR50721.1"
FT                   /translation="MANAYSKSRPKKLKQYPEVELTLGNKPDLPQDGQPYMPWMRAIDA
FT                   HFEMFGFKPGDRVYLRFSFASRRVIITPDYSALNWREQPYGAAAQEEDEAEDYAALAAL
FT                   RGSTAW"
FT   misc_feature    449978..463082
FT                   /note="BcenGI3"
FT   repeat_region   450373
FT                   /note="duplicated insertion sequence target"
FT   mobile_element  450374..451609
FT                   /mobile_element_type="insertion sequence:IS407"
FT                   /note="putative IS element - IS407"
FT   repeat_region   450374..450385
FT                   /note="IS element inverted repeat region"
FT   CDS_pept        450442..450705
FT                   /transl_table=11
FT                   /locus_tag="BCAL0410"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0410"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50722"
FT                   /db_xref="GOA:B4E5I8"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B4E5I8"
FT                   /protein_id="CAR50722.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKNLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   misc_feature    450445..450678
FT                   /locus_tag="BCAL0410"
FT                   /note="HMMPfam hit to PF01527, Transposase, score 1.6e-29"
FT                   /inference="protein motif:HMMPfam:PF01527"
FT   CDS_pept        450699..451562
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BCAL0411"
FT                   /product="transposase"
FT                   /note="CDS lacks appropriate translational start site. It
FT                   is likely that this CDS encodes the C-terminal region of a
FT                   larger protein encompassing the upstream CDS. A
FT                   translational frameshift possibly occurs after residue 86
FT                   of the upstream overlapping CDS"
FT   misc_feature    451035..451511
FT                   /locus_tag="BCAL0411"
FT                   /note="HMMPfam hit to PF00665, Integrase core domain, score
FT                   4.5e-41"
FT                   /inference="protein motif:HMMPfam:PF00665"
FT   repeat_region   complement(451598..451609)
FT                   /note="IS element inverted repeat region"
FT   repeat_region   451610
FT                   /note="duplicated insertion sequence target"
FT   CDS_pept        451612..452151
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BCAL0412"
FT                   /product="conserved hypothetical protein (fragment)"
FT                   /note="Probable gene remnant. Similar to the C-terminal
FT                   region of Verminephrobacter eiseniae hypothetical protein
FT                   UniProt:Q0XH92 (EMBL:CP000542 (296 aa) fasta scores:
FT                   E()=1.7e-51, 76.136% id in 176 aa"
FT   CDS_pept        452305..453675
FT                   /transl_table=11
FT                   /locus_tag="BCAL0413"
FT                   /product="conserved hypothetical protein"
FT                   /note="C-terminus is similar to the N-terminus of
FT                   Clostridium tetani conserved protein ctc02236 SWALL:Q891X7
FT                   (EMBL:AE015943) (384 aa) fasta scores: E(): 1.2, 30.12% id
FT                   in 156 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0413"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50725"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7C3"
FT                   /protein_id="CAR50725.1"
FT                   /translation="MTSKNTGLLIYFDENRRRDLIRQKVEGSYEPFSDALSVYDWDIGQ
FT                   LNIALLCFSEVTIDYIAIAKKGRRVATSKSKVEFSSLVNLSQVPLPAIESRLTNRLKQY
FT                   FIKASQGIGGAIPDTTWSVLVDAIKLERPGLAGEIDRLLALRRYSGLRLSGQSAEILIQ
FT                   EREALGISLDIFSGSNQLREHVLTEWAPSEGFVEEINEDDSSAKLANLPKGQSSFLMGI
FT                   PKRYLQEESAIQHDLFNWPGMTSIHESGVSVFKQGNRSLNVLYANRNDLEHTLGVDLIY
FT                   YNEFYGLFVLVQYKLMSEEGGGFVYRPDAQFASELERMDNFYKEIHSDDAIRSHADYRL
FT                   SDDGFMMKMVPNRGLQPASGELVKGMYLPRKYVHYLLSPSGPKGPRGGVQITFEDAPRY
FT                   LTNSQFSASVHDGWIGTRGAQSETLKKMIRNFYETGRAILIAVETKDVPQFTRKPWY"
FT   CDS_pept        join(454607..455112,456353..457535)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="hsdM"
FT                   /locus_tag="BCAL0414"
FT                   /product="type I modification component of
FT                   restriction-modification system (pseudogene)"
FT                   /note="CDS has an IS element inserted into the gene after
FT                   codon 169"
FT                   /db_xref="PSEUDO:CAR50726.1"
FT   misc_feature    join(455087..455112,456353..457412)
FT                   /gene="hsdM"
FT                   /locus_tag="BCAL0414"
FT                   /note="HMMPfam hit to PF02384, N-6 DNA Methylase, score
FT                   4.4e-152"
FT                   /inference="protein motif:HMMPfam:PF02384"
FT   repeat_region   complement(455109..455112)
FT                   /note="duplicated insertion sequence target"
FT   mobile_element  complement(455113..456348)
FT                   /mobile_element_type="insertion sequence:IS407"
FT                   /note="putative IS element - IS407"
FT   repeat_region   455113..455124
FT                   /note="IS element inverted repeat region"
FT   CDS_pept        complement(455160..456023)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BCAL0415"
FT                   /product="transposase"
FT                   /note="CDS lacks appropriate translational start site. It
FT                   is likely that this CDS encodes the C-terminal region of a
FT                   larger protein encompassing the upstream CDS. A
FT                   translational frameshift possibly occurs after residue 86
FT                   of the upstream overlapping CDS"
FT   misc_feature    complement(455211..455687)
FT                   /locus_tag="BCAL0415"
FT                   /note="HMMPfam hit to PF00665, Integrase core domain, score
FT                   4.5e-41"
FT                   /inference="protein motif:HMMPfam:PF00665"
FT   CDS_pept        complement(456017..456280)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0416"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0416"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50728"
FT                   /db_xref="GOA:B4E5I8"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B4E5I8"
FT                   /protein_id="CAR50728.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKNLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   misc_feature    complement(456044..456277)
FT                   /locus_tag="BCAL0416"
FT                   /note="HMMPfam hit to PF01527, Transposase, score 1.6e-29"
FT                   /inference="protein motif:HMMPfam:PF01527"
FT   repeat_region   complement(456337..456348)
FT                   /note="IS element inverted repeat region"
FT   repeat_region   complement(456349..456352)
FT                   /note="duplicated insertion sequence target"
FT   CDS_pept        457536..458870
FT                   /transl_table=11
FT                   /locus_tag="BCAL0418"
FT                   /product="type I restriction enzyme specificity protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0418"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50729"
FT                   /db_xref="GOA:B4E7C6"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7C6"
FT                   /protein_id="CAR50729.1"
FT                   /translation="MLGIFDTAPAAWERTTLGEVVARGGGSVQTGPFGSQLHASDYVPV
FT                   GIPSIMPVNIGDNRLIRDGIACITEVDAQRLSKHIVRKGDIIYSRRGDVERRALVRDAE
FT                   DGWFCGTGCLKVRLGQGVVLPEFAAFYLGHPEVREWIVRHAVGATMPNLNTGIMEAIPF
FT                   LLPPLPQQELIAATLGALDDKIEQNRRTNRELEGLAQAMFKAWFVDFEPVKAKASGKTS
FT                   FAGMPPAAFAALPDRLTDSPLGQVPQGWEIRPIGDLVAVKGGGTPSTKVAEYWDEGTHF
FT                   WATPKDLSGLQDPVLLETSRCITDAGAECISSGVLQENTVLLSSRAPVGYTALAKVPTA
FT                   VNQGFIAMTCDGPLPPHYVLHWTRSMLGEIKSRASGTTFPEISKGAFRPILAIVPSAVV
FT                   VQAFESFAACLFDLIEVNVRQRFSLEEMRNYLLPRLLSGAVKVRS"
FT   misc_feature    457569..458084
FT                   /locus_tag="BCAL0418"
FT                   /note="HMMPfam hit to PF01420, Type I restriction
FT                   modification DNA speci, score 1.7e-13"
FT                   /inference="protein motif:HMMPfam:PF01420"
FT   misc_feature    458283..458759
FT                   /locus_tag="BCAL0418"
FT                   /note="HMMPfam hit to PF01420, Type I restriction
FT                   modification DNA speci, score 4.7e-12"
FT                   /inference="protein motif:HMMPfam:PF01420"
FT   CDS_pept        458867..459997
FT                   /transl_table=11
FT                   /locus_tag="BCAL0419"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0419"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50730"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7C7"
FT                   /protein_id="CAR50730.1"
FT                   /translation="MSDSTARDHAELDSKNPAEALLQWRETRDADRYRQWCLDMFEGYV
FT                   RVGEHEFHPAEVLRLKPDVVEKTISECRSQLLDQDDETICAQFPSPIAIPYQQTIYGPR
FT                   DPNRRLTRMRDTWEGLINLLFAMVIAEAGLVGIGELPVQVIETASRRAIKHKDLRSDKL
FT                   SVRIGIIEGILESWRATGVRAVLADLIPSGLPAELRRLNTVRNGFSHLGTLSDVQAAHL
FT                   IDESRPILHDVLVDCLFLADTQLVRLIKVTPGVPPYAEVDRLNGHSTARHVTDLELDAD
FT                   AQKVVMQSGKVGSYDRVLAKIRSQCLDLSPYFYACDDDSGHHTRIAFFKKRAADTCHLE
FT                   VVGESLPLTSAANLHAPEFARCEVAVVGSQGGAGDE"
FT   CDS_pept        459990..463085
FT                   /transl_table=11
FT                   /locus_tag="BCAL0420"
FT                   /product="type I restriction component of type I
FT                   restriction-modification system"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0420"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50731"
FT                   /db_xref="GOA:B4E7C8"
FT                   /db_xref="InterPro:IPR004473"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR021810"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7C8"
FT                   /protein_id="CAR50731.1"
FT                   /translation="MSSISERFIEEESARVFAEVGIPCELTPGLDFDNRERPDISSGVL
FT                   PRRLVERVQGINPSLPHSVSAEVALEASRPPHPTLVENNRWFHDLLINGAPVEYKDAAT
FT                   GETRGGRARLIDFDNPANNDFLVVRQLTVAGANGKTIRPDLVLYVNGLPLVVIELKDPA
FT                   NTSATLEVAIDQLGRYKTVAPDLFVPSLLLVASDGLLTRVGSITSGLQRFTPWRPAHGG
FT                   EPTLEALIRELLNPSALLDYLLSCVAFEEDERGNIVKKVAGYHQFRAVRKARASVISAI
FT                   KTSARSDDVTAGKGGVVWHTQGSGKSLTMLMLAGTLVRAAEMANPTIVIVTDRNDLDDQ
FT                   LFETFAMGRALLRQDPMQAEGREHLRQLLDRASGGVVFTTIHKFTEAHGMISERANIVV
FT                   MADEAHRSQYGFVEGGARWMREALPNATFVGFTGTPLMAGDRVTQNVFGEYADVYDVRQ
FT                   AVADGATVPIYYEPRIVKLTIDETGAKEAEAKIAQYATRDEYGQETPENVRISLEELYG
FT                   APERLQRVAKFVVEHWEERRAAMEGKAMLVTMSRDIAARLYDEICKLRPAWHDEDDAQG
FT                   AIKVVMTGGPNDSEHMMRHSRSKAQRKSLADRFKDPTDDFRLAVVVDMWLTGFDVPCAH
FT                   TMYLDKPLAGHNLMQAIARVNRVYGEKPGGLIVDMIGLADPLADALATYASATGETDKP
FT                   VKELQDEAIPAMQSAFEQLRSFFHDFNYAEALDAIPSRVLRVYLGAIDHVLDVKHTVGD
FT                   ETGWQRFGGMVKRLATAFALAVPREETRDITPHLAFFQRVAAMIRKRLTDERGPTESRS
FT                   DGSPDIDAAVRQVIGGAVDAGEVIDLFAAAGLDAARLDILSDDFLERVSALEQKNLALE
FT                   TLRKLLADQIKLSERSNLVQAQKFREALERAMLGYTNKQITTAQMITQLLALAKWVREA
FT                   KLHGQDLGLSDEEAAFYDALTENGSAKEAMKSDQLRLMARELAEMVKKMPRLDWTQRES
FT                   VRADLRRKVRRLLAMYGYPPDLSEEATQLVLRQAELSTENSE"
FT   misc_feature    459996..460625
FT                   /locus_tag="BCAL0420"
FT                   /note="HMMPfam hit to PF04313, Type I restriction enzyme R
FT                   protein N term, score 2.8e-40"
FT                   /inference="protein motif:HMMPfam:PF04313"
FT   misc_feature    460764..461300
FT                   /locus_tag="BCAL0420"
FT                   /note="HMMPfam hit to PF04851, Type III restriction enzyme,
FT                   res subunit, score 4.1e-07"
FT                   /inference="protein motif:HMMPfam:PF04851"
FT   misc_feature    461733..461966
FT                   /locus_tag="BCAL0420"
FT                   /note="HMMPfam hit to PF00271, Helicase conserved
FT                   C-terminal domain, score 0.024"
FT                   /inference="protein motif:HMMPfam:PF00271"
FT   CDS_pept        complement(463355..465829)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0421"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0421"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50732"
FT                   /db_xref="GOA:B4E7C9"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7C9"
FT                   /protein_id="CAR50732.1"
FT                   /translation="MSEQHNSQPDNSSYGASSIQILEGLEAVRKRPGMYIGDTSDGTGL
FT                   HHLVFEVLDNSIDEALAGYCNDIHVTIHADNSISVTDNGRGIPTDVKMNDKHEPKRSAA
FT                   EIVMTELHAGGKFDQNSYKVSGGLHGVGVSCVNALSSWLRLTVRRDGKKRFMEFHRGVA
FT                   QDRVIEVVDGVEVSPMLVTGDTENRGTEVHFMADPTIFGTVEYHYDILAKRMRELSFLN
FT                   NGVRIRLTDLRSGKEDDFAFAGGVKGFVEFINKTKSTLHPTVFFANGEKDGVGVEVAMQ
FT                   WNDSYNENVLCFTNNIPQRDGGTHLTGLRAAMTRVINKYITDNEIAKKAKVETTGDDMR
FT                   EGLSCVLSVKVPEPKFSSQTKDKLVSSEVRAPVEEVVAKALEEFLLETPIDAKIICGKI
FT                   VEAARARDAARKAREMTRRKGVLDGVGLPGKLADCQEKDPAKCEIYIVEGDSAGGSAKQ
FT                   GRDRKFQAILPLRGKVLNVEKARYDKLLSSEQIVTLVTALGCGIGKEDYNLDKLRYHRI
FT                   IIMTDADVDGAHIRTLLLTFLYRQMPDMIERGYVYIAQPPLYKIKAGKDERYLKDDVEL
FT                   NAHMLRLALQGSELVPGENAAAISGDALGELARSYLLSQSVIERLSRLYDPAALEAVMD
FT                   GVVIDLSNEESTEASAKALHAALHDEALKNEVRVVPSYDPVREQRALHVERTHHGNVRV
FT                   SVIDQEFQHTADYQQLVTTANTFKGLIGEGAVIKRGERSMAVADFKSAMKWLLADAERN
FT                   VSKQRYKGLGEMNPEQLWETTMDPAVRRLLRVQIEDAIAADGIFTTLMGDDVEPRRAFI
FT                   ESNALRAGNIDV"
FT   misc_feature    complement(463391..463591)
FT                   /locus_tag="BCAL0421"
FT                   /note="HMMPfam hit to PF00986, DNA gyrase B subunit,
FT                   carboxyl terminus, score 5.2e-44"
FT                   /inference="protein motif:HMMPfam:PF00986"
FT   misc_feature    complement(464168..464506)
FT                   /locus_tag="BCAL0421"
FT                   /note="HMMPfam hit to PF01751, Toprim domain, score
FT                   6.1e-06"
FT                   /inference="protein motif:HMMPfam:PF01751"
FT   misc_feature    complement(464330..464362)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    complement(464468..464494)
FT                   /note="PS00177 DNA topoisomerase II signature."
FT                   /inference="protein motif:Prosite:PS00177"
FT   misc_feature    complement(464585..465097)
FT                   /locus_tag="BCAL0421"
FT                   /note="HMMPfam hit to PF00204, DNA gyrase B, score 2.7e-87"
FT                   /inference="protein motif:HMMPfam:PF00204"
FT   misc_feature    complement(465233..465712)
FT                   /locus_tag="BCAL0421"
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and H, score 1.2e-25"
FT                   /inference="protein motif:HMMPfam:PF02518"
FT   misc_feature    complement(465425..465457)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(466021..467127)
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="BCAL0422"
FT                   /product="DNA polymerase III, beta chain"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0422"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50733"
FT                   /db_xref="GOA:B4E7D0"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7D0"
FT                   /protein_id="CAR50733.1"
FT                   /translation="MQLVKTERDTLLRPLQTVSGIVERRHTLPILANLLITKNGPDVSF
FT                   LSTDLELQITTRADFGVGGDQIATTVAARKLLDILRAMPDGQVTLSLADKRLTVQSGKS
FT                   RFALQTLAADEFPTVAQAKDFGATLTVPQKSFRQLLGMVHFAMAQQDIRYYLNGMLLVV
FT                   DGDQLMAVATDGHRLAFSSMKLEGGTFGRQEVIVPRKTILELQRLLEDIDDTVTIDIAQ
FT                   TQAKFTFGQVELVSKLVEGKFPDFQRVIPKAHKNTFEIGREELQRSLQRAAILTSDKFK
FT                   GVRCIIAPGQLKIMSTNADQEEAQEELEIAYQGDTVDIGFNVTYLLDVLANLKVDTVQV
FT                   SLGDASSSALITVPENDEFKYVVMPMRI"
FT   misc_feature    complement(466027..466389)
FT                   /gene="dnaN"
FT                   /locus_tag="BCAL0422"
FT                   /note="HMMPfam hit to PF02768, DNA polymerase III beta
FT                   subunit, C-te, score 2e-39"
FT                   /inference="protein motif:HMMPfam:PF02768"
FT   misc_feature    complement(466393..466740)
FT                   /gene="dnaN"
FT                   /locus_tag="BCAL0422"
FT                   /note="HMMPfam hit to PF02767, DNA polymerase III beta
FT                   subunit, cent, score 7.3e-43"
FT                   /inference="protein motif:HMMPfam:PF02767"
FT   misc_feature    complement(466768..467127)
FT                   /gene="dnaN"
FT                   /locus_tag="BCAL0422"
FT                   /note="HMMPfam hit to PF00712, DNA polymerase III beta
FT                   subunit, N-te, score 2.3e-29"
FT                   /inference="protein motif:HMMPfam:PF00712"
FT   CDS_pept        complement(467298..468875)
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="BCAL0423"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0423"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50734"
FT                   /db_xref="GOA:B4E7D1"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E7D1"
FT                   /protein_id="CAR50734.1"
FT                   /translation="MNDFWQHCSALLERELTPQQYVTWIKPLAPVAFDASANTLSIAAP
FT                   NRFKLDWVKSQFSGRIADLAREFWNTPIEVQFVLDPKAGMRSAPAGAAPAAPRAPLAPN
FT                   GPAATVAAIAANLTANASAAPAAPADVPMTPSAAAARHLNADDADIDLPSLPAHEAAAG
FT                   RRTWRPGPGAAPANGGEADSMYERSKLNPVLTFDNFVTGKANQLARAAAIQVADNPGIS
FT                   YNPLFLYGGVGLGKTHLIHAIGNQLLLDKAGARIRYIHAEQYVSDVVKAYQRKAFDDFK
FT                   RYYHSLDLLLIDDIQFFSGKSRTQEEFFYAFEALVANKAQVIITSDTYPKEISGIDDRL
FT                   ISRFDSGLTVAIEPPELEMRVAILMRKAQSEGVNLSEDVAFFVAKHLRSNVRELEGALR
FT                   KILAYSKFHGREISIELTKEALKDLLTVQNRQISVENIQKTVADFYNIKVADMYSKKRP
FT                   ANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERSKDAQLNHELH
FT                   VLEQTLKG"
FT   misc_feature    complement(467370..467579)
FT                   /gene="dnaA"
FT                   /locus_tag="BCAL0423"
FT                   /note="HMMPfam hit to PF08299, Bacterial dnaA protein
FT                   helix-turn-helix, score 9e-43"
FT                   /inference="protein motif:HMMPfam:PF08299"
FT   misc_feature    complement(467370..467429)
FT                   /note="PS01008 DnaA protein signature."
FT                   /inference="protein motif:Prosite:PS01008"
FT   misc_feature    complement(467652..468308)
FT                   /gene="dnaA"
FT                   /locus_tag="BCAL0423"
FT                   /note="HMMPfam hit to PF00308, Bacterial dnaA protein,
FT                   score 1.5e-120"
FT                   /inference="protein motif:HMMPfam:PF00308"
FT   misc_feature    complement(468165..468188)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        469297..469431
FT                   /transl_table=11
FT                   /gene="rpmH"
FT                   /locus_tag="BCAL0423a"
FT                   /product="50S ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0423a"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50735"
FT                   /db_xref="GOA:B4E7D2"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E7D2"
FT                   /protein_id="CAR50735.1"
FT                   /translation="MKRTYQPSVTRRKRTHGFRVRMKTAGGRKVINARRAKGRKRLAI"
FT   CDS_pept        469447..469908
FT                   /transl_table=11
FT                   /gene="rnpA"
FT                   /locus_tag="BCAL0424"
FT                   /product="ribonuclease P protein component"
FT                   /EC_number="3.1.26.5"
FT                   /note="Possible alternative translational start sites"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0424"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50736"
FT                   /db_xref="GOA:B4E7D3"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7D3"
FT                   /protein_id="CAR50736.1"
FT                   /translation="MSAVRSPAEGAVEPGANPSQTKAAFPKAARLLKTDEFSSVFRLRP
FT                   WRRSAHFVIYGKPTGQPARLGLVIGKKYAPRAVTRNLVKRLARDQFRLRRAEFAGYDLL
FT                   LRQHTRFDKKALPSAASAPLAAMCAAEIRELLDRAVREIARRASKPASE"
FT   CDS_pept        469984..470250
FT                   /transl_table=11
FT                   /locus_tag="BCAL0425"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0425"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50737"
FT                   /db_xref="GOA:B4E7D4"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E7D4"
FT                   /protein_id="CAR50737.1"
FT                   /translation="MKTVLIALLRFYKVAVSPMLGNRCRFYPSCSDYAREAIQYHGAAR
FT                   GTYLAVRRVCRCHPFSAGGIDLVPPPNSDTRARGEADARSHRL"
FT   misc_feature    469984..470187
FT                   /locus_tag="BCAL0425"
FT                   /note="HMMPfam hit to PF01809, Domain of unknown function
FT                   DUF37, score 6.7e-33"
FT                   /inference="protein motif:HMMPfam:PF01809"
FT   CDS_pept        470259..471917
FT                   /transl_table=11
FT                   /locus_tag="BCAL0426"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0426"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50738"
FT                   /db_xref="GOA:B4E7D5"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E7D5"
FT                   /protein_id="CAR50738.1"
FT                   /translation="MDIKRTVLWVIFFMSAVMLYDNWQRDHGRPSMFFPSATHTAPAAA
FT                   GGASGTGATTAGDVPAAAAGAAPSTTAPAAQAQLVKFSTDVYDGEIDTRGGTLAKLTLK
FT                   KQGDGKQPDLYITLFDHTAGHTYLARTGLLGGDFPNHNDVYTQLNPGSTSLTGDQNTLK
FT                   LSFESPVKGGVKVVKTYTFTRGSYVIGVDTKIDNVGTAPVTPTVYMELVRDNTAVETPM
FT                   FSHTFLGPAVYTDAKHFQKIDFSDLDKNKANFEKSADNGWVAMVQHYFASAWIPQQGAK
FT                   RDIYAEKIDPALYRVGVKQPVAAIAPGQSADVQARLFAGPEEERMLEGIAPGLELVKDY
FT                   GWVTIIAKPLFWLLEKIHGYVGNWGWAIVLLTVLIKAVFFPLSAASYKSMARMKEITPR
FT                   MQALRERFKSDPQKMNAALMELYKTEKVNPFGGCLPVVIQIPVFISLYWVLLASVEMRG
FT                   APWILWIHDLSQRDPFFILPVLMAVSMFVQTSLNPTPPDPVQAKMMKFMPIAFSVMFFF
FT                   FPAGLVLYYVVNNVLSIAQQYYITRKLGGVKKKPA"
FT   misc_feature    join(470277..470330,471348..471416,471543..471611,
FT                   471774..471842)
FT                   /locus_tag="BCAL0426"
FT                   /note="4 probable transmembrane helices predicted for
FT                   BCAL0426 by TMHMM2.0 at aa 7-24, 364-386, 429-451 and
FT                   506-528"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    471342..471893
FT                   /locus_tag="BCAL0426"
FT                   /note="HMMPfam hit to PF02096, 60Kd inner membrane protein,
FT                   score 1.8e-105"
FT                   /inference="protein motif:HMMPfam:PF02096"
FT   CDS_pept        complement(472042..472518)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0427"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0427"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50739"
FT                   /db_xref="GOA:B4E7D6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7D6"
FT                   /protein_id="CAR50739.1"
FT                   /translation="MVVWDAAMELHNLPMPTSEEKAAFSERLKFALRRSPEKVTGATEL
FT                   ANRFNLRHRGTHPVSPQTAHKWLTGRTIPTSDKLETLAEWLRVEVHWLHYGPSPSVIEH
FT                   PTPQPLPRDERYPPTPETIELASKIEALSPHQRYLVQELVEQFYGDPKLEAKKA"
FT   CDS_pept        472814..474208
FT                   /transl_table=11
FT                   /gene="trmE"
FT                   /gene_synonym="thdF"
FT                   /gene_synonym="mnmE"
FT                   /locus_tag="BCAL0428"
FT                   /product="putative tRNA modification GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0428"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50740"
FT                   /db_xref="GOA:B4E7D7"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7D7"
FT                   /protein_id="CAR50740.1"
FT                   /translation="MLATDSDPIVAIATAAGRGGIGVVRVSFGRGGEAAALPLIDALCG
FT                   QKLAPRHASYVPFLDAHGAPLDRGIALYFPAPHSYTGEHVLELQGHGGPIVMQLLLQRC
FT                   LDAGRGFGLRLAEPGEFTRRAFLNDKLDLAQAEAVADLIEASTEAAARSAGRSLDGAFS
FT                   RQIHALVDDVITLRMLVEATLDFPEEEIDFLEAADARGKLAKIRAQLAHVLGDARQGAL
FT                   LREGLSVVLAGQPNVGKSSLLNALAGAELAIVTPIAGTTRDKVAQTIQVEGIPLHIIDT
FT                   AGLRETEDEVERIGIARTWSEIERADVVLHLLDSRTGMTADDETIAARFPAGVPVVRVL
FT                   NKTDLTGVPACVEHPAAEGDLTEVHLSAKRGDGIDMLRAELLRIAGWQAGAEGVYLARE
FT                   RHLIALRAAQEHLAQAADHAEQRAQSLDLFAEELRLAQEQLNAITGEFTSDDLLGVIFS
FT                   RFCIGK"
FT   misc_feature    473492..473845
FT                   /gene="trmE"
FT                   /locus_tag="BCAL0428"
FT                   /note="HMMPfam hit to PF01926, GTPase of unknown function,
FT                   score 2.6e-43"
FT                   /inference="protein motif:HMMPfam:PF01926"
FT   misc_feature    473510..473533
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(474626..475984)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0430"
FT                   /product="putative diguanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0430"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50741"
FT                   /db_xref="GOA:B4E7D8"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033424"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7D8"
FT                   /protein_id="CAR50741.1"
FT                   /translation="MEGILIQHTTQRQLWFGALTALVILLTLGIAAPHANVALPPVEPF
FT                   MPMCALTVFTTASIAAFFLGAQFTVTRQPVLGALGGAYAFTALAVALQLLTFPGVFAPH
FT                   GLLGARPQSAAWMWVFWHAGFPCFVMAALFARERLTRAPVGAKETRRWTLALVGGPAIA
FT                   AALLCVLALNVSLPPAFHPPRDAAVLPVNGIALVVWILNALALVAVLVTGRLRTTLDLW
FT                   LAIAVLACLTDTTLNLLSTNRFTVGWYVARVFSMFTPGVLVCVLAWEVTMLYQQLFEAH
FT                   ATLIRSSARDGLTGAFNRSHFNDHFHTLFLQARRQGEPLSLLMVDVDRFKAYNDAFGHV
FT                   KGDACLIAVANALAGAVRRPADIVARYGGEEFAIVLPNTGARGARVVADEVREAVLRLD
FT                   LAMPDSPAGRVSVSVGCATVSADDLSTPDALIEAADAALYRAKDAGRNRVVVA"
FT   misc_feature    complement(474641..475135)
FT                   /locus_tag="BCAL0430"
FT                   /note="HMMPfam hit to PF00990, GGDEF domain, score 2.4e-59"
FT                   /inference="protein motif:HMMPfam:PF00990"
FT   misc_feature    complement(474842..474859)
FT                   /note="PS00343 Gram-positive cocci surface proteins
FT                   'anchoring' hexapeptide."
FT                   /inference="protein motif:Prosite:PS00343"
FT   misc_feature    complement(join(475175..475243,475346..475414,
FT                   475457..475525,475583..475651,475694..475762,
FT                   475781..475837,475880..475948))
FT                   /locus_tag="BCAL0430"
FT                   /note="7 probable transmembrane helices predicted for
FT                   BCAL0430 by TMHMM2.0 at aa 13-35, 50-68, 75-97, 112-134,
FT                   154-176, 191-213 and 248-270"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(475874..475984)
FT                   /locus_tag="BCAL0430"
FT                   /note="Signal peptide predicted for BCAL0430 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.893) with cleavage site
FT                   probability 0.422 between residues 37 and 38"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(476094..476342)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0431"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0431"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50742"
FT                   /db_xref="InterPro:IPR021527"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7D9"
FT                   /protein_id="CAR50742.1"
FT                   /translation="MNDKPTIPPHDIPNETIDLQIADVLAAVRYPANKDAIVDAARDAG
FT                   ASNEVLSMLDGLPEQDYADVDAVTRWVAGNFGPGLGI"
FT   CDS_pept        complement(476458..476628)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0432"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0432"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50743"
FT                   /db_xref="GOA:B4E7E0"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7E0"
FT                   /protein_id="CAR50743.1"
FT                   /translation="MIEQVILGIFLVLPLVIVAALFSDELWQEHRRQHPRDENAPHIDW
FT                   KHPWRRVRRGH"
FT   sig_peptide     complement(476560..476628)
FT                   /locus_tag="BCAL0432"
FT                   /note="Signal peptide predicted for BCAL0432 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.898) with cleavage site
FT                   probability 0.604 between residues 23 and 24"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(476563..476616)
FT                   /locus_tag="BCAL0432"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAL0432 by TMHMM2.0 at aa 5-22"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        476774..477337
FT                   /transl_table=11
FT                   /gene="speG"
FT                   /locus_tag="BCAL0433"
FT                   /product="spermidine N(1)-acetyltransferase"
FT                   /EC_number="2.3.1.57"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0433"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50744"
FT                   /db_xref="GOA:B4E7E1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7E1"
FT                   /protein_id="CAR50744.1"
FT                   /translation="MNMQLQNDTNTLALRPLERQDLRFVHELNNDAKIMRYWFEEPYET
FT                   FSELSQLYDRHVHDQRERRFVAVDAQDELVGLVELIELDYIHRRGEFQIIIAPQCQGRG
FT                   YAGQATRLAIEYAFKVLNMRKLYLIVDTSNAAAIHVYEKCGFQHEAELKEEFFGNGAYH
FT                   NAYRMCIFQCDYFERQRAGVNNAG"
FT   misc_feature    476969..477214
FT                   /gene="speG"
FT                   /locus_tag="BCAL0433"
FT                   /note="HMMPfam hit to PF00583, Acetyltransferase (GNAT)
FT                   family, score 2.2e-19"
FT                   /inference="protein motif:HMMPfam:PF00583"
FT   CDS_pept        477828..478172
FT                   /transl_table=11
FT                   /locus_tag="BCAL0434"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0434"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50745"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7E2"
FT                   /protein_id="CAR50745.1"
FT                   /translation="MKRTGVLFALVGAFCAVSIAQAGGDSAVKPKQEIQLTKNAWGCLS
FT                   KDNLDSVLSHERDGKSQAKQQYFDDFRCLSVPEGQRFRVVSVDQGDVQFVSADNSDQQG
FT                   LWTDSRFVKQ"
FT   sig_peptide     477828..477893
FT                   /locus_tag="BCAL0434"
FT                   /note="Signal peptide predicted for BCAL0434 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.827 between residues 22 and 23"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        478361..478915
FT                   /transl_table=11
FT                   /locus_tag="BCAL0435"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0435"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50746"
FT                   /db_xref="InterPro:IPR009822"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR038590"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7E3"
FT                   /protein_id="CAR50746.1"
FT                   /translation="MALKSTIYKAELQIADMDRHYYADHALTVARHPSETDDRMMVRIV
FT                   AFALFAHERLEFCKGLSDVDEPDLWQKDLTGAIDVWIEAGQPDERRISKAAGRAGQVTV
FT                   IAYGGKTSDIWWQGVRSKVERLRNVQVLSLADGVAAALGRLAERTMRLQCTVQDGTAWI
FT                   SSADHDPVVVEWTVLKARADA"
FT   misc_feature    478361..478906
FT                   /locus_tag="BCAL0435"
FT                   /note="HMMPfam hit to PF07152, YaeQ protein, score
FT                   1.8e-104"
FT                   /inference="protein motif:HMMPfam:PF07152"
FT   CDS_pept        complement(478937..479350)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0436"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0436"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50747"
FT                   /db_xref="GOA:B4E7E4"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7E4"
FT                   /protein_id="CAR50747.1"
FT                   /translation="MKPTIRGIDHIVLRVTDMAAMTRFYCDAVGCHVEKEQPDLGLVQL
FT                   RAGDALIDLLTVGGPIDRPDSGPPGTGRNLDHLCLRVEPFDPNALIAHFATHGARPGAP
FT                   AERYGAGGYGPSIYLFDPEGNMVEFKGPPSALG"
FT   misc_feature    complement(478964..479332)
FT                   /locus_tag="BCAL0436"
FT                   /note="HMMPfam hit to PF00903, Glyoxalase/Bleomycin
FT                   resistance protein/Di, score 3e-15"
FT                   /inference="protein motif:HMMPfam:PF00903"
FT   CDS_pept        479782..480873
FT                   /transl_table=11
FT                   /locus_tag="BCAL0437"
FT                   /product="O6-methylguanine-DNA methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0437"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50748"
FT                   /db_xref="GOA:B4E7E5"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR016221"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7E5"
FT                   /protein_id="CAR50748.1"
FT                   /translation="MKTAYPTDDARWGAVTERDPHADGAFFYGVRTTGVFCRPTCASRQ
FT                   PRRENVSFFTDPAAARAAGFRPCKRCQPEGLPRELDIVNRACAVLDAQAERLTLQQLSD
FT                   AVHVSPFHLQRLFKRVVGVSPRQYQAAQRGAALRQALQSGQPVTQAAVDAGFNSPSRLY
FT                   ASVPRELGMAPSAFRRQGAGLRIDYATASTSLGTVLVAATEQGICRIAFGDDPASLVGE
FT                   LKDTFARAELVESSARLAPFVTQIRAYLDGTRHAFDLPLDIAPTAFQQRVWEALTHIPY
FT                   GETRSYSEIAEALGSPRAVRAVASACASNPVALAIPCHRVVQKGGALAGYRWGVRRKAT
FT                   LLAAEARHVHDDEAEAETEGSAV"
FT   misc_feature    479806..480003
FT                   /locus_tag="BCAL0437"
FT                   /note="HMMPfam hit to PF02805, Metal binding domain of Ada,
FT                   score 4e-41"
FT                   /inference="protein motif:HMMPfam:PF02805"
FT   misc_feature    480034..480171
FT                   /locus_tag="BCAL0437"
FT                   /note="HMMPfam hit to PF00165, Bacterial regulatory
FT                   helix-turn-helix, score 2.3e-10"
FT                   /inference="protein motif:HMMPfam:PF00165"
FT   misc_feature    480070..480135
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1844.000, SD 5.47 at aa 97-118, sequence
FT                   LTLQQLSDAVHVSPFHLQRLFK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    480334..480570
FT                   /locus_tag="BCAL0437"
FT                   /note="HMMPfam hit to PF02870, 6-O-methylguanine DNA
FT                   methyltransfera, score 1.6e-12"
FT                   /inference="protein motif:HMMPfam:PF02870"
FT   misc_feature    480574..480831
FT                   /locus_tag="BCAL0437"
FT                   /note="HMMPfam hit to PF01035, 6-O-methylguanine DNA
FT                   methyltransfera, score 2.4e-47"
FT                   /inference="protein motif:HMMPfam:PF01035"
FT   misc_feature    480727..480747
FT                   /note="PS00374 Methylated-DNA--protein-cysteine
FT                   methyltransferase active site."
FT                   /inference="protein motif:Prosite:PS00374"
FT   CDS_pept        480870..481829
FT                   /transl_table=11
FT                   /locus_tag="BCAL0438"
FT                   /product="putative DNA-3-methyladenine glycosylase II"
FT                   /EC_number="3.2.2.21"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0438"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50749"
FT                   /db_xref="GOA:B4E7E6"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR010316"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR037046"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7E6"
FT                   /protein_id="CAR50749.1"
FT                   /translation="MSIETTTIKSLANGGPVPPSAQMELRYKAPYDWARVLRFFSGRAI
FT                   PGVEQVADGVYRRIVDLHGDAGRLTVTKHPRKHCLIATVEGAVARHVDDAFAARVATMF
FT                   DLGADPAAIGDGLARDPWFAPLVDAAPGLRVPGAWSGFELAVRAIVGQQVSVKAATTIV
FT                   GRLVERAGERVMQDDDGAPAWRFPTPDALAACDLDKIGMPGKRVAALTGVARAVAAGDV
FT                   PVDRAHADLATLRSAWLDLPGIGPWTVEYIAMRAWRDPDAWPASDLVLMQSIAARDPAL
FT                   DRLASQKRRTEGWRPWRAYAALHLWNEVADRAGGARGG"
FT   misc_feature    480933..481289
FT                   /locus_tag="BCAL0438"
FT                   /note="HMMPfam hit to PF06029, AlkA N-terminal domain,
FT                   score 3e-27"
FT                   /inference="protein motif:HMMPfam:PF06029"
FT   misc_feature    481305..481757
FT                   /locus_tag="BCAL0438"
FT                   /note="HMMPfam hit to PF00730, HhH-GPD superfamily base
FT                   excision DNA repair, score 5.6e-10"
FT                   /inference="protein motif:HMMPfam:PF00730"
FT   CDS_pept        482307..483908
FT                   /transl_table=11
FT                   /locus_tag="BCAL0439"
FT                   /product="glutamate--cysteine ligase"
FT                   /EC_number="6.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0439"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50750"
FT                   /db_xref="GOA:B4E7E7"
FT                   /db_xref="InterPro:IPR006334"
FT                   /db_xref="InterPro:IPR007370"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7E7"
FT                   /protein_id="CAR50750.1"
FT                   /translation="MTHRQSELLLNRLDALSSGPTRQHLPDGLRGIEKESLRVTRDGMI
FT                   AFTPHPRALGSALTHPALTTDYSEALIELITPAERDAALTLERLDDLHRYVYASLGDEM
FT                   LWNDSMPGLLPADDQIPIADYGTSNIGRLKTVYRRGLAYRYGRTMQCIAGIHYNYSLHE
FT                   EVWRRLHAEEGSTATLVDYQSERYLAQIRNFRRRSWLLMYLFGASPVLDTRFLRGKPHK
FT                   LDTFDADTLYRPYATSLRMSDLGYSNTTAQAALHVDYNTLPGYLDALSKAVSEPYPAYE
FT                   AIGTHRDGEWIQINTNVLQIENEFYSTIRPKRVTYSGERPLHALASRGVQYIEVRCLDI
FT                   DPFEPTGIALETARFIDAFLLACALDESAPLDCDAYKEANANFGSVTMDGRKPGLTLTR
FT                   DGQSITLRQWADELMADIEIVGHRLDEIRGGDEHARAIAAQRDKLADPERTPSARVLRT
FT                   MRENGQSFLAFALAQSEAHAAHFRAHPPSAETLRTEQALAAKSLAEQAELEAKEAGSFD
FT                   AFVAAYRAYTLNRFSV"
FT   misc_feature    482334..483467
FT                   /locus_tag="BCAL0439"
FT                   /note="HMMPfam hit to PF04262, Glutamate-cysteine ligase,
FT                   score 1e-196"
FT                   /inference="protein motif:HMMPfam:PF04262"
FT   CDS_pept        complement(483996..484313)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0440"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0440"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50751"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7E8"
FT                   /protein_id="CAR50751.1"
FT                   /translation="MKTMKHAACAFVLIGAAFAAHAQAASTLTRAQVRQELVELQAAGY
FT                   RTSLASSPDFPENMQAVMQRAAQARTEGDAAGYGSDGRSHTESGKPMLPHAADRGTYAH
FT                   H"
FT   misc_feature    complement(484239..484295)
FT                   /locus_tag="BCAL0440"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAL0440 by TMHMM2.0 at aa 7-25"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(484248..484313)
FT                   /locus_tag="BCAL0440"
FT                   /note="Signal peptide predicted for BCAL0440 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.595 between residues 22 and 23"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        484736..486376
FT                   /transl_table=11
FT                   /locus_tag="BCAL0441"
FT                   /product="putative L-lactate permease"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0441"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50752"
FT                   /db_xref="GOA:B4E7E9"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7E9"
FT                   /protein_id="CAR50752.1"
FT                   /translation="MNPTDALPPGIVFAQPLTPVAHSLLLSFLVAAIPIAVALIALGVL
FT                   RRPAWQASLAGLVAGLAVAIGAWGMPAGLAFNAVGAGMALAVVPVMWIVFNALLLYNIA
FT                   VKSGRFDQFRQWMLDNLPDDRRLVLLVVAFSFGCLLEGISGFGTPVAITSALLIALGFP
FT                   ALEALTYTLLFNTAPVAFGALGVPITVLGAVTSLPPATLAQMVGRQLPFFALLLPFYVV
FT                   GAYGGLRSIAKLWPALLVSGGSFALAQFVTSNFLGYQLTDVLSSLTSLIVTIGFLQVWK
FT                   PQPDPQYALARSVPAAAGAARAGFGGWLPWLVVSVVVIVWVHANVAAIGDVKIKWPGLH
FT                   NAVYVSLYHKPYAAIWDFQPLGTGTAILLSAIVTAALTRTGPGAFVECVVKTWRQTWIA
FT                   IVTVMMIVGLAYLLNYSGISYTLGTGVASTGALFPLVSASLGWIAVFLSGSDTSGNALF
FT                   GNLQVVAARQLGLDPVLMAATNSSGGVMGKMISPQNIATGVSTTDLKGQEGVVFARTFW
FT                   HSVILTLLLGVLVFLQQHVLTWMIPALPK"
FT   misc_feature    join(484793..484861,484880..484939,484982..485050,
FT                   485111..485179,485189..485257,485270..485338,
FT                   485351..485419,485438..485506,485654..485722,
FT                   485795..485863,485921..485989,486008..486076,
FT                   486263..486331)
FT                   /locus_tag="BCAL0441"
FT                   /note="13 probable transmembrane helices predicted for
FT                   BCAL0441 by TMHMM2.0 at aa 20-42, 49-68, 83-105, 126-148,
FT                   152-174, 179-201, 206-228, 235-257, 307-329, 354-376,
FT                   396-418, 425-447 and 510-532"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    484811..486334
FT                   /locus_tag="BCAL0441"
FT                   /note="HMMPfam hit to PF02652, L-lactate permease, score
FT                   6.8e-127"
FT                   /inference="protein motif:HMMPfam:PF02652"
FT   misc_feature    485117..485149
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(486473..487408)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0442"
FT                   /product="LysR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0442"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50753"
FT                   /db_xref="GOA:B4E7F0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017724"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7F0"
FT                   /protein_id="CAR50753.1"
FT                   /translation="MFDQLKAFHATVRQGSITRAARHLGVSQPTIAAQIRQVEQVYGVE
FT                   LFYRSGRKLEVTDTGIELLPLVEQMIALEAQADIMLRNVGGLFEGHLRIGATGPYYIMD
FT                   AVGRFSSAHPSIALTCRIGNSEEILQALQEFRIDLAVSSQRNDADGLERKVISTDPLVL
FT                   VVHRRHPLARFDSIDPAQLADVRLLIREEGSVTRRCTETILAAAGVAAPSVAEIGSREA
FT                   IREAILHGVGGSLFPLGEAERHPDLRVIALRGVDTTIDEYVYYLKARRQSPAIDAFLAC
FT                   ILPGDGEAADAIDAADTVETGRTMRRVNAR"
FT   misc_feature    complement(486548..487156)
FT                   /locus_tag="BCAL0442"
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 8.2e-43"
FT                   /inference="protein motif:HMMPfam:PF03466"
FT   misc_feature    complement(487226..487405)
FT                   /locus_tag="BCAL0442"
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix, score 3.4e-20"
FT                   /inference="protein motif:HMMPfam:PF00126"
FT   misc_feature    complement(487271..487363)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00044"
FT   misc_feature    complement(487301..487366)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   2007.000, SD 6.02 at aa 15-36, sequence
FT                   GSITRAARHLGVSQPTIAAQIR"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        487638..489809
FT                   /transl_table=11
FT                   /locus_tag="BCAL0443"
FT                   /product="putative phospholipase C"
FT                   /EC_number="3.1.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0443"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50754"
FT                   /db_xref="GOA:B4E7F1"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="InterPro:IPR008475"
FT                   /db_xref="InterPro:IPR017767"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7F1"
FT                   /protein_id="CAR50754.1"
FT                   /translation="MSSNNRRDFLRLAAQSAGAMAAYAGFPPAIRNALAMPAAYRTGTI
FT                   RDVEHVVIFMQENRSFDHYFGGLRGVRGFDDPRPHLLPNGAPVWQQPPASVFTKNYHSR
FT                   GLDPSAPYVLPFYLDPKQTTEFQPGTNHGWSSGHLSWNNGQWDQWVNQKQDVLTMGYLK
FT                   RQDLTYHYALADAFTICDSYFCSAHADTAPNRIYLWTGTIDSRNVYGSAPNGPGIGERN
FT                   DVNGYTWTTYAERLENAKISWKVYQGGTGIPGDPTDNYTDNSLMFFKRFQVKEGASGPL
FT                   VDKGASNHTLAELKADVQANRLPQVSWIVSPYKYSEHPQASPTDGAFYINMVLEALTSN
FT                   PEVWAKTVFILNYDENDGLFDHVVPPVPPVTSGVGGQGIVSSNLLSTLGDELLDLNKYP
FT                   GEMSPLVPGADPGGIQPIGLGPRVPLIIISPWTKGGWVCSETFDHTSVLRFLEARFGVK
FT                   EPNISAWRRSICGDLTSAFDFSARPDTRTVSFTVPQHLATAGQAYQVPAQQSMPAQEPG
FT                   TRPARALPYELFVHSRVGAHDDTVSLDFANTGDAGAAFYVYDRRNPATPPRRYAVSARD
FT                   RFVDTWSTSAARGDYHLAAYGPNGYLCEFQGNTRLAADGRHANPEAKIGYDVRNRHVYL
FT                   QLRNSGRASCRVTVDNAYSHAHARTYTLAPGERIEAHFELSSSHGWYDLTITATTLRGG
FT                   DDKVVRRFAGHVETGRPSHSDPGPVKHTA"
FT   sig_peptide     487638..487742
FT                   /locus_tag="BCAL0443"
FT                   /note="Signal peptide predicted for BCAL0443 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.974) with cleavage site
FT                   probability 0.430 between residues 35 and 36"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    487779..489011
FT                   /locus_tag="BCAL0443"
FT                   /note="HMMPfam hit to PF04185, Phosphoesterase family,
FT                   score 3.2e-125"
FT                   /inference="protein motif:HMMPfam:PF04185"
FT   misc_feature    489195..489461
FT                   /locus_tag="BCAL0443"
FT                   /note="HMMPfam hit to PF05506, Domain of unknown function
FT                   (DUF756), score 1.3e-26"
FT                   /inference="protein motif:HMMPfam:PF05506"
FT   misc_feature    489471..489752
FT                   /locus_tag="BCAL0443"
FT                   /note="HMMPfam hit to PF05506, Domain of unknown function
FT                   (DUF756), score 8.3e-24"
FT                   /inference="protein motif:HMMPfam:PF05506"
FT   misc_feature    489498..489533
FT                   /note="PS00192 Cytochrome b/b6 heme-ligand signature."
FT                   /inference="protein motif:Prosite:PS00192"
FT   CDS_pept        490005..490730
FT                   /transl_table=11
FT                   /locus_tag="BCAL0444"
FT                   /product="GntR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0444"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50755"
FT                   /db_xref="GOA:B4E7F2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR017723"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7F2"
FT                   /protein_id="CAR50755.1"
FT                   /translation="MTAPNALSAIELLQSQSLAMIVQDMLERAIVSGEYAPGEKLNEVE
FT                   IATRLNVSRGPVREAFRALEQAGLLRNEKNRGVTVRVVPLREAEEIYEVRAMLDESVAR
FT                   ALAKRISPETLKVLKGIIQSMKDAAKTHDVTRYTELNVQFHDAMVVGVGNTHLTDTYRR
FT                   LVRQLGLLRQAAIEAEEDAIAVSAAEHDKIVQALAAGDEDKAVALVREHVAHGLARMRR
FT                   THEQGLPATGKAAREKAGA"
FT   misc_feature    490056..490244
FT                   /locus_tag="BCAL0444"
FT                   /note="HMMPfam hit to PF00392, Bacterial regulatory
FT                   proteins, gntR family, score 3.7e-18"
FT                   /inference="protein motif:HMMPfam:PF00392"
FT   misc_feature    490122..490196
FT                   /note="PS00043 Bacterial regulatory proteins, gntR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00043"
FT   misc_feature    490125..490190
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1208.000, SD 3.30 at aa 41-62, sequence
FT                   LNEVEIATRLNVSRGPVREAFR"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    490272..490649
FT                   /locus_tag="BCAL0444"
FT                   /note="HMMPfam hit to PF07729, FCD domain, score 1.4e-26"
FT                   /inference="protein motif:HMMPfam:PF07729"
FT   CDS_pept        complement(490830..492218)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0445"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0445"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50756"
FT                   /db_xref="GOA:B4E7F3"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR017715"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7F3"
FT                   /protein_id="CAR50756.1"
FT                   /translation="MRPFWIEQALFNDGDLAPALQGATQADVCIVGGGFTGLWTAIQAK
FT                   QQHPALDIAILEADLCGAGASGRNGGCLLTWSAKFLTLRRLFGEAEAIRLVKASEAAVQ
FT                   HIADFCRAHDIDAELRLDGTLYTATSRAQVGTLAPVLDALAACGIHSYEPLPPAEVARR
FT                   SGSARNLDGVYSPIAATVHPGKLVRGLRRAARAMGIRIYERTPMLDFTPGQPAVVRTPS
FT                   GSVTAGKLVFAINAWMASRFPQFERTIAVVSSDMVITEKCPELLERTGLVDGVSVLDSR
FT                   IFVYYYRTTADGRLMLGKGGNTFSWRSRIAPVFDRRSPYEAQLTHSLREFFPSLAGVPV
FT                   TASWNGPSDRSVTGFPFFGRLDDAPNVFYGFGYSGNGVGPTYMGGQILSSLVLGLDNAW
FT                   TRSPIVRGPLGHFPPEPIRYVGAHVVRNAIRRKERAEDESRQPSAVDTWLAKFASAAGK
FT                   ADKA"
FT   misc_feature    complement(491046..492140)
FT                   /locus_tag="BCAL0445"
FT                   /note="HMMPfam hit to PF01266, FAD dependent
FT                   oxidoreductase, score 1e-80"
FT                   /inference="protein motif:HMMPfam:PF01266"
FT   CDS_pept        complement(492314..493444)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0446"
FT                   /product="putative aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0446"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50757"
FT                   /db_xref="GOA:B4E7F4"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR012703"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7F4"
FT                   /protein_id="CAR50757.1"
FT                   /translation="MTLAAQPILLTPGPLTTSERTRDAMLRDWGSWDGDFNAITARLRE
FT                   RLLQIVHGEGTHECVPLQGSGTFSVEAAIGTLVPRDGHVLVPNNGAYCQRLAKICRVLG
FT                   RRLTTIDYREDRRVDPADVERALAADPSITHVALVHCETGAGVLNPLHDVAQAVAKHGR
FT                   ALIVDAMSSFGAIDIDARTTPFDAVIAASGKCLEGVPGLGFVIAKRSALERCEGNSHSL
FT                   AMDLYDQWVYMQRTTQWRFTPPTHVVAALDAAVAQYIDEGGLAARGGRYQRNTRALLDG
FT                   MRALGFRPFLDPAIQAPIIVTFHAPDDPNYDFKRFYQEVKKRGYILYPGKLTEVETFRV
FT                   GCIGHFGEAGIPGAVAAIADTLRAMGVRRVSAEAAA"
FT   misc_feature    complement(492380..493423)
FT                   /locus_tag="BCAL0446"
FT                   /note="HMMPfam hit to PF00266, Aminotransferase class-V,
FT                   score 4.6e-08"
FT                   /inference="protein motif:HMMPfam:PF00266"
FT   CDS_pept        complement(493492..495219)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0447"
FT                   /product="binding-protein-dependent transport system inner
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0447"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50758"
FT                   /db_xref="GOA:B4E7F5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR017664"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7F5"
FT                   /protein_id="CAR50758.1"
FT                   /translation="MSTVLTERRRGASAPADVRQLTHWHDRLAQLALVAMAALMSLFLL
FT                   LPLALVVQKCFVDADGRFVGAHNFVEYLEDSGVLRSMLHSLTVGALVTMIVVPMAFTFA
FT                   YALTRSCMPLKNAARTIALLPLLAPTLLSAVSFIYWFGNAGLLKPLLHGHSIYGLPGIV
FT                   LSMVYASFPHVLMILVTALSLADGRLYEAADAMGTGRLRKFFTITLPGAKYGLISATMV
FT                   AFTMCINDFGVPVVIGGAYNVLSTDIYKLIIGLQDFNRSAVVSLMLLCPALVAFGVDYF
FT                   IRRRQQSQLGARSTPYQPKPSRGFDAAMLAYCALVCAFFIAVVGISVFASFVKFWPYQM
FT                   TLGLQHYEMGLIAAGIFDAYKNSLRMAATVALGGTIVVFGGAYLIEKTRGARWLRGFIG
FT                   LCAILPMGVPGLVLGISYIFLFNAPGNPLNGLYGSLWLLAIVTVVHYYASSHLTAVTAL
FT                   RQIDSEFEAVSASLKVPFYKTFLRVTVPVCLPAILLIARYLFVNGMTTVSAVAFLYSPD
FT                   TQPASVAILNLDDAGQMGPAAAMATLVLATSSFACVLFACISHRLLRRTQAWRNPHRR"
FT   misc_feature    complement(493528..494142)
FT                   /locus_tag="BCAL0447"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 0.00031"
FT                   /inference="protein motif:HMMPfam:PF00528"
FT   misc_feature    complement(join(493543..493611,493717..493785,
FT                   493846..493914,493957..494025,494062..494130,
FT                   494224..494292,494371..494439,494542..494610,
FT                   494668..494736,494794..494862,494899..494967,
FT                   495061..495129))
FT                   /locus_tag="BCAL0447"
FT                   /note="12 probable transmembrane helices predicted for
FT                   BCAL0447 by TMHMM2.0 at aa 31-53, 85-107, 120-142, 162-184,
FT                   204-226, 261-283, 310-332, 364-386, 399-421, 436-458,
FT                   479-501 and 537-559"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(494356..494988)
FT                   /locus_tag="BCAL0447"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 0.00096"
FT                   /inference="protein motif:HMMPfam:PF00528"
FT   misc_feature    complement(494590..494676)
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT                   /inference="protein motif:Prosite:PS00402"
FT   CDS_pept        complement(495216..496298)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0448"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0448"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50759"
FT                   /db_xref="GOA:B4E7F6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR014769"
FT                   /db_xref="InterPro:IPR017666"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7F6"
FT                   /protein_id="CAR50759.1"
FT                   /translation="MAPYLSVERIEKRYNDTQVLTDINLSVMKGEMICFLGPSGCGKTT
FT                   LLRIIAGLETQNAGHIMQDGRDISRLPPQLRDYGIVFQSYALFPNLTVYDNVAYGLVNR
FT                   KMKRDAIHERVHTLLALVGLPDSHRKHPGQLSGGQQQRIALARALATSPGLLLLDEPLS
FT                   ALDARVRVRLRQEIRALQQRLGVTTIMVTHDQEEALSMADRIVVMNHGVIEQIGTPLEI
FT                   YRQPASPFVADFIGRVNTIPAEVAQDGTLRAGGIGFDCRHGTAQGAAVSVYVRPEDLRI
FT                   RVPGETADNVLAGRVEKLEFLGAFCRVSFRIDGLDGQEIVADLSYHDVDRTGVQAGARI
FT                   DLALDREHVRVFPCAKERLQ"
FT   misc_feature    complement(495243..495485)
FT                   /locus_tag="BCAL0448"
FT                   /note="HMMPfam hit to PF08402, TOBE domain, score 5.8e-11"
FT                   /inference="protein motif:HMMPfam:PF08402"
FT   misc_feature    complement(495246..495443)
FT                   /locus_tag="BCAL0448"
FT                   /note="HMMPfam hit to PF03459, TOBE domain, score 0.00056"
FT                   /inference="protein motif:HMMPfam:PF03459"
FT   misc_feature    complement(495666..496211)
FT                   /locus_tag="BCAL0448"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   2.5e-63"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    complement(495852..495896)
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    complement(496167..496190)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(496396..497451)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0449"
FT                   /product="extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0449"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50760"
FT                   /db_xref="InterPro:IPR017663"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7F7"
FT                   /protein_id="CAR50760.1"
FT                   /translation="MNEVPVNKRLNAWAAGAARVALAAAVALGAAHAAYAKTSLLVYTA
FT                   LEDEAMKPYKDAFEKANPDIEIRWVRDSTGSVTAKLLAEKNNPRADVVLGLAASSLTLL
FT                   DLQGMLMPYTPKGFDQLTRKYSDANTPPHWVGMDVWGATICYNRVAAQAKNIPKPTSWE
FT                   DLTKPVYKGAIVMPSPVSSGTGYLDVTAWLQTFGDDRGWKFMDALDKNVAQYVHSGSKP
FT                   CTLAGTGEFPIGISFEFRGHELQAQGAPIDLVFPKEGLGWDMEGTAIMKTTKQPDAAKK
FT                   LADFMASKEANQITARWWAIVAYPGVARKLAGIPDNYSDLLVKNDFVWSAKNRQSILDT
FT                   WQKRYGAKAQQ"
FT   misc_feature    complement(496573..497415)
FT                   /locus_tag="BCAL0449"
FT                   /note="HMMPfam hit to PF01547, Bacterial extracellular
FT                   solute-binding prot, score 1.6e-08"
FT                   /inference="protein motif:HMMPfam:PF01547"
FT   sig_peptide     complement(497344..497451)
FT                   /locus_tag="BCAL0449"
FT                   /note="Signal peptide predicted for BCAL0449 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.892 between residues 36 and 37"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(497347..497415)
FT                   /locus_tag="BCAL0449"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAL0449 by TMHMM2.0 at aa 13-35"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        497652..498899
FT                   /transl_table=11
FT                   /locus_tag="BCAL0450"
FT                   /product="putative phosphonoacetate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0450"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50761"
FT                   /db_xref="GOA:B4E7F8"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR012710"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR023116"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7F8"
FT                   /protein_id="CAR50761.1"
FT                   /translation="MNVMTETPVSVEVNGRRYNWMSRPVVVVCVDGCAYEYLEEAAEAG
FT                   VAPFLRTLLKPGTALKGECVVPSFTNPNNLSIVTGVPPAIHGISGNYFYDRDTGAEVLM
FT                   NDPKYLVAPTVLATFAERGARVAVVTAKDKLRRLLGKGLKGICFSSEKADEASVEENGI
FT                   DNVLELVGKPVPSVYSADLSEFVFAAGVRLLETRPIDLMYLSTTDYVQHKCAPGTEGAN
FT                   AFYAMMDTYLQRLDALGAIVAITADHGMNAKHDDATGEPNVIYLQELFDEWLGHDAARV
FT                   ILPITDPYVVHHGALGSFATVYVPATADADALRARLAAVDGIEVVLTGAEGCARFELPP
FT                   ARMGDLIVISKQDVVLGTRRIKHDLSGLDVPLRSHGGISEQIVPLIFSKPVATDVTGRA
FT                   RLRNFDIIDIALNHLQ"
FT   misc_feature    497718..498785
FT                   /locus_tag="BCAL0450"
FT                   /note="HMMPfam hit to PF01663, Type I phosphodiesterase /
FT                   nucleotide py, score 7.5e-17"
FT                   /inference="protein motif:HMMPfam:PF01663"
FT   CDS_pept        498929..500383
FT                   /transl_table=11
FT                   /locus_tag="BCAL0451"
FT                   /product="putative NADP-dependent
FT                   glyceraldehyde-3-phosphate dehydrogenase"
FT                   /note="Similar to BCAM1186, 96.488% identity (96.488%
FT                   ungapped) in 484 aa overlap (1-484:1-484), and BCAM2493,
FT                   68.153% identity (68.153% ungapped) in 471 aa overlap
FT                   (14-484:12-482)"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0451"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50762"
FT                   /db_xref="GOA:B4E7F9"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR017656"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7F9"
FT                   /protein_id="CAR50762.1"
FT                   /translation="MNAIAASTAVREIRREALRIDGERIHRDAVIDVRNPYDGALVGTV
FT                   PKATLDDVRRAFAVARAYRPTLTRHDRAAILRRAADIVRSRTAEIAALITAEAGLCIKD
FT                   STYEAGRVADVLTFGAGEVLKDDGQIFSCDLTPHGKKRRVYTQRDPLLGVISAITPFNH
FT                   PMNQVAHKIVPSVATNNRIVVKPSEKVPLSCYLFADILYEAGLPPQMLQVITGDPKEIA
FT                   DELITNPAIDLITFTGGVSIGKSIAARMGYRRAVLELGGNDPIIVMEDADLDEASTLAV
FT                   SGSYKNSGQRCTAIKRMLVHEAVADRFTALVVEKTRAWSYGNPSDPSVDMGTVIDEAAA
FT                   KFCEQQVNDAIARGARLLVGNVRDGALYSPTVVDRVTPDMPLVKHETFGPVSPIMRFRD
FT                   IDEAIRMSNSTDYALSSSVCTNRFDHITRFITELEVGSVNVREVPGYRLELTPFGGVKD
FT                   SGLGYKEGVQEAMKSFTNTKTYSLPW"
FT   misc_feature    499004..500368
FT                   /locus_tag="BCAL0451"
FT                   /note="HMMPfam hit to PF00171, Aldehyde dehydrogenase
FT                   family, score 3.6e-178"
FT                   /inference="protein motif:HMMPfam:PF00171"
FT   misc_feature    499640..499663
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    499697..499720
FT                   /note="PS00687 Aldehyde dehydrogenases glutamic acid active
FT                   site."
FT                   /inference="protein motif:Prosite:PS00687"
FT   misc_feature    499781..499816
FT                   /note="PS00070 Aldehyde dehydrogenases cysteine active
FT                   site."
FT                   /inference="protein motif:Prosite:PS00070"
FT   CDS_pept        500563..501345
FT                   /transl_table=11
FT                   /locus_tag="BCAL0452"
FT                   /product="periplasmic solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0452"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50763"
FT                   /db_xref="GOA:B4E7G0"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7G0"
FT                   /protein_id="CAR50763.1"
FT                   /translation="MKFLRSLLVVALLQATAATSALAADDLSQIKSAGVFRVGTEGTYA
FT                   PFTYHDETGKLTGFDVDIATAIAQRLGVKPQFVEGKWDGLIAGLDVNRYDAVVNEVSIT
FT                   DARKAKYDFSTPYITSHAVLIVRADNTTIRSFDDLKGKKSANTLTSNFGKLAAAHGADV
FT                   VPVQGFNESIDLLTSGRVDATINDSLSYLDFRKHKPDAKLKIAATDQTGAGDASGVLLR
FT                   KGSPALVAAIDKALADIKADGTYAKISQKYFGRDVSQP"
FT   sig_peptide     500563..500631
FT                   /locus_tag="BCAL0452"
FT                   /note="Signal peptide predicted for BCAL0452 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.981 between residues 23 and 24"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    500668..501327
FT                   /locus_tag="BCAL0452"
FT                   /note="HMMPfam hit to PF00497, Bacterial extracellular
FT                   solute-binding prot, score 4.9e-99"
FT                   /inference="protein motif:HMMPfam:PF00497"
FT   misc_feature    500734..500775
FT                   /note="PS01039 Bacterial extracellular solute-binding
FT                   proteins, family 3 signature."
FT                   /inference="protein motif:Prosite:PS01039"
FT   CDS_pept        501360..502040
FT                   /transl_table=11
FT                   /locus_tag="BCAL0453"
FT                   /product="putative amino acid ABC transporter permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0453"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50764"
FT                   /db_xref="GOA:B4E7G1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7G1"
FT                   /protein_id="CAR50764.1"
FT                   /translation="MPAWLHLMAESLRPLLVAGLVFTVPLTLASFAIGLLLAFGAALTR
FT                   LFGPRWAQAVVRFYIWLFRGSPLLVQLFVIFYGLPNVGIVLDPLTAAVIGFSLNVGAYN
FT                   AEVIRGVIESMPKGQWEAAYSMSMTRAQALRRAILPQAARVALPALSNSFISLVKDTSL
FT                   AAVLTVPEIFQAAQRIAAVTYEPLILYTEAALIYLLFSSVLSTLQRRLETRFGRHALFH
FT                   AELR"
FT   sig_peptide     501360..501479
FT                   /locus_tag="BCAL0453"
FT                   /note="Signal peptide predicted for BCAL0453 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.699) with cleavage site
FT                   probability 0.289 between residues 40 and 41"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(501402..501470,501531..501599,501921..501980)
FT                   /locus_tag="BCAL0453"
FT                   /note="3 probable transmembrane helices predicted for
FT                   BCAL0453 by TMHMM2.0 at aa 15-37, 58-80 and 188-207"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    501405..502010
FT                   /locus_tag="BCAL0453"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 1.1e-28"
FT                   /inference="protein motif:HMMPfam:PF00528"
FT   CDS_pept        502037..502795
FT                   /transl_table=11
FT                   /locus_tag="BCAL0454"
FT                   /product="putative amino acid ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0454"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50765"
FT                   /db_xref="GOA:B4E7G2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7G2"
FT                   /protein_id="CAR50765.1"
FT                   /translation="MIRLERIDKSFGAHRVLSGIDLALQPGSVTALIGPSGSGKSTLLR
FT                   CVNLLEVPEAGALVVGDARIDFVPARRPSRDAVFAVRKQTGMVFQNFQLFPHLSVVQNV
FT                   MEGLVTVQRWPRERARERALALLDKVGIADKADAWPATLSGGQQQRVAIARALAPSPQV
FT                   LLCDEPTSALDPELSVEVVEVLRQLAREGTTMLMATHDLRLAASIAHDAVFLADGRIVE
FT                   AGASRDLFGRPRDPRTAKFVATLAQGVPAF"
FT   misc_feature    502115..502690
FT                   /locus_tag="BCAL0454"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   5.2e-64"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    502136..502159
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    502463..502507
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        complement(502820..503635)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0455"
FT                   /product="putative hydrolase"
FT                   /note="family S33 serine peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0455"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50766"
FT                   /db_xref="GOA:B4E7G3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7G3"
FT                   /protein_id="CAR50766.1"
FT                   /translation="MLELPNRFNFEGHRIAWGTLGEGPPLVLVHGTPFSSQVWRRIAPW
FT                   LARRHRVYFYDLLGYGQSDMPDADVSLGRQNALFGALLNEWKLARPRVLAHDYGGATAL
FT                   RAHFLDGIAYADLTLVNPVAIAPQGSPFVRHVAQHEAAFTGLPAYAHHALLSAYLGNAV
FT                   ARPLSDDALSIYRAPWLTPAGQAAFYRQIAQMRQRYIEEAEARYAPPDFPVRIVWGEDD
FT                   AWIPLEQGQALADRIANGQLIRVPHAGHLVQEDAPEAIVAAVLDGYAQR"
FT   misc_feature    complement(502838..503488)
FT                   /locus_tag="BCAL0455"
FT                   /note="HMMPfam hit to PF00561, alpha/beta hydrolase fold,
FT                   score 6.8e-11"
FT                   /inference="protein motif:HMMPfam:PF00561"
FT   CDS_pept        503718..504332
FT                   /transl_table=11
FT                   /locus_tag="BCAL0456"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0456"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50767"
FT                   /db_xref="InterPro:IPR010852"
FT                   /db_xref="InterPro:IPR021005"
FT                   /db_xref="InterPro:IPR023286"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7G4"
FT                   /protein_id="CAR50767.1"
FT                   /translation="MVTRSDPVRPRHEWRAADFVGGHPALDFLNTVADTGKTRAEDKLV
FT                   DWPAVRAWAGKAGLPAPDDLARLLRHPRQDGPDELAALRRFREDAYVAIAHLTAEGGGS
FT                   ARARAAERLAVAIRDAIGRSAFDAVGGRFAWRPDARAASRWVDAIALGFEDLMRSDDFA
FT                   RVRQCGRCTWFFVDRGRGVGRRWCDMRTCGNRAKVEAFRER"
FT   misc_feature    503766..504326
FT                   /locus_tag="BCAL0456"
FT                   /note="HMMPfam hit to PF07336, Protein of unknown function
FT                   (DUF1470), score 8.3e-18"
FT                   /inference="protein motif:HMMPfam:PF07336"
FT   CDS_pept        complement(504369..505274)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0457"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0457"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50768"
FT                   /db_xref="GOA:B4E7G5"
FT                   /db_xref="InterPro:IPR021994"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7G5"
FT                   /protein_id="CAR50768.1"
FT                   /translation="MPGKDALLALMIGVVLFVLAGVLAITAGREPGNLVRAPGTVVRIV
FT                   QDSDAMHAYRPIVAYLANDGQRREVAGNTASTVPAYDIGENVDVLLDPDHPERPALIDD
FT                   FTQRWFPAAVPALLAVASFAIGGLLIARERRHRQSDPAPRRVVHTPARRRWDVAIVLIP
FT                   IAIGTGFLAGAGAAGLRQWQIVHHYARSTGHVVEIAKNGRSSRSRTSLYSAVVAFTTDS
FT                   GRLITFAQGSASSHPGLHEGDAVNVLYDPVTPERALVDRFWDRWGLTAILFAIGAPFLA
FT                   AGLFVAATLWPDHRPHGTAQ"
FT   misc_feature    complement(join(504411..504479,504738..504806,
FT                   504882..504950,505188..505256))
FT                   /locus_tag="BCAL0457"
FT                   /note="4 probable transmembrane helices predicted for
FT                   BCAL0457 by TMHMM2.0 at aa 7-29, 109-131, 157-179 and
FT                   266-288"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(505203..505274)
FT                   /locus_tag="BCAL0457"
FT                   /note="Signal peptide predicted for BCAL0457 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.981) with cleavage site
FT                   probability 0.469 between residues 24 and 25"
FT                   /inference="protein motif:SignalP:2.0"
FT   tRNA            complement(505607..505682)
FT                   /gene="BCALr0457"
FT                   /note="tRNA Lys anticodon CTT, Cove score 94.68"
FT   CDS_pept        505873..506277
FT                   /transl_table=11
FT                   /locus_tag="BCAL0458"
FT                   /product="thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0458"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50769"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7G6"
FT                   /protein_id="CAR50769.1"
FT                   /translation="MDENAVRELLDRLLAPWVRSLGLVPVSIGDDSVTLRLPFSGEFRH
FT                   SGGIICGQVFTAAADTAMVVAISSALGEFRPMTTVSLNTNFMRPVRKGDVLVTARVLRM
FT                   GRNLVFGEVELFDEDGKIAVHATSTYALVS"
FT   misc_feature    506011..506244
FT                   /locus_tag="BCAL0458"
FT                   /note="HMMPfam hit to PF03061, Thioesterase superfamily,
FT                   score 2.2e-15"
FT                   /inference="protein motif:HMMPfam:PF03061"
FT   CDS_pept        506286..507152
FT                   /transl_table=11
FT                   /locus_tag="BCAL0459"
FT                   /product="putative patatin-like phospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0459"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50770"
FT                   /db_xref="GOA:B4E7V1"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7V1"
FT                   /protein_id="CAR50770.1"
FT                   /translation="MFDQIVFAGGGNRCWWQAGFWDVARPALDLRPRVITGISAGAATA
FT                   CMLYTRDAAWVMRYYGEALRHNRKNAYWGNLFGREPVFPHYRIYRQALLDIYGEPFAKL
FT                   ATAPEIRIGVSHVPRWLGARSAVAAGLVAYNIEKYVRKTLHPTLGRTLGFRPEFVRAQA
FT                   CTQVDELADLILQSSCTPPFTPVLRRGGRPVLDGGMVDNVPVDALDPSPGDVLVLVTRL
FT                   YPRPQMFTVAHGDQRRLYVQPSSKVPISSWDYTSPSQMRHAYDLGRRDGEHFLARVGAM
FT                   TGGRVAA"
FT   misc_feature    506298..506912
FT                   /locus_tag="BCAL0459"
FT                   /note="HMMPfam hit to PF01734, Patatin-like phospholipase,
FT                   score 6.3e-06"
FT                   /inference="protein motif:HMMPfam:PF01734"
FT   misc_feature    506391..506423
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(507201..508214)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0460"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0460"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50771"
FT                   /db_xref="GOA:B4E7V2"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7V2"
FT                   /protein_id="CAR50771.1"
FT                   /translation="MKIAILDDYQDAVRKLNCFEMLAGHDVKVFNNTVRGLGQLASRLA
FT                   EVEALVLIRERTPITSQLLSKLPNLRMISQTGRVSSHIDLDACTDRGIAVLEGTGSPVA
FT                   PAELTWALVMAAQRRIPQYVANLKQGAWQQSGLKTSALPPNFGLGQVLRGQTLGIWGYG
FT                   KIGRLVAGYGKAFGMNVLVWGREHSLEAARADGYTAADSREALFEQSDVLSLHLRLHDD
FT                   TRGIVKQEDLMRMKPTSLLVNTSRAELLEENALVNALSHNRPGMVAIDVFESEPILQGY
FT                   SLLRMENVICTPHIGYVERESYELYFSAAFRNILAFDDGDMSSVANPEALTPIRKR"
FT   misc_feature    complement(507234..508208)
FT                   /locus_tag="BCAL0460"
FT                   /note="HMMPfam hit to PF00389, D-isomer specific
FT                   2-hydroxyacid dehydrog, score 8.4e-20"
FT                   /inference="protein motif:HMMPfam:PF00389"
FT   misc_feature    complement(507327..507887)
FT                   /locus_tag="BCAL0460"
FT                   /note="HMMPfam hit to PF02826, D-isomer specific
FT                   2-hydroxyacid dehydrog, score 8.1e-67"
FT                   /inference="protein motif:HMMPfam:PF02826"
FT   CDS_pept        508642..509691
FT                   /transl_table=11
FT                   /locus_tag="BCAL0461"
FT                   /product="LysR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0461"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50772"
FT                   /db_xref="GOA:B4E7V3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7V3"
FT                   /protein_id="CAR50772.1"
FT                   /translation="MDHLQSMRVFVKVADLGSFARAASAMDISNAVATRHVADLEGRLG
FT                   TRLLNRTTRSLSLTESGQVYLERARQILDELEDVEQMVVARNHEPVGTLRIVAPVVFGL
FT                   HNLAPVLQSYTENFPKVVPDLTLVDRQVDLVEEGFDVGIVVTRQMRSASIVTRRLTTGC
FT                   MTVCATPSYLEKHGVPTHPEQLAEHPALSLPTEYWGDERVFTGPDGEVRVRPTNVIVAN
FT                   NTAMLRQFALLGMGVAILPSYLIGSDIARGALVRLLPDFRLPQVEINIAYPSRRHLPAK
FT                   VRTFIDHLVEHFSHSTDAMMGEQWAAQGATLPPIGVEMRAEQPESTDPNLQPRLARSPR
FT                   TRVAVPSPL"
FT   misc_feature    508651..508830
FT                   /locus_tag="BCAL0461"
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix, score 1.3e-18"
FT                   /inference="protein motif:HMMPfam:PF00126"
FT   misc_feature    508693..508785
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00044"
FT   misc_feature    508900..509523
FT                   /locus_tag="BCAL0461"
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 1.4e-51"
FT                   /inference="protein motif:HMMPfam:PF03466"
FT   CDS_pept        complement(509823..512420)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0462"
FT                   /product="putative DNA topoisomerase III"
FT                   /EC_number="5.99.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0462"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50773"
FT                   /db_xref="GOA:B4E7V4"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7V4"
FT                   /protein_id="CAR50773.1"
FT                   /translation="MSKALIIAEKPSVANDIARALGGFTKHDEYYESDDFVLSSAVGHL
FT                   LEIAAPEEYEVKRGKWSFAHLPVIPPHFDLNPIAKSESRLKVLTKLMKRKDVDRLINAC
FT                   DAGREGELIFRLIAQHAKAKQPVQRLWLQSMTPQAIRDGFANLRSDSDMQPLADAARCR
FT                   SEADWLVGINGTRAMTAFNSKGGGFFLTTVGRVQTPTLSIVVEREEKIRRFIPRDYWEV
FT                   KAEFACAGGFYEGKWFDPKFKRDEFDPEKRDSRLWSLPAAETIVAACRDQVGTVSEESK
FT                   PSTQLSPLLFDLTSLQREANSRFGFSAKNTLGLAQALYEKHKVLTYPRTDARALPEDYL
FT                   STVQSTLEMLKESHNYLPHAKQVLDKGWVKPNKRIFDNSKISDHFAIIPTLQAPKSLSE
FT                   PEQKLYDMVVKRFLAVFFPAAEFRVTTRITEVAGHHFKTEGKVLVEPGWLQVYGRDAEG
FT                   ADANLVPVQKDEKVKTDEIAAVALVTKPPARYSEATLLSAMEGAGKLVEDDELREAMAA
FT                   KGLGTPATRAAIIEGLLGEKYLLREGRELIPTAKAFQLMTLLRGLGVKELTAPELTGEW
FT                   EYKLSQMERGNLGRDAFMQEIARMTQQIVKRAKEYDSDTIPGDYATLETPCPNCGGQVK
FT                   ENYRRFACTKCDFSISKIPGSRQFEIPEVEELLQKKEIGPLSGFRSKMGRPFSAILKLS
FT                   FDDETKNYKLEFDFGQDQGGEEGEAPDFSAQEPVGACPKCKGRVFEHGMSYVCEHSVAN
FT                   PKTCDFRSGKVILQQEITREQMGKLLADGRTDLLPNFKSSRTGRNFKAFLVKQPDGKIG
FT                   FEFEKKEPKAAAAKKTAKSATKDAETVTEGAEEKPAPARKTAARKTTARKTGS"
FT   misc_feature    complement(510735..511976)
FT                   /locus_tag="BCAL0462"
FT                   /note="HMMPfam hit to PF01131, DNA topoisomerase, score
FT                   1.8e-100"
FT                   /inference="protein motif:HMMPfam:PF01131"
FT   misc_feature    complement(511428..511475)
FT                   /note="PS00396 Prokaryotic DNA topoisomerase I active
FT                   site."
FT                   /inference="protein motif:Prosite:PS00396"
FT   misc_feature    complement(512022..512414)
FT                   /locus_tag="BCAL0462"
FT                   /note="HMMPfam hit to PF01751, Toprim domain, score
FT                   2.6e-14"
FT                   /inference="protein motif:HMMPfam:PF01751"
FT   CDS_pept        complement(512613..512993)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0463"
FT                   /product="putative thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0463"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50774"
FT                   /db_xref="GOA:B4E7V5"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7V5"
FT                   /protein_id="CAR50774.1"
FT                   /translation="MPALNLDTDADRIAERLADPGTLLVACLCAEWCGTCRDYRTAFDQ
FT                   LADAHPDACFAWIDIETHADRLDDLDVENFPTILIEDAHTARFFGTVLPHAAIVERMLS
FT                   DLSAVPGAPHAPKLRDVLNVEA"
FT   misc_feature    complement(512679..512990)
FT                   /locus_tag="BCAL0463"
FT                   /note="HMMPfam hit to PF00085, Thioredoxin, score 0.015"
FT                   /inference="protein motif:HMMPfam:PF00085"
FT   CDS_pept        complement(513030..514343)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0464"
FT                   /product="SMF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0464"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50775"
FT                   /db_xref="GOA:B4E7V6"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7V6"
FT                   /protein_id="CAR50775.1"
FT                   /translation="MAPRASLAAAFEGRLMSPQALTPAALRAWLQFAHAPGLSPAVLQL
FT                   LLAAFGSPEALLRASDEAIATVSSPAAAQAVRMSERDDLDTRTAAALAWLDGPGNVLVT
FT                   LSDPAYPPRLRDLHDPPPLLYVKGGLELLHARGLAVVGSRHATPQGLADATQFARTLSD
FT                   AGLTIVSGLALGIDGAAHRGGLDGRSGTVAVIATGADLVYPARHRALAHEIAAHGAIVS
FT                   EWPLGTPARAAHFPQRNRLIAALAIGALVVEAAPRSGSLITARLANELGRDVFAIPGSI
FT                   HAPLAQGCHALIRDGAKLTAAPLDVLEEYGLDEPAARATSGAMRAGNQGSNTDALREPE
FT                   TAGIAQANRTAATTAPASIEAAPPGNPSERAVLAALGYGPVTYEWLAEHSGLSDDVLHG
FT                   ALLALELAGRVASVAGGRFARLDAAPTPSTRGVLHSPA"
FT   misc_feature    complement(513441..514064)
FT                   /locus_tag="BCAL0464"
FT                   /note="HMMPfam hit to PF02481, SMF family, score 2.5e-91"
FT                   /inference="protein motif:HMMPfam:PF02481"
FT   misc_feature    complement(513477..513509)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        514529..515032
FT                   /transl_table=11
FT                   /gene="def"
FT                   /gene_synonym="fms"
FT                   /locus_tag="BCAL0465"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0465"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50776"
FT                   /db_xref="GOA:B4E7V7"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7V7"
FT                   /protein_id="CAR50776.1"
FT                   /translation="MALLNILHYPDKRLHKVAKPVDKVDDRIRKLVADMAETMYAAPGI
FT                   GLAATQVDVHERVIVIDVSEEKNELRAFINPEIVWSSDAKQTYEEGCLSVPGIYDEVER
FT                   PDHVRVRALNEQGETFELDCEGLLAVCVQHEMDHLMGRVFVEYLSPLKQTRIKTKMKKL
FT                   ERAM"
FT   misc_feature    514535..514990
FT                   /gene="def"
FT                   /locus_tag="BCAL0465"
FT                   /note="HMMPfam hit to PF01327, Polypeptide deformylase,
FT                   score 1.6e-71"
FT                   /inference="protein motif:HMMPfam:PF01327"
FT   CDS_pept        515067..516059
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="BCAL0466"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0466"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50777"
FT                   /db_xref="GOA:B4E7V8"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E7V8"
FT                   /protein_id="CAR50777.1"
FT                   /translation="MTHTLRVIFAGTPEFAAAALAAIHEAGFPVPLVLTQPDRPAGRGM
FT                   KLQASAVKRYAVEHGMTVAQPPSLRRAGKYPAEAADAIELLRTTQHDVMVVAAYGLLLP
FT                   QEVLDIPRAGCINIHASLLPRWRGAAPIHRAIEAGDAETGVTLMQMDVGLDTGAMIEEA
FT                   RIAIAPDDTTATLHDRLAADGARLIVDALVRLERDGTLPATPQPADGVTYAEKIGKHEA
FT                   ALDWRKPADVLARQVRAFDPFPGGVATLDGAAIKLWAAEPVAARGTMANAAPGTIVEAA
FT                   PEGVVVACGSGALRVTQLQKPGGKRLPAREFLAGSPLAAGQRFALPDVD"
FT   misc_feature    515073..515642
FT                   /gene="fmt"
FT                   /locus_tag="BCAL0466"
FT                   /note="HMMPfam hit to PF00551, Formyl transferase, score
FT                   4.7e-49"
FT                   /inference="protein motif:HMMPfam:PF00551"
FT   misc_feature    515718..516017
FT                   /gene="fmt"
FT                   /locus_tag="BCAL0466"
FT                   /note="HMMPfam hit to PF02911, Formyl transferase,
FT                   C-terminal domain, score 4e-29"
FT                   /inference="protein motif:HMMPfam:PF02911"
FT   CDS_pept        516180..516821
FT                   /transl_table=11
FT                   /locus_tag="BCAL0467"
FT                   /product="putative LysE type translocator protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0467"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50778"
FT                   /db_xref="GOA:B4E7V9"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7V9"
FT                   /protein_id="CAR50778.1"
FT                   /translation="MFGITHFGFFVFAVFLLNVTPGPDTAYIVGRSVAQGRGAGLMSAF
FT                   GISAGCCVHALACAFGLTALLAASATAFTVIKLVGAAYLIYLGVRMIIAKQAAAPSGAA
FT                   AAQVAVAKPLRQLFMQGFWTNVLNPKVVLFFVSFFPQFVSADSPHKTWAFLTLGAVFVA
FT                   MSTVWTSLVAWVAGSVTQRFSGKPGVKKWLDRTVGSAFVGLGLRLATSQR"
FT   misc_feature    join(516189..516242,516300..516368,516378..516446,
FT                   516540..516608,516636..516704)
FT                   /locus_tag="BCAL0467"
FT                   /note="5 probable transmembrane helices predicted for
FT                   BCAL0467 by TMHMM2.0 at aa 4-21, 41-63, 67-89, 121-143 and
FT                   153-175"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    516222..516815
FT                   /locus_tag="BCAL0467"
FT                   /note="HMMPfam hit to PF01810, LysE type translocator,
FT                   score 1.8e-36"
FT                   /inference="protein motif:HMMPfam:PF01810"
FT   misc_feature    516300..516332
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    516438..516524
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT                   /inference="protein motif:Prosite:PS00402"
FT   CDS_pept        516921..517778
FT                   /transl_table=11
FT                   /locus_tag="BCAL0468"
FT                   /product="metallo peptidase, subfamily M48B"
FT                   /note="subfamily M48B metallo peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0468"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50779"
FT                   /db_xref="GOA:B4E7W0"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E7W0"
FT                   /protein_id="CAR50779.1"
FT                   /translation="MFNWVKTAMLMAAITALFIVIGGMIGGSRGMTIALLFALGMNFFS
FT                   YWFSDKMVLRMYNAQEVDENTAPQFYRMVRELATRANLPMPRVYLINEDAPNAFATGRN
FT                   PEHAAVAATTGILRVLSEREMRGVMAHELAHVKHRDILISTITATMAGAISALANFAMF
FT                   FGGRDENGRPANPIAGIAVALLAPIAGALIQMAISRAREFEADRGGAQISGDPQSLATA
FT                   LDKIHRYAAGIPFQAAEAHPATAQMMIMNPLHGGGLQNLFSTHPATEERIARLMEMART
FT                   GRFD"
FT   sig_peptide     516921..517097
FT                   /locus_tag="BCAL0468"
FT                   /note="Signal peptide predicted for BCAL0468 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.991) with cleavage site
FT                   probability 0.472 between residues 59 and 60"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(516939..516998,517008..517067,517344..517412,
FT                   517440..517499)
FT                   /locus_tag="BCAL0468"
FT                   /note="4 probable transmembrane helices predicted for
FT                   BCAL0468 by TMHMM2.0 at aa 7-26, 30-49, 142-164 and
FT                   174-193"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    517128..517760
FT                   /locus_tag="BCAL0468"
FT                   /note="HMMPfam hit to PF01435, Peptidase family M48, score
FT                   1e-22"
FT                   /inference="protein motif:HMMPfam:PF01435"
FT   CDS_pept        517999..519390
FT                   /transl_table=11
FT                   /gene="rsmB"
FT                   /locus_tag="BCAL0469"
FT                   /product="ribosomal RNA small subunit methyltransferase B"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0469"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50780"
FT                   /db_xref="GOA:B4E7W1"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7W1"
FT                   /protein_id="CAR50780.1"
FT                   /translation="MTRPRSSAPTSSGRPARLAALHLAPDSLGFALDAAAQAVDAVRRG
FT                   TALPAALSTVFAQMPSGAQALARGATQDVAYRTMRRLGSADWLIGKFVSKAPPAHVHAV
FT                   LAGAFALLLDPPDEAAYPAFTVVDQAVTVIGARREFAFAKGMVNAVLRRFLRERDALVA
FT                   AMQDDPVACWNYRAWWVDAVKRAWPDAWQAILAAGERQGPLTLRVNARRANVDAYLDTL
FT                   RASGIEAVAIGRHAVRLASALPVDRIPGFADGVVSVQDAGAQLAAEWLGARDGMRVLDA
FT                   CAAPGGKTGHILELADAEVVALESDATRAARIGENLVRLSLAANVCVGDAGAPDAWYDG
FT                   RPFDRILADVPCSASGIVRRHPDIRWLRREADIPALVAEQRRILSALWPLVKPGGELLY
FT                   VTCSIFPEEGEGQARWFEAACEDAVRLDAPGQLLPGGVQGRAAAGALDQNTDHDGFFYA
FT                   RFQKR"
FT   sig_peptide     518122..518199
FT                   /gene="rsmB"
FT                   /locus_tag="BCAL0469"
FT                   /note="Signal peptide predicted for BCAL0469 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.391 between residues 26 and 27"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    518578..519381
FT                   /gene="rsmB"
FT                   /locus_tag="BCAL0469"
FT                   /note="HMMPfam hit to PF01189, NOL1/NOP2/sun family, score
FT                   3.3e-65"
FT                   /inference="protein motif:HMMPfam:PF01189"
FT   misc_feature    519025..519060
FT                   /note="PS01153 NOL1/NOP2/sun family signature."
FT                   /inference="protein motif:Prosite:PS01153"
FT   CDS_pept        519387..519977
FT                   /transl_table=11
FT                   /locus_tag="BCAL0470"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0470"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50781"
FT                   /db_xref="InterPro:IPR025500"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7W2"
FT                   /protein_id="CAR50781.1"
FT                   /translation="MTIKHLFPFRLAAVLLVALTLCLAVVRPAHAESIAVQRASLQSDG
FT                   SGWSLDARFDFELNPNLEDAVNKGIPLYFTTDFELSRARWYWFDEQPVAVTQTIRLSFQ
FT                   PLTREYRVSTGGLQLGFPSLKDALAVVRHITSWHVIDRNQVRAGETYTASVRMQLDTAL
FT                   MPKPFQVDAVNNRDWTLGSDWKRFNFTVTERAK"
FT   sig_peptide     519387..519479
FT                   /locus_tag="BCAL0470"
FT                   /note="Signal peptide predicted for BCAL0470 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.999 between residues 31 and 32"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    519405..519473
FT                   /locus_tag="BCAL0470"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAL0470 by TMHMM2.0 at aa 7-29"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        520018..522381
FT                   /transl_table=11
FT                   /locus_tag="BCAL0471"
FT                   /product="two-component regulatory system, sensor kinase
FT                   protein"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0471"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50782"
FT                   /db_xref="GOA:B4E7W3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR017232"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7W3"
FT                   /protein_id="CAR50782.1"
FT                   /translation="MIVSTVALTALLLLVLLAAASANTEFFDRYYSWLYATNIVVALVF
FT                   LLVVLGLIGMIVVRLRKGKFGTRLLAKLAVFFALVGVVPGGIIYIVSYQFVSRSIESWF
FT                   DVNVETALTAGLNLGRGMLDASLSDLQTKARLMSDQLASVDANTNGTTLTLLRLRDQFG
FT                   VQDATIVEPSRGGSGAAPDLHIVAQASGNFAALIPDDLPTPLMLSQAREHGAYAAIEGE
FT                   VDGDPRAHGAKGALRLRVVRPIPDATTSLLQPAERFLQLTQPVPPTLAHNADAVQRAYS
FT                   EYQAKSLGRTGLRKMYIGTLTLALFLATFIAMMLALALGQQLARPLFLLAQGTKEITEG
FT                   DYTPKREIKTRDELGFLTQSFNAMTRQLSEARLAVEKNRIALEHSKTYLESILANLTAG
FT                   VFVLDRQFRLTTANRGAERIFRQPFNTLIGTTLDRIGVAAGFGAMVRKAFADREAASDG
FT                   GSGDRGHWQQQFAIEVPGETDPLTLLVRGTRLVSTVEGQADDPQTSGYVVVFDDISDVI
FT                   SAQRSVAWGEVARRLAHEIKNPLTPIQLSAERLQMKLSDKLAPPDADVLKRGATMIVNQ
FT                   VAAMKRMVDDFREYARTPPAVLANLQLNELASEVLGLYGVGEGKSPIVAELAPSLPVIR
FT                   GDATQLRQVIHNLLQNAQDSVAESAHPRVLIETKTVEYGDPDAEGKTRVAVRLTVSDNG
FT                   PGFPARILTRAFEPYVTTKAKGTGLGLATVKKIVDEHGARIDLRNRMHGETVEGAQVSI
FT                   LFLQMASDTPGAEPGAQDGTTPAKTKASEQTKAA"
FT   sig_peptide     520018..520083
FT                   /locus_tag="BCAL0471"
FT                   /note="Signal peptide predicted for BCAL0471 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.483 between residues 22 and 23"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(520030..520098,520132..520191,520234..520302,
FT                   520906..520974)
FT                   /locus_tag="BCAL0471"
FT                   /note="4 probable transmembrane helices predicted for
FT                   BCAL0471 by TMHMM2.0 at aa 5-27, 39-58, 73-95 and 297-319"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    520918..521127
FT                   /locus_tag="BCAL0471"
FT                   /note="HMMPfam hit to PF00672, HAMP domain, score 5.3e-16"
FT                   /inference="protein motif:HMMPfam:PF00672"
FT   misc_feature    521194..521502
FT                   /locus_tag="BCAL0471"
FT                   /note="HMMPfam hit to PF08448, PAS fold, score 0.0012"
FT                   /inference="protein motif:HMMPfam:PF08448"
FT   misc_feature    521587..521805
FT                   /locus_tag="BCAL0471"
FT                   /note="HMMPfam hit to PF00512, His Kinase A
FT                   (phosphoacceptor) domain, score 5.3e-09"
FT                   /inference="protein motif:HMMPfam:PF00512"
FT   misc_feature    521923..522291
FT                   /locus_tag="BCAL0471"
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HSP90, score 7.9e-28"
FT                   /inference="protein motif:HMMPfam:PF02518"
FT   CDS_pept        522382..523083
FT                   /transl_table=11
FT                   /locus_tag="BCAL0472"
FT                   /product="two-component regulatory system, response
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0472"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50783"
FT                   /db_xref="GOA:B4E7W4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7W4"
FT                   /protein_id="CAR50783.1"
FT                   /translation="MATILVVDDEMGIRELLSEILSDEGHVVEAAENAQAAREYRLNQA
FT                   PDLVLLDIWMPDTDGVTLLKEWAAQGLLTMPVIMMSGHATIDTAVEATKIGALDFLEKP
FT                   IALQKLLKSVEHGLARGAAPVSANAAAKAGGGQAAGPAAVASAAALPTLGDDMASALGL
FT                   AGQTAAIPFDIPLREARDAFERAYFEYHLARENGSMRRVAEKTGLERTHLYRKLKQLGV
FT                   ELGKKPSEGAL"
FT   misc_feature    522385..522726
FT                   /locus_tag="BCAL0472"
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 2.8e-36"
FT                   /inference="protein motif:HMMPfam:PF00072"
FT   misc_feature    522919..523041
FT                   /locus_tag="BCAL0472"
FT                   /note="HMMPfam hit to PF02954, Bacterial regulatory
FT                   protein, Fis family, score 0.0028"
FT                   /inference="protein motif:HMMPfam:PF02954"
FT   misc_feature    522970..523035
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1531.000, SD 4.40 at aa 197-218, sequence
FT                   GSMRRVAEKTGLERTHLYRKLK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   tRNA            523144..523219
FT                   /gene="BCALr0472"
FT                   /note="tRNA Phe anticodon GAA, Cove score 86.97"
FT   CDS_pept        523571..524305
FT                   /transl_table=11
FT                   /locus_tag="BCAL0473"
FT                   /product="putative putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0473"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50784"
FT                   /db_xref="GOA:B4E7W5"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E7W5"
FT                   /protein_id="CAR50784.1"
FT                   /translation="MIRTDAKDGALVLFSGGQDSATCVAWALERYQTVETLGFDYGQRH
FT                   RVELECREGVREALKHRFPAWSDRLGDDHMIDLSVLGAISDTAMTRTIEIETTANGLPN
FT                   TFVPGRNLMFMTIAAAIAYRRGLRVLVGGMCETDFSGYPDCRDDTMKALQVALNLGMDT
FT                   RMVLETPLMWLDKAQTWQLAEQLGGDALVELIRVETHTCYVGERAELHDWGFGCGECPA
FT                   CKLRKRGYEAYLKGERVTEAPL"
FT   misc_feature    523595..524131
FT                   /locus_tag="BCAL0473"
FT                   /note="HMMPfam hit to PF06508, ExsB, score 1.8e-88"
FT                   /inference="protein motif:HMMPfam:PF06508"
FT   CDS_pept        524381..525013
FT                   /transl_table=11
FT                   /locus_tag="BCAL0474"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0474"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50785"
FT                   /db_xref="GOA:B4E7W6"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="InterPro:IPR030977"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7W6"
FT                   /protein_id="CAR50785.1"
FT                   /translation="MTYAVKEIFYTLQGEGANAGRPAVFCRFAGCNLWSGREEDRAEAV
FT                   CRFCDTDFVGTDGENGGKFKDAAALVATIAGLWPEGEAHRFVVCTGGEPMLQLDQPLVD
FT                   ALHAAGFEIAIETNGSLPVLESIDWICVSPKADAPLVVTKGNELKVVVPQDNQRLADYA
FT                   KLDFEYFLVQPMDGPSRDLNTKLAIDWCKRHPQWRLSMQTHKYLNIP"
FT   CDS_pept        525032..525484
FT                   /transl_table=11
FT                   /locus_tag="BCAL0475"
FT                   /product="putative 6-pyruvoyl tetrahydropterin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0475"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50786"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7W7"
FT                   /protein_id="CAR50786.1"
FT                   /translation="MLITRKLEFDAGHRIPDHRSQCRNLHGHRYVLEITLRGDLVDTEG
FT                   APDRGMVMDFADVKALAMEHLVSKWDHAFLVYARDEVVRSFLEQMADHKTVVIDRIPTV
FT                   ENLAAIAFDLLANVYDAHYGVNLRLERVRLYETPNCWADVERQPGR"
FT   misc_feature    525032..525451
FT                   /locus_tag="BCAL0475"
FT                   /note="HMMPfam hit to PF01242, 6-pyruvoyl tetrahydropterin
FT                   synthase, score 4.7e-06"
FT                   /inference="protein motif:HMMPfam:PF01242"
FT   CDS_pept        525811..526596
FT                   /transl_table=11
FT                   /locus_tag="BCAL0476"
FT                   /product="HpcH/HpaI aldolase/citrate lyase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0476"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50787"
FT                   /db_xref="GOA:B4E7W8"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="PDB:4MF4"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7W8"
FT                   /protein_id="CAR50787.1"
FT                   /translation="MSTLTNSLKQRLRDGDEPLYGLWLSLGSDSAAEALAHAGYDWLCI
FT                   DMEHAPNDSRDVASQLRAIAAAHLPSEPVVRVPAREPWLVKRALDAGARTLMFPCIETP
FT                   DDAAHAVRLTRFPSPESPDGLRGVAGMVRAAAFGMRRDYLQTANAQVAVIVQVESARGV
FT                   DEVERIAATPGVDCLFVGPADLAASLGHLGDIRHPDVETAMARVLAAGKQAGVAVGIFA
FT                   GDTAAARQYREAGYRLITVSADVSWLLRATRQALQEVRS"
FT   misc_feature    525865..526563
FT                   /locus_tag="BCAL0476"
FT                   /note="HMMPfam hit to PF03328, HpcH/HpaI aldolase/citrate
FT                   lyase family, score 1.3e-72"
FT                   /inference="protein motif:HMMPfam:PF03328"
FT   misc_feature    526420..526506
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT                   /inference="protein motif:Prosite:PS00402"
FT   CDS_pept        526593..527345
FT                   /transl_table=11
FT                   /locus_tag="BCAL0477"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0477"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50788"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7W9"
FT                   /protein_id="CAR50788.1"
FT                   /translation="MNGADGACRGRARIGAMVGLWAVWAAAVAQGAPQAKPDPSRETQS
FT                   AVADYNAGDYRAALVQFHDAAERGDRLAQFNYAMMLLTGEGVTANVDEGLRWLKRAAEA
FT                   NMSHAQYVYGRMFDDGEFVARNPAEAHRWFLRAAKQGHVQAELSLANQFLDGRGTPRDN
FT                   RQAFVWYKQAADAGEPTAQYVTASFYERGGDGVAQNLNIARAYYAAAAAQGDETAGMKF
FT                   KELSARLKAPGPASGTGAEPGKPHAPPQ"
FT   misc_feature    526803..526910
FT                   /locus_tag="BCAL0477"
FT                   /note="HMMPfam hit to PF08238, Sel1 repeat, score 1.3e-07"
FT                   /inference="protein motif:HMMPfam:PF08238"
FT   misc_feature    526911..527018
FT                   /locus_tag="BCAL0477"
FT                   /note="HMMPfam hit to PF08238, Sel1 repeat, score 2.1e-09"
FT                   /inference="protein motif:HMMPfam:PF08238"
FT   misc_feature    527019..527126
FT                   /locus_tag="BCAL0477"
FT                   /note="HMMPfam hit to PF08238, Sel1 repeat, score 8.5e-07"
FT                   /inference="protein motif:HMMPfam:PF08238"
FT   misc_feature    527127..527237
FT                   /locus_tag="BCAL0477"
FT                   /note="HMMPfam hit to PF08238, Sel1 repeat, score 2.7e-06"
FT                   /inference="protein motif:HMMPfam:PF08238"
FT   CDS_pept        complement(527424..528572)
FT                   /transl_table=11
FT                   /gene="rodA"
FT                   /gene_synonym="mrdB"
FT                   /locus_tag="BCAL0478"
FT                   /product="rod shape-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0478"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50789"
FT                   /db_xref="GOA:B4E7X0"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7X0"
FT                   /protein_id="CAR50789.1"
FT                   /translation="MQFDKRAWLDKIKQMFAGFDRPLALIVFLLLCVGIVTLYSASIDV
FT                   PGRVEDQLRNILLTFVLMWVIANIPPTTLMRFAVPLYTFGVTLLIAVALFGMTKKGAKR
FT                   WLNVGVVIQPSEILKIATPLMLAWYYQRREGGLRWYDFIAAFGILLVPVGLIAKQPDLG
FT                   TGLLVFAAGFFVIYLAGLSFKLIVPVLVAGVIAVGSIAVFEERICQPEVQWPLMHDYQK
FT                   HRVCTLLDPTSDPLGKGFHTIQAVIAIGSGGVLGKGYLKGTQAHLEFIPEKHTDFIFAV
FT                   FSEEWGLAGGLVLLTLYMALIARGLYIAAQGATLFGRLLAGSLTLAFFVYAFVNIGMVS
FT                   GVLPVVGVPLPFMSYGGTALTTLGIAIGMIMSVGRQRRLMKS"
FT   misc_feature    complement(527436..528512)
FT                   /gene="rodA"
FT                   /locus_tag="BCAL0478"
FT                   /note="HMMPfam hit to PF01098, Cell cycle protein, score
FT                   1e-123"
FT                   /inference="protein motif:HMMPfam:PF01098"
FT   misc_feature    complement(join(527451..527519,527562..527630,
FT                   527649..527717,527964..528017,528030..528089,
FT                   528102..528170,528288..528356,528444..528512))
FT                   /gene="rodA"
FT                   /locus_tag="BCAL0478"
FT                   /note="8 probable transmembrane helices predicted for
FT                   BCAL0478 by TMHMM2.0 at aa 21-43, 73-95, 135-157, 162-181,
FT                   186-203, 286-308, 315-337 and 352-374"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(527496..527570)
FT                   /note="PS00428 Cell cycle proteins ftsW / rodA / spoVE
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00428"
FT   CDS_pept        complement(528584..530716)
FT                   /transl_table=11
FT                   /gene="mrdA"
FT                   /gene_synonym="pbpA"
FT                   /locus_tag="BCAL0479"
FT                   /product="penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0479"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50790"
FT                   /db_xref="GOA:B4E7X1"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7X1"
FT                   /protein_id="CAR50790.1"
FT                   /translation="MTEFNDTQQQLSKFRLRVAAAGVFVFVCFGLLASRFFYLQLMQHG
FT                   KYALQAEENRISVAPIVPNRGIITDRNGVVLAKNYSAYTLEITPSKLDDTLDNTIDKLS
FT                   EIIPIDARDRRRFKKLQEDSKNFESLPIRTRLTDAEVARFTAQRFRFPGVDVRARLFRQ
FT                   YPLGMTAAHVIGYIGRISKRDQDRIDAMSDDNDSDQEHYDPRRDANNYKGTDYIGKIGV
FT                   EQSYETELHGLTGFEEVEVTAGGRPVRTLSRTQATPGNNLVLSLDIGLQQVAEQAFAGK
FT                   RGALVAIEPKTGDVLAFVSSPSFDPNSFVDGIDQQTWDELNNSPDKPLLNRPLHGTYPP
FT                   GSTYKPFMALAGLTLGKRTPGWGFQDPGYFTFGGHTFRNDVRSGQGWVDMNKAIMVSND
FT                   TYFYMLARDLGVNAIANFMKPFGFGQITGIDIQGEARGILPSTDWKKKAFKKAAQQKWF
FT                   DGETISLGIGQGYNSFTILQLAHATATLANNGVVMKPHLVKEVEDPISRARHLTVPKES
FT                   EVIPLKQADIDVVKRGMENVIENPSGTAYKVFRGAPYLAAGKTGTAQVFSLQGSNYKGH
FT                   LLAEHLRDHALFIAYAPVDHPQIAVALVVENGGWGAQAAGPIARRVLDYYLVERQNPKN
FT                   EAAAVAAAASATEPVSAPVVGDTSKPATIAAGFTALPQPVVPSAASDAQPVVATPRDDN
FT                   HRATAPAKAADAGTAH"
FT   misc_feature    complement(528845..529870)
FT                   /gene="mrdA"
FT                   /locus_tag="BCAL0479"
FT                   /note="HMMPfam hit to PF00905, Penicillin binding protein
FT                   transpeptid, score 5.6e-83"
FT                   /inference="protein motif:HMMPfam:PF00905"
FT   misc_feature    complement(529961..530539)
FT                   /gene="mrdA"
FT                   /locus_tag="BCAL0479"
FT                   /note="HMMPfam hit to PF03717, Penicillin-binding Protein
FT                   dimerisatio, score 8.8e-47"
FT                   /inference="protein motif:HMMPfam:PF03717"
FT   misc_feature    complement(530600..530659)
FT                   /gene="mrdA"
FT                   /locus_tag="BCAL0479"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAL0479 by TMHMM2.0 at aa 20-39"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(530818..531330)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0480"
FT                   /product="putative rod shape-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0480"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50791"
FT                   /db_xref="GOA:B4E7X2"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7X2"
FT                   /protein_id="CAR50791.1"
FT                   /translation="MNRPQYILQPVNPYFIVFSLAAAFLLNLMPWGRLPGVPDFVALVL
FT                   LFWNIHQPRKVGMGVAFALGILMDVHDAGLLGEHALAYTLLSYGAITIHRRVLWMPIGV
FT                   QVLYVTPLLVVAQLVPFVIRLLMGAAFPGWRYLVDGFVEAALWPIASHLLLMPQRRPVD
FT                   PDDTRPI"
FT   misc_feature    complement(530866..531309)
FT                   /locus_tag="BCAL0480"
FT                   /note="HMMPfam hit to PF04093, rod shape-determining
FT                   protein MreD, score 6e-11"
FT                   /inference="protein motif:HMMPfam:PF04093"
FT   misc_feature    complement(join(530947..531015,531034..531093,
FT                   531235..531294))
FT                   /locus_tag="BCAL0480"
FT                   /note="3 probable transmembrane helices predicted for
FT                   BCAL0480 by TMHMM2.0 at aa 13-32, 80-99 and 106-128"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(531327..532391)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0481"
FT                   /product="putative rod shape-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0481"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50792"
FT                   /db_xref="GOA:B4E7X3"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7X3"
FT                   /protein_id="CAR50792.1"
FT                   /translation="MEYSPPPLFKQGPPALARLIFFVALAIALLVSDARFSTLEIARGV
FT                   LGTVLYPLQRAALVPRDLFMGAADLAVTGATLRHENDDLRKRNLQLSTQANQAAVLTQE
FT                   NAHLRAVLELRQHIATQSTPVEIQYDTSDPFTQKIVVGQGSQQGIQDGSPVVSEDGVIG
FT                   QVTRVFPLQSEITLVTDRDLAIPVQVLRTGLRSVIYGTPKGDSLDLRFVPTSADLVAGD
FT                   ELVTSGLDGVYPPGLPVAKVVRVDKLADTAFARVTCAPVAAVRGARQMLVLHYRNDIPP
FT                   RPAEPDPAAEKNAKGKKGKAAAKAEKADKADANAKPAAAAPPAGANPAPAPAAPAKPAV
FT                   APAKPAAGQSGAQR"
FT   misc_feature    complement(531561..532025)
FT                   /locus_tag="BCAL0481"
FT                   /note="HMMPfam hit to PF04085, rod shape-determining
FT                   protein MreC, score 2.7e-33"
FT                   /inference="protein motif:HMMPfam:PF04085"
FT   misc_feature    complement(532296..532349)
FT                   /locus_tag="BCAL0481"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAL0481 by TMHMM2.0 at aa 15-32"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(532530..533573)
FT                   /transl_table=11
FT                   /gene="mreB"
FT                   /gene_synonym="envB"
FT                   /gene_synonym="rodY"
FT                   /locus_tag="BCAL0482"
FT                   /product="putative rod shape-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0482"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50793"
FT                   /db_xref="GOA:B4E7X4"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7X4"
FT                   /protein_id="CAR50793.1"
FT                   /translation="MFGFLRSYFSNDLAIDLGTANTLIYMRGKGIVLDEPSVVSIRQEG
FT                   GPNGKKTIQAVGKEAKQMLGKVPGNIEAIRPMKDGVIADFTVTEQMIKQFIKTAHESRM
FT                   FSPSPRIIICVPCGSTQVERRAIKEAAHGAGASQVYLIEEPMAAAIGAGLPVSEATGSM
FT                   VVDIGGGTTEVGVISLGGIVYKGSVRVGGDKFDEAIVNYIRRNYGMLIGEQTAEAIKKE
FT                   IGSAFPGSEVKEMEVKGRNLSEGIPRSFTISSNEILEALTDPLNQIVSSVKIALEQTPP
FT                   ELGADIAERGMMLTGGGALLRDLDRLLAEETGLPVLVAEDPLTCVVRGSGMALERMDKL
FT                   GSIFSYE"
FT   misc_feature    complement(532548..533546)
FT                   /gene="mreB"
FT                   /locus_tag="BCAL0482"
FT                   /note="HMMPfam hit to PF06723, MreB/Mbl protein, score
FT                   6.7e-231"
FT                   /inference="protein motif:HMMPfam:PF06723"
FT   CDS_pept        533941..534240
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="BCAL0483"
FT                   /product="glutamyl-tRNA amidotransferase subunit C"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0483"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50794"
FT                   /db_xref="GOA:B4E7X5"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E7X5"
FT                   /protein_id="CAR50794.1"
FT                   /translation="MALTLTDVKRIAHLARLEMADADAEHMLGQLNEFFGLVEQMQAVD
FT                   TAGIAPLAHPIEQIQEVAQRLRDDAVTEVVDRDDNQRPAPAVQDGLYLVPKVIE"
FT   CDS_pept        534310..535800
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="BCAL0484"
FT                   /product="glutamyl-tRNA amidotransferase subunit A"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0484"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50795"
FT                   /db_xref="GOA:B4E7X6"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E7X6"
FT                   /protein_id="CAR50795.1"
FT                   /translation="MHAKSLTELRAALAAKECSAVELAQHYLKRIDAARDLNAFVHVDA
FT                   DLTLAQAKAADAELARGAGGALTGLPIAHKDVFVTRGWRSTAGSKMLANYESPFDATVV
FT                   ARLQAAGMVTLGKTNMDEFAMGSSNENSAFGAVKNPWDTNAVPGGSSGGSSAAVAARLA
FT                   PAATGTDTGGSIRQPASFAGVTGIKPTYGRVSRYGMIAFASSLDQGGPMAQSASDCALL
FT                   LNAMAGFDERDSTSLERDDEDFTRHLGQPWAAGNDAGKPLAGLRIGLPNEYFGAGLADD
FT                   VRATIDAALKQYEALGATLVPVSLPKTELSIPVYYVIAPAEASSNLSRFDGVRFGHRAA
FT                   QYGDLLDMYKKSRAEGFGPEVKRRILVGTYVLSHGYYDAYYLQAQKIRRIIANDFQEAF
FT                   KSCDVIMGPASPTVAWDLGAKGDDPVQMYLADIYTLSVSLAGLPGMSVPCGFGAGANAQ
FT                   RPVGLQIIGNYFNEARMLQVADAFQRATDWHKQVPAGV"
FT   misc_feature    534373..535737
FT                   /gene="gatA"
FT                   /locus_tag="BCAL0484"
FT                   /note="HMMPfam hit to PF01425, Amidase, score 1.4e-184"
FT                   /inference="protein motif:HMMPfam:PF01425"
FT   misc_feature    534640..534663
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    534751..534846
FT                   /note="PS00571 Amidases signature."
FT                   /inference="protein motif:Prosite:PS00571"
FT   CDS_pept        535805..537280
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="BCAL0485"
FT                   /product="glutamyl-tRNA amidotransferase subunit B"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0485"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50796"
FT                   /db_xref="GOA:B4E7X7"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E7X7"
FT                   /protein_id="CAR50796.1"
FT                   /translation="MATQWEVVIGLETHAQLSTVSKIFSGASTQFGAEPNTQACPVDLA
FT                   LPGVLPVLNRGAVERAIRFGLAIGSTIAPRSIFARKNYFYPDLPKGYQISQYEIPVVQG
FT                   GQITIQVPANEKAGKAAYEKTVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEI
FT                   VTEPEMRSAAEAVAYAKALHGLVVWLGICDGNMQEGSFRCDANVSVRPVGQEKFGTRAE
FT                   IKNLNSFRFLEEAINYEVRRQIELIEDGGEVVQETRLYDPDKRETRSMRSKEDAHDYRY
FT                   FPDPDLMPLVIGQDWIERVQSGMPELPAAMQQRFVDEYGVSAYDAGVLTSSKAMAAYFE
FT                   AVVAKAGAANAKIAANWLMGDVSSQLNRDGIEIDAIPVSAAQLALLLQRIADGTISNKI
FT                   AKEIFATIWDEKATDEGAADRIIDAKGLKQISDTGALEAIIDEVLAANAKSVEEFRAGK
FT                   EKAFNALIGQAMKATKGKANPQQVNELLKKKLG"
FT   misc_feature    535811..536554
FT                   /gene="gatB"
FT                   /locus_tag="BCAL0485"
FT                   /note="HMMPfam hit to PF02934, PET112 family, N terminal
FT                   region, score 1e-146"
FT                   /inference="protein motif:HMMPfam:PF02934"
FT   misc_feature    536258..536305
FT                   /note="PS01234 PET112 family signature."
FT                   /inference="protein motif:Prosite:PS01234"
FT   misc_feature    536603..536809
FT                   /gene="gatB"
FT                   /locus_tag="BCAL0485"
FT                   /note="HMMPfam hit to PF01162, PET112 family, C terminal
FT                   region, score 5.2e-33"
FT                   /inference="protein motif:HMMPfam:PF01162"
FT   misc_feature    536813..537274
FT                   /gene="gatB"
FT                   /locus_tag="BCAL0485"
FT                   /note="HMMPfam hit to PF02637, GatB/Yqey domain, score
FT                   6.3e-64"
FT                   /inference="protein motif:HMMPfam:PF02637"
FT   CDS_pept        537399..538238
FT                   /transl_table=11
FT                   /locus_tag="BCAL0486"
FT                   /product="putative polyphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0486"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50797"
FT                   /db_xref="GOA:B4E7X8"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022300"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7X8"
FT                   /protein_id="CAR50797.1"
FT                   /translation="MAKQPSLDDFRVPYSTREKEAAAFKLDAFDPAAKPFSSGSKEADR
FT                   ERLSVVSTELDVQQERLHTQQKKRVLLVLQGMDTSGKDGTVRAVFREVDPLGLRIVPFK
FT                   APTPIEAAHDFLWRVHAQVPAAGELAIFNRSHYEDVLVPRVLGAIGDKECERRYRQIRD
FT                   FETMLFENGTTIIKCFLHISKDEQRARLQARIDDPTKHWKFDIADLDARKHWDAYQSAY
FT                   RDALAATSAEHAPWYVIPANSKTHRNVMIAELLLRTMTDMKLEFPPPKPELEGVKIR"
FT   misc_feature    537510..538199
FT                   /locus_tag="BCAL0486"
FT                   /note="HMMPfam hit to PF03976, Polyphosphate kinase, score
FT                   2.8e-78"
FT                   /inference="protein motif:HMMPfam:PF03976"
FT   CDS_pept        538279..539052
FT                   /transl_table=11
FT                   /locus_tag="BCAL0487"
FT                   /product="endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /EC_number="4.2.99.18"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0487"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50798"
FT                   /db_xref="GOA:B4E7X9"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7X9"
FT                   /protein_id="CAR50798.1"
FT                   /translation="MMRVITANLNGIRSAAKKGFFDWLGEQNADCVCVQEIKVSADDLP
FT                   AEFVEPHGFKSYFHHAEKKGYSGAGVYSRREPDDVIIGFGSSEFDPEGRYVEARYGKLS
FT                   VVSVYVPSGSSGEERQQAKYRFMAEFMPHLAALKKKREVILCGDVNIVHKEIDIKNWKS
FT                   NQKNSGCLPEEREWLTKLFDDVGYVDVFRTLDPRPEQYTWWSNRGQAYAKNVGWRIDYQ
FT                   IATPGVAGTAKSASIFKDIKFSDHAPLTVDYDYQK"
FT   misc_feature    538282..539037
FT                   /locus_tag="BCAL0487"
FT                   /note="HMMPfam hit to PF03372,
FT                   Endonuclease/Exonuclease/phosphatase fa, score 2.4e-51"
FT                   /inference="protein motif:HMMPfam:PF03372"
FT   CDS_pept        complement(539160..540212)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0488"
FT                   /product="putative alcohol dehydrogenase"
FT                   /EC_number="1.1.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0488"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50799"
FT                   /db_xref="GOA:B4E7Y0"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7Y0"
FT                   /protein_id="CAR50799.1"
FT                   /translation="MSTTYAYAATDAQSPLAPFEFQRRALRDLDVQIDVLYCGVCHSDL
FT                   HQARNEWRNTIYPVVPGHEIVGRVTATGPQVSRFKVGELVGVGCLVDSCRTCASCEEGL
FT                   EQYCENGFVGTYNGQDRVTGDITYGGYSTQLVVDEAFVLRVPDTLDPAGAAPLLCAGIT
FT                   TYSPLRQWNVGPGKKVGIVGLGGLGHMGVKLARAMGAHVVLFTTSPSKIEDGKRLGAHE
FT                   VVISKDEAQMNAHLNSFDFILNTVAAQHDLNPFLHLLKRDGTMTLVGAPEHDHPSPQVF
FT                   NLIFKRRRLAGSLIGGIAETQEMLDFCAEHGITSDIETIPMQQINTAYERMLKSDVKYR
FT                   FVIDMASLKQ"
FT   misc_feature    complement(539283..539690)
FT                   /locus_tag="BCAL0488"
FT                   /note="HMMPfam hit to PF00107, Zinc-binding dehydrogenase,
FT                   score 2.6e-35"
FT                   /inference="protein motif:HMMPfam:PF00107"
FT   misc_feature    complement(539592..539678)
FT                   /note="PS00065 D-isomer specific 2-hydroxyacid
FT                   dehydrogenases NAD-binding signature."
FT                   /inference="protein motif:Prosite:PS00065"
FT   misc_feature    complement(539778..540131)
FT                   /locus_tag="BCAL0488"
FT                   /note="HMMPfam hit to PF08240, Alcohol dehydrogenase
FT                   GroES-like domain, score 6.8e-35"
FT                   /inference="protein motif:HMMPfam:PF08240"
FT   misc_feature    complement(539985..540029)
FT                   /note="PS00059 Zinc-containing alcohol dehydrogenases
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00059"
FT   misc_feature    complement(540084..540101)
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00190"
FT   CDS_pept        540439..541383
FT                   /transl_table=11
FT                   /locus_tag="BCAL0489"
FT                   /product="AraC family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0489"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50800"
FT                   /db_xref="GOA:B4E7Y1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7Y1"
FT                   /protein_id="CAR50800.1"
FT                   /translation="MSFQPLLADAGERLQRRMIELHTRLAPNEGDTLAALDGVRFIRVT
FT                   HPAPRMPVLYEPSIIVVCQGRKLGYLGDRSFVYDAQQYLVLSVPLPFECETFASMDEPF
FT                   LAISIRVDLAVIAELAILLDETLGAAVSEPLGVYSTPLDAPLADAVVRLLEALASPHDT
FT                   RVLGPAIMREIAYRVLTGEQGDAMRAALVQQHHFGRIAKALRRIHAELKADLDVETLAR
FT                   EAGMSLAVFHAQFKHVTATSPMQYVKTARLHQARLMMVRDGLGAGAAAARVGYASASQF
FT                   SREFKRLFGRSPGDEVRWMRDSGVRPAMADVDA"
FT   misc_feature    540538..540999
FT                   /locus_tag="BCAL0489"
FT                   /note="HMMPfam hit to PF06719, AraC-type transcriptional
FT                   regulator N-termin, score 2.7e-68"
FT                   /inference="protein motif:HMMPfam:PF06719"
FT   misc_feature    541033..541167
FT                   /note="PS00041 Bacterial regulatory proteins, araC family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00041"
FT   misc_feature    541042..541182
FT                   /locus_tag="BCAL0489"
FT                   /note="HMMPfam hit to PF00165, Bacterial regulatory
FT                   helix-turn-helix protei, score 3.1e-06"
FT                   /inference="protein motif:HMMPfam:PF00165"
FT   misc_feature    541198..541332
FT                   /locus_tag="BCAL0489"
FT                   /note="HMMPfam hit to PF00165, Bacterial regulatory
FT                   helix-turn-helix protei, score 0.0012"
FT                   /inference="protein motif:HMMPfam:PF00165"
FT   CDS_pept        complement(541406..542446)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0490"
FT                   /product="peptidase, family M48"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0490"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50801"
FT                   /db_xref="GOA:B4E7Y2"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7Y2"
FT                   /protein_id="CAR50801.1"
FT                   /translation="MRSNRLHRLARVAAALSIGAAALAAMDACASDTGATAAGSAPATP
FT                   PAPATAAAPAAPSIAEGAQPTGAAVPAKAYTPTPQQVRYGNAIAFRTLIPSPLLEQLTA
FT                   NEYAQIVQAAADSNRLLSANQPRVKRLRAIVAKLAPYSVKWNDRVKSWAWDVNAIRSRD
FT                   IRLTCLPGGKVLVYGGMLDRVRLNDDELGVLLAHGIAHALREHARSNFSVTSQTSLRAA
FT                   ALPPLFGVGDPLPQALNLGERLQSLHYDPTDETEADVIGGDIAARAGFDPRAAITLWDK
FT                   LAVATRANKASGFIYTHPYSSARRQDLLNRLPDLMPLYAKATGKRVESLPDYAGISAQR
FT                   RKIVRR"
FT   misc_feature    complement(541508..542032)
FT                   /locus_tag="BCAL0490"
FT                   /note="HMMPfam hit to PF01435, Peptidase family M48, score
FT                   2.5e-14"
FT                   /inference="protein motif:HMMPfam:PF01435"
FT   CDS_pept        complement(542436..543857)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0491"
FT                   /product="Major Facilitator Superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0491"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50802"
FT                   /db_xref="GOA:B4E7Y3"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7Y3"
FT                   /protein_id="CAR50802.1"
FT                   /translation="MSKTPHEAPALTAHEDHPGWRAYLNTHMLICVFLGFTSGLPLFTL
FT                   VYLVQAWLRSEGVNLKEIGLFALIQFPYTWKFLWAPLMDRYIPRLPGWRPGRRRGWLLL
FT                   TQLLVAGAIAALGFVSPRDSIWTVAALTTLVAFFGASADIVIDAYRRELLRDTEQGLGN
FT                   AVHVNAYKLAALIPGSLALILSDHMPWDAVFAITGAFMLPGILMTLVVREPEVVGAPPR
FT                   NLRDAIVLPFREFIQRDGWAGALLVIAFIFLYKIGDTMATTLSTSFFLDIGFTRTEIGI
FT                   VAKTTALVASVLGGIIGGIWLVKIGIGRGLWIFGALQLVSTLGFAWLAQLGPGSPVLAM
FT                   LYDFTVSTSHAIASALSVFGIAVTPQFSPMTVALAIVYGFETFTTGLTMAAFVAYIAST
FT                   TDPRYTATQFALFTSLASVPRTLASAASGFIVAKIGWFDYFIVCTALAIPGMLLLFRIA
FT                   PWNGTARDGEASRAQ"
FT   misc_feature    complement(join(542490..542558,542670..542738,
FT                   542775..542843,542871..542930,542949..543017,
FT                   543075..543134,543225..543293,543306..543359,
FT                   543420..543488,543501..543560,543618..543671,
FT                   543699..543767))
FT                   /locus_tag="BCAL0491"
FT                   /note="12 probable transmembrane helices predicted for
FT                   BCAL0491 by TMHMM2.0 at aa 31-53, 63-80, 100-119, 124-146,
FT                   167-184, 189-211, 242-261, 281-303, 310-329, 339-361,
FT                   374-396 and 434-456"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(542562..543767)
FT                   /locus_tag="BCAL0491"
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 4e-10"
FT                   /inference="protein motif:HMMPfam:PF07690"
FT   CDS_pept        complement(543974..544582)
FT                   /transl_table=11
FT                   /gene="metW"
FT                   /locus_tag="BCAL0492"
FT                   /product="methionine biosynthesis protein MetW"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0492"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50803"
FT                   /db_xref="InterPro:IPR010743"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7Y4"
FT                   /protein_id="CAR50803.1"
FT                   /translation="MNQQALNSLSARADFRAIARWVEPRATVLDLGCGDGSLLSLLMEE
FT                   LDVTGYGIELNDAGVLASTKNGINVIQQNLEDGLRLFEDHSFDIAILSQTLQTIHQTAA
FT                   ILRETARVGRECIVSFPNFGYWAHRLSVLRGRMPVSKSLPYQWHNTPNVRVLTIKDFEA
FT                   LAPEVGVTILDRIVLHEGQPIRWGANWRGSLAVYRVKRS"
FT   misc_feature    complement(543986..544549)
FT                   /gene="metW"
FT                   /locus_tag="BCAL0492"
FT                   /note="HMMPfam hit to PF07021, Methionine biosynthesis
FT                   protein MetW, score 2e-118"
FT                   /inference="protein motif:HMMPfam:PF07021"
FT   misc_feature    complement(544229..544498)
FT                   /gene="metW"
FT                   /locus_tag="BCAL0492"
FT                   /note="HMMPfam hit to PF08241, Methyltransferase domain,
FT                   score 5.3e-07"
FT                   /inference="protein motif:HMMPfam:PF08241"
FT   misc_feature    complement(544247..544498)
FT                   /gene="metW"
FT                   /locus_tag="BCAL0492"
FT                   /note="HMMPfam hit to PF08242, Methyltransferase domain,
FT                   score 7.4e-06"
FT                   /inference="protein motif:HMMPfam:PF08242"
FT   CDS_pept        complement(544579..545724)
FT                   /transl_table=11
FT                   /gene="metX"
FT                   /locus_tag="BCAL0493"
FT                   /product="putative homoserine O-acetyltransferase"
FT                   /EC_number="2.3.1.31"
FT                   /note="family S33 serine peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0493"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50804"
FT                   /db_xref="GOA:B4E7Y5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E7Y5"
FT                   /protein_id="CAR50804.1"
FT                   /translation="MESIGIVAPQTMHFAEPLRLQSGSVIGNYQLVVETYGELNAARSN
FT                   AVLVCHALNASHHVAGVYADDPRSTGWWDNMVGPGKPLDTNRFFVIGVNNLGSCFGSTG
FT                   PMSIDPSTGKPYGAKFPVVTVEDWVHAQARVADAFGIERFAAVMGGSLGGMQALAWSLM
FT                   YPERVAHCIDIASTPKLSAQNIAFNEVARSAILSDPDFHGGDYYAHGVKPKRGLRVARM
FT                   IGHITYLSDDDMAEKFGRALRRADGALDAYNFSFDVEFEVESYLRYQGDKFADYFDANT
FT                   YLLITRALDYFDPAKAFDGNLTAALAHTQAKYLIASFSTDWRFAPARSREIVKALLDNK
FT                   RTVSYAEIDAPHGHDAFLLDDARYHNLIRAYYERIANEVGA"
FT   misc_feature    complement(544615..545463)
FT                   /gene="metX"
FT                   /locus_tag="BCAL0493"
FT                   /note="HMMPfam hit to PF00561, alpha/beta hydrolase fold,
FT                   score 1.4e-13"
FT                   /inference="protein motif:HMMPfam:PF00561"
FT   misc_feature    complement(545284..545313)
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00339"
FT   CDS_pept        complement(545991..546656)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0494"
FT                   /product="TetR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0494"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50805"
FT                   /db_xref="GOA:B4E7Y6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7Y6"
FT                   /protein_id="CAR50805.1"
FT                   /translation="MQPTYPQDQAVTEGQATPSRPRPKPGERRVMILQTLAAMLEAPKP
FT                   EKITTAALAARLDVSEAALYRHFTSKAKMYEGLIEFIEQALFGLVNQIVAKEPNGVLQA
FT                   RTIALTMLNFAAKNPGMTRVLTGEALVGEDERLTERVNQLLDRIEATVKQCLRVARTEA
FT                   NAPQDGATPFVLPADYDPGARASLLVSYVIGRWHRFAKGGFQKPPGEQADAHLRLILQ"
FT   misc_feature    complement(546423..546563)
FT                   /locus_tag="BCAL0494"
FT                   /note="HMMPfam hit to PF00440, Bacterial regulatory
FT                   proteins, tetR family, score 2.4e-06"
FT                   /inference="protein motif:HMMPfam:PF00440"
FT   misc_feature    complement(546450..546515)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1850.000, SD 5.49 at aa 48-69, sequence
FT                   ITTAALAARLDVSEAALYRHFT"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        complement(546623..547414)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0495"
FT                   /product="haloacid dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0495"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50806"
FT                   /db_xref="GOA:B4E7Y7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010237"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7Y7"
FT                   /protein_id="CAR50806.1"
FT                   /translation="MSARRPPARPDLPAPLRRRRISRSRPRAGAPVWLFDLDNTLHHAS
FT                   HAIFPEINRAMTQYIIDALQVGRAEADRLRTGYTERYGAALLGLTRHHPIDPHDFLRVV
FT                   HTFSDLPAMVRAERGLARIVAALPGRKLILTNAPENYARAVLRELGIERLFERVIAIEH
FT                   MRDRRTWRAKPDHTMLRRTLRAAHARLADAILVEDTRGHLKRYKRLGIGTIWITGHLPG
FT                   HLPATGRPHYVDQRIRSLKSLRLGTRSGRQKCSRLTRRTKP"
FT   misc_feature    complement(546758..547327)
FT                   /locus_tag="BCAL0495"
FT                   /note="HMMPfam hit to PF00702, haloacid dehalogenase-like
FT                   hydrolase, score 1.3e-08"
FT                   /inference="protein motif:HMMPfam:PF00702"
FT   CDS_pept        complement(547411..548310)
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="BCAL0496"
FT                   /product="putative acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0496"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50807"
FT                   /db_xref="GOA:B4E7Y8"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E7Y8"
FT                   /protein_id="CAR50807.1"
FT                   /translation="MSEPIDLSQIAPTLKAEILAEALPYIRRYHGKSVVIKYGGNAMTE
FT                   ERLKQGFARDVILLKLVGINPVIVHGGGPQIDHALKKIGKAGTFIQGMRVTDEETMEVV
FT                   EWVLGGEVQQDIVMLINHFGGHAVGLTGKDGGLIHARKLLMPDRDNPGQYIDIGQVGEV
FT                   EAINPAVVKALQDDAFIPVISPIGFGEDGLSYNINADLVAGKLATVLNAEKLLMMTNIP
FT                   GVMDKDGNLLTDLSAREIDALFEDGTISGGMLPKISSALDAAKSGVKSVHIVDGRIEHS
FT                   VLLEILTEQPFGTMIRSH"
FT   misc_feature    complement(547486..548217)
FT                   /gene="argB"
FT                   /locus_tag="BCAL0496"
FT                   /note="HMMPfam hit to PF00696, Amino acid kinase family,
FT                   score 9.1e-50"
FT                   /inference="protein motif:HMMPfam:PF00696"
FT   misc_feature    complement(547909..547941)
FT                   /note="PS00639 Eukaryotic thiol (cysteine) proteases
FT                   histidine active site."
FT                   /inference="protein motif:Prosite:PS00639"
FT   CDS_pept        548921..550351
FT                   /transl_table=11
FT                   /locus_tag="BCAL0497"
FT                   /product="two-component regulatory system, sensor kinase
FT                   protein"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0497"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50808"
FT                   /db_xref="GOA:B4E7Y9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7Y9"
FT                   /protein_id="CAR50808.1"
FT                   /translation="MQRITTTGRVNLSHLFWLRNLAIIGQLVTIGVVQTYFGVHLPLPA
FT                   MLMVIALEIVFNALTWVRVLRARPETNFELLGQLWVDLGALSALLFLSGGTTNPFVSLY
FT                   LPSLAIAAAVLPWHLMIWLAAFAVACYAALGFDSVPLNMDNPANLFDYYRTGMWANFMV
FT                   SVGLIAWFVARMSNALRQRDAALGEAQAHLLRDERAVALGVQAATVAHEMGTPLSTIAM
FT                   LAEELRDAARADPGLARYEADLKVLEEQMTLCTSALARLRSRASAPASRQPVDDWLDTF
FT                   VEHWRLRHPHVQFELLGARPAGVALDDTVAAGQILTILLDNAARASPQRVTLAAKVAHD
FT                   RAADEIEFEVCDDGPGIPAALRESLGAMPVDSTQGGHGVGLYLAFSAAARLGGEIELSD
FT                   VTPRAAGGNGRAGGAANGHAAAASGQRAGSRTGAPAAERPAGTPDSRPAGAAAGRGTRA
FT                   VLRLPVVRVAMPAASTNT"
FT   misc_feature    join(548966..549034,549047..549115,549134..549202,
FT                   549260..549328,549386..549439)
FT                   /locus_tag="BCAL0497"
FT                   /note="5 probable transmembrane helices predicted for
FT                   BCAL0497 by TMHMM2.0 at aa 16-38, 43-65, 72-94, 114-136 and
FT                   156-173"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    549278..549310
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    549521..549730
FT                   /locus_tag="BCAL0497"
FT                   /note="HMMPfam hit to PF00512, His Kinase A
FT                   (phosphoacceptor) domain, score 6.2e-05"
FT                   /inference="protein motif:HMMPfam:PF00512"
FT   misc_feature    549839..550315
FT                   /locus_tag="BCAL0497"
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HSP90, score 4.6e-21"
FT                   /inference="protein motif:HMMPfam:PF02518"
FT   CDS_pept        550365..550907
FT                   /transl_table=11
FT                   /locus_tag="BCAL0499"
FT                   /product="two-component regulatory system, response
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0499"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50809"
FT                   /db_xref="GOA:B4E7Z0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7Z0"
FT                   /protein_id="CAR50809.1"
FT                   /translation="MSENNFLVIDDNEVFAGTLARGLERRGYAVQQAHDKEAALRLAAG
FT                   GKFQFITVDLHLGEDSGLSLIAPLCDLQPDARILVLTGYASIATAVQAVKEGADNYLAK
FT                   PANVESILAALQTNATEVQAEEALENPVVLSVDRLEWEHIQRVLAENNNNISATARALN
FT                   MHRRTLQRKLAKKPVRQ"
FT   misc_feature    550374..550712
FT                   /locus_tag="BCAL0499"
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 1.2e-21"
FT                   /inference="protein motif:HMMPfam:PF00072"
FT   misc_feature    550770..550892
FT                   /locus_tag="BCAL0499"
FT                   /note="HMMPfam hit to PF02954, Bacterial regulatory
FT                   protein, Fis family, score 1.5e-09"
FT                   /inference="protein motif:HMMPfam:PF02954"
FT   misc_feature    550821..550886
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1579.000, SD 4.56 at aa 153-174, sequence
FT                   NNISATARALNMHRRTLQRKLA"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        complement(550975..552318)
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /gene_synonym="htpI"
FT                   /locus_tag="BCAL0500"
FT                   /product="ATP-dependent protease ATP-binding subunit HslU"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0500"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50810"
FT                   /db_xref="GOA:B4E7Z1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E7Z1"
FT                   /protein_id="CAR50810.1"
FT                   /translation="MSTMTPAEIVSELDKHIIGQAKAKKAVAVALRNRWRRQQVADPLR
FT                   QEITPKNILMIGPTGVGKTEIARRLAKLADAPFIKIEATKFTEVGYVGRDVDSIVRDLI
FT                   EISVKQTREAEMRKVRSKATDQAEDRILDILLPQPRAVGFGGNAEHANDDNNATRQTFR
FT                   KRLREGQLDDKEVELDLEQPSVGMDIMAPPGMEEMTEQIRSMFSNLGSGKKQRRKVKIK
FT                   EALKLLTDEEAAKMLNEEEVKTKAVQNVEQNGIVFLDEIDKITSRNNEGSGGEVSRQGV
FT                   QRDLLPLVEGTTVNTKYGMVKTDHILFIASGAFHLAKPSDLIPELQGRFPIRVELDSLS
FT                   VNDFEAILVATDASLVKQYQALLATEDVQLEFADDGIRRLAEIAFAVNEKTENIGARRL
FT                   YTVIEKLLEEVSFSAGNHAGERVTIDAKYVDRALGEVSQDEDLSRYVL"
FT   misc_feature    complement(551320..551802)
FT                   /gene="hslU"
FT                   /locus_tag="BCAL0500"
FT                   /note="HMMPfam hit to PF07724, ATPase family associated
FT                   with various cellul, score 1.3e-51"
FT                   /inference="protein motif:HMMPfam:PF07724"
FT   misc_feature    complement(552127..552150)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(552328..552864)
FT                   /transl_table=11
FT                   /gene="hslV"
FT                   /gene_synonym="htpO"
FT                   /locus_tag="BCAL0501"
FT                   /product="ATP-dependent protease HslV"
FT                   /EC_number="3.4.25.-"
FT                   /note="subfamily T1B threonine peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0501"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50811"
FT                   /db_xref="GOA:B4E7Z2"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4E7Z2"
FT                   /protein_id="CAR50811.1"
FT                   /translation="MEQFHGTTIVSVRRGDKVALGGDGQVTLGNIVMKGGARKVRRIYN
FT                   NQVLVGFAGGTADAFSLLDRFEAKLEKHQGNLTRAAVELAKDWRTDRMLRRLEAMLITA
FT                   DATTTLVITGNGDVLDPEGGICAIGSGGAYAQAAARALVENTDLSPREIVEKSLGIAGD
FT                   MCIYTNHNRIIETIE"
FT   misc_feature    complement(552334..552858)
FT                   /gene="hslV"
FT                   /locus_tag="BCAL0501"
FT                   /note="HMMPfam hit to PF00227, Proteasome A-type and
FT                   B-type, score 5.7e-32"
FT                   /inference="protein motif:HMMPfam:PF00227"
FT   CDS_pept        complement(553101..553517)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0502"
FT                   /product="DksA/TraR C4-type zinc finger family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0502"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50812"
FT                   /db_xref="GOA:B4E7Z3"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7Z3"
FT                   /protein_id="CAR50812.1"
FT                   /translation="MTKKLLTEAEILKMSDKDYMNEDQLAFFKNRLEQLQADILKNAGQ
FT                   TTENLRETVIVPDPADRATIEEEHALELRTRDRERKLLKKVQQSLARIDSGDYGWCEET
FT                   GEPIGIPRLLARPTATLSLEAQERRELRQKLFGD"
FT   misc_feature    complement(553119..553331)
FT                   /locus_tag="BCAL0502"
FT                   /note="HMMPfam hit to PF01258, Prokaryotic dksA/traR
FT                   C4-type zinc finge, score 6.6e-13"
FT                   /inference="protein motif:HMMPfam:PF01258"
FT   CDS_pept        complement(554012..555091)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0503"
FT                   /product="putative cobalamin synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0503"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50813"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7Z4"
FT                   /protein_id="CAR50813.1"
FT                   /translation="MATPVTILTGFLGSGKTTLLKRILNEQHGMKIAVIENEFGEENID
FT                   NEILVQDSNEQIIQMSNGCICCTIRGDLARALGDLAAKKREGKLDFDRIVIETTGLANP
FT                   GPVAQTFFIDSEIADDFLLDAVITLVDAKHANAQLDEHEVVQRQVGFADRLFITKSDLV
FT                   DDQTVAGLKHRLMHMNPKAAIKVVNFGEADIKEIFDLRGFNLNAKLEIDPDFLAEDDHA
FT                   HHHHDHDHDHDHANCDHDHGQCAHDHDHGHHNHHHAHHDDKIKSFVYRNDRPFDPNKLE
FT                   DFLGGILQIYGERMLRYKGVLYMKGVDRKVVFQGVHQMMGSDLAAKWLPVEKKTNKMVF
FT                   IGVDLPQDLITDGLDACLA"
FT   misc_feature    complement(554018..554302)
FT                   /locus_tag="BCAL0503"
FT                   /note="HMMPfam hit to PF07683, Cobalamin synthesis protein
FT                   cobW C-terminal, score 3.2e-33"
FT                   /inference="protein motif:HMMPfam:PF07683"
FT   misc_feature    complement(554534..555082)
FT                   /locus_tag="BCAL0503"
FT                   /note="HMMPfam hit to PF02492, CobW/HypB/UreG,
FT                   nucleotide-binding domain, score 1.4e-76"
FT                   /inference="protein motif:HMMPfam:PF02492"
FT   misc_feature    complement(555041..555064)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(555284..556498)
FT                   /transl_table=11
FT                   /locus_tag="BCAL0504"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAL0504"
FT                   /db_xref="EnsemblGenomes-Tr:CAR50814"
FT                   /db_xref="GOA:B4E7Z5"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041532"
FT                   /db_xref="UniProtKB/TrEMBL:B4E7Z5"
FT                   /protein_id="CAR50814.1"
FT                   /translation="MQTVTLKPSKEKSLLRRHPWIYANAIDRVDGKPAPGATVLVRAHD
FT                   GRFLARGAYSPQSQIRVRVWSFDEHEPIDHAFFKRRVQRAVAHRTTMVSGTGAVRLVFG
FT                   EADGLPGLIVDYYVADTAEAGAAPRGQLVCQFMAAGVEAWKDAIVAALTGATGCPNVYE
FT                   RSDVSIRDKEGLEQTTGVLAGDAPPATLISNENGVRYHVDVPNGHKTGFYVDQRDNRAL
FT                   VAQYAADRDVLNCFCYTGGFSLAALKGGAKRVVSIDSSGDALALAQQNVVANGFDAERA
FT                   TWLDADAFKTLRRLVDEGERFDLIVLDPPKFAPTRDSVDRAARAYKDINLSGFRLLRPG
FT                   GLLFTYSCSGAIDMDLFQKIVAGAAADAKVDARILKRLGAGVDHPLLAAFPEGEYLKGL
FT                   LLQIV"
FT   misc_feature    complement(556025..556057)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_