(data stored in ACNUC1104 zone)

EMBL: AM747721

ID   AM747721; SV 1; circular; genomic DNA; STD; PRO; 3217062 BP.
XX
AC   AM747721;
XX
PR   Project:PRJNA339;
XX
DT   19-JUN-2008 (Rel. 96, Created)
DT   06-FEB-2015 (Rel. 123, Last updated, Version 10)
XX
DE   Burkholderia cenocepacia J2315 chromosome 2, complete genome
XX
KW   am0001 gene; sigma factor.
XX
OS   Burkholderia cenocepacia J2315
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
XX
RN   [1]
RP   1-3217062
RA   Holden M.T.G.;
RT   ;
RL   Submitted (20-JUN-2007) to the INSDC.
RL   Holden M.T.G., The Pathogen Sequencing Unit, The Wellcome Trust Sanger
RL   Institute, The Wellcome Trust Genome Campus, CB10 1SA, UNITED KINGDOM.
XX
RN   [2]
RX   DOI; 10.1128/JB.01230-08.
RX   PUBMED; 18931103.
RA   Holden M.T., Seth-Smith H.M., Crossman L.C., Sebaihia M., Bentley S.D.,
RA   Cerdeno-Tarraga A.M., Thomson N.R., Bason N., Quail M.A., Sharp S.,
RA   Cherevach I., Churcher C., Goodhead I., Hauser H., Holroyd N., Mungall K.,
RA   Scott P., Walker D., White B., Rose H., Iversen P., Mil-Homens D.,
RA   Rocha E.P., Fialho A.M., Baldwin A., Dowson C., Barrell B.G., Govan J.R.,
RA   Vandamme P., Hart C.A., Mahenthiralingam E., Parkhill J.;
RT   "The genome of Burkholderia cenocepacia J2315, an epidemic pathogen of
RT   cystic fibrosis patients";
RL   J. Bacteriol. 191(1):261-277(2009).
XX
DR   MD5; f3309276684be385d05ee411280ce329.
DR   BioSample; SAMEA1705928.
DR   EnsemblGenomes-Gn; BCAM0065A.
DR   EnsemblGenomes-Gn; BCAM0150A.
DR   EnsemblGenomes-Gn; BCAM0151.
DR   EnsemblGenomes-Gn; BCAM0225.
DR   EnsemblGenomes-Gn; BCAM0225A.
DR   EnsemblGenomes-Gn; BCAM0245.
DR   EnsemblGenomes-Gn; BCAM0273.
DR   EnsemblGenomes-Gn; BCAM0274a.
DR   EnsemblGenomes-Gn; BCAM0335.
DR   EnsemblGenomes-Gn; BCAM0354a.
DR   EnsemblGenomes-Gn; BCAM0454.
DR   EnsemblGenomes-Gn; BCAM0458.
DR   EnsemblGenomes-Gn; BCAM0520.
DR   EnsemblGenomes-Gn; BCAM0666a.
DR   EnsemblGenomes-Gn; BCAM0706.
DR   EnsemblGenomes-Gn; BCAM0788.
DR   EnsemblGenomes-Gn; BCAM0856.
DR   EnsemblGenomes-Gn; BCAM1102.
DR   EnsemblGenomes-Gn; BCAM1251.
DR   EnsemblGenomes-Gn; BCAM1328.
DR   EnsemblGenomes-Gn; BCAM1498.
DR   EnsemblGenomes-Gn; BCAM1543C.
DR   EnsemblGenomes-Gn; BCAM1663a.
DR   EnsemblGenomes-Gn; BCAM1752A.
DR   EnsemblGenomes-Gn; BCAM1794.
DR   EnsemblGenomes-Gn; BCAM1874.
DR   EnsemblGenomes-Gn; BCAM1914.
DR   EnsemblGenomes-Gn; BCAM1916.
DR   EnsemblGenomes-Gn; BCAM1923.
DR   EnsemblGenomes-Gn; BCAM1951.
DR   EnsemblGenomes-Gn; BCAM2006a.
DR   EnsemblGenomes-Gn; BCAM2006b.
DR   EnsemblGenomes-Gn; BCAM2043.
DR   EnsemblGenomes-Gn; BCAM2101.
DR   EnsemblGenomes-Gn; BCAM2111.
DR   EnsemblGenomes-Gn; BCAM2112a.
DR   EnsemblGenomes-Gn; BCAM2228.
DR   EnsemblGenomes-Gn; BCAM2252.
DR   EnsemblGenomes-Gn; BCAM2621.
DR   EnsemblGenomes-Gn; BCAM2837.
DR   EnsemblGenomes-Gn; EBG00000501332.
DR   EnsemblGenomes-Gn; EBG00000501333.
DR   EnsemblGenomes-Gn; EBG00000501334.
DR   EnsemblGenomes-Gn; EBG00000501335.
DR   EnsemblGenomes-Gn; EBG00000501336.
DR   EnsemblGenomes-Gn; EBG00000501337.
DR   EnsemblGenomes-Gn; EBG00000501338.
DR   EnsemblGenomes-Gn; EBG00000501339.
DR   EnsemblGenomes-Gn; EBG00000501340.
DR   EnsemblGenomes-Gn; EBG00000612163.
DR   EnsemblGenomes-Gn; EBG00000612164.
DR   EnsemblGenomes-Gn; EBG00001048934.
DR   EnsemblGenomes-Gn; EBG00001048935.
DR   EnsemblGenomes-Gn; EBG00001048936.
DR   EnsemblGenomes-Gn; EBG00001048937.
DR   EnsemblGenomes-Gn; EBG00001048938.
DR   EnsemblGenomes-Gn; EBG00001048939.
DR   EnsemblGenomes-Gn; EBG00001048940.
DR   EnsemblGenomes-Gn; EBG00001048941.
DR   EnsemblGenomes-Gn; EBG00001048942.
DR   EnsemblGenomes-Gn; EBG00001048943.
DR   EnsemblGenomes-Gn; EBG00001048944.
DR   EnsemblGenomes-Gn; EBG00001048945.
DR   EnsemblGenomes-Tr; BCAM0065A.
DR   EnsemblGenomes-Tr; BCAM0150A.
DR   EnsemblGenomes-Tr; BCAM0151.
DR   EnsemblGenomes-Tr; BCAM0225.
DR   EnsemblGenomes-Tr; BCAM0225A.
DR   EnsemblGenomes-Tr; BCAM0245.
DR   EnsemblGenomes-Tr; BCAM0273.
DR   EnsemblGenomes-Tr; BCAM0274a.
DR   EnsemblGenomes-Tr; BCAM0335.
DR   EnsemblGenomes-Tr; BCAM0354a.
DR   EnsemblGenomes-Tr; BCAM0454.
DR   EnsemblGenomes-Tr; BCAM0458.
DR   EnsemblGenomes-Tr; BCAM0520.
DR   EnsemblGenomes-Tr; BCAM0666a.
DR   EnsemblGenomes-Tr; BCAM0706.
DR   EnsemblGenomes-Tr; BCAM0788.
DR   EnsemblGenomes-Tr; BCAM0856.
DR   EnsemblGenomes-Tr; BCAM1102.
DR   EnsemblGenomes-Tr; BCAM1251.
DR   EnsemblGenomes-Tr; BCAM1328.
DR   EnsemblGenomes-Tr; BCAM1498.
DR   EnsemblGenomes-Tr; BCAM1543C.
DR   EnsemblGenomes-Tr; BCAM1663a.
DR   EnsemblGenomes-Tr; BCAM1752A.
DR   EnsemblGenomes-Tr; BCAM1794.
DR   EnsemblGenomes-Tr; BCAM1874.
DR   EnsemblGenomes-Tr; BCAM1914.
DR   EnsemblGenomes-Tr; BCAM1916.
DR   EnsemblGenomes-Tr; BCAM1923.
DR   EnsemblGenomes-Tr; BCAM1951.
DR   EnsemblGenomes-Tr; BCAM2006a.
DR   EnsemblGenomes-Tr; BCAM2006b.
DR   EnsemblGenomes-Tr; BCAM2043.
DR   EnsemblGenomes-Tr; BCAM2101.
DR   EnsemblGenomes-Tr; BCAM2111.
DR   EnsemblGenomes-Tr; BCAM2112a.
DR   EnsemblGenomes-Tr; BCAM2228.
DR   EnsemblGenomes-Tr; BCAM2252.
DR   EnsemblGenomes-Tr; BCAM2621.
DR   EnsemblGenomes-Tr; BCAM2837.
DR   EnsemblGenomes-Tr; EBG00000501332-1.
DR   EnsemblGenomes-Tr; EBG00000501333-1.
DR   EnsemblGenomes-Tr; EBG00000501334-1.
DR   EnsemblGenomes-Tr; EBG00000501335-1.
DR   EnsemblGenomes-Tr; EBG00000501336-1.
DR   EnsemblGenomes-Tr; EBG00000501337-1.
DR   EnsemblGenomes-Tr; EBG00000501338-1.
DR   EnsemblGenomes-Tr; EBG00000501339-1.
DR   EnsemblGenomes-Tr; EBG00000501340-1.
DR   EnsemblGenomes-Tr; EBT00000612165.
DR   EnsemblGenomes-Tr; EBT00000612166.
DR   EnsemblGenomes-Tr; EBT00001651188.
DR   EnsemblGenomes-Tr; EBT00001651189.
DR   EnsemblGenomes-Tr; EBT00001651190.
DR   EnsemblGenomes-Tr; EBT00001651191.
DR   EnsemblGenomes-Tr; EBT00001651192.
DR   EnsemblGenomes-Tr; EBT00001651193.
DR   EnsemblGenomes-Tr; EBT00001651194.
DR   EnsemblGenomes-Tr; EBT00001651195.
DR   EnsemblGenomes-Tr; EBT00001651196.
DR   EnsemblGenomes-Tr; EBT00001651197.
DR   EnsemblGenomes-Tr; EBT00001651198.
DR   EnsemblGenomes-Tr; EBT00001651199.
DR   EuropePMC; PMC2612433; 18931103.
DR   EuropePMC; PMC2765135; 19700546.
DR   EuropePMC; PMC4603805; 26462475.
DR   EuropePMC; PMC4993015; 27597847.
DR   EuropePMC; PMC5688073; 29142288.
DR   EuropePMC; PMC5749847; 29293658.
DR   EuropePMC; PMC5760752; 29359187.
DR   EuropePMC; PMC5987112; 29896180.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01725; SAM-I-IV-variant.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   RFAM; RF02005; group-II-D1D4-6.
DR   RFAM; RF02278; Betaproteobacteria_toxic_sRNA.
DR   SILVA-LSU; AM747721.
DR   SILVA-SSU; AM747721.
DR   StrainInfo; 322838; 1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3217062
FT                   /organism="Burkholderia cenocepacia J2315"
FT                   /chromosome="2"
FT                   /strain="J2315"
FT                   /mol_type="genomic DNA"
FT                   /country="United Kingdom:Edinburgh"
FT                   /isolation_source="cystic fibrosis patient"
FT                   /note="representative of the ET12 epidemic lineage"
FT                   /db_xref="taxon:216591"
FT   CDS_pept        230..829
FT                   /transl_table=11
FT                   /locus_tag="BCAM0001"
FT                   /product="putative sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAO00537"
FT                   /db_xref="GOA:B3KYE4"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014289"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B3KYE4"
FT                   /protein_id="CAO00537.1"
FT                   /translation="MPSAYDDPTYLAQLRRDLLRFARLQLRDADAAEDAVQEALAAAWS
FT                   HAGDFAGQSAHKTWVFGILRNKLIDVLRARQRMVSLTALDAELDGESVLDRELFKDNGH
FT                   WAAHAKPRPWPKPETLLQQQQFWTLFQACLDQLPEQIGRVFMMREFLDVEIVDICSELT
FT                   LTTNHCSVLLYRARTRLRTCLSEKGLTTEDAAGEMY"
FT   misc_feature    257..463
FT                   /locus_tag="BCAM0001"
FT                   /note="HMMPfam hit to PF04542, Sigma-70 region, score
FT                   1.7e-12"
FT                   /inference="protein motif:HMMPfam:PF04542"
FT   misc_feature    596..628
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    608..769
FT                   /locus_tag="BCAM0001"
FT                   /note="HMMPfam hit to PF08281, Sigma-70, region, score
FT                   5.8e-05"
FT                   /inference="protein motif:HMMPfam:PF08281"
FT   CDS_pept        831..1022
FT                   /transl_table=11
FT                   /locus_tag="BCAM0001A"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0001A"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53855"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:B4EFY6"
FT                   /protein_id="CAR53855.1"
FT                   /translation="MTRLLSDALDRRLTLHERLQVRVHLPTCSGCRAYRGQIALLRTAA
FT                   KAAAGREPDGDDGSSGGG"
FT   CDS_pept        complement(1160..1516)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0002"
FT                   /product="ArsC family arsenate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53856"
FT                   /db_xref="GOA:B4EFY7"
FT                   /db_xref="InterPro:IPR006659"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B4EFY7"
FT                   /protein_id="CAR53856.1"
FT                   /translation="MITIYHNPRCSKSRETLALVESLNTAGAPLNVVEYLKTPPTVEEL
FT                   DTLHKQLGRPVRDMLRDGEEPYKALNLARADLTDAEAYGAIVAHPVLLQRPIVVYRGKA
FT                   AIGRPPESVKALFE"
FT   misc_feature    complement(1163..1504)
FT                   /locus_tag="BCAM0002"
FT                   /note="HMMPfam hit to PF03960, ArsC family, score 2.1e-34"
FT                   /inference="protein motif:HMMPfam:PF03960"
FT   CDS_pept        2538..3200
FT                   /transl_table=11
FT                   /locus_tag="BCAM0003"
FT                   /product="putative partition protein ParA"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53857"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4EFY8"
FT                   /protein_id="CAR53857.1"
FT                   /translation="MAAEIIAVTQQKGGVGKSTIAMHLGAAFHEKGKRVLVIDADRQNT
FT                   LVHWSSASGDSDNGIPFPVVNLAEADGQIHREIKKFINDYDIIVVDCPPSITEKVSGVV
FT                   LLAASIAVIPTSSSPADYWSSVGLVKLIQQAQVMNEDLRAVFLLNKTEEKRMLTRELKR
FT                   ALEELGFPLLKTQIPTREAYKQAMALGQTVLQMNDRGGKLAAAEIRACADEIVAMLP"
FT   misc_feature    2553..3092
FT                   /locus_tag="BCAM0003"
FT                   /note="HMMPfam hit to PF01656, CobQ/CobB/MinD/ParA
FT                   nucleotide binding domai, score 9.2e-18"
FT                   /inference="protein motif:HMMPfam:PF01656"
FT   CDS_pept        3224..4285
FT                   /transl_table=11
FT                   /locus_tag="BCAM0004"
FT                   /product="putative partitioning protein ParB"
FT                   /note="Similar to Ralstonia solanacearum putative
FT                   partitioning protein parB SWALL:Q8XTV0 (EMBL:AL646076) (334
FT                   aa) fasta scores: E(): 4.7e-19, 28.71% id in 310 aa;
FT                   homology does not extend to the N terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53858"
FT                   /db_xref="GOA:B4EFY9"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:B4EFY9"
FT                   /protein_id="CAR53858.1"
FT                   /translation="MKPSQFAKGFQARPDITTSEKRTALDRLNAIDGIVKSETPTPAPT
FT                   KSAKKDIAPPPAPEFTIDPSIDESQQYRAWRLENRYAPGQVIELPLKAIKHSPFNPRHF
FT                   YLKSSIAELAVNLAKQGQQQAIHVIPDYDNPGTYFVSDGGRRVRALKEANKESVKAIVI
FT                   DVPIGIQSYKLGYDLNVQRDSQTVFDNAVVWRRFLDDKHFQSQKELSEHLGLDESTVAV
FT                   ALSIGKLPEAIMQEMVARPDRFGSNMAYQVGRYHNARGTEATLRLINKIVSDDLSTRQV
FT                   SDIVKGRVAAQETPKPAGRQRYAQRLEIKLGGKSVGDLKSYGEDRIELRLRGLPKDKRD
FT                   AILEQLERMLLSE"
FT   misc_feature    3482..3763
FT                   /locus_tag="BCAM0004"
FT                   /note="HMMPfam hit to PF02195, ParB-like nuclease domain,
FT                   score 1.4e-11"
FT                   /inference="protein motif:HMMPfam:PF02195"
FT   misc_feature    3833..3898
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1577.000, SD 4.56 at aa 204-225, sequence
FT                   QSQKELSEHLGLDESTVAVALS"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        complement(4378..5745)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0005"
FT                   /product="putative replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53859"
FT                   /db_xref="GOA:B4EFZ0"
FT                   /db_xref="InterPro:IPR000525"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EFZ0"
FT                   /protein_id="CAR53859.1"
FT                   /translation="MATTKRAKKTDVDVVSASSAELRKAVEAIAIQPKSGKITLLTRKL
FT                   FNVLLAVAQQADDSGDTYRALLSDIVANSAFDSNDTALVKEHLRRMVSVQVEWSTGTSS
FT                   QKPGRKWGISTLIADAEILEDPTTRRVWVEFSFAPKIKKKLLDPVQYARLSLQFQSQLR
FT                   SSAGLALYEICVRYLTNPSHLTMREPWEWWRPILSGTPDTEAGDEAKREYKYFKRDYLR
FT                   PAIAEVNAVTNIFVELIEHREGRRVAEIQFRVTERKQPMLALDEHPNVFDSTLVDRMVK
FT                   LGIPLKEAQTLYADSEENRIRAALQMTEQRMRSTTLPPVRSAPALFKDALKKGYAPPVE
FT                   SVDALPAGTPSAKVAAAQPDDLKARLLSEFAAFRRKEAKVLYEEQGDAEREVARESFES
FT                   EALPTMGSHLRDDWRKRGLDSKLAETAFFDWLAQKTWGEPTDGDLLSFTLNQSRAA"
FT   CDS_pept        complement(6784..6996)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0005A"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0005A"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53860"
FT                   /db_xref="UniProtKB/TrEMBL:B4EFZ1"
FT                   /protein_id="CAR53860.1"
FT                   /translation="MEPALCLTAQFSACADIGENLQDPLHAPILPIFWADLAKGEVSRD
FT                   STGICCEDFREANAILHSKSALGGL"
FT   CDS_pept        7550..8731
FT                   /transl_table=11
FT                   /locus_tag="BCAM0006"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains coiled-coiled domains, residues 112 to 296"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53861"
FT                   /db_xref="InterPro:IPR021104"
FT                   /db_xref="UniProtKB/TrEMBL:B4EFZ2"
FT                   /protein_id="CAR53861.1"
FT                   /translation="MTLDEMRQVIREELESLRASGARRQELSLHACKRLFFDLGIRPSA
FT                   ANVRDLTQTGSASDIPKDIDHFWERIRSASKIRLDGAAIPKAVEEKAGALLGALYEEAL
FT                   KAARDSLDGDREQVRADMAEAEQRLRDATVRQETLEGALARGEARNEQLQARVTELEVQ
FT                   LASQTTHGSASEATLLTTVARLEKELAAAAGRIEAEQAQNAALRDRIDALQAELQQRTE
FT                   HYAQQIKDAVAEAERRVKPMLVELDSLRSMASTYQSGLRDVQRKEFDFLQQLSSAKARA
FT                   DRLEEQLRTQSDELERATRDVSSLRANRGMNPEIAALIRRLAEAGQLDADAYAAIGTAL
FT                   DHEIPAPTQCPHCDGEPELSHGDEGFEVACPECEHASGTWPSRFEAVARFAHT"
FT   CDS_pept        complement(8868..9887)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0007"
FT                   /product="putative phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53862"
FT                   /db_xref="GOA:B4EFZ3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B4EFZ3"
FT                   /protein_id="CAR53862.1"
FT                   /translation="MSLPAAPDTAAHPEEKDLFDRDASDWVASPEAAFDAWLAMQDYRR
FT                   SSADVYRAQWGAFLAWMRAHQKNLATVDTPTIANFVGELPIKKTQRMRYLRLIERVLDH
FT                   IRRTEYASTNPARFIAQDGEANWRKARDNEPTGFLTPAERATLLAYLFSPIGVSGSAYW
FT                   KERRDRALVAAFLGAGIKTGEARSLTISCINTSGTSLRIESTHPDYSRETHLASFAIAL
FT                   LEAWLTERKRQEIPGELVFPASHAGRPMHKATMLRAIDAIVESAGLTSSRTARASPQTL
FT                   RNTYAAELFEHDVPPERVGKWLGFMRPISSNRLHRAWKNWRDGLADHNGDASDRDETH"
FT   misc_feature    complement(8919..9437)
FT                   /locus_tag="BCAM0007"
FT                   /note="HMMPfam hit to PF00589, Phage integrase family,
FT                   score 0.00032"
FT                   /inference="protein motif:HMMPfam:PF00589"
FT   CDS_pept        complement(9990..10367)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0008"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53863"
FT                   /db_xref="InterPro:IPR018894"
FT                   /db_xref="UniProtKB/TrEMBL:B4EFZ4"
FT                   /protein_id="CAR53863.1"
FT                   /translation="MTEEQDLAALSFKAAAHDLELIVRHIAGRYIRQRVPLTWRLLHAI
FT                   EAEALADLGFASRHDAGMRQLFERPSDMTFPETDDPIDFGRSNALPAVFSFAVLAYEAA
FT                   ATAHDTARPARALRPSKAWGD"
FT   CDS_pept        complement(10509..11120)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0009"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53864"
FT                   /db_xref="GOA:B4EFZ5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B4EFZ5"
FT                   /protein_id="CAR53864.1"
FT                   /translation="MASSSGSRRPPAAAAPQPPAATPPRVGEQIQRLRNERKLTLDDLS
FT                   RAAGVSKSMLSEIERDKANPTIAVAWRLTNALGITLDELFSQPKAPETIRVDGPHDIPT
FT                   LAGHDGRYQLRVWGPIDLAGKFEWYELTLPGGGALVSNAHEPGTREHLTVLQGAMEIEA
FT                   AAASRRLKTGDTARYPADEPHAIRNPGKAEARALLIVIHR"
FT   misc_feature    complement(10521..10736)
FT                   /locus_tag="BCAM0009"
FT                   /note="HMMPfam hit to PF07883, Cupin domain, score 1.4e-11"
FT                   /inference="protein motif:HMMPfam:PF07883"
FT   misc_feature    complement(10869..11033)
FT                   /locus_tag="BCAM0009"
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix, score
FT                   5.1e-17"
FT                   /inference="protein motif:HMMPfam:PF01381"
FT   misc_feature    complement(10941..11006)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1501.000, SD 4.30 at aa 39-60, sequence
FT                   LTLDDLSRAAGVSKSMLSEIER"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        11279..12478
FT                   /transl_table=11
FT                   /gene="kbl"
FT                   /locus_tag="BCAM0010"
FT                   /product="2-amino-3-ketobutyrate coenzyme A ligase"
FT                   /EC_number="2.3.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53865"
FT                   /db_xref="GOA:B4EFZ6"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011282"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B4EFZ6"
FT                   /protein_id="CAR53865.1"
FT                   /translation="MRDAFLAQVRGTLDQIRADGFYKTEREIASPQAAAVRLAGGAGVL
FT                   NFCANNYLGLANDPRLLDAAKAGLDQDGFGMASVRFICGTQTVHKQLESALAAFLGTED
FT                   SILYSSCFDANGGLFETLLDENDAVISDELNHASIIDGIRLCKAKRFRYKNNDLADLEA
FT                   KLKEADAAGARHKLIATDGVFSMDGIIADLKGICDLADRYGALVMVDDSHAVGFIGTHG
FT                   RGTPEHCGVEGRVDIITGTLGKALGGASGGYVAARHEVIELLRQRSRPYLFSNTLTPSI
FT                   AAASLKVLELLGSDEGAKLRERVRENGARFRKQMTEAGFTLVPGAHPIIPVMLGDAQLA
FT                   TNMADRLLGEGVYVIGFSFPVVPRGRARIRTQMSAAHTPEQIDQTVAAFVRVGKSLGII
FT                   "
FT   misc_feature    11363..12286
FT                   /gene="kbl"
FT                   /locus_tag="BCAM0010"
FT                   /note="HMMPfam hit to PF00202, Aminotransferase class-III,
FT                   score 0.02"
FT                   /inference="protein motif:HMMPfam:PF00202"
FT   misc_feature    11402..12445
FT                   /gene="kbl"
FT                   /locus_tag="BCAM0010"
FT                   /note="HMMPfam hit to PF00155, Aminotransferase class I and
FT                   II, score 2.4e-92"
FT                   /inference="protein motif:HMMPfam:PF00155"
FT   misc_feature    11444..12466
FT                   /gene="kbl"
FT                   /locus_tag="BCAM0010"
FT                   /note="HMMPfam hit to PF00464, Serine
FT                   hydroxymethyltransferase, score 0.00023"
FT                   /inference="protein motif:HMMPfam:PF00464"
FT   misc_feature    11999..12028
FT                   /note="PS00599 Aminotransferases class-II
FT                   pyridoxal-phosphate attachment site."
FT                   /inference="protein motif:Prosite:PS00599"
FT   misc_feature    12440..12463
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        12492..13520
FT                   /transl_table=11
FT                   /gene="tdh"
FT                   /locus_tag="BCAM0011"
FT                   /product="threonine 3-dehydrogenase"
FT                   /EC_number="1.1.1.103"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53866"
FT                   /db_xref="GOA:B4EFZ7"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR004627"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EFZ7"
FT                   /protein_id="CAR53866.1"
FT                   /translation="MKALAKLERGPGLTLTRVKRPEVGHNDVLIKIRRTAICGTDIHIW
FT                   KWDDWAQKTIPVPMHVGHEYVGEIVEMGQEVRGFAIGDRVSGEGHITCGFCRNCRAGRR
FT                   HLCRNTVGVGVNREGAFAEYLAIPAFNAFKIPPEISDDLASIFDPFGNATHTALSFNLV
FT                   GEDVLITGAGPIGIMAVAIAKHVGARNVVITDINDYRLELARKMGATRAVNVARESLRD
FT                   VMADLHMTEGFDVGLEMSGVPSAFTSLLEAMNHGGKVALLGIPPAQTAIDWNQVIFKGL
FT                   EIKGIYGREMFETWYKMVAMLQSGLDLSPIITHRFAADDYEQGFAAMLSGESGKVILDW
FT                   TV"
FT   misc_feature    12564..12896
FT                   /gene="tdh"
FT                   /locus_tag="BCAM0011"
FT                   /note="HMMPfam hit to PF08240, Alcohol dehydrogenase
FT                   GroES-like domain, score 3.2e-43"
FT                   /inference="protein motif:HMMPfam:PF08240"
FT   misc_feature    12675..12719
FT                   /note="PS00059 Zinc-containing alcohol dehydrogenases
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00059"
FT   misc_feature    12978..13403
FT                   /gene="tdh"
FT                   /locus_tag="BCAM0011"
FT                   /note="HMMPfam hit to PF00107, Zinc-binding dehydrogenase,
FT                   score 9.4e-42"
FT                   /inference="protein motif:HMMPfam:PF00107"
FT   CDS_pept        complement(13918..14322)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0012"
FT                   /product="putative membrane protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53867"
FT                   /db_xref="GOA:B4EFZ8"
FT                   /db_xref="UniProtKB/TrEMBL:B4EFZ8"
FT                   /protein_id="CAR53867.1"
FT                   /translation="MRKRDDDDDRARLAIRQARVRAALRLRGVMKLTIVTIAVAHVLTF
FT                   AFEGVLAAAGFAPDAAAVLLFRFATCALVSFWLQADALRAYRYAAQHGFVTAPGAHGDP
FT                   LDVAPQCPKRWLVVLSLQLDPRGSNGERIK"
FT   misc_feature    complement(join(14089..14157,14185..14253))
FT                   /locus_tag="BCAM0012"
FT                   /note="2 probable transmembrane helices predicted for
FT                   BCAM0012 by TMHMM2.0 at aa 24-46 and 56-78"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(14331..14969)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0013"
FT                   /product="putative acetyltransferase-GNAT family"
FT                   /note="Poor database matches. C-terminal region is similar
FT                   to Chromobacterium violaceum hypothetical protein
FT                   SWALL:Q7NWH5 (EMBL:AE016917) (161 aa) fasta scores: E():
FT                   8.3e-13, 35.06% id in 154 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53868"
FT                   /db_xref="GOA:B4EFZ9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B4EFZ9"
FT                   /protein_id="CAR53868.1"
FT                   /translation="MQRPESARPARAYAAYAKRLDGRVIVRRFDPCSDSYDTLTALLHR
FT                   AFAPLGALGFNCPCVDQPAAATRERVLTGECFVALGNAHLVATMTMRSHDPDSRCDPYR
FT                   SRRVATLEQLAVDPVWQDRGIGRALLAFAQRRAAARGATHLALDAPYAAARLIAFYRRD
FT                   GFQPVDVVRFPGHNYDSTILCKAVGGADGSTRAHGTMQIDVARQAGAAS"
FT   misc_feature    complement(14472..14741)
FT                   /locus_tag="BCAM0013"
FT                   /note="HMMPfam hit to PF00583, Acetyltransferase (GNAT)
FT                   family, score 3.2e-15"
FT                   /inference="protein motif:HMMPfam:PF00583"
FT   CDS_pept        15152..15757
FT                   /transl_table=11
FT                   /locus_tag="BCAM0014"
FT                   /product="TetR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53869"
FT                   /db_xref="GOA:B4EG00"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B4EG00"
FT                   /protein_id="CAR53869.1"
FT                   /translation="MNTLLDSSGEPGVRDRLLDAAEALIYSGGIHATGVDAIVKRSGAA
FT                   RKSFYSHFESKEALVVAALERRDERWMRWFVDATLARGKTPRAQLLGMFDVLCDWFGQP
FT                   DFHGCAFLNTAGEIPDADDPVRVVARMHKARLLAFVRERFDACADETGIERRGLARIAR
FT                   QWLVLIDGAIGVALVSGDANAARDARATAELLLDAVSR"
FT   misc_feature    15200..15340
FT                   /locus_tag="BCAM0014"
FT                   /note="HMMPfam hit to PF00440, Bacterial regulatory
FT                   proteins, tetR family, score 8.3e-15"
FT                   /inference="protein motif:HMMPfam:PF00440"
FT   misc_feature    15383..15406
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        15822..16301
FT                   /transl_table=11
FT                   /locus_tag="BCAM0015"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53870"
FT                   /db_xref="InterPro:IPR009783"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:B4EG01"
FT                   /protein_id="CAR53870.1"
FT                   /translation="MSASPEVRPPVPPFTLDTARQKVRAAEDAWNTRDPQRVSLAYTPQ
FT                   SRWRNRAEFVTGRDEIVGLLQRKWARELDYRLIKELWAFDGNRIAVRFAYEWHDDAGNW
FT                   FRSYGNENWAFDENGLMAHRHASINDLPIREADRLYHWPLGRRPDDHPGLSDLGL"
FT   misc_feature    15843..16271
FT                   /locus_tag="BCAM0015"
FT                   /note="HMMPfam hit to PF07080, Protein of unknown function
FT                   (DUF1348), score 2.8e-95"
FT                   /inference="protein motif:HMMPfam:PF07080"
FT   CDS_pept        complement(16765..17850)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0016"
FT                   /product="tartrate dehydrogenase"
FT                   /EC_number="1.1.1.93"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53871"
FT                   /db_xref="GOA:B4EG02"
FT                   /db_xref="InterPro:IPR011829"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:B4EG02"
FT                   /protein_id="CAR53871.1"
FT                   /translation="MTDRTYRIAVIPGDGIGREVMPEGLRVLAAVTARFGVRFDFVEID
FT                   WASCDYYARHGKMMPDDWKAQLSDMDAILFGAVGWPATVPDHISLWGSLLKFRREFDQY
FT                   INLRPARLFDGVPSPLAGRRAGDIDFMIVRENTEGEYSSVGGTMFEGTEREVVMQQSVF
FT                   TRHGTERVLKFAFELAQRRAKRVTVATKSNGIAISMPWWDARAAEMAERYPEIAVDKQH
FT                   IDILCARFVLQPDRFDVVVASNLFGDILSDLGPACTGTIGIAPSANLNPDRTFPSLFEP
FT                   VHGSAPDIAGQYIANPVAMIWSAAMMLDFLGNGTGRERDAHDAIVAAIEDVLRTGPHTR
FT                   DLGGHAGTQEVGEAIAARVAG"
FT   misc_feature    complement(16786..17832)
FT                   /locus_tag="BCAM0016"
FT                   /note="HMMPfam hit to PF00180, Isocitrate/isopropylmalate
FT                   dehydrogenase, score 7.2e-103"
FT                   /inference="protein motif:HMMPfam:PF00180"
FT   misc_feature    complement(17062..17121)
FT                   /note="PS00470 Isocitrate and isopropylmalate
FT                   dehydrogenases signature."
FT                   /inference="protein motif:Prosite:PS00470"
FT   CDS_pept        17966..18889
FT                   /transl_table=11
FT                   /locus_tag="BCAM0017"
FT                   /product="LysR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53872"
FT                   /db_xref="GOA:B4EG03"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EG03"
FT                   /protein_id="CAR53872.1"
FT                   /translation="MNKSPNLDDLRVFSLVVRLASFSAAAEQLAVSPAYVSKRIAMLEA
FT                   QLGTRLLHRSTRRMTVTEAGERVFARAEKILDDVDHLVEDVSTTRTVPRGTLRLSSSFG
FT                   FGRHVVAPALLDFSARYPQLNVRLDLFDRLVDVAGEGYDLDVRIGDEIADHLIARRLAT
FT                   NHRVLCASPDYLARRGTPRSLADLASHDCLAIKERDHPFGVWRLTVRGETATVKVGGAL
FT                   STNHGEVAVQWALAGRGIVLRSIWEAGPLIERGALCRVLPDALQPANIWAVYPERVAAS
FT                   AKVRVCVDFLVETLAGLNAVASDDTA"
FT   sig_peptide     17966..18043
FT                   /locus_tag="BCAM0017"
FT                   /note="Signal peptide predicted for BCAM0017 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.966) with cleavage site
FT                   probability 0.857 between residues 26 and 27"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    17984..18163
FT                   /locus_tag="BCAM0017"
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix, score 4e-18"
FT                   /inference="protein motif:HMMPfam:PF00126"
FT   misc_feature    18023..18088
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1242.000, SD 3.42 at aa 20-41, sequence
FT                   ASFSAAAEQLAVSPAYVSKRIA"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    18233..18853
FT                   /locus_tag="BCAM0017"
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 5.9e-45"
FT                   /inference="protein motif:HMMPfam:PF03466"
FT   CDS_pept        complement(18955..19896)
FT                   /transl_table=11
FT                   /gene="argC"
FT                   /locus_tag="BCAM0018"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53873"
FT                   /db_xref="GOA:B4EG04"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR010136"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EG04"
FT                   /protein_id="CAR53873.1"
FT                   /translation="MSFPTVFIDGDQGTTGLQIHARLRDRTDVRLLTLPAAERKDPARR
FT                   ADALNACDIAVLCLPDAAAREAVGFIRNPAVRVIDASSAHRTQPDWVYGFPEMADGHAQ
FT                   DIAHAKRVTNPGCYPTGAIGLLRPLLQAGLLPRDYPVSIHAVSGYSGGGRAAVDAFESA
FT                   DAATPPLPLQVYGLALEHKHVPEIRQHAGLAHRPFFVPAYGAYRQGIVLTIPIELRLLP
FT                   AGVTGERLHACLAHHYADARHVDVTPLADAAAATHLDPQALNGTNDLRLGVFVNEARGQ
FT                   VLLSAVFDNLGKGASGAAVQNLDLMLGASSAA"
FT   misc_feature    complement(19570..19884)
FT                   /gene="argC"
FT                   /locus_tag="BCAM0018"
FT                   /note="HMMPfam hit to PF01118, Semialdehyde dehydrogenase,
FT                   NAD bindin, score 9.8e-11"
FT                   /inference="protein motif:HMMPfam:PF01118"
FT   CDS_pept        20018..20902
FT                   /transl_table=11
FT                   /locus_tag="BCAM0019"
FT                   /product="LysR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53874"
FT                   /db_xref="GOA:B4EG05"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EG05"
FT                   /protein_id="CAR53874.1"
FT                   /translation="MREISLDRLRTLVAIADQGSFVAAAQWLHLAPPTVSLHVAELESR
FT                   VGAPLLSRTRGNVRPSVIGEVLVERARRLLAEVEATLDDVQRQVQGLSGRVRLGASTGA
FT                   IAHLLPQAVAGLRAQHPDIDVQIAVLTSQDTLARIAQGTLDVGLVALPQAPVAGLSIRP
FT                   WRRDPVMAFLPADWPLPARVTPAYLAARPLILNDATTRLSRLTTEWFALGGHRPEPRIE
FT                   LNYNDAIKSLVAAGYGATLLPHEAGAPLPDARIVMRPLRPALWRELGIAHRAGPVERAT
FT                   QHVLDALWALGAR"
FT   misc_feature    20018..20029
FT                   /note="PS00228 Tubulin-beta mRNA autoregulation signal."
FT                   /inference="protein motif:Prosite:PS00228"
FT   misc_feature    20033..20212
FT                   /locus_tag="BCAM0019"
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix, score 1.7e-15"
FT                   /inference="protein motif:HMMPfam:PF00126"
FT   misc_feature    20072..20137
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1158.000, SD 3.13 at aa 19-40, sequence
FT                   GSFVAAAQWLHLAPPTVSLHVA"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    20075..20167
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00044"
FT   misc_feature    20282..20896
FT                   /locus_tag="BCAM0019"
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 8.5e-40"
FT                   /inference="protein motif:HMMPfam:PF03466"
FT   CDS_pept        complement(20953..21471)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0020"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53875"
FT                   /db_xref="GOA:B4EG06"
FT                   /db_xref="UniProtKB/TrEMBL:B4EG06"
FT                   /protein_id="CAR53875.1"
FT                   /translation="MQRAGMLHAPARPPFRFDMSIFIALFALIALGWGAVHLFHVIAAQ
FT                   FGQPVAIAAAVLAAALLVALIAWWLKRRRDIAPNTKEEGWTHVVHRAWGELRVSATQGL
FT                   LWLSHDGADGRYTLSQLDGCEAAPIDGRWHLVVRVRDAVRGEWKLPMMDKRDAQRWARV
FT                   LTLAKDNRL"
FT   misc_feature    complement(join(21262..21330,21343..21411))
FT                   /locus_tag="BCAM0020"
FT                   /note="2 probable transmembrane helices predicted for
FT                   BCAM0020 by TMHMM2.0 at aa 21-43 and 48-70"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(21478..22662)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0021"
FT                   /product="putative patatin-like phospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53876"
FT                   /db_xref="GOA:B4EG07"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR021095"
FT                   /db_xref="UniProtKB/TrEMBL:B4EG07"
FT                   /protein_id="CAR53876.1"
FT                   /translation="MDAADLHHEAGAPAAARSLPYETIALVLQGGGALGAYQAGVFEGL
FT                   HEAGIPLDWIAGISIGALNTALIAGNAPEHRVERLREFWETICQPAFFPTIPAAFEFAL
FT                   FNSIDQVRTFFTASQAASAMMQGQQGFFVPRFPPPLPGVSDHPEKISWYDTSALRATLL
FT                   KLCDFDRINSGETRVSVGAVNVGTGNFVYFDNSRIRLAPEHFMASGALPPAFPPVEIDG
FT                   EYYWDGGVVSNTPLMEVLRARPRRDTLAFQVDLWSARGPLPRTMADVAERTKDVQYSSR
FT                   TRFVTDTLQREQRYRNVLRHVLEQVPEEQRKNDPWCVEAEAMSSGKKYNIQHLIYQQKA
FT                   YEHHYKDYQFGLSTMRDHWSAGLDDIRKTLAVKDGLALPVNDAGFVTHDIHRRR"
FT   misc_feature    complement(21943..22587)
FT                   /locus_tag="BCAM0021"
FT                   /note="HMMPfam hit to PF01734, Patatin-like phospholipase,
FT                   score 1.4e-21"
FT                   /inference="protein motif:HMMPfam:PF01734"
FT   CDS_pept        complement(22692..23477)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0022"
FT                   /product="putative D-beta-hydroxybutyrate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53877"
FT                   /db_xref="GOA:B4EG08"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011294"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:4TRR"
FT                   /db_xref="UniProtKB/TrEMBL:B4EG08"
FT                   /protein_id="CAR53877.1"
FT                   /translation="MSNLNGKTAVVTGAASGIGKEIALELAKAGAAVAIADLNQDGANA
FT                   VADEINKAGGKAIGVAMDVTNEEAVNTGIDKVAEAFGSVDILVSNAGIQIVNPIENYSF
FT                   ADWKKMQAIHVDGAFLTTKAALKHMYKDDRGGVVIYMGSVHSHEASPLKSAYVTAKHGL
FT                   LGLARVLAKEGAKHNVRSHVVCPGFVRTPLVDKQIPEQAKELGISEEEVIKKVMLGNTV
FT                   DGVFTTVQDVAQTVLFLSAFPSAALTGQSFIVSHGWFMQ"
FT   misc_feature    complement(22953..23459)
FT                   /locus_tag="BCAM0022"
FT                   /note="HMMPfam hit to PF00106, short chain dehydrogenase,
FT                   score 5.9e-30"
FT                   /inference="protein motif:HMMPfam:PF00106"
FT   misc_feature    complement(22965..23051)
FT                   /note="PS00061 Short-chain dehydrogenases/reductases family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00061"
FT   CDS_pept        complement(23530..24270)
FT                   /transl_table=11
FT                   /gene="adc"
FT                   /locus_tag="BCAM0023"
FT                   /product="acetoacetate decarboxylase"
FT                   /EC_number="4.1.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53878"
FT                   /db_xref="GOA:B4EG09"
FT                   /db_xref="InterPro:IPR010451"
FT                   /db_xref="InterPro:IPR023375"
FT                   /db_xref="InterPro:IPR023653"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EG09"
FT                   /protein_id="CAR53878.1"
FT                   /translation="MKPSDVRSKAFAMPLTSPAFPMGPYRFVDREFLIITYRTDPDRLR
FT                   EIVPEPLQVTEPLVHYEFIRMADSTGFGDYTESGQVIPVEYNGQAGGYTLAMYLDDHPP
FT                   IAGGRELWGFPKKLASPTLHVNTDHILGTLDYGKVRVATGTMGYKHKELDIDEQTKRLA
FT                   GPNFLLKIIPHVDGTARVCELVRYYMQDIKMKGAWTGPASLELAPHALAPVADLPVLEI
FT                   VEARHLVADLTLGLGEVVYDYLAQ"
FT   misc_feature    complement(23539..24246)
FT                   /gene="adc"
FT                   /locus_tag="BCAM0023"
FT                   /note="HMMPfam hit to PF06314, Acetoacetate decarboxylase
FT                   (ADC), score 5.2e-159"
FT                   /inference="protein motif:HMMPfam:PF06314"
FT   CDS_pept        24705..25286
FT                   /transl_table=11
FT                   /locus_tag="BCAM0024"
FT                   /product="putative undecaprenyl-diphosphatase"
FT                   /EC_number="3.6.1.27"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0024"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53879"
FT                   /db_xref="GOA:B4EG10"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR033879"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:B4EG10"
FT                   /protein_id="CAR53879.1"
FT                   /translation="MQNLNLALFSAINAGGAPHPGVARLAIFAADWLVYALPAMLLLTW
FT                   IFGARPARHQAIEAGVGVCVALVLAQMLGHVWFSPRPFMAGVGTQLIPHAPDSSFPSDH
FT                   MTFAWSMAVGLLLGGTTRVTGFVMAAMAVAIAWGRVYAGVHWPFDMAGGVLVGTVGALA
FT                   AHLYGQRVTALLERLGDSVHAVVMGRRQAP"
FT   sig_peptide     24705..24773
FT                   /locus_tag="BCAM0024"
FT                   /note="Signal peptide predicted for BCAM0024 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.618) with cleavage site
FT                   probability 0.453 between residues 23 and 24"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(24783..24851,24870..24938,25023..25091,25128..25196)
FT                   /locus_tag="BCAM0024"
FT                   /note="4 probable transmembrane helices predicted for
FT                   BCAM0024 by TMHMM2.0 at aa 27-49, 56-78, 107-129 and
FT                   142-164"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    24867..25223
FT                   /locus_tag="BCAM0024"
FT                   /note="HMMPfam hit to PF01569, PAP2 superfamily, score
FT                   3.6e-19"
FT                   /inference="protein motif:HMMPfam:PF01569"
FT   CDS_pept        complement(25311..25544)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0025"
FT                   /product="putative membrane protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53880"
FT                   /db_xref="GOA:B4EG11"
FT                   /db_xref="UniProtKB/TrEMBL:B4EG11"
FT                   /protein_id="CAR53880.1"
FT                   /translation="MTKESHASPFLRHLKIAGYCGLAAVVLALFVAMCAILKESALDRD
FT                   AARHPADTPELHDAGGSPSASAESARTSGSSG"
FT   misc_feature    complement(25431..25499)
FT                   /locus_tag="BCAM0025"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAM0025 by TMHMM2.0 at aa 37-59"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(25696..26517)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0026"
FT                   /product="putative siderophore-interacting protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53881"
FT                   /db_xref="GOA:B4EG12"
FT                   /db_xref="InterPro:IPR007037"
FT                   /db_xref="InterPro:IPR013113"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="InterPro:IPR039374"
FT                   /db_xref="UniProtKB/TrEMBL:B4EG12"
FT                   /protein_id="CAR53881.1"
FT                   /translation="MQNTSERTVTRVRHPLKFRLLQVLRVHPVTPHLLRVTLGGPDLAD
FT                   FESASFDDHVKIFFPPPGAERPALPTLGANGPEFPAGEPKPVARDFTPRRFDRAARELD
FT                   LEFVLNHPGPASQWAAQARVGQWLGIGGPRGSFVVPTGFDWHLLIGDDTALPAVARRLS
FT                   ELPAGARAAVVLEVADRTAQISFDTRADVHEIWRFRAEADAADGDALLNAVRDLPLPSS
FT                   GDGYVWAAGEALSMRAVRQHLTGERGVDKSRIRAAAYWKRGAAAVHETLED"
FT   misc_feature    complement(25729..26091)
FT                   /locus_tag="BCAM0026"
FT                   /note="HMMPfam hit to PF04954, Siderophore-interacting
FT                   protein, score 9.6e-42"
FT                   /inference="protein motif:HMMPfam:PF04954"
FT   misc_feature    complement(26107..26454)
FT                   /locus_tag="BCAM0026"
FT                   /note="HMMPfam hit to PF08021, Siderophore-interacting
FT                   FAD-binding dom, score 1.9e-55"
FT                   /inference="protein motif:HMMPfam:PF08021"
FT   CDS_pept        complement(26556..27263)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0027"
FT                   /product="PadR family regulatory protein"
FT                   /note="Similar to Rhodopseudomonas palustris
FT                   transcriptional regulator, padr family SWALL:Q6NB15
FT                   (EMBL:BX572596) (196 aa) fasta scores: E(): 1.3e-16, 42.07%
FT                   id in 183 aa; homology does not extend to the N terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53882"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EG13"
FT                   /protein_id="CAR53882.1"
FT                   /translation="MRHNHFRGHARCDGHGAHDHPEGFAGLWYAIGRHRRGHDAFGGGP
FT                   FGGRGGRGFGDFGDDGMPRGRQFSSDDLQLLLLALVAEQPSHGYELIKALDTRSNGFYS
FT                   PSPGMVYPALTYLEEVGFVASQAEGNRKRYALTDAGRAHLDAQRERVDTLFARLTHLAR
FT                   KMEFMRRAFAGESAGNEAQDESQAGWLPEFVEARLALKRALLHKSAADADEQRRIAAIM
FT                   RRATAEIEGGAGA"
FT   misc_feature    complement(26823..27065)
FT                   /locus_tag="BCAM0027"
FT                   /note="HMMPfam hit to PF03551, Transcriptional regulator
FT                   PadR-like family, score 1.5e-28"
FT                   /inference="protein motif:HMMPfam:PF03551"
FT   CDS_pept        28013..29074
FT                   /transl_table=11
FT                   /locus_tag="BCAM0028"
FT                   /product="putative FHA-domain protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53883"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:B4EG14"
FT                   /protein_id="CAR53883.1"
FT                   /translation="MPGSVDASLERSGRIRHGAAMAILKNDASGDACLLRAYHVFGRDD
FT                   ARCDTVIRDGSVSRVHAHIRWVGGLWELHDHSSNGTSVSGVSLRDGEHAVLQQGDVIRF
FT                   GRAGIAPWRVESLDDPADTLWPIRGAAAPIVLAPCQILPAPAAQPVTIVRSPAGEWLCD
FT                   DTLPPRALHDGDEVSTGDFAWRLALARHGSTVMLAAPADPAAPAQLLEFFVSRDEEHVR
FT                   MLLHVRGGVVDLGERAHHYSLVTLARARSADMQAGYDAATQGWIELDRLARMLGIDASH
FT                   VNVQIHRARSQFAALPGLGASQLVERRRGSVRFGDVPFRIMRGEHLECESVPAVGPRLG
FT                   VPRAVPGPVVHCP"
FT   misc_feature    28127..28327
FT                   /locus_tag="BCAM0028"
FT                   /note="HMMPfam hit to PF00498, FHA domain, score 7e-13"
FT                   /inference="protein motif:HMMPfam:PF00498"
FT   misc_feature    28808..28873
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1097.000, SD 2.92 at aa 266-287, sequence
FT                   IELDRLARMLGIDASHVNVQIH"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        29092..33123
FT                   /transl_table=11
FT                   /locus_tag="BCAM0029"
FT                   /product="putative protein kinase"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53884"
FT                   /db_xref="GOA:B4EG15"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR023889"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:B4EG15"
FT                   /protein_id="CAR53884.1"
FT                   /translation="MLPTASHPAVRPDAPEPSKRAAPFATLAGKWHYRLGALLGEGGNG
FT                   VVFRATCDETGHAVALKLMRDDAALVAPERMRRRARFRRETSLCEALRHPNIVALLDQG
FT                   EAPDGRLFAVFELVEGRTVRDRLAADGPLSAIDTGRLMTQVLDALAAAHRRGIVHRDLK
FT                   PQNIVIAMADDGPHAKLLDFGIGALLPGTEDIARQTATLATEVLGSPPYCAPEQLRNEP
FT                   PTPASDLYAWGLIVIECLTGEVVMQGASVAEILYQQLSPVDVALPPSIAALPLGAVLRH
FT                   ALNKNPRQRAASAEALAAQFRALNFAALVGQFDAGRAGRHARSRPLAPRGETIAEVGEY
FT                   RQITTLCCCVTIAGEGRRRHAGTEHGMVLDGYEEQWLTKCADIAVGYGAHVGGRLGDTL
FT                   LFHFGLQGDIDRPARRAVRAALDMVRVAERARLPVPPAAGGRAAAGAEEGWRVEVAAAI
FT                   HVGQVLAQASHMSGVSTPAAASRLLRLAGPGQILISDDARLVLERHADSRPTALRLARA
FT                   GVVSQPVHELLGERHADTPFDSLDAGRRTPMVGRARELDALLRAWQDTHERHRRARRGE
FT                   PAPPGVPRLVIGDAGFGKSRLVHELCEAVRTRGHAFAQCGCLPERENHALFPVLRFIAA
FT                   HWQVDADRAPGAALAAIDAMIAPLDCDHAAARVALATWLGLPCDANGLLWSSAREQHAL
FT                   FDVLEQLIVSLGNGAPVLLVIEDVQWLDRSTEEFLAYLQHSPRAAALCIVLTSRPDKLA
FT                   RWRGATDRVVLRRLPRDDAQRLMSAHLGPGAFDPVWLDRLADRTAGIPLFIEAVARELK
FT                   VSGADGPLAGPAATDPYPLPLSLGGMLGLAFDRIDDARDTAQLAATIGLEVDAQLLADA
FT                   SPHDRVTLDAHLRLLLEERIVYAQHRRDRVFYAFRHALIRDAAYESMPPAVRRGNHARI
FT                   GRALLAQADRGAGAHAFGVAGHFARAGACADAIAHGIDAARRALERSRYDDAIRYGQAV
FT                   LDWLATADHAQREHDRARIRATLTHATMARFGWADAQVREHAEQLLRQTQTLDDPELEI
FT                   SALWTLSTYYHVAGDRATVRRIGKRLDTLATERGEAGVQVAADAMRGMSLWVDGDYARA
FT                   RAAFDAVLAGYDVRRDAGHRRILGLDTRAWTMASLASVRWCMDDDPQPALAMAHEAVYR
FT                   ATCLDHLPTLGVTMMYLARTHQLAGDRDAARAVSEAILRLADAHRLRAVGHYAAIIHAW
FT                   TQRDRAGVVAHLDAQRQSGGLLGLTYYASLLAELDAERGDHDAALAQIGQCLAWCESSG
FT                   ERYYEAQLLLKQSEYLCRADPRCGGVAALDACRRAVEIATTAGMGRIARLAEATLQSLP
FT                   "
FT   misc_feature    29188..29994
FT                   /locus_tag="BCAM0029"
FT                   /note="HMMPfam hit to PF00069, Protein kinase domain, score
FT                   4.1e-45"
FT                   /inference="protein motif:HMMPfam:PF00069"
FT   misc_feature    29206..29277
FT                   /note="PS00107 Protein kinases ATP-binding region
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00107"
FT   misc_feature    29560..29598
FT                   /note="PS00108 Serine/Threonine protein kinases active-site
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00108"
FT   misc_feature    30853..30876
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    32353..32430
FT                   /locus_tag="BCAM0029"
FT                   /note="HMMPfam hit to PF07721, Tetratricopeptide repeat,
FT                   score 0.079"
FT                   /inference="protein motif:HMMPfam:PF07721"
FT   misc_feature    32620..32697
FT                   /locus_tag="BCAM0029"
FT                   /note="HMMPfam hit to PF07721, Tetratricopeptide repeat,
FT                   score 0.024"
FT                   /inference="protein motif:HMMPfam:PF07721"
FT   misc_feature    32839..32916
FT                   /locus_tag="BCAM0029"
FT                   /note="HMMPfam hit to PF07721, Tetratricopeptide repeat,
FT                   score 0.058"
FT                   /inference="protein motif:HMMPfam:PF07721"
FT   CDS_pept        33157..33501
FT                   /transl_table=11
FT                   /locus_tag="BCAM0030"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53885"
FT                   /db_xref="GOA:B4EG16"
FT                   /db_xref="InterPro:IPR022261"
FT                   /db_xref="InterPro:IPR036648"
FT                   /db_xref="UniProtKB/TrEMBL:B4EG16"
FT                   /protein_id="CAR53885.1"
FT                   /translation="MSKDLRLPTYEQFLEYRATVIRAIALAWHSPAFLDKLEADPVHAL
FT                   REQFDYHFPFKLDLKVQLKSSEWTPTVNGDWTAGQKNRLTLYLPPAPADETQFAQALAA
FT                   YNADHITIME"
FT   CDS_pept        33518..33880
FT                   /transl_table=11
FT                   /locus_tag="BCAM0031"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53886"
FT                   /db_xref="GOA:B4EG17"
FT                   /db_xref="InterPro:IPR022261"
FT                   /db_xref="InterPro:IPR036648"
FT                   /db_xref="UniProtKB/TrEMBL:B4EG17"
FT                   /protein_id="CAR53886.1"
FT                   /translation="MAKDNANPTLESMLEFQKVYLRAIALSWRDPAFKTELLDRPLDTL
FT                   AKYFGYQCPWIIDIDIEKTGGDHGWTSDGKGGGSWNLPRNVMTVGIPEQPAHLDEEAVA
FT                   LAAYCDAGPCYLFTCC"
FT   CDS_pept        33974..36214
FT                   /transl_table=11
FT                   /locus_tag="BCAM0032"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Streptomyces galilaeus AknN SWALL:Q9L4V1
FT                   (EMBL:AF264025) (662 aa) fasta scores: E(): 1.3e-37, 35.36%
FT                   id in 673 aa; homology does not extend to termini"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53887"
FT                   /db_xref="InterPro:IPR003776"
FT                   /db_xref="InterPro:IPR022291"
FT                   /db_xref="InterPro:IPR027624"
FT                   /db_xref="UniProtKB/TrEMBL:B4EG18"
FT                   /protein_id="CAR53887.1"
FT                   /translation="MLDDLSRVLRFKPHLLVLDAGPDTLFVVDEFKRAMLSGAIFVRIA
FT                   ACLRARMTIAEIVASLAGTFGEWDVLARLDHLVRRGYVRADPPHGDDAARGYFERAGLD
FT                   GDAACARVAQLRVAVETFGADGAPLRRALDTACIGIAKEAELTVAIVDTHDRDDLAACA
FT                   ARVAARGGALLVVAAGGVQTLIGPLLAGGVDALADAPCVECVRYWIRVNRPVEALLARH
FT                   HGRDAKHVPPAASRAGAAAAAALVAATVEQIAVNRAVAERSQTHIVAQRLDTLTVERHR
FT                   VVRRPQCPCCGHPLWMREQAARAPRLAAPAPLARADGGYRTADPQQVFARHAHLISPVS
FT                   GAIAYLHPMPKRHAGLRKVYASGFLVCPAAVPDSNRFDRLCSGKGRTDEQARTSALCEA
FT                   LERFSSVYQGDEATVTGSIDGLRADPACDAEPIHVNALQQFSERQFDARDAINALTRDV
FT                   RKQVPPRFTSRDVIDWTPAWSLVDGRRRLVPLSYCYAETPDSARAPAACVHNPNGCAAG
FT                   SSLDEAMLQGMLELIERDAVAIWWYNRIERPGIELASFADPYFDALVHEYAAFGWRVWA
FT                   LDITTDLTVPTVAALAENLQDGRFSIGFGCHPDGRIAVQRALTEVNQLLDIAADAPDPW
FT                   DRDMLSSTGFLYPAPGTPATTHSTWQPLDIASLPAAIAHCVGRIAAAGMDVLVVDKTRP
FT                   DIGLSVVQVIAPGLCHFWPRFGARRLYSVPVALGWRARPCDETALNPALLFL"
FT   misc_feature    35012..36103
FT                   /locus_tag="BCAM0032"
FT                   /note="HMMPfam hit to PF02624, YcaO-like family, score
FT                   7.8e-60"
FT                   /inference="protein motif:HMMPfam:PF02624"
FT   CDS_pept        complement(36282..37373)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0033"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53888"
FT                   /db_xref="GOA:B4EG19"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:B4EG19"
FT                   /protein_id="CAR53888.1"
FT                   /translation="MTKKTFLALAVCTLPAAAFAQSSVTMFGLMDAGISYVSNQGGHGA
FT                   AKFDDNIFFPNLLGFEGKEDLGAGTRAIFRLVNQYSLGNGSIIGGGLFARTAYVGLQND
FT                   RYGTLTLGNQYEFMVDALAASGSEIAQDLVGLYGFRNGPFDRLALPNNPTGAFDWDRVA
FT                   GSNRVANSVKYTSPSLSGLTVGALYGFGNVAGSIGANNTVSIGASYDRGPFGAGAAYTN
FT                   QKYGAAGGLPPTSVRNWGAGVHYTVGTVTGKALVTTVHNARNGAGAWSAEAGAAWRPSP
FT                   VWVIGASYTYMKGNDTLDNAHAHQLLAAVQYWLSKRTMVYVAGVHQRASHGSNAQINGV
FT                   MDANGASSGALQSIARVGFSTRF"
FT   misc_feature    complement(37287..37355)
FT                   /locus_tag="BCAM0033"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAM0033 by TMHMM2.0 at aa 7-29"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(37314..37373)
FT                   /locus_tag="BCAM0033"
FT                   /note="Signal peptide predicted for BCAM0033 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.988 between residues 20 and 21"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(37551..38273)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0034"
FT                   /product="putative short-chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0034"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53889"
FT                   /db_xref="GOA:B4EG20"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4EG20"
FT                   /protein_id="CAR53889.1"
FT                   /translation="MNRQWAFDGQSVVVTGGTSGIGARTALRFAQAGASVVALGLDAAG
FT                   PHAPVHDRIRCVELDVADGAALTRTIAGLPRLGALVNGVGISRHADEYRMDQFEHVLNV
FT                   NLTSVMRASDAALPALAATGGSIVNIASMYTYFGSKDRPAYSASKGGIAQLTRSLAQAW
FT                   ADHGIRVNAVAPGWIDTPLSSTLMADTQASRRIVERTPLGRWGTTDEVAEVILFLCSPG
FT                   ASFVTGAVVPVDGGYSTV"
FT   misc_feature    complement(37572..38240)
FT                   /locus_tag="BCAM0034"
FT                   /note="HMMPfam hit to PF01370, NAD dependent
FT                   epimerase/dehydratase family, score 0.00015"
FT                   /inference="protein motif:HMMPfam:PF01370"
FT   misc_feature    complement(37782..38246)
FT                   /locus_tag="BCAM0034"
FT                   /note="HMMPfam hit to PF00106, short chain dehydrogenase,
FT                   score 6.6e-15"
FT                   /inference="protein motif:HMMPfam:PF00106"
FT   misc_feature    complement(37794..37880)
FT                   /note="PS00061 Short-chain dehydrogenases/reductases family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00061"
FT   CDS_pept        complement(38251..39372)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0035"
FT                   /product="putative zinc-binding dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53890"
FT                   /db_xref="GOA:B4EG21"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4EG21"
FT                   /protein_id="CAR53890.1"
FT                   /translation="MRALQWHGPRDVRLVEIDTPHVGPGDVRIAVEYCGICGSDLHEYA
FT                   DGPHAIPVDVPHPLSRRTAPLTLGHEFCGTVVEVGAGVTTLRAGDRVAVEPEYRCSQCA
FT                   YCRAGSYNLCVSMGFAGLMGDGGMADFAVVPAYMLHRLPDGVSLEQAAVMEPAAVALHA
FT                   LRRGELRLGETCAVFGLGPIGLLLIMLAKRQGATTIVAVDVSPERLAAATRFGATHAFD
FT                   ARGLDASALQDAIRATTGGLGVDASFEAAGLQATFESAMRALRKGGRVVMVGLMPHAGF
FT                   DAFRAVNDELTFTASVGYRHAYEDLLRIVASGALDLTSIVTRTVSLEDAVADGFDALLA
FT                   DRTQIKILVSPAQRPARRATTIGSAEHESSVGV"
FT   misc_feature    complement(38437..38862)
FT                   /locus_tag="BCAM0035"
FT                   /note="HMMPfam hit to PF00107, Zinc-binding dehydrogenase,
FT                   score 2.5e-42"
FT                   /inference="protein motif:HMMPfam:PF00107"
FT   misc_feature    complement(38947..39303)
FT                   /locus_tag="BCAM0035"
FT                   /note="HMMPfam hit to PF08240, Alcohol dehydrogenase
FT                   GroES-like domain, score 1.1e-46"
FT                   /inference="protein motif:HMMPfam:PF08240"
FT   misc_feature    complement(39124..39168)
FT                   /note="PS00059 Zinc-containing alcohol dehydrogenases
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00059"
FT   CDS_pept        complement(39374..40678)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0036"
FT                   /product="Major Facilitator Superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53891"
FT                   /db_xref="GOA:B4EG22"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4EG22"
FT                   /protein_id="CAR53891.1"
FT                   /translation="MTSPSSSRPAWTYENRLLLILFMTFGFVFFDRLALSFLFPFMSAE
FT                   LHLTNTQLGMVSSALALTWALSGAATGAWSDARGTRKPLLIAAVLGFSVCSALSGLVGG
FT                   FASLIAFRALMGIAEGPVLPLSQSLMVESSTPSRRGLNMGLLQGSAAGLLGAMIGPPVV
FT                   IGIATAYGWREAFYVSCIPGFLIAFCIWRWVREVPPGGVRHAQADTTAAPAAGGATVSR
FT                   WALLKERNILLCVLISCFFLTWFVVIISFAPVFLVESRHLSPADMGVVMTCLGAAWVFW
FT                   GFAVPAISDRIGRKPTMIAFALIAAVCPVVLIHVGSVWALGALVFVTYTGLGCFTLFMA
FT                   TIPAETVPPRAIASALGLIMGAGELIGGFVAPTVAGFAADKYGLQFAMWTSTTGAILAC
FT                   VLSFGLVETAPAVLRKRALAGAAAGRLDTQNLGGR"
FT   misc_feature    complement(39419..40624)
FT                   /locus_tag="BCAM0036"
FT                   /note="HMMPfam hit to PF00083, Sugar (and other)
FT                   transporter, score 8.4e-05"
FT                   /inference="protein motif:HMMPfam:PF00083"
FT   misc_feature    complement(join(39461..39529,39557..39625,39659..39727,
FT                   39740..39793,39812..39880,39923..39991,40097..40156,
FT                   40169..40237,40361..40429,40457..40516,40553..40621))
FT                   /locus_tag="BCAM0036"
FT                   /note="11 probable transmembrane helices predicted for
FT                   BCAM0036 by TMHMM2.0 at aa 20-42, 55-74, 84-106, 148-170,
FT                   175-194, 230-252, 267-289, 296-313, 318-340, 352-374 and
FT                   384-406"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(39482..39514)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    complement(39539..40618)
FT                   /locus_tag="BCAM0036"
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 5.9e-55"
FT                   /inference="protein motif:HMMPfam:PF07690"
FT   misc_feature    complement(39677..39709)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    complement(40262..40339)
FT                   /note="PS00217 Sugar transport proteins signature 2."
FT                   /inference="protein motif:Prosite:PS00217"
FT   sig_peptide     complement(40496..40678)
FT                   /locus_tag="BCAM0036"
FT                   /note="Signal peptide predicted for BCAM0036 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.880) with cleavage site
FT                   probability 0.692 between residues 61 and 62"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(40697..41230)
FT                   /transl_table=11
FT                   /gene="dad"
FT                   /locus_tag="BCAM0037"
FT                   /product="2,4'-dihydroxyacetophenone dioxygenase"
FT                   /EC_number="1.13.11.41"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0037"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53892"
FT                   /db_xref="GOA:B4EG23"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B4EG23"
FT                   /protein_id="CAR53892.1"
FT                   /translation="MVDKAVSEFWQNIPAIANPFKPDALPEAYIPNAATDDERYYVPFT
FT                   ETVSSRPLWISPSQNKWCDILMAKEAGLVNRHYHPHEVFAYTLSGKWGYLEHEWTATRG
FT                   DFVYETPGEGHTLVAFDHPEPMRAFFIVKGPLIWLDDEGNPDGYFDVHSYIAMCKAHYE
FT                   KVGLGAQAIEKLFR"
FT   misc_feature    complement(40835..41044)
FT                   /gene="dad"
FT                   /locus_tag="BCAM0037"
FT                   /note="HMMPfam hit to PF07883, Cupin domain, score 2.4e-05"
FT                   /inference="protein motif:HMMPfam:PF07883"
FT   CDS_pept        41410..42390
FT                   /transl_table=11
FT                   /locus_tag="BCAM0038"
FT                   /product="AraC family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0038"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53893"
FT                   /db_xref="GOA:B4EG24"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:B4EG24"
FT                   /protein_id="CAR53893.1"
FT                   /translation="MTNSTVFSRTRGSTADVPARDRMAYWDAFNAATLVGLRCSSLSPA
FT                   GLEVEKTDIALPGLGIADISGQDHVIERSPALVRQLPKESLFACQILSGRAYFIQRDRC
FT                   LLAEAGDVVVYDTRVPYLFGFLTPMRQLLIDIPITTLDDRLDAELAALPLRIAPKPGAG
FT                   AMLGATLRASVERFMKAPVERDAARFAEHTRTLIAALVDAEVNGVGASRASLSYLLTAK
FT                   QYIATHLGEPELGPQAVADAVGLSLRHLGRLFAAEGESITQHIWSERLSHAHRELTDAR
FT                   LRKTSIGEIAFRWGFSSQAHFSRAIRERYGASPMALRDAARDAAG"
FT   misc_feature    42109..42174
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1307.000, SD 3.64 at aa 234-255, sequence
FT                   LGPQAVADAVGLSLRHLGRLFA"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    42214..42351
FT                   /note="PS00041 Bacterial regulatory proteins, araC family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00041"
FT   misc_feature    42223..42366
FT                   /locus_tag="BCAM0038"
FT                   /note="HMMPfam hit to PF00165, Bacterial regulatory
FT                   helix-turn-helix protei, score 3.9e-08"
FT                   /inference="protein motif:HMMPfam:PF00165"
FT   CDS_pept        complement(42486..44051)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0039"
FT                   /product="putative alcohol dehydrogenase"
FT                   /note="Similar to Pseudomonas oleovorans alcohol
FT                   dehydrogenase [acceptor] alkJ SWALL:ALKJ_PSEOL
FT                   (SWALL:Q00593) (558 aa) fasta scores: E(): 1.4e-76, 41.69%
FT                   id in 530 aa; contains C terminal 30 amino acid truncation"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53894"
FT                   /db_xref="GOA:B4EG25"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B4EG25"
FT                   /protein_id="CAR53894.1"
FT                   /translation="METYDHIVVGGGSAGCTVAHRLVKAGRRVLLLEDGPKDDSLFIRI
FT                   PATFIRVLGTQRTVTFESEPQPGAAGRKTYVPQGRTLGGGSSVNAMLYVRGTRDDYDDW
FT                   AALGCTGWGWDDVLPVFKRAESHLRLSEPFHGTDGPLKVGDTRFRHPLSLAFVKAAQEA
FT                   GIAYNDDFNGAAQHGVGFYHTTIFDGQRGSTAATYLADAIADPNLRVLTGCRVTRIRFD
FT                   GRRASGVEWRTASGATGAAVARADVVLAAGALSTPKLLMLSGIGPGAHLHAHGIDVLHD
FT                   SRDVGAHYQDHLEVSIYGRTQAPVSLLGEDRGWRALRHGLQWMLCRSGLLTSNVVESGA
FT                   FVDTTGGGRPDIQFHVLPTLVGDVDRAPLPGHGLSINPCLLRPRSRGAVQLRGNDPAAP
FT                   ILFDSGALSDPADVEGLVRGVRLARQILRAPSLARLVREAETLTDAALADYVRRRAKTV
FT                   YHPAGTCRMGSDAHAVVTPRLAVQGVDGLRICDASVMPRIVSGNTNAPTIMIAERCAAF
FT                   MLTA"
FT   misc_feature    complement(42510..42926)
FT                   /locus_tag="BCAM0039"
FT                   /note="HMMPfam hit to PF05199, GMC oxidoreductase, score
FT                   1.2e-43"
FT                   /inference="protein motif:HMMPfam:PF05199"
FT   misc_feature    complement(42984..44039)
FT                   /locus_tag="BCAM0039"
FT                   /note="HMMPfam hit to PF01266, FAD dependent
FT                   oxidoreductase, score 0.00025"
FT                   /inference="protein motif:HMMPfam:PF01266"
FT   misc_feature    complement(43131..44042)
FT                   /locus_tag="BCAM0039"
FT                   /note="HMMPfam hit to PF00732, GMC oxidoreductase, score
FT                   5.2e-90"
FT                   /inference="protein motif:HMMPfam:PF00732"
FT   misc_feature    complement(43254..43298)
FT                   /note="PS00624 GMC oxidoreductases signature 2."
FT                   /inference="protein motif:Prosite:PS00624"
FT   misc_feature    complement(43470..43517)
FT                   /note="PS00225 Crystallins beta and gamma 'Greek key' motif
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00225"
FT   misc_feature    complement(43746..43817)
FT                   /note="PS00623 GMC oxidoreductases signature 1."
FT                   /inference="protein motif:Prosite:PS00623"
FT   misc_feature    complement(44004..44036)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(44210..45178)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0040"
FT                   /product="AraC family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53895"
FT                   /db_xref="GOA:B4EG26"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:B4EG26"
FT                   /protein_id="CAR53895.1"
FT                   /translation="MPDTSTEIATISTRAVRGAERVDFWVDHVARTLVRIECSGKSSEG
FT                   IDASLRKRDLGLFRACDIVANRHAVVRTSHNIHADQRDAVFICLMHEGHGYTFQDVDCM
FT                   QHGPGDLVLYDTSMPYGHGFPADMAMTVLDVPRDVFEARVGPWRYRSLVKIDRDDGVAS
FT                   WAVRQVVALLAAPQEPTPDARERRAAAILELVQSMLRLRDGDASPTKSTVHTLSRAKAF
FT                   IDSHLADDDLDSRSVSRAINLSPRQLARVFEIEGTPLTRYILARRLERCRADLRDRSLK
FT                   HLTVSEIAFRWGFNNSAHFSRSYRARFGETPSDTRAPADTR"
FT   misc_feature    complement(44228..44371)
FT                   /locus_tag="BCAM0040"
FT                   /note="HMMPfam hit to PF00165, Bacterial regulatory
FT                   helix-turn-helix protei, score 3e-06"
FT                   /inference="protein motif:HMMPfam:PF00165"
FT   misc_feature    complement(44420..44485)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1078.000, SD 2.86 at aa 232-253, sequence
FT                   LDSRSVSRAINLSPRQLARVFE"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        complement(45382..46185)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0041"
FT                   /product="putative lipoprotein"
FT                   /note="Similar to Erwinia carotovora putative exported
FT                   protein SWALL:Q6D2K7 (EMBL:BX950851) (253 aa) fasta scores:
FT                   E(): 2.1e-21, 37.61% id in 218 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53896"
FT                   /db_xref="UniProtKB/TrEMBL:B4EG27"
FT                   /protein_id="CAR53896.1"
FT                   /translation="MIHLARRSRAARHVRPLATTIAALLACAPAVSFAGWYEIANYTGT
FT                   IGNAPVHVSLQTYDAINHNDAGRWRVDGSYYYDAHRKPIPLRGQREPDGRLTLCEASSP
FT                   ASNADAPVVPAASPSRPKPCPIALTVSGKAATGTWDDGRKTLPITLNEVGRLNDTDDPH
FT                   PQLDGSVDIPMWYRTKTHMLVGVYALSDKCGVAMQSLRAVNIATGRVDRTIALDCDAGM
FT                   VMTSIYANVTGAHWADHVSVEFRDGKMGYAEDVSLGLPSSSSKPK"
FT   misc_feature    complement(46066..46125)
FT                   /locus_tag="BCAM0041"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAM0041 by TMHMM2.0 at aa 21-40"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(46084..46185)
FT                   /locus_tag="BCAM0041"
FT                   /note="Signal peptide predicted for BCAM0041 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.908 between residues 34 and 35"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(46105..46137)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(46349..47296)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0042"
FT                   /product="putative aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53897"
FT                   /db_xref="GOA:B4EG28"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B4EG28"
FT                   /protein_id="CAR53897.1"
FT                   /translation="MAHRTLGTSGIQVSPLAFGGNVFGWTVDENASFALLDALADTGIN
FT                   FIDTADVYSAWVPGNHGGESETIIGKWLKRSGKREQVVIATKVGLLDARAGLSKDNILK
FT                   AVDDSLRRLQTDYIDLYFSHRDLVDTAPLEETLGAYQTLIDAGKVRIIGASNYSGARLR
FT                   EAAAISARDGLPAYQVIQPEYNLLDRADYERDLEPVVRDLKLGVVNYYALASGFLSGKY
FT                   RSEADLKKSVRGDRVAGYLNARGLRILAALDAVSAKHNTQPAAIALAWQIARPTITAPI
FT                   ASATSLAQLALLGEAIRVTLDQDDIRRIDEASAP"
FT   misc_feature    complement(46355..47278)
FT                   /locus_tag="BCAM0042"
FT                   /note="HMMPfam hit to PF00248, Aldo/keto reductase family,
FT                   score 2.6e-51"
FT                   /inference="protein motif:HMMPfam:PF00248"
FT   CDS_pept        47652..50156
FT                   /transl_table=11
FT                   /locus_tag="BCAM0043"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Ralstonia solanacearum putative
FT                   vgr-related protein rs03020 SWALL:Q8XTK5 (EMBL:AL646076)
FT                   (885 aa) fasta scores: E(): 6.7e-86, 51.59% id in 814 aa;
FT                   homology does not extend to C terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53898"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR018769"
FT                   /db_xref="InterPro:IPR028244"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:B4EG29"
FT                   /protein_id="CAR53898.1"
FT                   /translation="MADLAAFIRTPFFLQDKRLLALSFPHDDAPSVTDAYGRQRPARLV
FT                   AERLVAHEGLGIDFTFDVTLLSSEAGITLADMLGKLLAVSMVRPDGGLRYFTGYCTAFS
FT                   LVRNDDSIAEYRAVLRPWSHFLRTRVNNRLFLGQSLQQQIGTLLADYQGLAPSWEWRVR
FT                   GDDPARTMNVQGGGLGESDWNYIVRHLEAVGFLYWWEHDEKGLKLIVGDDSTVQCPAVD
FT                   GRSPVIRFQTHDGPMAADAISQWSAVRSLSAGSYSATAFDFKAPHAAHAQIPTLHPPGV
FT                   APQVEHHEYVGHYGFAKQTRAGDALARVRMEEIEAAATRFDAAGNHHGILPGRWFQLSD
FT                   HFSAASGSPQDHEYLILEARHEAANNYLQADGKPEYRNRFVAGHRRTPWRPGRGFNSEP
FT                   VRVLAPQTATVAGAKGAGSVDVDEYGRVCIVYHWDRAAQISARIRVAAGWAGGEKGMIA
FT                   HPRVGSEVLVMCLDGNPDRPVVSGTTYNAERMPPWALPDQHVLTGLRSRELSGDSGNAA
FT                   GGRSNHVLLDDTPQQLQLKLRSDTDASELTLGHNVRIDATQGRTDQRARGFELRTDAHG
FT                   AVRAAKGLLVTSEARYDARAHATDIGETVARLDKAHDLHESLSGSAHDVKAQESGDQDA
FT                   VHQALRTQNDGLRGSGGNPQQGEFPEFAQPFLALASPAGILATTTGSTHVASDQHVALT
FT                   SGAHTSIGAGKSMLVSAQQAVRVAAFEKGIRLVAAAADIDIQALKDSINVLAKLDVKVD
FT                   ANRITITAKEEVLINGGTSYTRWNGSGIVHGTKGEFTAHAASHTFIGPDSLPVPARAFP
FT                   GTACAPCMVNAASMASPFAAKA"
FT   misc_feature    48864..49091
FT                   /locus_tag="BCAM0043"
FT                   /note="HMMPfam hit to PF04524, Protein of unknown function,
FT                   DUF586, score 4.8e-21"
FT                   /inference="protein motif:HMMPfam:PF04524"
FT   CDS_pept        50170..51072
FT                   /transl_table=11
FT                   /locus_tag="BCAM0044"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53899"
FT                   /db_xref="InterPro:IPR025391"
FT                   /db_xref="UniProtKB/TrEMBL:B4EG30"
FT                   /protein_id="CAR53899.1"
FT                   /translation="MTNDPTAAQAADALQAALSSQDGLRAYVLIDGALLDTLPDDEKAS
FT                   WPAFVAASLLDDADDEARIVGPLLFEWQPGADGADAADAIEARSIPWPAASVLVSPLSL
FT                   ARLAAHLAPMVDVQLEQMESVMLMRFFDPRVLPFWLDMLPAAHRAYLAQGVRHWIHRDT
FT                   ALQLRTADIAAPADVRQAAEFPLQLTQAEEDELLAACYPYTMLERLRVEKPGLLASLPA
FT                   ARHYDFVRDQLARCRAHGADSAASLLIYCELALRYGARFDEDPAMAAVFDAVAQGQAFP
FT                   EALARVPAEDWRRMQEAAA"
FT   CDS_pept        51129..51806
FT                   /transl_table=11
FT                   /locus_tag="BCAM0045"
FT                   /product="putative lipoprotein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53900"
FT                   /db_xref="UniProtKB/TrEMBL:B4EG31"
FT                   /protein_id="CAR53900.1"
FT                   /translation="MNRCWITLLSVMVFSTAACSKSVNDAEKDSLAPGEVNKWNDPNYD
FT                   VITAGSFNYTDYDIYGVYLLPPDKNSLDDAASADGAHATPRNAKYWSGGGGSRPSLAWD
FT                   FRWKTPKTFKVWWERVVDKRAMEASSANYDPYTHRETQPGMAWCEGEITVTRPPVKDKS
FT                   GGIVLHFFPDGRVEGDMDFEVDGPDPKVALSKRDAQHKLADRACLKEIPNPFYGRKKPA
FT                   QWN"
FT   sig_peptide     51129..51188
FT                   /locus_tag="BCAM0045"
FT                   /note="Signal peptide predicted for BCAM0045 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.988) with cleavage site
FT                   probability 0.600 between residues 20 and 21"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    51153..51185
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        51843..53576
FT                   /transl_table=11
FT                   /locus_tag="BCAM0046"
FT                   /product="hypothetical protein"
FT                   /note="Weakly similar to Chromobacterium violaceum
FT                   hypothetical protein SWALL:Q7P249 (EMBL:AE016910) (512 aa)
FT                   fasta scores: E(): 2.5e-11, 30.85% id in 512 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0046"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53901"
FT                   /db_xref="InterPro:IPR018712"
FT                   /db_xref="UniProtKB/TrEMBL:B4EG32"
FT                   /protein_id="CAR53901.1"
FT                   /translation="MSNPPLIRRITDITPVEDSIRHAHREALDPLRVEQCKECPKPVWF
FT                   TAFFDGTGNNYGEDGNGSTDVARTKYSNIAKLAMFAHVPFNKANPRTMGRYVEGVGTPC
FT                   SKVGDSGKGLDGVLGMAAASKGEARIRWMLRELEKHVTNHMPAVSQINVAAFGFSRGAT
FT                   EARAFVRMLTEQLAENIGGRLWWNKKNMKGMRPEVVVYFMGILDTVASTGFGGSRLEKA
FT                   APYIVGAILGPVYGGVLHGIDKGGHAEWANDIRIPDYVRQCVHYVASHEVREKFPGDSV
FT                   REDQKLPANCREVYYPGMHSDVGGGYERNYQEGRTNELANVALNNLFIEAWKAGVPFRE
FT                   PKDVMETAGGLFAISRELEAAWNVYMGQGNERRAGVASNSDRLESQIIWHMNRYYQWRA
FT                   SRSRRLHDGRLKPPGGVDPHMAITDGEWNEDADAVRRANGGILTRTISEQYKAIDAATR
FT                   VTGNWLGGIDPAARATFDRFFDHYVHDSIAGFKKQMEDGYAGFAEASRWSVNRQYFMGK
FT                   RGKKFLYWRYEGDKAEQAATQLAKADPAKQQDPMAANEPQLASNQPAAVGGTLPDATST
FT                   A"
FT   CDS_pept        complement(53657..54277)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0047"
FT                   /product="putative transporter-LysE family"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53902"
FT                   /db_xref="GOA:B4EG33"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B4EG33"
FT                   /protein_id="CAR53902.1"
FT                   /translation="MNWLAFSHGAALCASLIVTIGAQNAFVLRQGIMRSHVGKIVLLCA
FT                   VSDMILIGAGVGGASVLVERYPTFVHAVLYVGLAYLAWFGINALRRAFKPGHDTLDVRG
FT                   DAVAPPPQSALAIVLMTLAFTWLNPHVYLDTFLLIGTAGAREPEGGRLAFAIGAMTASV
FT                   VWFLGLGYGARLLAPWFRKAVAWRVLDGAIGSMVLFLAAVQLR"
FT   misc_feature    complement(join(53663..53731,53750..53818,53846..53914,
FT                   54011..54079,54092..54160,54197..54265))
FT                   /locus_tag="BCAM0047"
FT                   /note="6 probable transmembrane helices predicted for
FT                   BCAM0047 by TMHMM2.0 at aa 5-27, 40-62, 67-89, 122-144,
FT                   154-176 and 183-205"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(53663..54238)
FT                   /locus_tag="BCAM0047"
FT                   /note="HMMPfam hit to PF01810, LysE type translocator,
FT                   score 4.1e-44"
FT                   /inference="protein motif:HMMPfam:PF01810"
FT   sig_peptide     complement(54197..54277)
FT                   /locus_tag="BCAM0047"
FT                   /note="Signal peptide predicted for BCAM0047 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.930) with cleavage site
FT                   probability 0.410 between residues 27 and 28"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        54388..55281
FT                   /transl_table=11
FT                   /locus_tag="BCAM0048"
FT                   /product="LysR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53903"
FT                   /db_xref="GOA:B4EG34"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017685"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EG34"
FT                   /protein_id="CAR53903.1"
FT                   /translation="MLDYALLDALAAVIRHGSFERAAKELNVTPSAVSQRVKLLEERVG
FT                   SVLVKRGQPCVATTSGALLCRHTERVQLLEAELGGRMPALPGQIASAWPTLRVAVNDDS
FT                   VATWFIDAVGPFCTERETLLDLVIDDQDYTASRIRDGSVQGAVTAQAEPIQGCRSERLG
FT                   RIRYRAVCSPAFYARYFDAGITRDALRRAPCVMFNPKDGLQARFIRRVTRADLDPPQHW
FT                   IPHVAGYLRACETGLGWGMCPDRMVDRQLAAGELIDMSRGRTIDIDLYWQSWRLSIGWL
FT                   DDFSAALKARAALFLD"
FT   misc_feature    54397..54576
FT                   /locus_tag="BCAM0048"
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix, score 1.5e-14"
FT                   /inference="protein motif:HMMPfam:PF00126"
FT   misc_feature    54436..54501
FT                   /note="Predicted helix-turn-helix motif with score
FT                   2002.000, SD 6.01 at aa 17-38, sequence
FT                   GSFERAAKELNVTPSAVSQRVK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    54439..54531
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00044"
FT   misc_feature    54529..54564
FT                   /note="PS00070 Aldehyde dehydrogenases cysteine active
FT                   site."
FT                   /inference="protein motif:Prosite:PS00070"
FT   misc_feature    54652..55266
FT                   /locus_tag="BCAM0048"
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 9.1e-09"
FT                   /inference="protein motif:HMMPfam:PF03466"
FT   CDS_pept        complement(55330..56076)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0049"
FT                   /product="CRP family regulatory protein"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   Escherichia coli O157:H7, and Shigella flexneri fumarate
FT                   and nitrate reduction regulatory protein fnR
FT                   SWALL:FNR_ECOLI (SWALL:P03019) (250 aa) fasta scores: E():
FT                   4.2e-35, 42.92% id in 226 aa; homology does not extend to N
FT                   terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53904"
FT                   /db_xref="GOA:B4EG35"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EG35"
FT                   /protein_id="CAR53904.1"
FT                   /translation="MLTPVATRPAATPHAGSWAPRQAAHCSSCAMRHLCMPQGLAPEAL
FT                   SRLESVICAARPVKRGEALFREGDAFDNLYAVRSGSLKTVATRHDGREQVTGLHLAGEA
FT                   LGLDGICDDTHPRTAVALEDSSVCVIPYSALKTLCSEAGSMQLRMHKLMSEQIVRETSQ
FT                   TMLLGSLNAEERVAAFLLDVSSRYLKRGYSPSEFNLRMTREDIGSYLGMTLETVSRTLS
FT                   KFQKRGLIEMQGRHVQIIDFDGLQHL"
FT   misc_feature    complement(55387..55482)
FT                   /locus_tag="BCAM0049"
FT                   /note="HMMPfam hit to PF00325, Bacterial regulatory
FT                   proteins, crp famil, score 8.8e-15"
FT                   /inference="protein motif:HMMPfam:PF00325"
FT   misc_feature    complement(55405..55476)
FT                   /note="PS00042 Bacterial regulatory proteins, crp family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00042"
FT   misc_feature    complement(55411..55476)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1625.000, SD 4.72 at aa 201-222, sequence
FT                   MTREDIGSYLGMTLETVSRTLS"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    complement(55645..55914)
FT                   /locus_tag="BCAM0049"
FT                   /note="HMMPfam hit to PF00027, Cyclic nucleotide-binding
FT                   domain, score 4.9e-21"
FT                   /inference="protein motif:HMMPfam:PF00027"
FT   CDS_pept        complement(56180..56647)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0050"
FT                   /product="universal stress-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53905"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B4EG36"
FT                   /protein_id="CAR53905.1"
FT                   /translation="MYKRILVAVDGSDTSRHAFDAALALAKAHGAELQPFYVVENAAIY
FT                   YNVPGYDPSVLRDQLVAQGNTLAQDFAKRMQAAGVKGETRLNEATSLNDVSSLILDGAK
FT                   AFGADLLVLGTHGRRGFRRLVLGSIAEQCVRHATLPVLLIPAAANADEPAA"
FT   misc_feature    complement(56213..56647)
FT                   /locus_tag="BCAM0050"
FT                   /note="HMMPfam hit to PF00582, Universal stress protein
FT                   family, score 8.1e-24"
FT                   /inference="protein motif:HMMPfam:PF00582"
FT   CDS_pept        complement(57156..57563)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0050a"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0050a"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53906"
FT                   /db_xref="InterPro:IPR021551"
FT                   /db_xref="UniProtKB/TrEMBL:B4EG37"
FT                   /protein_id="CAR53906.1"
FT                   /translation="MESSAQTGRAHPRSVELDNDDTHDSTVDTDGKHREASRLAGAGPI
FT                   SPDQITRSNASLVNAMPEAGDGFAGFDSRPDGNHPAFALRAGYRVIEKGFDTPPADDAP
FT                   FGPVHRMYGSAYWPGHGRRPERVIELTAVPG"
FT   CDS_pept        57842..58075
FT                   /transl_table=11
FT                   /locus_tag="BCAM0052"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53907"
FT                   /db_xref="UniProtKB/TrEMBL:B4EG38"
FT                   /protein_id="CAR53907.1"
FT                   /translation="MQATTAFTHRGYLLNCAPARASDGSFKPYVVISRSSDGELVANRF
FT                   FPIELQFNDEGDAIAHARDWAVRWIDASSISM"
FT   CDS_pept        58213..59133
FT                   /transl_table=11
FT                   /gene="srpH"
FT                   /locus_tag="BCAM0053"
FT                   /product="serine acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53908"
FT                   /db_xref="GOA:B4EG39"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:B4EG39"
FT                   /protein_id="CAR53908.1"
FT                   /translation="MSTSPARQWGLEEIVAGLRESREELHRTRHPRGIRELPSRDAICK
FT                   IVTGLRASMFPTHYGAPDLTDESVDYYVGHTLESTLRILSEQIRRALPFLPEHVDTPFA
FT                   ELDERAFEIAREFGRQLPAIRALLVSDIQAAYAGDPAAQHITEILLCYPGVLAMMHHRL
FT                   AHALHQLGVPLLARFINEIAHSATGIDIHPGAQIGPSFFIDHGTGVVIGETAIIGERVR
FT                   VYQAVTLGAKSFPADGDGALVKGNARHPIVEDDVVIYAGATILGRVTIGRGSVIGGNVW
FT                   LTHSVPPGTSVAQGKVREGGSAEKP"
FT   misc_feature    58834..58887
FT                   /gene="srpH"
FT                   /locus_tag="BCAM0053"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (three rep, score 0.52"
FT                   /inference="protein motif:HMMPfam:PF00132"
FT   misc_feature    58957..59010
FT                   /gene="srpH"
FT                   /locus_tag="BCAM0053"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (three rep, score 11"
FT                   /inference="protein motif:HMMPfam:PF00132"
FT   misc_feature    59011..59064
FT                   /gene="srpH"
FT                   /locus_tag="BCAM0053"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (three rep, score 8.6"
FT                   /inference="protein motif:HMMPfam:PF00132"
FT   CDS_pept        complement(59296..60099)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0054"
FT                   /product="putative short-chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0054"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53909"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4EG40"
FT                   /protein_id="CAR53909.1"
FT                   /translation="MEQTKQTAHAPVVLVTGAARRAGRAFAEYFAAHGYRTAVHYDRSA
FT                   DAAQAAARAIAERGHDSVALQADLSDAAQITTLIDQVYARFGRLDVLVNNASVFWQDHF
FT                   PSFDLAAFDQAWAVNCRAPILLTRAFYERARAAGTQGVVVNVVDQKIKENFHRDHFSYT
FT                   VAKAALGNLTQMLALSSAPVLRVNAVFPGLMLPSDDQTQADFEHASRASTPLARIAGPD
FT                   DVASAILLLTGNAYNGVDFVVDAGQNLIRVDQDVLYKHRSPDGKH"
FT   misc_feature    complement(59557..60069)
FT                   /locus_tag="BCAM0054"
FT                   /note="HMMPfam hit to PF00106, short chain dehydrogenase,
FT                   score 1e-07"
FT                   /inference="protein motif:HMMPfam:PF00106"
FT   CDS_pept        complement(60099..60734)
FT                   /transl_table=11
FT                   /gene="folE"
FT                   /locus_tag="BCAM0055"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0055"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53910"
FT                   /db_xref="GOA:B4EG41"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:B4EG41"
FT                   /protein_id="CAR53910.1"
FT                   /translation="MGKGKKSARPEAVASRPSREEAEDAVRVLLRWAGDDPAREGLLDT
FT                   PARVVRAYEQFFAGYALDPRDILARTFSEVDGYDEMIVLKDIRFESYCEHHMVPIIGRA
FT                   HVAYLPNHRVVGISKLARLVDAFAKRLQIQEKMTVQIADTLFDVLQPKGVGVILEAAHQ
FT                   CISTRGVHKPGVEMVTSRMLGTFRTDPSTRREFLSIVANPSSVNLTNT"
FT   misc_feature    complement(60183..60497)
FT                   /gene="folE"
FT                   /locus_tag="BCAM0055"
FT                   /note="HMMPfam hit to PF01227, GTP cyclohydrolase I, score
FT                   5.1e-44"
FT                   /inference="protein motif:HMMPfam:PF01227"
FT   misc_feature    complement(60447..60497)
FT                   /note="PS00859 GTP cyclohydrolase I signature 1."
FT                   /inference="protein motif:Prosite:PS00859"
FT   CDS_pept        complement(60830..61756)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0056"
FT                   /product="LysR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53911"
FT                   /db_xref="GOA:B4EGI0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGI0"
FT                   /protein_id="CAR53911.1"
FT                   /translation="MDALDLNLIPYLVALDDARNVSRAGDLLGVSQPRVSTALGRLREY
FT                   FGDPLFVRTSRGMEPTPRALALLPAARDALAQIERGLVAPHDFDPAASTHTFSIALSDV
FT                   GEIVFLPKLLQAFATHAPHANLRSVSLAHDEVGRGLEAGSIDLAVGYFPDLDGNNFFQQ
FT                   RLFTHRFVCLMRRGHPFEQTPPFTVEQFLACGHAVVRAEGRSQEVLEKYLAKQRMQRRA
FT                   VLETPHFMSLPFILSRTDLIATVPHAIGYAYAAEHAFIVPVEPPLALPRFDLKQHWHRK
FT                   YHNDPRTAWLRGVVASLFNDEQDEWPK"
FT   misc_feature    complement(60857..61489)
FT                   /locus_tag="BCAM0056"
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 3.5e-23"
FT                   /inference="protein motif:HMMPfam:PF03466"
FT   misc_feature    complement(61562..61741)
FT                   /locus_tag="BCAM0056"
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix, score 1.4e-18"
FT                   /inference="protein motif:HMMPfam:PF00126"
FT   misc_feature    complement(61637..61702)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1285.000, SD 3.56 at aa 19-40, sequence
FT                   RNVSRAGDLLGVSQPRVSTALG"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        61873..63105
FT                   /transl_table=11
FT                   /gene="pobA"
FT                   /gene_synonym="pobB"
FT                   /gene_synonym="phbH"
FT                   /locus_tag="BCAM0057"
FT                   /product="p-hydroxybenzoate hydroxylase"
FT                   /EC_number="1.14.13.2"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53912"
FT                   /db_xref="GOA:B4EGI1"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR012733"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGI1"
FT                   /protein_id="CAR53912.1"
FT                   /translation="MRTQVAIIGAGPSGLLLSHLLRLQGVDSILVEARSREYCENRIRA
FT                   GVLEQGTVDTLNEAGLGDRMRREGLEHHGIELLFDGQRHRIDLSELTGGRAITVYSQHE
FT                   VVRDLIAAGVEHGHQMHFEVSDVALHDVESERPFVTFKHADGRADRIDCDYIAGCDGFH
FT                   GIARQTIPADRLNTFERVYPFAWLGILADAAPSLDELVYAHHDNGFALFSMRSPTVTRL
FT                   YLQCKPDEDLAEWSDARIWDELHTRFSNDTGWTPTEGRITQKSVTPMRSFVSETMQHGR
FT                   LFLAGDAAHIVPPTGAKGMNLAVADVRALSRALGARYRTGDATPLERYSATCLERVWRA
FT                   EHFSYFMTNMLHASPDDSPFVNRLKFAELKYVTRSRAAAQSLAENYVGLPFDDATASEA
FT                   TRLDNALCATL"
FT   misc_feature    61876..62904
FT                   /gene="pobA"
FT                   /locus_tag="BCAM0057"
FT                   /note="HMMPfam hit to PF01494, FAD binding domain, score
FT                   5.7e-108"
FT                   /inference="protein motif:HMMPfam:PF01494"
FT   CDS_pept        63250..63966
FT                   /transl_table=11
FT                   /gene="pcaI"
FT                   /locus_tag="BCAM0058"
FT                   /product="3-oxoadipate CoA-transferase subunit A"
FT                   /EC_number="2.8.3.6"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53913"
FT                   /db_xref="GOA:B4EGI2"
FT                   /db_xref="InterPro:IPR004163"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGI2"
FT                   /protein_id="CAR53913.1"
FT                   /translation="MVNKIFESLQSAVADVHDGATIMIGGFGTAGMPSELIDALIEQGA
FT                   RDLTIVNNNAGNGETGLAALLKAKKVRKIICSFPRQSDSQVFDALYRAGEIELELVPQG
FT                   NLAERIRAAGAGIGGFFTPTGYGTKLAEGKETRVIDGKPYVFETPIHADFALVKAYKGD
FT                   RWGNLVYRKTARNFGPIMASAAKVAIVQVSEVVPLGALNPEHIVTPGIFVQRIVEVPQA
FT                   AHAAELAAEHAASQAA"
FT   misc_feature    63265..63906
FT                   /gene="pcaI"
FT                   /locus_tag="BCAM0058"
FT                   /note="HMMPfam hit to PF01144, Coenzyme A transferase,
FT                   score 1.1e-93"
FT                   /inference="protein motif:HMMPfam:PF01144"
FT   misc_feature    63301..63348
FT                   /note="PS01273 CoA transferases signature 1."
FT                   /inference="protein motif:Prosite:PS01273"
FT   CDS_pept        63986..64642
FT                   /transl_table=11
FT                   /gene="pcaJ"
FT                   /locus_tag="BCAM0059"
FT                   /product="3-oxoadipate CoA-transferase subunit B"
FT                   /EC_number="2.8.3.6"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0059"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53914"
FT                   /db_xref="GOA:B4EGI3"
FT                   /db_xref="InterPro:IPR004164"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGI3"
FT                   /protein_id="CAR53914.1"
FT                   /translation="MKRLTRDEMAKRVAQDIPEGAYVNLGIGVPTLVANHLDPSKEIFL
FT                   HSENGLLGMGPAPAPGEEDDELINAGKQHVTLLTGGAYFHHSDSFAMMRGGHLDYCVLG
FT                   AFQVSANGDLANWHTGAPDAIPAVGGAMDLAIGAKQVFVMMEHLTKQGESKIVAQCSYP
FT                   VTGVQCVSRIYTDLAVLDVTADGLAVSEIFTDLSFDELQKLTGVPLIDATQKAAA"
FT   misc_feature    64001..64597
FT                   /gene="pcaJ"
FT                   /locus_tag="BCAM0059"
FT                   /note="HMMPfam hit to PF01144, Coenzyme A transferase,
FT                   score 2.7e-59"
FT                   /inference="protein motif:HMMPfam:PF01144"
FT   misc_feature    64118..64144
FT                   /note="PS01274 CoA transferases signature 2."
FT                   /inference="protein motif:Prosite:PS01274"
FT   CDS_pept        64731..66089
FT                   /transl_table=11
FT                   /gene="pcaB"
FT                   /locus_tag="BCAM0060"
FT                   /product="3-carboxy-cis,cis-muconate cycloisomerase"
FT                   /EC_number="5.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53915"
FT                   /db_xref="GOA:B4EGI4"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR012789"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGI4"
FT                   /protein_id="CAR53915.1"
FT                   /translation="MLEDSARLTSLICGTEPLNRIWSPRATIQRMLDVEAALARALAAQ
FT                   QVIPAAAVAPIERACDAGRLDADALAHGAALGGNLAIPLVKQLTAQVKADDPEAAKFVH
FT                   WGATSQDIIDTATVLQLRDTLDVLDPLLDEACASLAALARTHRATPMIGRTWLQQALPI
FT                   TLGLKFAQWLDALLRHRARFAELRERALVLQFGGAAGTLASLREHAAGVSAALAADLKL
FT                   AVPAVPWHTQRDRIAEAAACFGMLTGTLGKIARDVSLQMQTEIGELGEPAAAGKGGSST
FT                   MPHKRNPVGCAAVLTAAVRAPNLVATVFAGMVQEHERALGGWQAEWDALPDLARLTGGA
FT                   LAQIAQIVAGLDVNTERLAANLELTHGLILGEAVMLALGDRIGRLDAHHVVEHASKEAV
FT                   RTGATLFDVLAADATVSAHLSRDALARLLDPAHYVGEAHAYVDAVLALHAGAH"
FT   misc_feature    64773..65639
FT                   /gene="pcaB"
FT                   /locus_tag="BCAM0060"
FT                   /note="HMMPfam hit to PF00206, Lyase, score 1.9e-53"
FT                   /inference="protein motif:HMMPfam:PF00206"
FT   misc_feature    65562..65591
FT                   /note="PS00163 Fumarate lyases signature."
FT                   /inference="protein motif:Prosite:PS00163"
FT   CDS_pept        66106..66891
FT                   /transl_table=11
FT                   /locus_tag="BCAM0061"
FT                   /product="putative 3-oxoadipate enol-lactonase I"
FT                   /note="family S33 serine peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53916"
FT                   /db_xref="GOA:B4EGI5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR026968"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGI5"
FT                   /protein_id="CAR53916.1"
FT                   /translation="MPFATVNGVKLHYRIDRAARDDAPWLVFSNSLGADLQMWAPQIRP
FT                   LTQHFNILRYDTRGHGHSDAPAGSYTIEQLAGDVIGLLDHVGIDCAHFCGISMGGLTGA
FT                   ALAARYPSRIVRAVLSNTAAKIGSPEVWGPRAQKARAEGMAALADAVLPRWFTDAFVER
FT                   EPRLFDAIRDTFVHTDKDGYAANCDALNAADLREEVKGIALPVLVVTGAKDMSTPPDQG
FT                   RALAAAIPGALHVEFDAAHISNIECTGGFNRALLDFLTA"
FT   misc_feature    66253..66876
FT                   /locus_tag="BCAM0061"
FT                   /note="HMMPfam hit to PF00561, alpha/beta hydrolase fold,
FT                   score 8.7e-27"
FT                   /inference="protein motif:HMMPfam:PF00561"
FT   CDS_pept        66902..67288
FT                   /transl_table=11
FT                   /gene="pcaC"
FT                   /locus_tag="BCAM0062"
FT                   /product="4-carboxymuconolactone decarboxylase"
FT                   /EC_number="4.1.1.44"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53917"
FT                   /db_xref="GOA:B4EGI6"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR012788"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGI6"
FT                   /protein_id="CAR53917.1"
FT                   /translation="MDDQERYEAGMKVRRAVLGDAHVDRSIENRTEVTDEFQNLITRYA
FT                   WGEIWTRDGLPRHTRSLLTIAMMVALNRGEELALHLRAARNNGVTRDEIKEVLLQTAIY
FT                   CGVPAANSAFHLADKIFKEQDAAG"
FT   misc_feature    67004..67258
FT                   /gene="pcaC"
FT                   /locus_tag="BCAM0062"
FT                   /note="HMMPfam hit to PF02627, Carboxymuconolactone
FT                   decarboxylase family, score 7.5e-34"
FT                   /inference="protein motif:HMMPfam:PF02627"
FT   CDS_pept        67483..68841
FT                   /transl_table=11
FT                   /locus_tag="BCAM0063"
FT                   /product="putative 4-hydroxybenzoate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53918"
FT                   /db_xref="GOA:B4EGI7"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGI7"
FT                   /protein_id="CAR53918.1"
FT                   /translation="MNRAPVVDVQTFINEQPFGGFQWLVFLMCFVIVLLDGFDTAAIGF
FT                   IAPSLLGEWNLTKPDLAPVLSAALFGLACGALVSGPLSDRLGRRSLLLGSVFLFGVACL
FT                   MSAFSNTIGHLTILRFITGVGLGAAMPNAVTMMGEFCPDKRRATVINLMFCGFPLGAAF
FT                   GGFLAAWMIPHFGWRSVLVLGGVTPLLLGVLLLLKMPESVRFMVATGQSVDKIRATLAR
FT                   ISRDALNAGSFALTEAAPQTGGKGLGVVLSRSYIVGSVMLWLAYFMGLVIFYASINWMP
FT                   ILLKDAGLTPKSATLISALFPLGGVGAVLCGVLMDRFNANRVIAVCYALTAVSVYAIGQ
FT                   AAGNVGLLVLVVFVAGVLMNTAQSSMPALAAAFYPTEGRGTGVAWMLGVGRFGGIAGSF
FT                   LVAELTRRHFSFAGVFATIAVAGVLACVALLIKQMARPHGVAQPAGKIESLGH"
FT   misc_feature    67552..68835
FT                   /locus_tag="BCAM0063"
FT                   /note="HMMPfam hit to PF00083, Sugar (and other)
FT                   transporter, score 7.9e-07"
FT                   /inference="protein motif:HMMPfam:PF00083"
FT   misc_feature    join(67552..67620,67663..67731,67750..67818,67831..67890,
FT                   67927..67995,68005..68073,68245..68313,68356..68424,
FT                   68485..68553,68620..68688,68707..68775)
FT                   /locus_tag="BCAM0063"
FT                   /note="11 probable transmembrane helices predicted for
FT                   BCAM0063 by TMHMM2.0 at aa 24-46, 61-83, 90-112, 117-136,
FT                   149-171, 175-197, 255-277, 292-314, 335-357, 380-402 and
FT                   409-431"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    67567..68700
FT                   /locus_tag="BCAM0063"
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 1.4e-48"
FT                   /inference="protein motif:HMMPfam:PF07690"
FT   misc_feature    67672..67704
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    67717..67767
FT                   /note="PS00216 Sugar transport proteins signature 1."
FT                   /inference="protein motif:Prosite:PS00216"
FT   misc_feature    67759..67791
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    68728..68760
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(68974..69222)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0064"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53919"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGI8"
FT                   /protein_id="CAR53919.1"
FT                   /translation="MKPMLRAGEHIEGMHWIAEYHPLTHDIRVLRENIEVGTYCAPPTL
FT                   FGDEAGMGAANHDDHRGREAALRAYLRNFVKEHDAEE"
FT   CDS_pept        complement(69331..69948)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0065"
FT                   /product="putative transporter-LysE family"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53920"
FT                   /db_xref="GOA:B4EGI9"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGI9"
FT                   /protein_id="CAR53920.1"
FT                   /translation="MEFLTLSALPAGMLFALVTTITPGPNNTMLLASGVNFGFRRTMPH
FT                   LFGISIGVAILMLCVGFGLGEAFKRLPLLYTLLEVASVAYLLYLAWRIGTSGEVKAHGA
FT                   KSRPMTFIEAAAFQWVNPKAWMMVLTAATTIRLSADYGMNAAWMAILFILIGFPCISLW
FT                   AAFGLGLRRFLSNPRALRIFNVTMAVLLILSLYPLVAHLLPQ"
FT   misc_feature    complement(join(69337..69405,69442..69510,69670..69738,
FT                   69757..69825,69883..69942))
FT                   /locus_tag="BCAM0065"
FT                   /note="5 probable transmembrane helices predicted for
FT                   BCAM0065 by TMHMM2.0 at aa 3-22, 42-64, 71-93, 147-169 and
FT                   182-204"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(69346..69900)
FT                   /locus_tag="BCAM0065"
FT                   /note="HMMPfam hit to PF01810, LysE type translocator,
FT                   score 4.8e-05"
FT                   /inference="protein motif:HMMPfam:PF01810"
FT   sig_peptide     complement(69901..69948)
FT                   /locus_tag="BCAM0065"
FT                   /note="Signal peptide predicted for BCAM0065 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.797) with cleavage site
FT                   probability 0.340 between residues 16 and 17"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(70491..70733)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BCAM0065A"
FT                   /product="insertion element hypothetical protein
FT                   (fragment)"
FT                   /note="Similar to the N-terminal region of Burkholderia
FT                   cepacia insertion element IS402 hypothetical 16.2 kDa
FT                   protein SWALL:YI22_BURCE (SWALL:P24537) (147 aa) fasta
FT                   scores: E(): 1e-07, 45.78% id in 83 aa"
FT   CDS_pept        71131..73110
FT                   /transl_table=11
FT                   /locus_tag="BCAM0066"
FT                   /product="putative lipoprotein"
FT                   /note="Similar to Streptomyces avermitilis hypothetical
FT                   protein SWALL:Q82B80 (EMBL:BA000030) (654 aa) fasta scores:
FT                   E(): 3.7e-59, 35.8% id in 648 aa; homology does not extend
FT                   to far C terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53922"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038732"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGJ0"
FT                   /protein_id="CAR53922.1"
FT                   /translation="MSTGRAPSTRKAVPFTIAVIGCGPRGISVLERIAARLANERNASP
FT                   VIGDICIYVVDAHEIGGGRIWRPDQPSWLLMNTPAKETTIFSGPPDGGDVRPMAGPSLA
FT                   EWWAEVDSGNAEPNGLAPRYVYGKYLKFAFDRIINDLSRHADVRVIRGAVIDVQKSDRR
FT                   RTVMLSDRSTFDADKVVLATGHPVPELSASQLEFSLFARQHPGLRYIEGNSAADMQLSA
FT                   IQPGERVGVIGCGLAFYDVMASLTEGRGGRYETAADGDLVYIPSGKEPRIHAGSRSGVP
FT                   FPARATNEKAADYQYTPRLLTESRMQQIRLARVATKLDFRRDVLPWLEGEMQLVYFACI
FT                   LRETRGRVYASGFVDAAVNNVGEDIDALLPKDIIRKTAESFGAHGIEGVDLEKWSRPFA
FT                   GKLFRNAKEYSGELEKWIRNDIENAGKGNVRGAVKAATDVLRDIRPILKYAVDYAGLTP
FT                   ASHQHDFLGSFVGIYSMLSAGPPAVRLKQVLALIHANILTFAGPKAEFSVSVAEKAFVV
FT                   SSPQVSGDVFRASTLVDARIPPQNVHADSSPLFRNLLASGTVTSFTNSLGQDTFDTGGV
FT                   AVTRAPFNAMSREGPDSAIHVIGIPVEHTRWLMQFGSGRPGPWGQFTKDADAVAESVIA
FT                   AFLGALAATNTPVVADNEKEHVDV"
FT   misc_feature    71164..71196
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    72931..72960
FT                   /note="PS00215 Mitochondrial energy transfer proteins
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00215"
FT   CDS_pept        73112..73825
FT                   /transl_table=11
FT                   /locus_tag="BCAM0067"
FT                   /product="putative short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53923"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGJ1"
FT                   /protein_id="CAR53923.1"
FT                   /translation="MKSRAEKQKILVVGGTSGIGLAAARAFATSGADVTVMSRSAASID
FT                   RSLSIIGASASGAVVDVCDDESVADAIASLDAFDHVVVTTASTPLPTGSIKSIPLDRAY
FT                   GAMNSKFWGAYRIAREVKINQGGSLTFVSGILASRPTKNTALIGAINAALESLAKGLAL
FT                   ERAPVRVNVVSPGILGNASMLVHLNEEERKSIGARLPVEKIGTPELVADAIVFLANHKH
FT                   ITGTTLVVDGGGSLV"
FT   sig_peptide     73112..73195
FT                   /locus_tag="BCAM0067"
FT                   /note="Signal peptide predicted for BCAM0067 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.775 between residues 28 and 29"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    73133..73609
FT                   /locus_tag="BCAM0067"
FT                   /note="HMMPfam hit to PF00106, short chain dehydrogenase,
FT                   score 5.8e-07"
FT                   /inference="protein motif:HMMPfam:PF00106"
FT   misc_feature    73139..73804
FT                   /locus_tag="BCAM0067"
FT                   /note="HMMPfam hit to PF01370, NAD dependent
FT                   epimerase/dehydratase family, score 0.0033"
FT                   /inference="protein motif:HMMPfam:PF01370"
FT   CDS_pept        73803..75209
FT                   /transl_table=11
FT                   /locus_tag="BCAM0068"
FT                   /product="Major Facilitator Superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0068"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53924"
FT                   /db_xref="GOA:B4EGJ2"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGJ2"
FT                   /protein_id="CAR53924.1"
FT                   /translation="MEEVPLSDNSLFTSVIEEADAQSREIVKSRALITVCIGFFMVSLD
FT                   ATVVNVALNSLRLSLHVGLSGLQWTVDSYTLAFAALLLSAGALGDIFGPKKVFNVGLIV
FT                   FSLASALCGLSTSLGALLASRVLQGVGAALLVATSLSLLQKIFVEPADRARAFGVWGGV
FT                   GGVAVAAGPVLGGFLISMFGWPSVFLVNVPFGILGVILSARYLPKMPGEARRINFGAQV
FT                   LSAVALGALAFLFISAGAHGWSSRDVQIAAAAFAIATCLFLGIERFSANPMLPRGIFRS
FT                   RIFSAATTVGMIINFGFYGQLFVLSLYFQQICKYSTMETGLALLPQAIVCSLTAFYCGR
FT                   VTARTGPGFPMKVGLLAGALGLFGLTFANGNSSYVSVLIPMLAVGFGMSFTAPATVAAG
FT                   MSAAPAGQAGIVSGVINAARQSGSVMGIAVLGGLIGLSSNFEYGMHLAFWVASVLFAGA
FT                   LLVTALRIRK"
FT   misc_feature    join(73896..73964,74022..74081,74100..74168,74178..74231,
FT                   74268..74336,74346..74414,74448..74516,74544..74612,
FT                   74649..74717,74760..74819,74838..74906,74934..75002,
FT                   75063..75116,75126..75194)
FT                   /locus_tag="BCAM0068"
FT                   /note="14 probable transmembrane helices predicted for
FT                   BCAM0068 by TMHMM2.0 at aa 32-54, 74-93, 100-122, 126-143,
FT                   156-178, 182-204, 216-238, 248-270, 283-305, 320-339,
FT                   346-368, 378-400, 421-438 and 442-464"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    73905..75107
FT                   /locus_tag="BCAM0068"
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 3.4e-54"
FT                   /inference="protein motif:HMMPfam:PF07690"
FT   CDS_pept        75236..76918
FT                   /transl_table=11
FT                   /locus_tag="BCAM0069"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Streptomyces parvulus hypothetical
FT                   protein BorL SWALL:Q70HZ3 (EMBL:AJ580915) (556 aa) fasta
FT                   scores: E(): 1.8e-57, 35.79% id in 528 aa; homology does
FT                   not extend to N terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53925"
FT                   /db_xref="InterPro:IPR004993"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGJ3"
FT                   /protein_id="CAR53925.1"
FT                   /translation="MRLIDMNSIPNEWMKYWESRKDAFSSECLAELQRFETATRDPQGT
FT                   QQDVLRDVISVSKGSLHWQECGYSSVSGVDDYRSTLPIMRYDDFVPLIDREIRTKGGVL
FT                   TCSPVMRWLKTSGTTGTPKRVPYTLHWVLNYRIPAMKAMWGTYSRLHPELLSNPYATLD
FT                   TQTVRENAQDYIHGVPFQAVSNRHPRMNSMDWNPPWYEAPWFCENAPVSFEDKMYCRVR
FT                   HLVGKDLYFINAINPSTLLSLRDHIGTSKEKLVADVRNGTIDGQPLCNADPHEADRLEK
FT                   VLANPGFTLKDIWPTLGLYACWLSASAGLYQQALEEIFPGVARLPFMSCGTEGVVTIPV
FT                   SEDAYSQPLAINQAFFEFVEDDVPLGELVERGEKPQTLLAHQLTAGKNYHVIMSQANGL
FT                   YRLWTGDIYHVDRVVDGTPWIHFLHRDGVFHSFTGEKLTEHQVTAALRRGFAAADRQIG
FT                   LYLCGPRWGQPPSYVVVAEARGADVTLGATLSRHVESALQDISIEYESKRVSNRLGPIE
FT                   VHVVPENSIQAFVERKRQKGNANQYKYKPFQKDTEFLGELSGQ"
FT   misc_feature    75323..76894
FT                   /locus_tag="BCAM0069"
FT                   /note="HMMPfam hit to PF03321, GH3 auxin-responsive
FT                   promoter, score 1.9e-09"
FT                   /inference="protein motif:HMMPfam:PF03321"
FT   CDS_pept        76940..77818
FT                   /transl_table=11
FT                   /locus_tag="BCAM0070"
FT                   /product="putative hydrolase"
FT                   /note="Similar to Streptomyces parvulus hypothetical
FT                   protein BorF borF SWALL:Q70I05 (EMBL:AJ580915) (272 aa)
FT                   fasta scores: E(): 8.7e-27, 35.79% id in 257 aa; homology
FT                   does not extend to the N terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0070"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53926"
FT                   /db_xref="GOA:B4EGJ4"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGJ4"
FT                   /protein_id="CAR53926.1"
FT                   /translation="MLELKTHPSNLRREIRKIRRGPTELAMHAWLPENPKAAVFYFHGL
FT                   QSHAGWLWEAGRQFANNDVSVFVLDRRGSGISDGDRGDIPPAEVVVADYVAALKWVREF
FT                   IGDDTPLCLFGHCLGGSFMAAVMHHPSFDVPYDAAIFCSTWLGKLHASLPESELEKIAA
FT                   ESSDEMWDAGLRSSDFTDSRQYQAFIDEDDLAIREITKRSRRSLIEIERLYVDAQGDLP
FT                   SVPMAYVSGTSDPIIDLESAHNAFLRMTQSRGSVLKLPTHKHYLFYTEVRRELIDWASA
FT                   FVLLQAREVYA"
FT   misc_feature    77129..77770
FT                   /locus_tag="BCAM0070"
FT                   /note="HMMPfam hit to PF00561, alpha/beta hydrolase fold,
FT                   score 0.00025"
FT                   /inference="protein motif:HMMPfam:PF00561"
FT   CDS_pept        77811..78989
FT                   /transl_table=11
FT                   /locus_tag="BCAM0071"
FT                   /product="puatative mandelate racemase/muconate lactonizing
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53927"
FT                   /db_xref="GOA:B4EGJ5"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGJ5"
FT                   /protein_id="CAR53927.1"
FT                   /translation="MHDVRVYHVQQPMRVGFGHPAATRTTSESVVLELDISGCVGLGEC
FT                   APRSYVTGETCVTVCDALRSLPLARIIDELLSESPNDVLYRIKRLGIEAAFDFTAANNV
FT                   VCIVELAILDWIGKRTRVSLDAMLRNGASLAESSAPIKISQVLDQNLTVDDFLRERGPF
FT                   HFVKIKAHRDRAKDLETVTEIRRAIGDDTPIVIDANMSWSLIEAVEHVRKLREAGLTMV
FT                   EEPFSKRSWTELHELRVQTGISIMLDESVSTLDDLRRAIGSDSCDAVNVRVSKCGGVLR
FT                   SIEMIELAKSFGIQFQIGVQVAECGPLIQAGRLLASLHRDAIAVEGGQADRFFDSMIVS
FT                   PDLSFDRARSTVPPPAGFGLGLSTSTEISKYLAFGYSRSADEWTATSHYTEA"
FT   misc_feature    78192..78926
FT                   /locus_tag="BCAM0071"
FT                   /note="HMMPfam hit to PF01188, Mandelate racemase /
FT                   muconate lactonizing en, score 5.4e-08"
FT                   /inference="protein motif:HMMPfam:PF01188"
FT   misc_feature    78390..78485
FT                   /note="PS00909 Mandelate racemase / muconate lactonizing
FT                   enzyme family signature 2."
FT                   /inference="protein motif:Prosite:PS00909"
FT   CDS_pept        78956..80734
FT                   /transl_table=11
FT                   /locus_tag="BCAM0072"
FT                   /product="putative thiamine pyrophosphate enzyme"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53928"
FT                   /db_xref="GOA:B4EGJ6"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGJ6"
FT                   /protein_id="CAR53928.1"
FT                   /translation="MDRDIPLYRGLTFDMKRYFSDLIVDFLKQQEIEYVAFNPGASFRG
FT                   IHDSLVHREDSPEILMACHEEIAVAMAHGYYKACNRHMAVFLHANVGLLHGSMAIFNAW
FT                   CDRVPLLLIGGNGPIDAAKRRPWIDWIHTSQNIESAVKDFVKWCDQPTSQRATVESLYR
FT                   AFKLMNTEMHAPCYVAIDFDVQEQEVESAAQLLPPTATTPSRLPAADAPFIENLTERLL
FT                   SARMPVLIIDFSGRDPATVAPLISLAEQVGMAVIDRGNRFNFPNVHPLNVSNAPPDMLK
FT                   EADLVLAIEVQDLAGALGAFLPVTDGMPAIEDVTVVTLSTSDTLPSKWAADYQQFVPVN
FT                   LGAIADTRTTVEALERAVADAADRHARPEREERVRALTVHHERVRREWDLDVRQLRAED
FT                   NEIHVATAVREIFQVVQDRDWILTNTGSLTIDGWVKKLWDIERPGSYLGLNGGAGLGYG
FT                   LGASIGAAIAHRNDDVLCIDLQADGDFLYTPSALWTLSSYDVPLLVIIMNNRLYLNSTQ
FT                   HAERIAKARNRVEDLSHVATSFFETPVDFVKIAEGFGIKSFPRIDRASEIEQIVGEAAH
FT                   YVVTQRKPALVEILMK"
FT   misc_feature    79004..79534
FT                   /locus_tag="BCAM0072"
FT                   /note="HMMPfam hit to PF02776, Thiamine pyrophosphate
FT                   enzyme, N-termina, score 1.6e-08"
FT                   /inference="protein motif:HMMPfam:PF02776"
FT   misc_feature    80225..80722
FT                   /locus_tag="BCAM0072"
FT                   /note="HMMPfam hit to PF02775, Thiamine pyrophosphate
FT                   enzyme, C-termina, score 3.1e-22"
FT                   /inference="protein motif:HMMPfam:PF02775"
FT   CDS_pept        80783..81664
FT                   /transl_table=11
FT                   /locus_tag="BCAM0073"
FT                   /product="hypothetical protein"
FT                   /note="Central 170 amino acids similar to Caulobacter
FT                   crescentus hypothetical protein cc1419 SWALL:Q9A8D5
FT                   (EMBL:AE005816) (336 aa) fasta scores: E(): 2.3e-15, 35.59%
FT                   id in 177 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53929"
FT                   /db_xref="GOA:B4EGJ7"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGJ7"
FT                   /protein_id="CAR53929.1"
FT                   /translation="MTIKFMEGVLRGERFVGFVESGVTLPNELYRISLAKLCEATGGKT
FT                   DAVVAKEYLLKSASSVRFSDQDMIDFSPLPPLFPDAAGDAMASGFMQTHNVKIESARDD
FT                   HGEIVLPNWFVKGLGSSVKLSGQPLRAPRQALALCEEAEVVLVYRSNADGRPEYCGYTF
FT                   GNDLTDIGRFKRHPGHLAYAKLCDAAVSSWFHIAPPPQSVQGEVSIERDGAVAWKGNFK
FT                   TGLDALGYRLADMVDHLFSYSALSHPGRIHYVFIGADRSSFHAGFSIKEGDRIVLNFAS
FT                   HDVVISNQVQFA"
FT   CDS_pept        81873..83000
FT                   /transl_table=11
FT                   /locus_tag="BCAM0074"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53930"
FT                   /db_xref="GOA:B4EGJ8"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR039068"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGJ8"
FT                   /protein_id="CAR53930.1"
FT                   /translation="MLEEQYIRNAFPDIAAVPVPLLTSLSLPLDQAVSGLLDNMLLEEQ
FT                   AELHPEWEEVFLQRVRDALERALIKRDTDAANAVHRTLFLLYELHVVDGASPRAANQFN
FT                   PSLTRVRRCIERAWLDNEMRRVGDECPAHLDGSALTQRLKRLWVQHPVASHPLFDFLER
FT                   SASLEQIVAFFKSDSALNIRFFDLLVYSMIGSREGVRRELAQNFWDESGRGDAARSHVT
FT                   LFRSLLSTVGVSSASDDHASELGWQGLAGYNLFMLSSVNRQHYFKLLGIMAMTELLDPS
FT                   QYEKLARGCRRVGLGRDAELDYYDEHVTIDVIHGEGWLSNVIVPIVNETPTVAKDILVG
FT                   ASLRMATCNDYYDALLARLIEMGQQQAGEQISMAA"
FT   CDS_pept        complement(83007..83588)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0075"
FT                   /product="TetR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0075"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53931"
FT                   /db_xref="GOA:B4EGJ9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGJ9"
FT                   /protein_id="CAR53931.1"
FT                   /translation="MATSSKRQAIVDTATRLFTQYGYHAVGIDRIIEEAGVAKMTLFRY
FT                   FSTKNDLISEVLTQRAHSALGSMASAVATRNTPIERLREVFSWHDRWFNARDFGGCMFT
FT                   SALSEFHAEPGEIIRISTKQKVQLRLFIQNLLRDLVPATSIESTARQVVMLLDGATLAA
FT                   VIGDKTNAANEAWQATECLLHAVQAPVAML"
FT   misc_feature    complement(83421..83561)
FT                   /locus_tag="BCAM0075"
FT                   /note="HMMPfam hit to PF00440, Bacterial regulatory
FT                   proteins, tetR family, score 2.7e-17"
FT                   /inference="protein motif:HMMPfam:PF00440"
FT   CDS_pept        complement(84022..84789)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0076"
FT                   /product="TetR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0076"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53932"
FT                   /db_xref="GOA:B4EGK0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGK0"
FT                   /protein_id="CAR53932.1"
FT                   /translation="MPNTSSRRTRTPSPAVSNGQAPSSPEVREPRGARRKRETRARLLD
FT                   AAFVLMAQKGMEGVAINEITEAADVGFGSFYNHFESKEAIHAAVLEIVFEEFADTLDRI
FT                   AGGLTDPAEIISVSLRHTLLRARGEPVWGQFLLREGLSMRALSRGLGPRLLRDIQKGIL
FT                   AGRFSASDPLMSVITVGGAVLTAIAIELRFDADEKPVTDMLNMIGYSQNGFAERAASSL
FT                   LQTLGVPRTEAIEIANRPLPPAVTPAPNESQER"
FT   misc_feature    complement(84523..84663)
FT                   /locus_tag="BCAM0076"
FT                   /note="HMMPfam hit to PF00440, Bacterial regulatory
FT                   proteins, tetR family, score 3.9e-13"
FT                   /inference="protein motif:HMMPfam:PF00440"
FT   CDS_pept        84902..86614
FT                   /transl_table=11
FT                   /locus_tag="BCAM0077"
FT                   /product="putative flavoprotein monooxygenase"
FT                   /note="Similar to Escherichia coli 3- mhpA SWALL:MHPA_ECOLI
FT                   (SWALL:P77397) (554 aa) fasta scores: E(): 3.7e-45, 32.94%
FT                   id in 510 aa; homology does not extend to far N and C
FT                   termini"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0077"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53933"
FT                   /db_xref="GOA:B4EGK1"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGK1"
FT                   /protein_id="CAR53933.1"
FT                   /translation="MGDGTVVETKLTCEPGVHEGNDNANCAGGRDLPSEVDVLVVGCGP
FT                   VGAAIGALLGRDGVRVLVVDRAAEIFMAPRAIALDNDALRILQYVGVNEADLDTVAIPY
FT                   VRMRSPWFGEFGRINTLGSIDGHPKLVTFYQPDLERCLRARLAAHRTARMALGVTLVSL
FT                   DEHADHVAATLDSGPGARHVVRARYVVGADGASSIVRQLIGQDFKGKTFAEDWLIVDAR
FT                   NVRRPIDHVEFICDHRRPTPHMTAPGGRERWEFMLHPDETREEMESDERIRELLAPWGG
FT                   IEDMVIERKAVYRFHARTVTTFSKGRVFLAGDAAHITPPFVGQGLVAGLRDAANLGWKL
FT                   AWVVKGHATPQILDSYDRERRPHAKAMIGVAKFMGKLVMPRNAGIALFTHGLMRLTRLV
FT                   PPLRNHFDELGIKPKNAFRSGLFVPGHSSTRLVRGAALPQGWLRRHDGTIRLSDDVFGT
FT                   GLALIGFGRDPGVELDAGARAALIAAGGVVVQVMHRGQRLHRIEDDGWEDLDGTFMPGV
FT                   VRFGWAAVIRPDKTVLHEGPVADSTRLVLESLQLLGARTALSSLSDHIAQPIS"
FT   misc_feature    85004..86014
FT                   /locus_tag="BCAM0077"
FT                   /note="HMMPfam hit to PF01494, FAD binding domain, score
FT                   2.3e-59"
FT                   /inference="protein motif:HMMPfam:PF01494"
FT   misc_feature    85511..85534
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        86622..87692
FT                   /transl_table=11
FT                   /locus_tag="BCAM0078"
FT                   /product="putative dioxygenase"
FT                   /note="Similar to Burkholderia cepacia trihydroxytoluene
FT                   oxygenase dntD SWALL:O87474 (EMBL:AF076848) (315 aa) fasta
FT                   scores: E(): 5.8e-37, 39.33% id in 300 aa; contains
FT                   extensions at the N and C termini"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53934"
FT                   /db_xref="GOA:B4EGK2"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGK2"
FT                   /protein_id="CAR53934.1"
FT                   /translation="MKLTTAQPARSPQPTTKARALSYLMFERPDLERAERFLNDFGLRT
FT                   VSRDGEHLFLRGTAATPFCYVVRRAEKNRFVGFGLEVDGIDALRKLAGVPGASDVAPSP
FT                   WPGGGHRVTLVDPSGFRVDAVAGQARAGALPHRSALPFNSPDSVVRVNDTQRAPLAAPE
FT                   VIRLGHVVLELADFQATCAWYTSHFGFIPSDVQVLPDGSPAVAFLRLDRGATPTDHHTL
FT                   ALAQGFAALYSHSAFELVDADAVGIGQRVLSEKGWTHAWGMGRHILGSQVFDYWQDPWG
FT                   DKHEHYCDGDMFTADVATGIHEVSREAMSQWGPRMPRSFTKPKITAASIASLIRNLRAS
FT                   PDVTFAKLRTLAKLFA"
FT   misc_feature    87117..87479
FT                   /locus_tag="BCAM0078"
FT                   /note="HMMPfam hit to PF00903, Glyoxalase/Bleomycin
FT                   resistance protein/Di, score 0.0017"
FT                   /inference="protein motif:HMMPfam:PF00903"
FT   CDS_pept        87729..88685
FT                   /transl_table=11
FT                   /locus_tag="BCAM0079"
FT                   /product="putative fumarylacetoacetate hydrolase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0079"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53935"
FT                   /db_xref="GOA:B4EGK3"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR018833"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGK3"
FT                   /protein_id="CAR53935.1"
FT                   /translation="MALHVLHYRHQGRAQWGVVRHHRITPIPGDYPTTGEFVRAHRIDD
FT                   LAALDGETIPESDVEWLSPVTRNQRFVCQGANYRQHMIESGMNPDAKSFNMIFTKATSC
FT                   IVAADSDVIRPQHVRFLDYEIELGLVLRRDITSRQAITDKNLHEYVAGLVIVNDYSARD
FT                   IQIPQMQFYKGKSYRTFGPVGPYLCLLEASDIARLHALTLTLTVNGDVRQSDSTGNLVY
FT                   GPAETLTELSGVQDLNAGDLLATGTPSGCALSIPSPAKQRIAALLPEQMKWRIFTKVQA
FT                   ARPQYLKAGDLVESRIRSRDGAIDLGVQRNRIVDELA"
FT   misc_feature    87987..88493
FT                   /locus_tag="BCAM0079"
FT                   /note="HMMPfam hit to PF01557, Fumarylacetoacetate (FAA)
FT                   hydrolase fam, score 6.9e-36"
FT                   /inference="protein motif:HMMPfam:PF01557"
FT   CDS_pept        88682..90643
FT                   /transl_table=11
FT                   /locus_tag="BCAM0080"
FT                   /product="putative AMP-binding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53936"
FT                   /db_xref="GOA:B4EGK4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGK4"
FT                   /protein_id="CAR53936.1"
FT                   /translation="MNAIATEADVLRIENQGPPADLPASTYEMIGRGAAIDPSAPALSF
FT                   FLRADDHRKPLRWTYAALLRDITRAANMFSRLGIDRHAVVASVLPNLPETHFVIWGGEA
FT                   AGIVCAINPLLEGPAIASLLKAANAKVLVTLAPFPGTDIWSKIQPVLSEVPSLQSLVLI
FT                   DLAERVQGWRRIAARAMQRRECKRLHGRAGVRGAVPRHVAIHDFDSAMSRESGDSLLIP
FT                   RRFEADDISSYFCTGGTTGLPKIAIRRHGNEVANAWSVGQVVGAGMGPGKTVFCGLPLF
FT                   HVNAVLATGLVPFSRGAHVVLGTPQGYRGDGVVKRFWEIVEHHRINFFSAVPTLYSALL
FT                   DVPVDGRNIDSLEYGLCGAAPMPVEVFRTFQDRTGVRILEGYGLTEGACVSSVNPPGGE
FT                   RRLGSIGLRIPGQMMKAVILDDAGRYVRDCVENEVGVLTISGPNVFAGYLQEDQNKSLW
FT                   LDLGDGRQWLNTGDLARRDAQGYFWLTGRRKELIIRGGHNIDPATIEEPLHRHPAVQIA
FT                   AAIGRPDVHAGELPVAYVQLKAGATATETELDTFIRGMIGERAAIPKRIHIVDTMPLTA
FT                   VGKIFKPELKRWETFDALVSALKDAGVEGARVSMVDDPSRGLTLHVALSDHAQTAKANT
FT                   VMGRFPFAFSTSVEPEHH"
FT   misc_feature    88856..90238
FT                   /locus_tag="BCAM0080"
FT                   /note="HMMPfam hit to PF00501, AMP-binding enzyme, score
FT                   8.4e-79"
FT                   /inference="protein motif:HMMPfam:PF00501"
FT   misc_feature    89378..89413
FT                   /note="PS00455 Putative AMP-binding domain signature."
FT                   /inference="protein motif:Prosite:PS00455"
FT   misc_feature    89477..89500
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        90857..91582
FT                   /transl_table=11
FT                   /locus_tag="BCAM0081"
FT                   /product="putative outer membrane protein-OmpW family"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0081"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53937"
FT                   /db_xref="GOA:B4EGK5"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGK5"
FT                   /protein_id="CAR53937.1"
FT                   /translation="MKRISAGAVVLVAAISGAHAQSAGQWVVSAGWSHFAPQGAADPLT
FT                   LNALGQSQVMTGSGGDIASGDTFGLTATYFLTDHIAATTVMGFPPTWHLNGAGTLSGFG
FT                   ELGTARAWSPAIIFNYYFGQPNARFRPYLGAGVTYTWFSNIKLSNPVSTGQIYFSPTVG
FT                   TALEGPTSVSLSHSFAPVVNGGLTYNIDSHWSINASVAYSWVSTRATLTTRSSVGTVTS
FT                   TSKFRVNPIVTFLSVGYRF"
FT   sig_peptide     90857..90916
FT                   /locus_tag="BCAM0081"
FT                   /note="Signal peptide predicted for BCAM0081 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.952 between residues 20 and 21"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    90920..91579
FT                   /locus_tag="BCAM0081"
FT                   /note="HMMPfam hit to PF03922, OmpW family, score 1.2e-17"
FT                   /inference="protein motif:HMMPfam:PF03922"
FT   CDS_pept        complement(91858..92592)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0082"
FT                   /product="putative polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53938"
FT                   /db_xref="GOA:B4EGK6"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGK6"
FT                   /protein_id="CAR53938.1"
FT                   /translation="MLARTPRYPILMYHQIRLLPPPTDRLRSLSVAPDAFRRQMTLFRQ
FT                   LGYRGLSVRELQPYLRGERQGKVFGISFDDGFLNVLTHAMPVLDALGFTATCYFVAGRF
FT                   GGANDWDAGAPTKRSPLMTCEDMLAWRDHGHEIGSHTLDHVALSYVPAPVSDFQLTESK
FT                   RQLEMLSGQCVESFCYPYGNLDARVRDQVIAAGYGNATTTRRGCAGAADDPFLLPRIPV
FT                   AGGVGAARLWFKCWKGRIAGRR"
FT   misc_feature    complement(91993..92409)
FT                   /locus_tag="BCAM0082"
FT                   /note="HMMPfam hit to PF01522, Polysaccharide deacetylase,
FT                   score 4.6e-26"
FT                   /inference="protein motif:HMMPfam:PF01522"
FT   CDS_pept        complement(92616..93182)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0083"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53939"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGK7"
FT                   /protein_id="CAR53939.1"
FT                   /translation="MALNIWKKYWDLRTQECPCDVHFVEWLESVHLKGIRIYHFGTGGH
FT                   HHVGIECARPHLNNTVFGVTASPKEYKSYVDLVTRQPEVSKTYLAYFGDIYTSHSRLLP
FT                   TFDVVTLFHLCEFRDEANSRYGAKTDEEVLDLFARHTAPNGHLLFYTGSSAYRKAEPII
FT                   ARWAANADFVEVGDFKTLRIFRKAA"
FT   CDS_pept        complement(93173..94327)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0084"
FT                   /product="putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0084"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53940"
FT                   /db_xref="GOA:B4EGK8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGK8"
FT                   /protein_id="CAR53940.1"
FT                   /translation="MNILYTNFHGDYGGGQDTYVRDLAVAMSRHHRVTVASPEGSRLSR
FT                   LLKDSPDVAIFDMEFKPRWNRLCREILRLRRRIAAERFDVIHVNGAADHRQVMLALLGC
FT                   RYRPAIVLTKHNTYRADSLGNVLRARLATDHTIAVSDYVASMLALRSPYGNVTVVKHGV
FT                   RRPAAERLAGDEIRRRKIALFGASGAEAIVLGSSAGTTPEKGWMDLIAALGRLPEAERE
FT                   RFRVLLIGAEPSGEQREQLARHGMASRTAFTGRLDDVWAPFSIIDVSFVLSYHESLSYA
FT                   CREAMSLGCPAIVTRVGGLPENVEPGVDGWVVPPREPAAIEAILRAIVQEPGCVRAMGR
FT                   SARLKGKREFSFDAFVDATLSVYQKSIRHNPYRWVTSLRSTKWH"
FT   misc_feature    complement(93293..93796)
FT                   /locus_tag="BCAM0084"
FT                   /note="HMMPfam hit to PF00534, Glycosyl transferases group,
FT                   score 5e-18"
FT                   /inference="protein motif:HMMPfam:PF00534"
FT   CDS_pept        94684..95280
FT                   /transl_table=11
FT                   /locus_tag="BCAM0085"
FT                   /product="TetR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0085"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53941"
FT                   /db_xref="GOA:B4EGK9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGK9"
FT                   /protein_id="CAR53941.1"
FT                   /translation="MARTRNENLHQQRREQILTAAARVFKAKGFHGARTEDICAAADMS
FT                   AGAVFRYFADKREMIDAIIAVEVERYTQDFNRILSRDGLLGLAGITADELAGMMAQGDD
FT                   GLGVDSWLELARDAERRPDIVGLDRKMRADLAALLARGQAEGWVRPSLDPAGATNIVFA
FT                   LFNGLWLDRSLGTSVDMKQTAAALGDFFRTYVLVA"
FT   misc_feature    94732..94872
FT                   /locus_tag="BCAM0085"
FT                   /note="HMMPfam hit to PF00440, Bacterial regulatory
FT                   proteins, tetR family, score 4.5e-16"
FT                   /inference="protein motif:HMMPfam:PF00440"
FT   CDS_pept        95627..96925
FT                   /transl_table=11
FT                   /locus_tag="BCAM0086"
FT                   /product="putative sodium:dicarboxylate symporter family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0086"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53942"
FT                   /db_xref="GOA:B4EGL0"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGL0"
FT                   /protein_id="CAR53942.1"
FT                   /translation="MKKKHNITRYIVVAMILGIAVGYACHSAFPDPKMAKEVAGYVSLL
FT                   SDVFLRLIKMIIAPLVFATLTVGIAQMGDGSAVGRVGVKAFGWFFIASFTSLLLGLLTA
FT                   TLLQPGSHLSLPLPPSDAALNLKTGAFTLKDFVVHLVPKSIAEAMANNEILQIVVFSIF
FT                   FGTALSALGDAGKRLTGVIEDLAQVMLKVTGAVMWFAPVAVFAALASTITTEGLGILLT
FT                   FAKFMASFYLALALLWAVLTLAGVTFLGKRAFTLIRLIREPFLLSFATASSEAAYPKLL
FT                   DALDRFGVNRKISSFVLPIGYSFNLDGSMMYCTFAVLFIAQVYGIHLPLGTQITMLLML
FT                   MVTSKGMAGVPRASLVVIAATLNQFNMPEAGLLLIMGVDMFLDMGRSATNAVGNSIAAA
FT                   VVAKWEGQLDAPRDDDDSDGARVAEVKVRETSA"
FT   sig_peptide     95627..95707
FT                   /locus_tag="BCAM0086"
FT                   /note="Signal peptide predicted for BCAM0086 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.935) with cleavage site
FT                   probability 0.688 between residues 27 and 28"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    95645..96838
FT                   /locus_tag="BCAM0086"
FT                   /note="HMMPfam hit to PF00375, Sodium:dicarboxylate
FT                   symporter family, score 4e-110"
FT                   /inference="protein motif:HMMPfam:PF00375"
FT   misc_feature    join(95645..95713,95792..95860,95879..95947,96086..96139,
FT                   96200..96268,96305..96373,96569..96637)
FT                   /locus_tag="BCAM0086"
FT                   /note="7 probable transmembrane helices predicted for
FT                   BCAM0086 by TMHMM2.0 at aa 7-29, 56-78, 85-107, 154-171,
FT                   192-214, 227-249 and 315-337"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    95669..95701
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        97379..99313
FT                   /transl_table=11
FT                   /locus_tag="BCAM0087"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0087"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53943"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGL1"
FT                   /protein_id="CAR53943.1"
FT                   /translation="MVARKRIQAALVAAAIAACAPAAHAANTTDWLANTYGTLAAHVGN
FT                   VARAMWVAPEGVIYTASMWDEDEGGVAIYQNGKSIGSIGAHSEFQGSAITGNATSLFVA
FT                   LQPGKTYGSGAVGRYSRATKVRDRVIQISAATNQPRIDVVTGLATAGSLLYASDFYGNR
FT                   VRVFTTDGVWQRDIGVSAPGALAVDGAGNVWVAQKSAGSIVGFSPTGALLNTIRMPAGS
FT                   HPSALHVDAAAGQLLVGDEGPDQNIKRYSISGQPALAGTFGVRGGYLDTTTGIKGQVGP
FT                   QRFTRIVGIGKDTGGNLYVLNNPWGGSWDLGRNGATDIHAYGSNGNLRWTLQSLNFEGI
FT                   AAPDPVTDGALFYGGTHIYSGSAGGKFVANTVDPFTYPSDPRINMSDTQRDEHFGLITS
FT                   VGANRILVAAGQNPPIFYFYHFNAANGYIAIPDGSIPGPAFNTTQRVTGGFSLDSQGGV
FT                   WAGLDKTGAITHYPLTGFDADGKPSWGPGVTTRIPASIQPLTRIVYLADSDTMVLAQGA
FT                   LGSNDWTSIGTRIEVYHGWRAGNTTKPDPVITLPHSGAKSIDAAGNHLFVGYWFSSSGP
FT                   LWPNVDAFNLTTGKLDTTLVNTSPATVDTSSAIDAMYSIRAYRRSNGEYVVMKNNVKGN
FT                   SITVYRWTP"
FT   sig_peptide     97379..97453
FT                   /locus_tag="BCAM0087"
FT                   /note="Signal peptide predicted for BCAM0087 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 1.000 between residues 25 and 26"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    97403..97435
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    97592..97615
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        99606..100424
FT                   /transl_table=11
FT                   /locus_tag="BCAM0088"
FT                   /product="putative peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53944"
FT                   /db_xref="GOA:B4EGL2"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGL2"
FT                   /protein_id="CAR53944.1"
FT                   /translation="MTPNRLLTIVALAGALSGPVHAQTAATVATVNGTPITQTDVDTLL
FT                   RASGQPDSPQIRQAIKNQLITRVLVQQAAEKANYADKPEVKAAMQQAKVTAEVQLYLRD
FT                   HVKPEPVTDEQVKARYDELVAALGKNEFKPRLIVVKDPVAAATVLSELKAGKSFDGLAR
FT                   QYSVAPSRDTGGELPWVSFNTPAVEGRTAGLPLPVAQALEKLSVGAVTKDSIPVDGVRA
FT                   IVKLDAKRPTQVPGFETAKPTLQQQLQAIAAEKASAQMIGNLLKDAKITQ"
FT   sig_peptide     99606..99671
FT                   /locus_tag="BCAM0088"
FT                   /note="Signal peptide predicted for BCAM0088 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.999 between residues 22 and 23"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    100014..100289
FT                   /locus_tag="BCAM0088"
FT                   /note="HMMPfam hit to PF00639, PPIC-type PPIASE domain,
FT                   score 0.00011"
FT                   /inference="protein motif:HMMPfam:PF00639"
FT   CDS_pept        complement(100455..100892)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0089"
FT                   /product="putative acetyltransferase-GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53945"
FT                   /db_xref="GOA:B4EGL3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGL3"
FT                   /protein_id="CAR53945.1"
FT                   /translation="MKPAIHLRAASREDLPFLLTLRRLTMTEHLQRVGAPTDDEAHDRR
FT                   IRANFDDAMIVCEGVDAIGLLKVTRAAGEWHIHQIQILPARQGHGIGEAVLHALLTDAA
FT                   RAHVPVSLSVLHGNPARRLYERLGFRVASDTDTSANMIWHA"
FT   misc_feature    complement(100503..100733)
FT                   /locus_tag="BCAM0089"
FT                   /note="HMMPfam hit to PF00583, Acetyltransferase (GNAT)
FT                   family, score 1.5e-08"
FT                   /inference="protein motif:HMMPfam:PF00583"
FT   CDS_pept        complement(100935..101738)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0090"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0090"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53946"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGL4"
FT                   /protein_id="CAR53946.1"
FT                   /translation="MLDASTRALCGAQVRPQVNVRGSFKTGSFGIDFTLATSLLGRMRD
FT                   MLSGNEGTALANAVTILTALGIAAPKARKGLFAVLKWLRGREITHVRMQDRTAVLDVDG
FT                   DTLEIDLPVLTLLRDVRVRQATAQVLAPLAREGIEIFAVGTDTEVYEMVARNEMAWFHA
FT                   PEPTDALLLDEHRKMAFSIVSLAFKDDNKWRLRDGTATIHATITDAGFLSRVNNSQISF
FT                   SKGDLLLCNVRVQQWQTSDGAKTEYEVTDVLEHRPAGLQIPLPGL"
FT   CDS_pept        102192..103484
FT                   /transl_table=11
FT                   /locus_tag="BCAM0091"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0091"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53947"
FT                   /db_xref="GOA:B4EGL5"
FT                   /db_xref="InterPro:IPR007895"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGL5"
FT                   /protein_id="CAR53947.1"
FT                   /translation="MDTKRSRPGLVAALLWAALYLATGYISHEFNGPVRLTGYIWLPAG
FT                   VTVGAFMLRPMRDWLTLAGAFLVGQLALTAIEHGSLVNAVLFTVDEVGAAALAVWLVQR
FT                   VRFSLEGLYFLRSVILAGMIAGVVGAIGGAAWYTTLKGAPFFDVWSVWAASDFVGVLLV
FT                   TPVLASWSRFRAHRSGDHERFDLVLGIVAFVLLAAVALVIFDGDTSRKFGTGAGFALTY
FT                   VPLFLTVAVTLLLGGRAGSSSVLVLALIVIEQTAQGDGPFASLHAHYGSALLEAQLYLA
FT                   VASLLVLTVSTLKTTRERVHEHAAVLQNNMELALASAGQIAYVLDPESGRIEWSGDVER
FT                   VFGVGVDAAQIATVPLVLERVQPGDRDALRDYWNAEIAGEDRASLSLRIVLRDGGTRTI
FT                   TDHGAPLLDSNVDVTVVAGVWQLERVWPADE"
FT   sig_peptide     102192..102257
FT                   /locus_tag="BCAM0091"
FT                   /note="Signal peptide predicted for BCAM0091 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.853) with cleavage site
FT                   probability 0.522 between residues 22 and 23"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(102216..102269,102297..102353,102366..102419,
FT                   102429..102497,102531..102599,102642..102710,
FT                   102747..102803,102831..102899)
FT                   /locus_tag="BCAM0091"
FT                   /note="8 probable transmembrane helices predicted for
FT                   BCAM0091 by TMHMM2.0 at aa 9-26, 36-54, 59-76, 80-102,
FT                   114-136, 151-173, 186-204 and 214-236"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    102225..103085
FT                   /locus_tag="BCAM0091"
FT                   /note="HMMPfam hit to PF05231, MASE1, score 2.6e-41"
FT                   /inference="protein motif:HMMPfam:PF05231"
FT   misc_feature    103182..103466
FT                   /locus_tag="BCAM0091"
FT                   /note="HMMPfam hit to PF08447, PAS fold, score 0.0013"
FT                   /inference="protein motif:HMMPfam:PF08447"
FT   CDS_pept        103498..104313
FT                   /transl_table=11
FT                   /locus_tag="BCAM0092"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0092"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53948"
FT                   /db_xref="GOA:B4EGL6"
FT                   /db_xref="InterPro:IPR012354"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGL6"
FT                   /protein_id="CAR53948.1"
FT                   /translation="MTGRTGVLLIHGLGGTQYDLGSLHKAMRRAGGDTHMITLPGHGTR
FT                   PEDLVGVRAEAWLDAVTEQYRALAREYDTLHVAGMCMGALVALLLCHRVQHARGRLALL
FT                   ATPMFIDGWSTPWYRSLRHVLYRVPGVAERMRVEEGDPFGIKNATIRAIVKKKFERQDS
FT                   FHYAWVPLACVRQVDRMRDWALDAAAGTPCPTLVLHAREDELTSLRSADFLLENMPDAC
FT                   GIVLENSYHMICADNDRDDVARHVLEFFGFDPVHAVSPAMARRMGRLEP"
FT   CDS_pept        complement(104321..105343)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0093"
FT                   /product="MerR family regulatory protein"
FT                   /note="Poor database matches to the full length CDS.
FT                   N-terminal region is similar to Rhizobium meliloti heavy
FT                   metal dependent transcription regulator 2 HmrR2
FT                   SWALL:HMR2_RHIME (SWALL:P58379) (147 aa) fasta scores: E():
FT                   0.033, 31.34% id in 134 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0093"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53949"
FT                   /db_xref="GOA:B4EGL7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGL7"
FT                   /protein_id="CAR53949.1"
FT                   /translation="MGTATPGLNASAAAARLGVSIKALRLYERHGLVTPARTPAGYRTY
FT                   GPDDLARAADIAALRKLGLTLAQVASVLDGDARGLDAALAAHEAALDHGIHDFVSKLDR
FT                   VRAMRAGLARGRMPADGELTRLLDPGSAGVAFSLPWPWGGEWFECRDIRPLNYIIGSLG
FT                   SGKTRLALRLAEALPGAVFVGLDRLDDDCAAASDALRADPELKSRVDRTSALLVGTGAT
FT                   PSAALTALLVSLEAERPRVRIVDLIEQGLDRATQLALIAHLRDSAAAGVRPLFLLTRST
FT                   AILDLAAVGPDETILLCPANHSPPARVAPYPGAPGYEAVATCLAAPEVRERIARRPMTA
FT                   "
FT   misc_feature    complement(104843..104866)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    complement(105209..105319)
FT                   /locus_tag="BCAM0093"
FT                   /note="HMMPfam hit to PF00376, MerR family regulatory
FT                   protein, score 3.9e-09"
FT                   /inference="protein motif:HMMPfam:PF00376"
FT   misc_feature    complement(105245..105313)
FT                   /note="PS00552 Bacterial regulatory proteins, merR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00552"
FT   misc_feature    complement(105257..105322)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1159.000, SD 3.13 at aa 8-29, sequence
FT                   LNASAAAARLGVSIKALRLYER"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        complement(105426..106892)
FT                   /transl_table=11
FT                   /gene="xylB"
FT                   /locus_tag="BCAM0094"
FT                   /product="xylulose kinase"
FT                   /EC_number="2.7.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53950"
FT                   /db_xref="GOA:B4EGL8"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGL8"
FT                   /protein_id="CAR53950.1"
FT                   /translation="MTYLGIDLGTSEVKVLLTDSRSVPLATGSAALSISRPHPHWSEQS
FT                   PQAWWHAMLDAIASVRAAHPAGFAALRGIALSGQMHGATLIDRADQVLRPAILWNDTRA
FT                   GTECVELEALVPESRAITGNMAMPGFTAPKLLWLAKYEPAVFRAVHKVLLPKDYLIWRL
FT                   SGEFVSDMSDAAGTLWLDCARRDWSDRMLAATELSRAQMPRLVEGNAPAAQLRDALRRE
FT                   WGIDGPVTIAGGAGDNAASAIGMGVTGAGSGFLSLGTSGVLFAGNDRFAPNPDAAVHAF
FT                   CHCVEGRWHQMSVILSAAASLDWLARAHGTTAGALAARAERADPARAPLFLPYLGGERT
FT                   PHNDAHARGVFFGLSNEHDADDLAYAVMEGVAFAMADGYDALRAAGTTLDAVSFIGGGS
FT                   KSAFWARLCANATGLAMQRHADGAVGAALGAARLARLAATNDTLEEVCVAPPVTETVAP
FT                   DAASVDLLAGRLARYRRLYRALRDEFAAAD"
FT   misc_feature    complement(105492..106154)
FT                   /gene="xylB"
FT                   /locus_tag="BCAM0094"
FT                   /note="HMMPfam hit to PF02782, FGGY family of carbohydrate
FT                   kinases, C-termi, score 4.3e-45"
FT                   /inference="protein motif:HMMPfam:PF02782"
FT   misc_feature    complement(105786..105848)
FT                   /note="PS00445 FGGY family of carbohydrate kinases
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00445"
FT   misc_feature    complement(106161..106889)
FT                   /gene="xylB"
FT                   /locus_tag="BCAM0094"
FT                   /note="HMMPfam hit to PF00370, FGGY family of carbohydrate
FT                   kinases, N-termi, score 6.1e-87"
FT                   /inference="protein motif:HMMPfam:PF00370"
FT   CDS_pept        complement(106889..107824)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0095"
FT                   /product="AraC family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0095"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53951"
FT                   /db_xref="GOA:B4EGL9"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGL9"
FT                   /protein_id="CAR53951.1"
FT                   /translation="MNPDLEIVPTHRDESFRAWVHDYPHSVAKWHFHPEYEIHLIQASH
FT                   GKVFVGDHIGDFGPGNLIVTGPNLPHNWVSELADGERVPSRDVVLQFSRDAIEKMVGAF
FT                   SELQPVIDLIDDAARGVQFPDRVGIEVAPLMLELANAHGCRRVEILMSLFDRLSSCRER
FT                   RVLAGPGYRSDAQHYMSSTINQVLSYLQQNLPGMLREADVAAFAGMSVSTFTRFFRRHT
FT                   GSSFVRYLNRLRINEACELLMFSDLTVTDICYRVGFNNLSNFNRQFLAMKQVPPSKFRA
FT                   LHRLNEPHGRDDAPPPRRAPPRAPDRTLHT"
FT   misc_feature    complement(106982..107116)
FT                   /locus_tag="BCAM0095"
FT                   /note="HMMPfam hit to PF00165, Bacterial regulatory
FT                   helix-turn-helix protei, score 0.0001"
FT                   /inference="protein motif:HMMPfam:PF00165"
FT   misc_feature    complement(106997..107125)
FT                   /note="PS00041 Bacterial regulatory proteins, araC family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00041"
FT   misc_feature    complement(107132..107272)
FT                   /locus_tag="BCAM0095"
FT                   /note="HMMPfam hit to PF00165, Bacterial regulatory
FT                   helix-turn-helix protei, score 2.4e-05"
FT                   /inference="protein motif:HMMPfam:PF00165"
FT   misc_feature    complement(107168..107233)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1306.000, SD 3.64 at aa 198-219, sequence
FT                   LREADVAAFAGMSVSTFTRFFR"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        complement(107854..109047)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0096"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="Similar to Escherichia coli sn-glycerol-3-phosphate
FT                   transport ATP-binding protein UgpC ugpC SWALL:UGPC_ECOLI
FT                   (SWALL:P10907) (356 aa) fasta scores: E(): 1.8e-56, 48.35%
FT                   id in 364 aa; contains 30 amino acid C terminal extension"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0096"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53952"
FT                   /db_xref="GOA:B4EGM0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGM0"
FT                   /protein_id="CAR53952.1"
FT                   /translation="MAQITCKALSKHYDGGPAVLHPLDLEIADGEFIVLLGPSGCGKST
FT                   MLRMIAGLEAITGGELVIGDAVVNDLPSRERNVAMVFQNYALYPHMTVYDNIAFGLRRL
FT                   KVPADEIDRRVRDVARILSLDALLDRRPRAMSGGQQQRAAIARAMIKTPAVFLFDEPLS
FT                   NLDAKLRTQLRGDIKRLHRQLKTTTLYVTHDQLEAMTLADRVVLMRGGHIEQIGTPAEL
FT                   YGQPHTVFAAGFVGTPAMNFADGTIARVGTNVLLDCNGARWPLASSRFARLQDGQQVKA
FT                   AIRPNHLQLVAEGDPTPGTLTLTGTVELVELLGAEALVTLDWRGQPCAALVPAPMAPAP
FT                   GAVVAFRFDEEALHLFDAGTERNVTLPDANPIAHAAPPAAATRTTPPAATGWSMSRS"
FT   misc_feature    complement(107980..108207)
FT                   /locus_tag="BCAM0096"
FT                   /note="HMMPfam hit to PF08402, TOBE domain, score 1.1e-14"
FT                   /inference="protein motif:HMMPfam:PF08402"
FT   misc_feature    complement(107983..108159)
FT                   /locus_tag="BCAM0096"
FT                   /note="HMMPfam hit to PF03459, TOBE domain, score 1.9e-05"
FT                   /inference="protein motif:HMMPfam:PF03459"
FT   misc_feature    complement(108415..108960)
FT                   /locus_tag="BCAM0096"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   6.6e-59"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    complement(108601..108645)
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    complement(108916..108939)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(109051..110085)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0097"
FT                   /product="D-xylulose reductase"
FT                   /EC_number="1.1.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0097"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53953"
FT                   /db_xref="GOA:B4EGM1"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGM1"
FT                   /protein_id="CAR53953.1"
FT                   /translation="MKALVLERTRELALRDIDLPQAVGPVDVRIKVHTVGVCGSDVHYY
FT                   VHGGIGPFRVDAPMVLGHEASGTVVETGAGVTHLRVGDRVCMEPGVPRLDSPATLRGLY
FT                   NLDPDVRFWATPPIHGCLTPFVVHPAAFTYRLPDNVSFAEGAIVEPLSIGLQAAKKAAM
FT                   KPGDLAVVIGAGTIGAMTALAALAGGAARVILADVVPDKLALFAGNPAVTTVDVRTRPL
FT                   ADAVAEASGGWGADVVFEASGSANAYAGLVDLMCPGGCAVLIGMPVAPVPLDVVALQAK
FT                   EGRIESVFRYANIFPRALALIASGAIDVKPFISRTFPFSEGVRAFEEAASGHPRDVKIQ
FT                   IEMD"
FT   misc_feature    complement(109174..109593)
FT                   /locus_tag="BCAM0097"
FT                   /note="HMMPfam hit to PF00107, Zinc-binding dehydrogenase,
FT                   score 8.9e-24"
FT                   /inference="protein motif:HMMPfam:PF00107"
FT   misc_feature    complement(109516..109584)
FT                   /locus_tag="BCAM0097"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAM0097 by TMHMM2.0 at aa 168-190"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(109678..110013)
FT                   /locus_tag="BCAM0097"
FT                   /note="HMMPfam hit to PF08240, Alcohol dehydrogenase
FT                   GroES-like domain, score 1.6e-34"
FT                   /inference="protein motif:HMMPfam:PF08240"
FT   misc_feature    complement(109858..109902)
FT                   /note="PS00059 Zinc-containing alcohol dehydrogenases
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00059"
FT   CDS_pept        complement(110096..110911)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0098"
FT                   /product="putative ABC transporter system permease"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53954"
FT                   /db_xref="GOA:B4EGM2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGM2"
FT                   /protein_id="CAR53954.1"
FT                   /translation="MARRGPAAVSTVAIAGAILLVAAFPLFWAVLNSLKHLLDIVTPTP
FT                   RFFFTPTLANYEQVLSSPEVLIGLGNSIAIVGAAVLIGAVLGVPAAYAIARYPVRGKRD
FT                   IQFFLLSLRFLPPVAVALPLIAIWVDLGLYDTKLSMIVTYLLVTLSTITWLSIPVFRRL
FT                   PREIEEAAALDGYGPYAVFWHIALPVCASTLLGGIVFSFVLVWNELMIALALTSSRSAT
FT                   LPVVASAFTSLGQEVPWGVINASTVLLALPPLVFVGMLSRLLNSMVKGK"
FT   misc_feature    complement(110102..110719)
FT                   /locus_tag="BCAM0098"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 3.7e-06"
FT                   /inference="protein motif:HMMPfam:PF00528"
FT   misc_feature    complement(join(110129..110197,110303..110371,
FT                   110429..110497,110525..110593,110627..110695,
FT                   110825..110893))
FT                   /locus_tag="BCAM0098"
FT                   /note="6 probable transmembrane helices predicted for
FT                   BCAM0098 by TMHMM2.0 at aa 7-29, 73-95, 107-129, 139-161,
FT                   181-203 and 239-261"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(110348..110434)
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT                   /inference="protein motif:Prosite:PS00402"
FT   sig_peptide     complement(110825..110911)
FT                   /locus_tag="BCAM0098"
FT                   /note="Signal peptide predicted for BCAM0098 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.969) with cleavage site
FT                   probability 0.514 between residues 29 and 30"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(110911..111870)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0099"
FT                   /product="putative ABC transporter system permease"
FT                   /note="Similar to Rhizobium loti sugar ABC transporter,
FT                   permease protein SWALL:Q98D12 (EMBL:BA000012) (290 aa)
FT                   fasta scores: E(): 6.6e-68, 63.38% id in 284 aa; contains
FT                   27 amino acid N terminal extension"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0099"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53955"
FT                   /db_xref="GOA:B4EGM3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGM3"
FT                   /protein_id="CAR53955.1"
FT                   /translation="MALANDGTGGRTLGVRPAPSATSARRGRARRDRTSLPWVFLAPTL
FT                   ALLAVLSLVPTIAAINLALRNRVLRYPDSEYVGLRNFVRLASDRRFLNAIEVSVLWEVV
FT                   TVAGAVLVGIALAVFLFERVHGRWRRFASLVLIMPVLLPRVSAAFIWKFMYAPLTGILS
FT                   WLLGTLGVEHTAFLADPHLALYAVALVDVWQWGLFFAVVILKLLETLPPEPLEAARLDY
FT                   ATTWQVHAYIALPMLKAPLVSLVFIKMVESLRSFDLIYVMTKGGPGIATETLDLYAYQQ
FT                   GIGLAGKVSYASGMAVLMMVATTLVFTLIWKRVNKWDD"
FT   misc_feature    complement(110914..111600)
FT                   /locus_tag="BCAM0099"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 0.00053"
FT                   /inference="protein motif:HMMPfam:PF00528"
FT   misc_feature    complement(join(110938..111006,111130..111198,
FT                   111259..111327,111370..111438,111508..111576,
FT                   111691..111759))
FT                   /locus_tag="BCAM0099"
FT                   /note="6 probable transmembrane helices predicted for
FT                   BCAM0099 by TMHMM2.0 at aa 38-60, 99-121, 145-167, 182-204,
FT                   225-247 and 289-311"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(110956..111000)
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        complement(111854..113119)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0100"
FT                   /product="putative periplasmic solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0100"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53956"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGM4"
FT                   /protein_id="CAR53956.1"
FT                   /translation="MRIVAAGLLLGACLPGVAAAQTCKVPTLRVLAQKSLGLSVMEKSL
FT                   ADYEKKNGTKVEISYFGENDRRAKSRLDASTGAGSYQIYYVDEANVAEFASANWIVPLL
FT                   KYYPKDYDYDDFLPGRRAVASYNGVAYFAPLIGGGDFLFYRRDLLDAAHIPVPKTLDQL
FT                   VAAIRKLNAPPKLYGWVARGQRGSGMNVWRWSPFMLGMGGAWTDKGGQPAFNSPAAVKA
FT                   TQLYSDLFKYAPPGSATYDWSNALEAFRSGKVAFMIESTPFADWMEDASKSSVAGKVGY
FT                   TRPPAPLPSAAYGHGFAISAVGAKDDCTRMAAGRFIAWATSKDQEQARLRNGVFSDYNR
FT                   SSTIASPYFKQHVAPQIQAGLNDTNPVTQVTIWRTPQWPDIGDNLGIALEQVFTGTQTD
FT                   IRGTLDDADQYAKDALEHGARK"
FT   misc_feature    complement(112139..113119)
FT                   /locus_tag="BCAM0100"
FT                   /note="HMMPfam hit to PF01547, Bacterial extracellular
FT                   solute-binding prot, score 7.4e-25"
FT                   /inference="protein motif:HMMPfam:PF01547"
FT   sig_peptide     complement(113060..113119)
FT                   /locus_tag="BCAM0100"
FT                   /note="Signal peptide predicted for BCAM0100 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.765 between residues 20 and 21"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(113081..113113)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(113331..114290)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0101"
FT                   /product="putative amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0101"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53957"
FT                   /db_xref="GOA:B4EGM5"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGM5"
FT                   /protein_id="CAR53957.1"
FT                   /translation="MRDEAPPDGMPDALVDAHHHLWRLDAGAHYPWLQAHYDPARFMFG
FT                   DYAALCRNFDVDDFRRAAQCAPLVASVHVEAERARDEALAETRWLHEVAAAHALPSAIV
FT                   AWVDLLAGDADERLAEQAAWPHVRGVRFKPRTAAAPDASIDEPGALRDPRWPAALERLA
FT                   AHGLSWDLRVPFWHLGDAAAMLVDAPDVDVVLEHAGLPWDRSEAGLARWRGGMAALAAL
FT                   PRVTVKISELGLRDAAWNDADNARIIRDTIAIFGWRRCLFASNFPVAGLRVSYPALLRT
FT                   FAGAIAHLDGPARRAIWHDNALRVYRIALDAPHRPARG"
FT   misc_feature    complement(113367..114248)
FT                   /locus_tag="BCAM0101"
FT                   /note="HMMPfam hit to PF04909, Amidohydrolase, score
FT                   1.4e-33"
FT                   /inference="protein motif:HMMPfam:PF04909"
FT   CDS_pept        complement(114292..115239)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0102"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0102"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53958"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGM6"
FT                   /protein_id="CAR53958.1"
FT                   /translation="MNDILLLVQKCAHTFSFYDLDTKAPLKHIVLPNFPHEFTVDVNDR
FT                   YAYVGIFGIETAWSRGHEGDHRIAEIDLVERTHTRMLDLWPYYRPHGMASDRDGRLYAM
FT                   SEAHDMLLVFDEPTRQPVPNMAVPSGGVKTHLVTLTRDASRAYGVHLLSNTVTQFHPRD
FT                   ATVAPRAVMPGPRPEGNALSNDERTLFVANRGDDTLVEIDTETMTCGRRVKTRSDPNRI
FT                   YRTSATGGRDLLLLTNSGERSISVFDARQLEEIERIALPANPTALSFHPSRRVAYVSFQ
FT                   DDHVRELDLDAWRFVGALATLREPDASYVLAGAR"
FT   CDS_pept        complement(115280..116572)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0103"
FT                   /product="Major Facilitator Superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0103"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53959"
FT                   /db_xref="GOA:B4EGM7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGM7"
FT                   /protein_id="CAR53959.1"
FT                   /translation="MNLLNPATPAYDAGEAIPRRRWLRVIPPLLLACIISYMDRVNIAF
FT                   AMPGGMNADLGMDATMAGLAGGIFFFGYLFLQIPGGRRAALGSGKAFIAWSLVSWAVLS
FT                   VLTGLVTHTWQLLALRFLLGVAEGGMLPVVLTMVSHWFPDRERGRANAMVILFVPLAGM
FT                   ITAPLSGFILAAYDWHHLFFCAGALSLLCLVVWMLFADDGPETARWVSPREKAYILDAL
FT                   RDEQERKRAAGTPAATSFGALLRHPTIWLLIAINFCYQAGIYGYTMWLPTLLKNLTHSG
FT                   MGRVGLLAMVPYVAMVIGMLVTSYWSDRTGKRRLFVLLPLVGFAACLALSVLTHASMAV
FT                   SFAFLIGCGFFLQAAAGVFWAIPPKLCSVEAAGSARGLINALGNLGGFCGPYAVGVLTQ
FT                   HVSAAAGVYSLAATLAVAGLLALTLPKRCEG"
FT   misc_feature    complement(115286..116479)
FT                   /locus_tag="BCAM0103"
FT                   /note="HMMPfam hit to PF00083, Sugar (and other)
FT                   transporter, score 0.00019"
FT                   /inference="protein motif:HMMPfam:PF00083"
FT   misc_feature    complement(join(115301..115369,115382..115450,
FT                   115487..115555,115565..115633,115652..115720,
FT                   115763..115831,115973..116041,116051..116119,
FT                   116156..116224,116234..116302,116339..116398,
FT                   116441..116509))
FT                   /locus_tag="BCAM0103"
FT                   /note="12 probable transmembrane helices predicted for
FT                   BCAM0103 by TMHMM2.0 at aa 22-44, 59-78, 91-113, 117-139,
FT                   152-174, 178-200, 248-270, 285-307, 314-336, 340-362,
FT                   375-397 and 402-424"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(115376..116488)
FT                   /locus_tag="BCAM0103"
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 7.8e-67"
FT                   /inference="protein motif:HMMPfam:PF07690"
FT   misc_feature    complement(115529..115561)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    complement(115592..115624)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(116670..117587)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0104"
FT                   /product="putative dihydrodipicolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0104"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53960"
FT                   /db_xref="GOA:B4EGM8"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGM8"
FT                   /protein_id="CAR53960.1"
FT                   /translation="MNARYQGVFPVVPTIFDAHGALDLDGQRRCVDFMIDAGSHGLCIH
FT                   ANYSEQFALGDDERDLITRTTLEHVAGRVPVIVTTSHFSARICAQRNREAQALGAAMVM
FT                   VMPPYHGATFRVPEAQVRAYFRDVADGLDIPLMIQDAPASGVALSASLLATLAREIDAV
FT                   SYFKIETAGAASKLRELIALGGDAIEGPWDGEEGITLLADLDAGATGAMTGGGYPDGIR
FT                   RVTDAYFAGRRDDAYDAYARWLPLINYENRQSGFLTAKALMKEGGVIACDRPRSPWPEL
FT                   PPQVRAGLLDTARRLDPLVLRWGR"
FT   misc_feature    complement(116697..117578)
FT                   /locus_tag="BCAM0104"
FT                   /note="HMMPfam hit to PF00701, Dihydrodipicolinate
FT                   synthetase family, score 3.3e-10"
FT                   /inference="protein motif:HMMPfam:PF00701"
FT   CDS_pept        complement(117596..118768)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0105"
FT                   /product="putative mandelate racemase/muconate lactonizing
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0105"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53961"
FT                   /db_xref="GOA:B4EGM9"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034619"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGM9"
FT                   /protein_id="CAR53961.1"
FT                   /translation="MKIRSVRARVFQWKGKTVPPQGNFCSNAMDLLYAPQETMSTFRFH
FT                   AWTVVEVGTDDGIVGLGNVALAPQVAKAIIDQYLAPLVIGQDPWDYEYLNQRMYRATHA
FT                   WGRKGIGMAAISAVDIAIWDILGKSVGKPVFKLLGGRTKEKIPCYYSKLYRTDLKAMQE
FT                   EAQQYLKEGFRAFKMRFGYGPAHGQQGVVENLKSVAAIREVIGYDNDLMLECYMGWTLE
FT                   YAKRILPKLEKYQPRWLEEPVIADDLDGYAELNRLTRIPISGGEHEFSLYGFKQLLDRK
FT                   AVSVVQYDTNRVGGITMAHKINALCEAYSVPVIPHAGQMHNYHLTMSTLASPMSEYFPM
FT                   FDVEVGNELFYYIFDGEPVAENGFLQLRDDVPGLGLTLKTEFLDQFDIVE"
FT   misc_feature    complement(117608..118345)
FT                   /locus_tag="BCAM0105"
FT                   /note="HMMPfam hit to PF01188, Mandelate racemase /
FT                   muconate lactonizing en, score 1.4e-09"
FT                   /inference="protein motif:HMMPfam:PF01188"
FT   misc_feature    complement(118352..118660)
FT                   /locus_tag="BCAM0105"
FT                   /note="HMMPfam hit to PF02746, Mandelate racemase /
FT                   muconate lactonizing en, score 2.9e-21"
FT                   /inference="protein motif:HMMPfam:PF02746"
FT   CDS_pept        complement(118818..119873)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0106"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0106"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53962"
FT                   /db_xref="GOA:B4EGN0"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGN0"
FT                   /protein_id="CAR53962.1"
FT                   /translation="MHTPSTAATQPVVALTLGDPAGIGAELIAKLLARPDATARANLVL
FT                   IGDRWLWEAGQRVAGVTIDVEPVASLAAVRGRPSTARAAFVAVDTIGAAQVTVGQADAA
FT                   GGRSTLAVLDQCLDAALAGDIDAICFAPLNKYAMKLGGLRHDDELHHFAEALGVTGYFC
FT                   EFNTLGELWTARISSHIPLKDAAGCLSIERIEQASELIYRSLLANGVAAPKVAIAAFNP
FT                   HGGDGGSCGREEVDIIEPAVRRLQARDWPTDTPFHGPFPADTIFLKAQAGDYQAIVTMY
FT                   HDQGQIAIKLLGFSRGVTVQGGLPVPITTPAHGTAYDIAGRGTADVGATWQALQIACRM
FT                   GAARRTAAVSA"
FT   misc_feature    complement(118860..119783)
FT                   /locus_tag="BCAM0106"
FT                   /note="HMMPfam hit to PF04166, Pyridoxal phosphate
FT                   biosynthetic protein Pdx, score 2e-96"
FT                   /inference="protein motif:HMMPfam:PF04166"
FT   CDS_pept        119989..120936
FT                   /transl_table=11
FT                   /locus_tag="BCAM0107"
FT                   /product="LysR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0107"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53963"
FT                   /db_xref="GOA:B4EGN1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGN1"
FT                   /protein_id="CAR53963.1"
FT                   /translation="MGSIDRRDSTPQLLNRLRMRQIALLLAVDECSTLRAAAEQMGLTQ
FT                   PAATKMLAELESALGQRLFDRIGRGLVLNPAGERVLGYFRGIRGSMEALNRELGELQLG
FT                   SAGRLAIGSIMAASPGRLTEALVQLKARYPLLAIDIAVDTSDRLMPQLREGVLEVVIGR
FT                   HVGTDCDFRVVDDEALAIIAGRDHPLAGAGPVEFDALLDYAWIVQPTGSPAREVVEREF
FT                   RSRHQPMPRGLVETGSILTTMNLVDRSSMLGVIPLTVAQRNAAHGLVAIIDYTLEQKLP
FT                   SYGSLVRRDRPLSIPAQQFLALFHRDGAGDDGDA"
FT   misc_feature    120043..120222
FT                   /locus_tag="BCAM0107"
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix, score 2.3e-20"
FT                   /inference="protein motif:HMMPfam:PF00126"
FT   misc_feature    120082..120147
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1421.000, SD 4.03 at aa 32-53, sequence
FT                   STLRAAAEQMGLTQPAATKMLA"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    120085..120177
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00044"
FT   misc_feature    120292..120915
FT                   /locus_tag="BCAM0107"
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 1.2e-27"
FT                   /inference="protein motif:HMMPfam:PF03466"
FT   CDS_pept        complement(121180..122451)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0108"
FT                   /product="Major Facilitator Superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0108"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53964"
FT                   /db_xref="GOA:B4EGN2"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGN2"
FT                   /protein_id="CAR53964.1"
FT                   /translation="MPNDHRQRRHTLWLLCALSFILYVDRVNLATAAGAIKAELGLSNT
FT                   ELGVAFSAFAYSYAICQIGGGWIADRFGARITLIGCGLIWVVSTFTTGLVHSLTLLFAA
FT                   RLLLGIGEGATLPAQARAITHWFPRERRGVVQGFTHSFSRLGNAVTPPIVAALMTWLSW
FT                   RAAFFVIGAVTLVWLAWWIVGFREHPAGDDDGRPRAARPVAPSGPTPWGPLFRRMAPTI
FT                   FVYFCYGWTAWLFFTWLPTFFLNGQGLNLKSTALFASGVFFAGVVGDTLGGWLCDRIYR
FT                   KTGNLALSRQSVIVTSFVGALACLLPLAFVHSTAGVALCLSGSFLCLELTIGPIWAVPS
FT                   DIAPSHAGIASGMMNAGSAISGILSPILFGYLVDRTGSWTVPFIGSVAMLLIGIVAALR
FT                   IRPDRALSESMPALADAPAAPSAH"
FT   misc_feature    complement(121210..122418)
FT                   /locus_tag="BCAM0108"
FT                   /note="HMMPfam hit to PF00083, Sugar (and other)
FT                   transporter, score 0.00026"
FT                   /inference="protein motif:HMMPfam:PF00083"
FT   misc_feature    complement(join(121252..121320,121333..121401,
FT                   121438..121506,121519..121587,121624..121692,
FT                   121720..121788,121897..121965,122158..122226,
FT                   122245..122313,122350..122418))
FT                   /locus_tag="BCAM0108"
FT                   /note="10 probable transmembrane helices predicted for
FT                   BCAM0108 by TMHMM2.0 at aa 12-34, 47-69, 76-98, 163-185,
FT                   222-244, 254-276, 289-311, 316-338, 351-373 and 378-400"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(121330..122409)
FT                   /locus_tag="BCAM0108"
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 1.1e-59"
FT                   /inference="protein motif:HMMPfam:PF07690"
FT   misc_feature    complement(121540..121572)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    complement(122152..122184)
FT                   /note="PS00626 Regulator of chromosome condensation (RCC1)
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00626"
FT   sig_peptide     complement(122356..122451)
FT                   /locus_tag="BCAM0108"
FT                   /note="Signal peptide predicted for BCAM0108 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.714) with cleavage site
FT                   probability 0.567 between residues 32 and 33"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        122633..123319
FT                   /transl_table=11
FT                   /locus_tag="BCAM0109"
FT                   /product="putative membrane protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53965"
FT                   /db_xref="GOA:B4EGN3"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGN3"
FT                   /protein_id="CAR53965.1"
FT                   /translation="MTDDDELSLRPESRFWQLAPVRWWIRGHGRDGYSFGLLLCPLAIV
FT                   FVLEFVCVMAGALYTSIAVSAVATLFLGIAGFHGARREWLMTAAPARALVKARMKKAAE
FT                   RLASLGVGATVLAIFVAATSLSLVMSGRPVLDSVSKDAVSIFIALVFLPVYVSGAVRKL
FT                   AIARIEELEALRHATVGTQLKFDRAGAVRAVVVQGAAGTGTVSVMEYTVLGFSPPLDQV
FT                   GREPRA"
FT   misc_feature    join(122726..122794,122804..122872,122948..123016,
FT                   123059..123127)
FT                   /locus_tag="BCAM0109"
FT                   /note="4 probable transmembrane helices predicted for
FT                   BCAM0109 by TMHMM2.0 at aa 32-54, 58-80, 106-128 and
FT                   143-165"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(123339..124424)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0110"
FT                   /product="two-component regulatory system, sensor kinase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0110"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53966"
FT                   /db_xref="GOA:B4EGN4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGN4"
FT                   /protein_id="CAR53966.1"
FT                   /translation="MRLDGLSRQIALTMGAIAFGITVLIVVTAYVFYYLLYQYSPEYFK
FT                   PQSWVPSGPEWVWIISTTLVGLLIAVVVAVNLSRRILVPLNSVTDSIRRVARGDLGARA
FT                   VAGDRSLKEAALLADNFNALASELQRVTDEQTFWNAAIAHELRTPVTVLRGRLQGLAEG
FT                   VFTPSDALYRSLLAQVEGLTRLIEDLRVVSLADSGHLSIEIRDTDLAAEVRAVVDAFAH
FT                   ALQAAGQHPEFDLDPRRMRCDPVRLRQALLALLENARRHAVPGAIRIQTRIENGMCRLR
FT                   VEDDGPGIPAEFAPHVFQAFRRVDETQPGGTGLGLAVVAAIAHAHRGEALCVPTGAGGT
FT                   RFEVRWPDDLTPAPDSERFPA"
FT   misc_feature    complement(123378..123701)
FT                   /locus_tag="BCAM0110"
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HSP90, score 3e-34"
FT                   /inference="protein motif:HMMPfam:PF02518"
FT   misc_feature    complement(123831..124025)
FT                   /locus_tag="BCAM0110"
FT                   /note="HMMPfam hit to PF00512, His Kinase A
FT                   (phosphoacceptor) domain, score 5e-11"
FT                   /inference="protein motif:HMMPfam:PF00512"
FT   misc_feature    complement(124035..124250)
FT                   /locus_tag="BCAM0110"
FT                   /note="HMMPfam hit to PF00672, HAMP domain, score 2.2e-09"
FT                   /inference="protein motif:HMMPfam:PF00672"
FT   misc_feature    complement(join(124191..124259,124323..124391))
FT                   /locus_tag="BCAM0110"
FT                   /note="2 probable transmembrane helices predicted for
FT                   BCAM0110 by TMHMM2.0 at aa 12-34 and 56-78"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(124421..125158)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0111"
FT                   /product="two-component regulatory system, response
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0111"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53967"
FT                   /db_xref="GOA:B4EGN5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGN5"
FT                   /protein_id="CAR53967.1"
FT                   /translation="MPEFPSSPGAGQGAQALVLIAEDEPEIAEILIAYFARNGLRTVHA
FT                   ADGRRALELHLSLKPDLVLLDVQMPHVDGWKVLAEIRHRGDTPVIMLTALDQDIDKLTG
FT                   LRIGADDYVVKPFNPAEVVARAQAVLRRSMAGARQEEQRVLRAAPFEIDLEHHEATVEV
FT                   DGVRHTLVLTLTEFKLLAQLARAPRRVFSRAELMATCLPEGDALERTVDSHVSKLRKKL
FT                   DDLGVAGVPASVRGVGYKLWSGE"
FT   misc_feature    complement(124436..124660)
FT                   /locus_tag="BCAM0111"
FT                   /note="HMMPfam hit to PF00486, Transcriptional regulatory
FT                   protein, C te, score 1.2e-14"
FT                   /inference="protein motif:HMMPfam:PF00486"
FT   misc_feature    complement(124778..125113)
FT                   /locus_tag="BCAM0111"
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 7.5e-36"
FT                   /inference="protein motif:HMMPfam:PF00072"
FT   CDS_pept        125740..127071
FT                   /transl_table=11
FT                   /locus_tag="BCAM0112"
FT                   /product="amine oxidase"
FT                   /note="Similar to the N-terminal region of Bos taurus amine
FT                   oxidase [flavin-containing] A MAOA SWALL:AOFA_BOVIN
FT                   (SWALL:P21398) (527 aa) fasta scores: E(): 1.4e-26, 31.33%
FT                   id in 466 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0112"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53968"
FT                   /db_xref="GOA:B4EGN6"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGN6"
FT                   /protein_id="CAR53968.1"
FT                   /translation="MLDVAIVGAGLAGLTAARDLRYAGCESFVVLEARDRVGGRTLNYD
FT                   VGGGYVTEVGGQWIGPGQTAVADLARELEVGTFPSYYTGKTVILGGDGRAEIDLEGTFG
FT                   TDEAVAAKLSRLSRDVPCGAPWTSPKARELDRLSVGDWLATQGIKAEDRMGWNASISLS
FT                   GGVAPAKMGLLHFLSMINSADCDYAQLDSIKHSAQETRFVGGSQLLSIRMAQQLGDKVR
FT                   LSSPVRRIVGWDRDIVTLQTDRGTVRAKKVVMALHPALCHQVRFDPPLPDKRVALQRAW
FT                   PAHSPARKTAMVYRRPFWRDKGLNGHIFQTDGPVFWAYDNSPPGGEIGVINAFVRNALM
FT                   PSDPQAAKQMHMDLYAQAWGDEARAPVSYHDRDWGLADPWTLTCVSAIPPGFWSAHGEA
FT                   LRAPCGNLIWSGTETANIWAGYMDGAVRAGHQSALQALNALRHA"
FT   misc_feature    125746..126867
FT                   /locus_tag="BCAM0112"
FT                   /note="HMMPfam hit to PF01266, FAD dependent
FT                   oxidoreductase, score 0.00058"
FT                   /inference="protein motif:HMMPfam:PF01266"
FT   misc_feature    125770..127050
FT                   /locus_tag="BCAM0112"
FT                   /note="HMMPfam hit to PF01593, Flavin containing amine
FT                   oxidoreductase, score 1.7e-42"
FT                   /inference="protein motif:HMMPfam:PF01593"
FT   CDS_pept        127064..127741
FT                   /transl_table=11
FT                   /locus_tag="BCAM0113"
FT                   /product="putative cytochrome c precursor"
FT                   /note="C-terminal region is similar to Chromatium vinosum
FT                   cytochrome subunit of sulfide dehydrogenase precursor FccA
FT                   SWALL:CYSD_CHRVI (SWALL:Q06529) (199 aa) fasta scores: E():
FT                   7.1e-06, 26.4% id in 178 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0113"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53969"
FT                   /db_xref="GOA:B4EGN7"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGN7"
FT                   /protein_id="CAR53969.1"
FT                   /translation="MLRITKMKKRVLLLTAAVATGALLALYGPTLLGFHRLQRHIDTAA
FT                   QADDADGGPWPRVTDVCMGCHGVKGTSLSQAYPSLAGQPAQYVAAQLRAFAGGQRANPT
FT                   MGPLAMTMSEAEITRLAGYYAKQAPLDNRYFKPDARLRTKGEQWVTGGACAACHGARLT
FT                   GQARFPRLAGQGYDYLLAQLDAFATGSRREATGTMQRVAQAMSADDRAAVATYLASLSP
FT                   ATQ"
FT   sig_peptide     127064..127138
FT                   /locus_tag="BCAM0113"
FT                   /note="Signal peptide predicted for BCAM0113 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.860 between residues 25 and 26"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    127097..127165
FT                   /locus_tag="BCAM0113"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAM0113 by TMHMM2.0 at aa 12-34"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    127211..127447
FT                   /locus_tag="BCAM0113"
FT                   /note="HMMPfam hit to PF00034, Cytochrome c, score 0.022"
FT                   /inference="protein motif:HMMPfam:PF00034"
FT   misc_feature    127247..127264
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00190"
FT   misc_feature    127487..127726
FT                   /locus_tag="BCAM0113"
FT                   /note="HMMPfam hit to PF00034, Cytochrome c, score 0.017"
FT                   /inference="protein motif:HMMPfam:PF00034"
FT   misc_feature    127523..127540
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00190"
FT   CDS_pept        127777..128451
FT                   /transl_table=11
FT                   /locus_tag="BCAM0114"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0114"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53970"
FT                   /db_xref="GOA:B4EGN8"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGN8"
FT                   /protein_id="CAR53970.1"
FT                   /translation="MDHRSLVLCLSSATLAATTGVYGFKFVRKRNFLLGFEWWIVTISA
FT                   SNAVIFFATESPVSYFISHFLDAFSRGFGMPVIAVAGLMAVTHGYRPSIRQDVTLFVLA
FT                   TLGTIALVAGVLQHALPYFYVAMWTLMSIYLAGFAWRLARAGHALHALTTTLALVASQA
FT                   IACIYDFYRIPGEDTNVVFNFYVLALLTWSYLTVALYYAYGALEREKGRSRTGAGVLSY
FT                   PK"
FT   sig_peptide     127777..127824
FT                   /locus_tag="BCAM0114"
FT                   /note="Signal peptide predicted for BCAM0114 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.997) with cleavage site
FT                   probability 0.917 between residues 16 and 17"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(127789..127848,127867..127935,127978..128046,
FT                   128065..128124,128134..128202,128221..128289,
FT                   128317..128385)
FT                   /locus_tag="BCAM0114"
FT                   /note="7 probable transmembrane helices predicted for
FT                   BCAM0114 by TMHMM2.0 at aa 5-24, 31-53, 68-90, 97-116,
FT                   120-142, 149-171 and 181-203"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        128525..129127
FT                   /transl_table=11
FT                   /locus_tag="BCAM0115"
FT                   /product="TetR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0115"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53971"
FT                   /db_xref="GOA:B4EGN9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGN9"
FT                   /protein_id="CAR53971.1"
FT                   /translation="MDPVRLTRAERRDATRERLLGAARAILAEKGYAAASVEDIAAAAG
FT                   HTRGAFYSNFGGKADVLFELLRRDRDEAAAALRRIVGSPDPADDAQRAMLAYWRRGATQ
FT                   RAVHLMWLDAQLQAARDPRFRARFGALLRDRQALAAACIDAYAARAGVSLPLPTRVLAL
FT                   GLTALCDGMQSHGAVDALADAVLVGFITHTVFDHLRR"
FT   misc_feature    128579..128719
FT                   /locus_tag="BCAM0115"
FT                   /note="HMMPfam hit to PF00440, Bacterial regulatory
FT                   proteins, tetR family, score 6.3e-14"
FT                   /inference="protein motif:HMMPfam:PF00440"
FT   CDS_pept        129372..130205
FT                   /transl_table=11
FT                   /locus_tag="BCAM0116"
FT                   /product="putative phytanoyl-CoA dioxygenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0116"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53972"
FT                   /db_xref="GOA:B4EGP0"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGP0"
FT                   /protein_id="CAR53972.1"
FT                   /translation="MDAMKRKAFFEDGAVLVEGVLDDEQLAQCRAVYDWGMENPGPMAT
FT                   TLLDGTEYKSHNDNANPYAKERLDALVGTLPFGPLFADLWGSKHVWYFAEELFMKAGGK
FT                   SARSPWHQDTSYLPWQGMHFGNAWISFEHVPKRNALEIVRGSHHGVRHDGTTFQNAEDP
FT                   TDPLHGGDVWPRLPDIEAERRVAPDAYDILSWETKPGDVLLLHPGVLHGGGAVDADFPD
FT                   RHTLVLRFFGDDAVFSPLPDESRSGFTPAGVLFVEELAALKAGDPFRAPCFRQLV"
FT   misc_feature    129390..130046
FT                   /locus_tag="BCAM0116"
FT                   /note="HMMPfam hit to PF05721, Phytanoyl-CoA dioxygenase
FT                   (PhyH), score 4.6e-06"
FT                   /inference="protein motif:HMMPfam:PF05721"
FT   CDS_pept        130222..130635
FT                   /transl_table=11
FT                   /locus_tag="BCAM0117"
FT                   /product="putative endoribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0117"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53973"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="InterPro:IPR038743"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGP1"
FT                   /protein_id="CAR53973.1"
FT                   /translation="MTATPKRQSIVPAAFQPWYDAYHFSPATRVGDTIWVSGQVGLDAQ
FT                   MQPADGVQAQARIAFECLKAILQEAGASLADVVELTTFHTDLQRETEAFAAVKDVYFPN
FT                   RYPSWTAVGVTQLALPGLCVEIRAVAVAGSGKG"
FT   misc_feature    130222..130617
FT                   /locus_tag="BCAM0117"
FT                   /note="HMMPfam hit to PF01042, Endoribonuclease L-PSP,
FT                   score 4.2e-31"
FT                   /inference="protein motif:HMMPfam:PF01042"
FT   CDS_pept        130845..132209
FT                   /transl_table=11
FT                   /locus_tag="BCAM0118"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0118"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53974"
FT                   /db_xref="InterPro:IPR010752"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGP2"
FT                   /protein_id="CAR53974.1"
FT                   /translation="MNKHRFWTTSAIAAAACVAIGTAVAADDLTPAGADRSASKDGAVP
FT                   AYAGKQSPDAGWEWGKVRGDFWKHRNEKPLYSIDAANVDKYADKLSPGQVALIKQKKGY
FT                   RMDVYPSHRECQLPDAAEQNSKANLTAAKLGPAGDTLASAVLPGVPFPQPKNGVEAMLN
FT                   YEMRYRGEGVDWAQMVTTVSPRPGSSEWIDAIGPQTLYFPSAKLGKFSPQDVDQLSAAV
FT                   YFQMNSPAALAGQAFVQRQYFDKASETYYYFPGQRRVRRMPAYTHDAPLIGFENQYLID
FT                   EGNMINGSLDRFNWKLVGKKEMIVPYNAFGMYRFKSKLHDVATPDGVAAANRRYETHRV
FT                   WVVEAALKPSARHVASKKVFYLDEDSWLALVGEDYDAQGKLWKVRESYPIPVWELGGTC
FT                   DNEPLAQYDMNNGRYVLDATSIGQGKDVRWLGQADDPRFKQDFYTAESLRSVSER"
FT   sig_peptide     130845..130919
FT                   /locus_tag="BCAM0118"
FT                   /note="Signal peptide predicted for BCAM0118 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.751 between residues 25 and 26"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    130851..132206
FT                   /locus_tag="BCAM0118"
FT                   /note="HMMPfam hit to PF07044, Protein of unknown function
FT                   (DUF1329), score 2.9e-114"
FT                   /inference="protein motif:HMMPfam:PF07044"
FT   misc_feature    130863..130922
FT                   /locus_tag="BCAM0118"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAM0118 by TMHMM2.0 at aa 7-26"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    130863..130895
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        132288..134132
FT                   /transl_table=11
FT                   /locus_tag="BCAM0119"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0119"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53975"
FT                   /db_xref="InterPro:IPR010727"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGP3"
FT                   /protein_id="CAR53975.1"
FT                   /translation="MESAGLFRNTTILVAMASAATSSAYAYDFTVGGGAVQGSWVTNLT
FT                   AGAGIRTKNPSCSLTGDPNAFGCGAGANTNQWGYADNGDLNYRKGQPFSTYVSATSELL
FT                   LKMPSEGLKFMVRGTGMYDFMAKNTNRTPLSSTAAAQVVYNAQLLDLWAQKDFTLGGRN
FT                   AHVRLGNQVINWGESMFAQSGINATNSIDTQKLLIPGSQLKQALLPAPMVSLAADLSHG
FT                   FSTEAYYQFQWNGNRYPPVGSYWSVTNGFGRGAEPFTINTNNLNVTGPSAGTIANAIGG
FT                   SGAAGNQDTLNAIRNGLVNGAYAGPPFNDIGLPSTTTLPAKYRPQFGVKFNYSPRAFDA
FT                   NFAFYYLNYTDKSPVLASLANGTEQWSYLGRRQLFGVSANFGVGPWAIGTELSYRPRDA
FT                   VALSSCYGAGGPLDLNTNGVAGIDCQQWVDKKKFQYDINGLLALTRSEYPFLKLLGADS
FT                   AALTWELTWIYYPGLKSSGVTRTIDGQTVTQVPQTGYLPWLNNGSAAGYPIGMAQGTSS
FT                   SVGATIDFNWTYDGSLIPGWQVTPGVTFSTGLYGYTPTFTANYVQGAKSLNVYVLFNQN
FT                   PPNWQAGINFTSFWGGHNTVGQPYADRNFVGLFVTRNF"
FT   sig_peptide     132288..132365
FT                   /locus_tag="BCAM0119"
FT                   /note="Signal peptide predicted for BCAM0119 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.999 between residues 26 and 27"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    132315..134129
FT                   /locus_tag="BCAM0119"
FT                   /note="HMMPfam hit to PF06980, Protein of unknown function
FT                   (DUF1302), score 5e-79"
FT                   /inference="protein motif:HMMPfam:PF06980"
FT   CDS_pept        134201..136561
FT                   /transl_table=11
FT                   /locus_tag="BCAM0120"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0120"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53976"
FT                   /db_xref="GOA:B4EGP4"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGP4"
FT                   /protein_id="CAR53976.1"
FT                   /translation="MLNRLVSRLEGLFFGHRAIVLAAIALFTVAMAVFAVQLRMDAGFE
FT                   KQMPIGHEYIRTFQQYRNDLLGANRITVVVRAKHGSIWSKQGLTRLYDVTQAVTYLPNV
FT                   DRIGVRSLWTPNAFVNEVTDEGFRAEPIIPGTVTPDQLTPERVQSIRRATTLGGYVGTL
FT                   VSHGEDSAMITAELNERDSAGKVLDYVAFNHLLEEKIRKPFEDAGYEIQIIGFAKQIGD
FT                   IADGATAVLGFCAVALLLTTLAVYWYCHSVRFTVLLVACSLTSLVWQFGTLKLLGFGLD
FT                   PLAVLVPFLVFAIGVSHGVQQVNFIVREIAHGQSSFDAARHSFSGLLIPGVLALITAFV
FT                   SFITLLLIPIPMVRELAITASLGVAYKIVTNLILLPVAASCFNFTKTYADNSLKRAQQR
FT                   AKPLRVLARVAQPKYAGVTVALTVAIFALAAWQSRDRVIGTLQPGAPELRTDARFNRDA
FT                   TSIAGNYDMGLDWLTVAIESTGKACDNPAVGLYEDDFSAAMKTEPGVVSVQSYSAMLRA
FT                   YNQGYNEDFPKMNVVPIAAENYSAVSVDVSRVKGFMSRDCGMTAVHLFLTDHKATTINR
FT                   ILDDVKQYRASHPFPGITVRLAAGNAGVLAATNDEVEKSELPMMLYVYAAILVLVFLAY
FT                   RDWRAMLACCVPLSVATFIGYWFMKELQIGLTVATLPVMVLAVGIGVDYAFYIYNRLQV
FT                   HLAGGQDIVKAVQHAMLEVGVATIFTAITLAIGVATWSFSALKFQADMGKLLAFMFIVN
FT                   LVMAMTALPALASLLERGFPRRKPARAPGLFSH"
FT   sig_peptide     134201..134305
FT                   /locus_tag="BCAM0120"
FT                   /note="Signal peptide predicted for BCAM0120 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.997) with cleavage site
FT                   probability 0.950 between residues 35 and 36"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(134237..134305,134879..134947,134960..135019,
FT                   135047..135115,135176..135244,135287..135355,
FT                   135440..135493,136052..136105,136124..136177,
FT                   136205..136264,136325..136393,136436..136504)
FT                   /locus_tag="BCAM0120"
FT                   /note="12 probable transmembrane helices predicted for
FT                   BCAM0120 by TMHMM2.0 at aa 13-35, 227-249, 254-273,
FT                   283-305, 326-348, 363-385, 414-431, 618-635, 642-659,
FT                   669-688, 709-731 and 746-768"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    135311..135343
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        136593..136877
FT                   /transl_table=11
FT                   /locus_tag="BCAM0121"
FT                   /product="putative lipoprotein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0121"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53977"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGP5"
FT                   /protein_id="CAR53977.1"
FT                   /translation="MVKTFAVCGALCLVAAAFARFHETVAQQPAPAHAFATDVKRVSVR
FT                   HTTGGEPAAAPSPNDTDAGRRTAAAQVADKPPAIVLGVAHAGWSVLFSH"
FT   sig_peptide     136593..136694
FT                   /locus_tag="BCAM0121"
FT                   /note="Signal peptide predicted for BCAM0121 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.464 between residues 34 and 35"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    136626..136649
FT                   /note="PS00306 Caseins alpha/beta signature."
FT                   /inference="protein motif:Prosite:PS00306"
FT   CDS_pept        136908..137876
FT                   /transl_table=11
FT                   /locus_tag="BCAM0122"
FT                   /product="BNR/Asp-box repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0122"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53978"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR028203"
FT                   /db_xref="UniProtKB/TrEMBL:B4EGP6"
FT                   /protein_id="CAR53978.1"
FT                   /translation="MIKTLVACTALCAAAATFAQPQDGTVAAWAAQPAHAWAAPAHRML
FT                   MDAARAGTRIVAVGEHGIVLLSDDDGKTWRQARRVPVAATLSAVSFADAKHGWAVGQWG
FT                   AILATDDGGDTWVTQRLDTSVDQPLFSVLFTSARDGMAVGLWSLMLQTHDGGRTWARTT
FT                   LPKPPGGGKADRNLYHVFADAAQALYIVSEQGMVLKSADGGANWTYLPTGGKGTLWSGV
FT                   AMPDGRIVVGGLLGSLFESRDGGATWTALHTGTRSSITDLVASGGGLTGVGLDGLVLTQ
FT                   RVAGGPFDVVQRADRATLSAALIDARGKPVLFSQDGVLAAP"
FT   sig_peptide     136908..136964
FT                   /locus_tag="BCAM0122"
FT                   /note="Signal peptide predicted for BCAM0122 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.905 between residues 19 and 20"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    137100..137135
FT                   /locus_tag="BCAM0122"
FT                   /note="HMMPfam hit to PF02012, BNR/Asp-box repeat, score
FT                   0.51"
FT                   /inference="protein motif:HMMPfam:PF02012"
FT   misc_feature    137226..137261
FT                   /locus_tag="BCAM0122"
FT                   /note="HMMPfam hit to PF02012, BNR/Asp-box repeat, score
FT                   7.7"
FT                   /inference="protein motif:HMMPfam:PF02012"
FT   misc_feature    137355..137390
FT                   /locus_tag="BCAM0122"
FT                   /note="HMMPfam hit to PF02012, BNR/Asp-box repeat, score
FT                   13"
FT                   /inference="protein motif:HMMPfam:PF02012"
FT   misc_feature    137499..137534
FT                   /locus_tag="BCAM0122"
FT                   /note="HMMPfam hit to PF02012, BNR/Asp-box repeat, score
FT                   2.8"
FT                   /inference="protein motif:HMMPfam:PF02012"
FT   misc_feature    137622..137657
FT                   /locus_tag="BCAM0122"
FT                   /note="HMMPfam hit to PF02012, BNR/Asp-box repeat, score
FT                   0.12"
FT                   /inference="protein motif:HMMPfam:PF02012"
FT   CDS_pept        137944..139398
FT                   /transl_table=11
FT                   /locus_tag="BCAM0123"
FT                   /product="putative amine oxidase"
FT                   /note="C-terminus is similar to the N-terminal region of
FT                   Homo sapiens amine oxidase [flavin-containing] B MAOB
FT                   SWALL:AOFB_HUMAN (SWALL:P27338) (519 aa) fasta scores: E():
FT                   4.1e-32, 33.54% id in 462 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0123"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53979"
FT                   /db_xref="GOA:B4EH23"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH23"
FT                   /protein_id="CAR53979.1"
FT                   /translation="MQARRRILRAAAAGAASLATGEVSFAEGAASASADRGVFDVVIIG
FT                   AGLAGLTAARDLKRAGCESFVVVEARDRVGGRTYNHDLGNGVVSEAGGQWIGPGQTAIA
FT                   DLARELGVDTFPTYYAGKTVVLAGDARVAQDFHGGSGGDDAIGAKLGALARGVPSREPW
FT                   TAQHAAELDKLTYGDWLLKQGVTYEDGYFLGLAAKLSLGGAPAQLGLLHYLSVINSADC
FT                   DYAKLESTKGGAQETRFVGGSQVLSLRMASELGAKVQLSCPVRKISGWDRDVVDVQTDR
FT                   GVLRARRVIVALNPALCQQIVFDPPLPDGRAQLQRNWPANAPMRKTVHVYDRPFWRDDG
FT                   YNGQIFEVGGPVFMAYDNSPPDGSIGVLAAFVAPGALPAEPKAAERTLSAIFARALGDK
FT                   ALHPTQFHDYDWGRVDPWTLQCIHPLPPGFWTKWGRFLRPEAGRLIWSGTETADLWPGA
FT                   MDGAVRSGHRAALQALGKLAGRGGEA"
FT   sig_peptide     137944..138021
FT                   /locus_tag="BCAM0123"
FT                   /note="Signal peptide predicted for BCAM0123 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.444 between residues 26 and 27"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    138061..139140
FT                   /locus_tag="BCAM0123"
FT                   /note="HMMPfam hit to PF01266, FAD dependent
FT                   oxidoreductase, score 2.7e-06"
FT                   /inference="protein motif:HMMPfam:PF01266"
FT   misc_feature    138085..139365
FT                   /locus_tag="BCAM0123"
FT                   /note="HMMPfam hit to PF01593, Flavin containing amine
FT                   oxidoreductase, score 1.3e-46"
FT                   /inference="protein motif:HMMPfam:PF01593"
FT   CDS_pept        139399..140070
FT                   /transl_table=11
FT                   /locus_tag="BCAM0124"
FT                   /product="putative cytochrome c precursor"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0124"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53980"
FT                   /db_xref="GOA:B4EH24"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH24"
FT                   /protein_id="CAR53980.1"
FT                   /translation="MKRTWMIGAALVIAGVAAAGTLYGPDLVDGMRYQKAMTAIGEGDR
FT                   ANGGAWPQPQETCFFCHGVHGQSQNAWYPSLSGQPATYLAAQLRAFATNQRRNAYMGPL
FT                   SRELDDAKIAALATYFARQAPARNEAVPADAALDKRGMALVEARSCRACHGAALTGKDP
FT                   APRLAGQGQLYLEAQLAAFRSGERHDPTGAMNALAATLSGDDTRAVAHYLAGLSPDGAA
FT                   K"
FT   sig_peptide     139399..139455
FT                   /locus_tag="BCAM0124"
FT                   /note="Signal peptide predicted for BCAM0124 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.877 between residues 19 and 20"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    139411..139479
FT                   /locus_tag="BCAM0124"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAM0124 by TMHMM2.0 at aa 5-27"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    139846..139863
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00190"
FT   CDS_pept        140244..141374
FT                   /transl_table=11
FT                   /locus_tag="BCAM0125"
FT                   /product="saccharopine dehydrogenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0125"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53981"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH25"
FT                   /protein_id="CAR53981.1"
FT                   /translation="MAKHPVVVYGASGYTGMLIMDWLIDQNIPFTAVARNAARAKEMMA
FT                   QRVVRLESAQYEIIEAEHDVDALVKAFRGAKVVCNTVGPFSSFGLVGVEAALKAGCHHL
FT                   DTTGEQSYIRAVRDEFGEQYRQAGLLASSSNAYMYTFAEIAAELALETPGIDALETATL
FT                   TRGPRGAAGVSIGSTATIFDGARHESCYLWEKALVPHAADASFTVATPELMQPVFCLPW
FT                   GGTSLPVYFEHDARVRSCISCVGFYDNNVMKLVHQFGQKWEAEYKHLPREQQDEVLKQV
FT                   VASTTPTMPPRERTTIQRSVDVAIGRGQLAAVRATVHGVTPYISTGAIHAAGVLKLLDG
FT                   ETARTGFASGSKAFGHRYLLGFLEQRGLARATVTQL"
FT   misc_feature    140259..141356
FT                   /locus_tag="BCAM0125"
FT                   /note="HMMPfam hit to PF03435, Saccharopine dehydrogenase,
FT                   score 4.9e-07"
FT                   /inference="protein motif:HMMPfam:PF03435"
FT   misc_feature    141213..141245
FT                   /note="PS00626 Regulator of chromosome condensation (RCC1)
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00626"
FT   CDS_pept        141417..142970
FT                   /transl_table=11
FT                   /locus_tag="BCAM0126"
FT                   /product="putative AMP-binding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0126"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53982"
FT                   /db_xref="GOA:B4EH26"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH26"
FT                   /protein_id="CAR53982.1"
FT                   /translation="MAIIDFYDRGWRLNPDGIAYIQGDRNYTFQEIGELSCRIANGLLA
FT                   AGFAKEAKAAVWADNDVIGWSCALGMWRAGLAYIPVNGRNAVAENQYVLDAFDCEVLFF
FT                   HHAFAAAIDALRPSLPKVRLWVCLDADLPWAPSLASWSEHQPATPPVVDYAMDDVVALS
FT                   ATGGTTGAPKGVMNTHRSLQTYFAQFMIAMTYDDARPVNLAAAPMTHTAGMMSLPCTAR
FT                   GGTVVVLPKPDPALLLGAIVKHRVTEFFLPPTVIYRLLDIPGIEQVDFSSLRYFLYGAA
FT                   PMSVEKLKRAIDVFGPVMTGGYGQTEAPASISYLTPAEHFVDGQLASDARLASVGRPNP
FT                   LVRVEIVGERGELLKQGETGEICVRGDLVMKGYYRAPDKTAETIVDGWLHTGDIGHLDR
FT                   DGYLHITDRKKDMIISGGFNVYPSEIEQVIWAHPAVQDCAVIGVPDDKWGEAVKAVVEL
FT                   NAGQQVSAEELVALCKEKLGSVKAPKSVDFVAALPRSTAGKVLKKDLRERYWQGQQRRI
FT                   "
FT   misc_feature    141498..142736
FT                   /locus_tag="BCAM0126"
FT                   /note="HMMPfam hit to PF00501, AMP-binding enzyme, score
FT                   1.2e-111"
FT                   /inference="protein motif:HMMPfam:PF00501"
FT   misc_feature    141900..141935
FT                   /note="PS00455 Putative AMP-binding domain signature."
FT                   /inference="protein motif:Prosite:PS00455"
FT   CDS_pept        142996..144237
FT                   /transl_table=11
FT                   /locus_tag="BCAM0127"
FT                   /product="putative thiolase"
FT                   /note="Similar to the N-terminal region of Rattus
FT                   norvegicus nonspecific lipid-transfer protein,
FT                   mitochondrial precursor SCP2 SWALL:NLTP_RAT (SWALL:P11915)
FT                   (547 aa) fasta scores: E(): 4.8e-30, 36.54% id in 405 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0127"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53983"
FT                   /db_xref="GOA:B4EH27"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH27"
FT                   /protein_id="CAR53983.1"
FT                   /translation="MSNIYIAGIAMTVFGRHLDRSLDDLAREALQRALRDAGCHADAIR
FT                   AAFYAGITNGALQGQLSIPGQVVFSKIGLEGIPVFNVENACASGSTAVHLAVRQLQSGA
FT                   CDVALALGAEKMNVADKAKSFALFDAGWDVSRVDENFAMLARLGEGIEPPPGSESDRPY
FT                   SRFMKIYAALCRHHMHTYGTTQRQIAAVSAKNHGHSVHNPYSQFRQPFTIDEVLAAAPI
FT                   TYPITLPMCAPLSDGAAAAILCTEEGLERIGADRGRCIRIAASVIRSFTRRRIDEPHKH
FT                   IGRLAALQAYEQAGVGPEDMDVAEVHDASAMGEIIQAENLGFVPLGEGGPAAERGEFTL
FT                   GGRIPINTSGGLESKGHPLGATGIGQLYELVTQLRGEAGARQVDGARHAIQENGGGLQG
FT                   VEEAALAIHILSRD"
FT   misc_feature    142996..143736
FT                   /locus_tag="BCAM0127"
FT                   /note="HMMPfam hit to PF00108, Thiolase, N-terminal domain,
FT                   score 1e-06"
FT                   /inference="protein motif:HMMPfam:PF00108"
FT   CDS_pept        144345..145733
FT                   /transl_table=11
FT                   /locus_tag="BCAM0128"
FT                   /product="putative FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0128"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53984"
FT                   /db_xref="GOA:B4EH28"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH28"
FT                   /protein_id="CAR53984.1"
FT                   /translation="MQAAGADALGPLARWGEEIRADAALRKYRPVGGWVEPPERAQPEL
FT                   EGDVQADAIVVGAGFAGLSTALELAARGASVVVLEREFAGFGASGRNAGYLAGGQGLEY
FT                   ELFLKRVGHEQARRIVGFYDEGVAYVERKLAEYAIDCDYRASGIIRAGVHPSQEKRLRE
FT                   SMATGIELGSPAQFLDGAAMRERGIPPAFLFGAYVPGGGTLDPGKYVTGLRRAALAAGV
FT                   KLYENTALLDFDAGETVRVRTARGSASAPVLVLATNAYTPQLGLLGDKVMPLRVSALET
FT                   EPLSGAQLAALGWPNREGIVTSHLTMESHRLTARNTLLLTTKRLHYVYGSQTPNVPDGD
FT                   TYRALLKTLRARFPQLGDVPVRACWSGYISFAGDALPVVGAAGAHANVFYAAGCSGHGV
FT                   GTQSLIGRVLAERIHDGRSPVLDALTHKTPSMPPEPLRWCAMTAMLGVANLLDERVNRR
FT                   VRPM"
FT   misc_feature    144498..145580
FT                   /locus_tag="BCAM0128"
FT                   /note="HMMPfam hit to PF01266, FAD dependent
FT                   oxidoreductase, score 1.5e-85"
FT                   /inference="protein motif:HMMPfam:PF01266"
FT   CDS_pept        145907..146578
FT                   /transl_table=11
FT                   /locus_tag="BCAM0129"
FT                   /product="TetR family regulatory protein"
FT                   /note="Poor database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53985"
FT                   /db_xref="GOA:B4EH29"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH29"
FT                   /protein_id="CAR53985.1"
FT                   /translation="MSNEQRSPRKRRTSTAAAAAGNTDGLRAQGLRTRNTIIRVARKLL
FT                   LEGGPLEFSQRAVAAAAGISVSNLQYYFPTRIAVLRAVIEPVIEAYLDDMKRAISSDAS
FT                   PRDVFEEIIVRSIADAKDAKYNALFRHFLSFAATDAECLKLCEEWYSALTRDLAQLVRA
FT                   VTPTFSAADSRHAATMLIALADGLAMQYGTIGRHTQALDAYFAATSRAIAYGTLTVPAG
FT                   K"
FT   misc_feature    146015..146155
FT                   /locus_tag="BCAM0129"
FT                   /note="HMMPfam hit to PF00440, Bacterial regulatory
FT                   proteins, tetR family, score 1.2e-08"
FT                   /inference="protein motif:HMMPfam:PF00440"
FT   misc_feature    146063..146128
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1673.000, SD 4.89 at aa 53-74, sequence
FT                   FSQRAVAAAAGISVSNLQYYFP"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        146750..148039
FT                   /transl_table=11
FT                   /locus_tag="BCAM0130"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0130"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53986"
FT                   /db_xref="GOA:B4EH30"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH30"
FT                   /protein_id="CAR53986.1"
FT                   /translation="MIRLNKSAALPVVGMTGFETPLSEEESAIQHTVHRFARDVLRPIG
FT                   RELDRMTAEDVIAPGSPYWAAIVESAKLGLDPQLIAQFPPETAVRIESLIGEELGWGDS
FT                   GLAVSIGAATMPLMMAHTVGNAELIEMCAGKVGCWMNTQPDRGSDAAILYRQELAGNGR
FT                   QPVGNVTAKVGADEIVINGQSSAWISNGSVAQVALAYMAADYGDGFYGEGERSAFTNGI
FT                   AMILPLDLPGVSRGKPLDKIGQRSLPQGEIYFDNVKVPKRFAVALKDDYLGNLASTWSY
FT                   AGTHMCQVFVGAARAAFELALAYCHERKQGGALLMDHQMTHLRIGEMLRRLEMARAIAR
FT                   RSLAFSRMSPQSHPYATAQAKVSVTEEAMKITHEAFQLFGGNGTTREFPIEKLFRDVRS
FT                   ALIEDGENYVLASRLGVLAGRLYENGWTRE"
FT   misc_feature    147554..147994
FT                   /locus_tag="BCAM0130"
FT                   /note="HMMPfam hit to PF00441, Acyl-CoA dehydrogenase,
FT                   C-terminal doma, score 3e-20"
FT                   /inference="protein motif:HMMPfam:PF00441"
FT   misc_feature    147599..147961
FT                   /locus_tag="BCAM0130"
FT                   /note="HMMPfam hit to PF08028, Acyl-CoA dehydrogenase,
FT                   C-terminal doma, score 6.5e-09"
FT                   /inference="protein motif:HMMPfam:PF08028"
FT   CDS_pept        complement(148102..148983)
FT                   /transl_table=11
FT                   /gene="hchA"
FT                   /locus_tag="BCAM0131"
FT                   /product="chaperone protein HchA"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0131"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53987"
FT                   /db_xref="GOA:B4EH31"
FT                   /db_xref="InterPro:IPR017283"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH31"
FT                   /protein_id="CAR53987.1"
FT                   /translation="MTSDTTQVDRTPAPDPAENNAYFPSPYSLSQYTSSKTDFDGADYP
FT                   NPYTGGKWKVLMIATDERYILMTNGKMFSTGNHPVEMLLPMHHMDKAGFEIDIATLSGN
FT                   PAKLELWAMPQDDEAVQSTYRKYLPKLKTPLKLSDVLDRHSGADSPYIAVFIPGGHGVL
FT                   AGIPHSKDVKRTLRWALDHDRHIITLCHGPACLLSAAVDEDPQDYPFKDYEICVFPDAL
FT                   DTGPNLDIGYMPGPLPWLVAQSLEKLGARVLNKDMTGRCHQDRKLITGDSPLASNGVGK
FT                   LAAAALLKEVGH"
FT   misc_feature    complement(148237..148614)
FT                   /gene="hchA"
FT                   /locus_tag="BCAM0131"
FT                   /note="HMMPfam hit to PF01965, DJ-1/PfpI family, score
FT                   0.0028"
FT                   /inference="protein motif:HMMPfam:PF01965"
FT   CDS_pept        149338..151005
FT                   /transl_table=11
FT                   /locus_tag="BCAM0132"
FT                   /product="putative AMP-binding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0132"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53988"
FT                   /db_xref="GOA:B4EH32"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH32"
FT                   /protein_id="CAR53988.1"
FT                   /translation="MNSSYPYPQDEPASSAHAYPLLIKQLLHAPLATRPEQEIVYGDRV
FT                   RHDYWTFRHRIGQLASGLASIGVGAGDVVAVLDWDSHRYLECYHAIPMMGAVLMTANVR
FT                   LSPDQLLYTLNHSGARIVLVHRDFLPLLAGMRDRLDTVRHVVLIADGDEAVLPDGFTDE
FT                   YEALVAAGSPDFAFPDFDEQTRATTFYTTGTTGLPKAVAFTHRQLVLHTLAGMAALSSA
FT                   RDRGRVHRDDVYMPITPMFHVHAWGMPYIATALGLKQVYPGRYSPDGLVALIAREAVTF
FT                   SHCVPTLLAMILDSPASAAVDLSAWKVIVGGSPLSDGLARAALARGIEVYTGYGMSETC
FT                   PLMTIAQIDPPRAAGGASADDDIARRTKAGLPLPLVDLRIVDAQFRDVPHDGRSAGEVV
FT                   VRMPWATQGYLGDAPASAALWAGGYLHTNDIGVIDPDGRLQITDRIKDVIKTGGEWVSS
FT                   LELESILSRHPAVRESAVIGVKNARWGERPLALVVLTDEQAGRVEPEELKAHVKQVADR
FT                   GLISRYAVPERLLIVDAIEKTSVGKINKRALRERYQPD"
FT   misc_feature    149479..150765
FT                   /locus_tag="BCAM0132"
FT                   /note="HMMPfam hit to PF00501, AMP-binding enzyme, score
FT                   3.9e-86"
FT                   /inference="protein motif:HMMPfam:PF00501"
FT   CDS_pept        151296..154061
FT                   /transl_table=11
FT                   /locus_tag="BCAM0133"
FT                   /product="LuxR superfamily regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0133"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53989"
FT                   /db_xref="GOA:B4EH33"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041617"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH33"
FT                   /protein_id="CAR53989.1"
FT                   /translation="MAPMDSRQPARPPDPDAIEVLVRTKLAPASARGIVARIARLGRLR
FT                   RGLDRRLTLVCAPAGYGKTTLLAEWRHALVASDVKVAWVSLDQDDDNASIFASYVVAAI
FT                   VDATGGVGARAQQLLRDRALIPLKTVFDELLNELDSAGVDLFLMLDDFDRLASPVIHDA
FT                   MFDLLRYAPSNLHVVLACRSVPALPLSYFESRDELVRVDEHDLRFDDTETRAFFERVAG
FT                   KPLNADNVARLRAATEGWVSGLQLAALALHDDSDAARVAEQVSHARAGIAAYLNDNVMT
FT                   QVPDAIRHFLLHTAVLDRMTPALCDALTGRDDALDCLEWLNAHNLFIRSIDGDRRRYRY
FT                   HALFLQYLREELALREPGAVATLHRRASAWYAAERQWPDAVRHALAAGDFDAAAGWVEA
FT                   CAMKLIASSDVRTVLDWVSRLPAQALAGRLRLRIAHTWALALSMQMVEARRALEALEAD
FT                   IATGRLDTDAVTATELLAVRSLIAGLSDHSIESLQLGERVLAAAPPAGSWVEQIGQTTL
FT                   IFGLGYAGRLGDVRDLGARAEHAASGHEPLYANVYRQNMSGLAEFVAGRLHDASKTFET
FT                   ALHAAERSAGRLSAATALSAGYLSAIYYEWNDWAKVRDAQADRFDIAMQACSLGPLLRF
FT                   MQTAALLQFQSGNDARAHDMLDEADRVACSRQWLRLRVACMATGIRLHLAAGKPTQAHR
FT                   VGRALASLVSPVPPDEASSHVETWQMAQSAQARLLLADARASEAAQRMATVHAVLAARG
FT                   FDWFAAQAAVLLAIALDQAGDESAALAALARALEYGQGNGLVRTFVDEGAAAERLLARV
FT                   HRRADRFPAVGAWYLRDLARAFDGQRQSNATPATRQGGPGNLSAREVEILDYVARGLSN
FT                   KEIARALRVAPETIKWHLKNVFEKLNVTSRIQAVRSGLALDPSRVRRDDE"
FT   misc_feature    151464..151487
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    151806..151838
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    153846..154019
FT                   /locus_tag="BCAM0133"
FT                   /note="HMMPfam hit to PF00196, Bacterial regulatory
FT                   proteins, luxR family, score 6.8e-20"
FT                   /inference="protein motif:HMMPfam:PF00196"
FT   misc_feature    153897..153980
FT                   /note="PS00622 Bacterial regulatory proteins, luxR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00622"
FT   misc_feature    153900..153965
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1736.000, SD 5.10 at aa 869-890, sequence
FT                   LSNKEIARALRVAPETIKWHLK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        complement(154087..154959)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0134"
FT                   /product="LysR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53990"
FT                   /db_xref="GOA:B4EH34"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH34"
FT                   /protein_id="CAR53990.1"
FT                   /translation="MNWDDARVFLAIHRERTLRRAAQTLGVDQATVGRRLATLEHMLGA
FT                   TLFLRSSKGYLPTPVGELALRAAEAMEQHAHELVRLTHGVDRRLAGEVKITTTDALAIE
FT                   FVMPSIARLHAKHPDVSVALNTSTHILNLAKREADIAIRTVRPENPDLVARRLACWDMG
FT                   LFASPDYLRRHGEPERGRAFAGHDLVVYQPYIDASRKPTLAGEPIDGGRIVTRTNSNLM
FT                   MRAALRAGLGVGEIPVHMGERDGLTRIWPDRMRQSPYEVWLVTHRDLRHTARIRAAIDE
FT                   IVAAFAAHR"
FT   misc_feature    complement(154099..154704)
FT                   /locus_tag="BCAM0134"
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 2.4e-38"
FT                   /inference="protein motif:HMMPfam:PF03466"
FT   misc_feature    complement(154774..154953)
FT                   /locus_tag="BCAM0134"
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix, score 1.2e-18"
FT                   /inference="protein motif:HMMPfam:PF00126"
FT   misc_feature    complement(154849..154914)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1474.000, SD 4.21 at aa 16-37, sequence
FT                   RTLRRAAQTLGVDQATVGRRLA"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        155154..156191
FT                   /transl_table=11
FT                   /locus_tag="BCAM0135"
FT                   /product="putative quinone oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0135"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53991"
FT                   /db_xref="GOA:B4EH35"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH35"
FT                   /protein_id="CAR53991.1"
FT                   /translation="MTAIEIVRPGGPDVLVPATRAVPVPGPDDVLIRIHAAGVNGPDVF
FT                   QRKGLYDPPPGASDIPGLEIAGEVVAVGRDVTRFAVGDRVCALIPGGGYAEYAVANESN
FT                   TLAIPDGLGMAEAAALPETFMTVWLNLFQRGRLSPGESVLIHGGASGIGTTATMLAKAF
FT                   GASTIITTVGSEAQRDASMRLGADLAIDYRSEDFVEAVARFTGGKGVDVIVDIIAGDYV
FT                   ARNFAAAAMNGRIVQIGVINGPAKELDLFPMLTKRLTHIGSTLRSRTYAEKAQIIRELE
FT                   EAVWPLIRQGTVKPRVYRLFDLRDARAAHELMDSGRHIGKIVLATRAAEGLLRAAVDAN
FT                   AKHST"
FT   misc_feature    155232..155477
FT                   /locus_tag="BCAM0135"
FT                   /note="HMMPfam hit to PF08240, Alcohol dehydrogenase
FT                   GroES-like domain, score 1.2e-23"
FT                   /inference="protein motif:HMMPfam:PF08240"
FT   misc_feature    155568..155999
FT                   /locus_tag="BCAM0135"
FT                   /note="HMMPfam hit to PF00107, Zinc-binding dehydrogenase,
FT                   score 2e-39"
FT                   /inference="protein motif:HMMPfam:PF00107"
FT   CDS_pept        156329..157312
FT                   /transl_table=11
FT                   /locus_tag="BCAM0136"
FT                   /product="LysR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0136"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53992"
FT                   /db_xref="GOA:B4EH36"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH36"
FT                   /protein_id="CAR53992.1"
FT                   /translation="MDMLENMRTFVRVVQAGSFSAVAKQTDVATAQVSRAVASLEAYAQ
FT                   IRLLNRTTRKIALTDSGRRYFERLQSILGDVDQANAEARNALVRPYGRLRVHTMPGLGQ
FT                   SHVTASAVAYRARFPDVAIEMTYSQRMPNLVEEGYDVSVVTAASLPDSACIAHSCGTSF
FT                   SVLVASPAYLARHGAPAVPADLARHTCLRLDTPAEANGEWLLHGAGGQAVSHAVAAAPF
FT                   HANAPEAMSIALRAGLGIGSLAIYSAIDDLRSGRLVRVLPDYRLTMLDVYAMYASRRFL
FT                   DAKVRTFVDHLRATLSPALKADARALDALAAPHGRDHARALSGVTA"
FT   misc_feature    156338..156517
FT                   /locus_tag="BCAM0136"
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix, score 4.3e-14"
FT                   /inference="protein motif:HMMPfam:PF00126"
FT   misc_feature    156377..156442
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1361.000, SD 3.82 at aa 17-38, sequence
FT                   GSFSAVAKQTDVATAQVSRAVA"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    156587..157219
FT                   /locus_tag="BCAM0136"
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 1e-33"
FT                   /inference="protein motif:HMMPfam:PF03466"
FT   CDS_pept        157361..157738
FT                   /transl_table=11
FT                   /locus_tag="BCAM0137"
FT                   /product="putative phospholipid-binding exported protein"
FT                   /note="Similar to the N-terminal region Escherichia coli,
FT                   and Escherichia coli O6 osmotically inducible protein Y
FT                   precursor osmY SWALL:OSMY_ECOLI (SWALL:P27291) (201 aa)
FT                   fasta scores: E(): 0.71, 28.57% id in 119 aa, and to the
FT                   full length Xanthomonas campestris hypothetical protein
FT                   XCC3437 SWALL:Q8P5A4 (EMBL:AE012463) (120 aa) fasta scores:
FT                   E(): 5.5, 30.68% id in 88 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0137"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53993"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH37"
FT                   /protein_id="CAR53993.1"
FT                   /translation="MKSRFAIVVAGFVALSPLAAHAQSAPSAAPAEQAASATASPRAAK
FT                   KAERAADRAFAKKVRRAIVRAPGVGNAQVTVFAKAKTGDVTLAGQIADESQDRAAVDAA
FT                   RQVPGVTSVKSKLQLRLEGGQ"
FT   sig_peptide     157361..157426
FT                   /locus_tag="BCAM0137"
FT                   /note="Signal peptide predicted for BCAM0137 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.994 between residues 22 and 23"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        158225..158899
FT                   /transl_table=11
FT                   /locus_tag="BCAM0138"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0138"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53994"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH38"
FT                   /protein_id="CAR53994.1"
FT                   /translation="MAELFLVRHGQASFGTDDYDRLSAAGDQQGVWLGEYFARQGLTFD
FT                   RVICGTMNRHAQTVAAILRGMDREGVAVDRHPGLNEYDFHGLFAAAASDYPEIARLAAG
FT                   SMKEHFRALRQVLQLWTEDKLGDAAPETWAHFQQRVADARAAIRHGGGQRVLAVSSGGP
FT                   IAVTVQQVLAAPPSSAIALNLQIRNSSLSQFFFNAEAFHLASFNGIPHLEDPERHALRT
FT                   YG"
FT   misc_feature    158231..158725
FT                   /locus_tag="BCAM0138"
FT                   /note="HMMPfam hit to PF00300, Phosphoglycerate mutase
FT                   family, score 2.9e-15"
FT                   /inference="protein motif:HMMPfam:PF00300"
FT   CDS_pept        158919..159950
FT                   /transl_table=11
FT                   /locus_tag="BCAM0139"
FT                   /product="putative phosphotransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53995"
FT                   /db_xref="GOA:B4EH39"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR041726"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH39"
FT                   /protein_id="CAR53995.1"
FT                   /translation="MTNPSQQLDVARLTRYLETHVPGFEGPVDTEKFAGGQSNPTFLLN
FT                   AKSGRYVLRRQPPGELLKSAHAVDREFRVLTALSGTAVPVAHPYHLCEDRDVIGSLFYV
FT                   MSFEDGRIFWDPALPELPKAERATCYDALLQTMAALHDVDVDAVGLADYGRPGNYFERQ
FT                   IGVWTKQYRAAETGRLDAMETLIDWLPKACPEDTGRPALVHGDFRIDNLMFARDGYRVQ
FT                   AVLDWELSTLGNPLADLAYFCMCLRLPSGGQVRGLAGQDRAALGIPDEAAIVARYCELR
FT                   GIAPIRDWHFYLAFSFFRLAAIAQGVKARALQGNASSEQALRVGEMAGRLAELAVGVID
FT                   AHR"
FT   misc_feature    159003..159740
FT                   /locus_tag="BCAM0139"
FT                   /note="HMMPfam hit to PF01636, Phosphotransferase enzyme
FT                   family, score 1.3e-51"
FT                   /inference="protein motif:HMMPfam:PF01636"
FT   misc_feature    159522..159560
FT                   /note="PS00109 Tyrosine protein kinases specific
FT                   active-site signature."
FT                   /inference="protein motif:Prosite:PS00109"
FT   CDS_pept        159982..160764
FT                   /transl_table=11
FT                   /locus_tag="BCAM0140"
FT                   /product="putative short-chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0140"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53996"
FT                   /db_xref="GOA:B4EH40"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH40"
FT                   /protein_id="CAR53996.1"
FT                   /translation="MEEHSNMATNLFDLTGKIALVTGASRGIGEEIAKLLAEQGAHVIV
FT                   SSRKIDDCQAVADAIVAAGGRAEALACHVGRLEDIAATFEHIRGKHGRLDILVNNAAAN
FT                   PYFGHILDTDLAAYEKTVDVNIRGYFFMSVEAGKLMKTHGGGAIVNTASVNALQPGDRQ
FT                   GIYSITKAAVVNMTKAFAKECGPLGIRVNALLPGLTKTKFAGALFADKDIYETWMTKIP
FT                   LRRHAEPREMAGTVLYLVSDAASYTNGECIVVDGGLTI"
FT   misc_feature    160030..160536
FT                   /locus_tag="BCAM0140"
FT                   /note="HMMPfam hit to PF00106, short chain dehydrogenase,
FT                   score 3.6e-28"
FT                   /inference="protein motif:HMMPfam:PF00106"
FT   misc_feature    160438..160524
FT                   /note="PS00061 Short-chain dehydrogenases/reductases family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00061"
FT   CDS_pept        160772..161530
FT                   /transl_table=11
FT                   /locus_tag="BCAM0141"
FT                   /product="putative short-chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0141"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53997"
FT                   /db_xref="GOA:B4EH41"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH41"
FT                   /protein_id="CAR53997.1"
FT                   /translation="MKLDSYAGQAVMITGAASGFGALLARELAAMGARLALGDLNGDAL
FT                   ERVAAPLRAGGADVLAQRCDVRIETDVASLVQEAVARFGRLDVGINNAGIAPPMKALID
FT                   TDEADLDLSFAVNAKGVFFGMKHQIRQMLVQREGVILNVASMAGLGGAPKLAAYAASKH
FT                   AVVGLTKTAALEYARHGIRVNAVCPFYSATPMVTDSEIGERQEFLAQGSPMKRLGRPDE
FT                   IVATMLTLCAKENTYLTGQAVAVDGGVSAF"
FT   misc_feature    160796..161302
FT                   /locus_tag="BCAM0141"
FT                   /note="HMMPfam hit to PF00106, short chain dehydrogenase,
FT                   score 1.9e-26"
FT                   /inference="protein motif:HMMPfam:PF00106"
FT   misc_feature    161204..161290
FT                   /note="PS00061 Short-chain dehydrogenases/reductases family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00061"
FT   CDS_pept        161570..162814
FT                   /transl_table=11
FT                   /locus_tag="BCAM0142"
FT                   /product="putative acyl-CoA dehydrogenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53998"
FT                   /db_xref="GOA:B4EH42"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH42"
FT                   /protein_id="CAR53998.1"
FT                   /translation="MDFGYTPKVEALRERVSAFMDAHIVPRIRQWNDEVHAGQYPVSFM
FT                   EELKERAKAEGLWNLFLPHLKDDEPGMGLTNLEYAPLAEIMGRVSWASEVFNCNAPDTG
FT                   NMELLHMFATPEQREQWLLPLLRGEIRSAFAMTEPDVASSDATNITTRIERIGDEYVIN
FT                   GRKWFITNAAHPNCKIFIVMGKTDPDAESHQQQSMILVPRDTPGVTVVRNITVVNHHAP
FT                   EGHCEITFDNVRVPARNLLGEEGSGFALAQARLGPGRIHHCMRSIGAAELALELMVDRA
FT                   QSRVAFGKPLNRHGTVGEWIARSRIEIDQARLLVLKAAWMIDKVGAKAARKEISMIKAL
FT                   VPTVYTDVCDRAMQVFGAAGLSPDTPLADLWTWGRALRFADGPDEVHLQAIARMEIKDG
FT                   EPGATAPYLTPPPRD"
FT   misc_feature    161966..162130
FT                   /locus_tag="BCAM0142"
FT                   /note="HMMPfam hit to PF02770, Acyl-CoA dehydrogenase,
FT                   middle domain, score 3.1e-23"
FT                   /inference="protein motif:HMMPfam:PF02770"
FT   misc_feature    162302..162757
FT                   /locus_tag="BCAM0142"
FT                   /note="HMMPfam hit to PF00441, Acyl-CoA dehydrogenase,
FT                   C-terminal doma, score 1.2e-43"
FT                   /inference="protein motif:HMMPfam:PF00441"
FT   misc_feature    162347..162715
FT                   /locus_tag="BCAM0142"
FT                   /note="HMMPfam hit to PF08028, Acyl-CoA dehydrogenase,
FT                   C-terminal doma, score 9.2e-07"
FT                   /inference="protein motif:HMMPfam:PF08028"
FT   CDS_pept        162891..163796
FT                   /transl_table=11
FT                   /locus_tag="BCAM0143"
FT                   /product="LysR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0143"
FT                   /db_xref="EnsemblGenomes-Tr:CAR53999"
FT                   /db_xref="GOA:B4EH43"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH43"
FT                   /protein_id="CAR53999.1"
FT                   /translation="MRLSKIDLNLFVVFEAIYNKRNLTRAAEVLNLTQPAVSNALARLR
FT                   KTLNDPLFVSTPAGMMPTPMAENIVGRVREALQLLDSSAHEGDVFDPASSERVFRLSMS
FT                   DLTEALLLPALGELLQTHAPGMHVRSYTMDRREVATALANGSVDIAIDAPLIGDPHLHQ
FT                   ALLVQDRYACMIRDDHPFNGDTLTMDDYLSMGHIHVSSRRKGSGHVDAELTRLGLRRNI
FT                   QMRVQHYMVAPLIAMRSDLALTAPLRLLQRYPARILELPFEMPGLDYFCYWHRSADQDQ
FT                   GSQWLREQLMTLMGGIGEVR"
FT   misc_feature    162912..163091
FT                   /locus_tag="BCAM0143"
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix, score 2.1e-19"
FT                   /inference="protein motif:HMMPfam:PF00126"
FT   misc_feature    162951..163016
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1798.000, SD 5.31 at aa 21-42, sequence
FT                   RNLTRAAEVLNLTQPAVSNALA"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    162954..163046
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00044"
FT   misc_feature    163164..163775
FT                   /locus_tag="BCAM0143"
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 1.9e-18"
FT                   /inference="protein motif:HMMPfam:PF03466"
FT   CDS_pept        complement(163813..164940)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0144"
FT                   /product="DnaJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54000"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH44"
FT                   /protein_id="CAR54000.1"
FT                   /translation="MTARRGAAVAIAPGHETASLSKAQQTFNTLVKQIETRRERLGAWE
FT                   AVMPAFQKKFVDALLPLEQEATALRIRLIHLLDDAFLQKGLSKAEQRTLSDLIVDMARD
FT                   LLDVSDDATLKIIYDRHAGPAHTGHAAGAPEPAKPGREQEPEPQPPEDLDTLSPDELAA
FT                   RMQAELDAQFERDMAAHAAREAQRAKRKKAPKQSAAQARIEAEQAESSKSIREIYRKLA
FT                   SALHPDREPDPQEQQRKTVLMQRVNRAYEKGNLLQLLELQLEIEQIDRRAIDGLGEARL
FT                   TRYNGILEEQLRELDQEIVHVEHDFRRTYGIAPSTKVAPDTVLRMLARDIAGMQRSNQD
FT                   LTVTLREFEDPDQVRNWLKDMKRRPASSRFDDESY"
FT   misc_feature    complement(164155..164313)
FT                   /locus_tag="BCAM0144"
FT                   /note="HMMPfam hit to PF00226, DnaJ domain, score 0.0049"
FT                   /inference="protein motif:HMMPfam:PF00226"
FT   CDS_pept        complement(165048..165374)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0145"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0145"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54001"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH45"
FT                   /protein_id="CAR54001.1"
FT                   /translation="MKSLIVTIAAVTTTATALLAAPTLSYAQSSSHSTLTRAQVRQELL
FT                   DLESVGYNPSIGDGDSYPDDIVAAQERLAAKRLAEHKNAEAGYGPNGAPGSDSGAPAAA
FT                   AVAH"
FT   sig_peptide     complement(165294..165374)
FT                   /locus_tag="BCAM0145"
FT                   /note="Signal peptide predicted for BCAM0145 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.720 between residues 27 and 28"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(165294..165362)
FT                   /locus_tag="BCAM0145"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAM0145 by TMHMM2.0 at aa 5-27"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(165890..168274)
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /gene_synonym="dinA"
FT                   /locus_tag="BCAM0146"
FT                   /product="DNA polymerase II"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0146"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54002"
FT                   /db_xref="GOA:B4EH46"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017964"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR042087"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH46"
FT                   /protein_id="CAR54002.1"
FT                   /translation="MTAFEQGFILTRHWRDTASGIEIEFWLATGHGPRRVRLRPQEAVA
FT                   FIPAEQQALAERTLAGERDAELRPLALRDFRQRRVVGLYCKRYRHLSGLQKRLAAAGVD
FT                   VYEADVQPPDRYAMERFITACVEFRGQPGRDGTLTGGELKPATGYRPALRCVSLDIETS
FT                   VHGELYSIALEGCGQRQVYMLGPPNGDERDSTGTLDFNLDYCDSRPAMLARLNDWFDEH
FT                   DPDAVIGWNLVQFDLRILHAHAEQYGVPLKLGRGGSVLDWRTHGQQPDHFFAGAAGRLI
FT                   LDGIDMLKSATWTFPSFSLEYVSQSLLGEGKSIDNPYQRMDEIQRRFDHDKPALARYNL
FT                   KDCELVTRIFDKADLLSFALERASVTGLAADRTGGSVAAFTHLYLPRMHRLGYVAPNLG
FT                   DVTGQNSPGGFVMDSRPGLYDSVLVFDYKSLYPSIIRTFLIDPVGLIEGLAHPADDTSV
FT                   PGFLGARFSRTAHCLPDIVRRVWEGRDDAKRQRNAPLSQALKIIMNSFYGVLGSTGCRF
FT                   FDPRLASSITMRGHEIMHRTRKLIEAQGYEVIYGDTDSTFVWLGRAHDDDEAGAKGRAL
FT                   VEHVNRWWQAHLREQFGLDSALELQYERHYRRFLMPTVRGAEEGSKKRYAGLAATADGG
FT                   EDLVFKGLETVRTDWTPLAQQFQRELYRRVFRREPYQDFIRDYVRRTLAGEFDDQLVYR
FT                   KRVRRPLREYERNVPPHVRAARIADEFNHAQGRPLQYQRGGWISYVMTTAGPEPLETMR
FT                   SPIDYAFYLSRQLQPVADAILPFLRDDFERVISGQGQLFGD"
FT   misc_feature    complement(165899..167152)
FT                   /gene="polA"
FT                   /locus_tag="BCAM0146"
FT                   /note="HMMPfam hit to PF00136, DNA polymerase family B,
FT                   score 1.3e-27"
FT                   /inference="protein motif:HMMPfam:PF00136"
FT   misc_feature    complement(166601..166627)
FT                   /note="PS00116 DNA polymerase family B signature."
FT                   /inference="protein motif:Prosite:PS00116"
FT   misc_feature    complement(166730..166762)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    complement(167366..168196)
FT                   /gene="polA"
FT                   /locus_tag="BCAM0146"
FT                   /note="HMMPfam hit to PF03104, DNA polymerase family B,
FT                   exonuclease do, score 5.9e-16"
FT                   /inference="protein motif:HMMPfam:PF03104"
FT   CDS_pept        complement(168376..169134)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0147"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0147"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54003"
FT                   /db_xref="GOA:B4EH47"
FT                   /db_xref="InterPro:IPR036041"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH47"
FT                   /protein_id="CAR54003.1"
FT                   /translation="MNFILRVGRTWDTQIDAIRDAVTEHTNLIRYDNTYYRICSNAAPP
FT                   SFTISLLPSTGGTPLVLNMRTRDLYVELIGGHPFENYSHNLDRMPFDAIATSGSDAVRG
FT                   FSLDSAIRGLLRTPDGDKRMLTPDDRFLAQSLVVFCVAESLRFDKIATELGQYFRSSYD
FT                   PNHPEITSFLKGATPIRYLQSWLKMAKNWEKTTRDVFDGIPDKMREIVVQPRDRLSPAD
FT                   RQASARVDTTAFGEVTQKIAPGMRVLMRPS"
FT   misc_feature    complement(168964..168981)
FT                   /note="PS00343 Gram-positive cocci surface proteins
FT                   'anchoring' hexapeptide."
FT                   /inference="protein motif:Prosite:PS00343"
FT   CDS_pept        169626..172472
FT                   /transl_table=11
FT                   /locus_tag="BCAM0148"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0148"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54004"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR018769"
FT                   /db_xref="InterPro:IPR028244"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH48"
FT                   /protein_id="CAR54004.1"
FT                   /translation="MDAHSMIGALTGGLIQQERLLKLDTPLGSNVLIPHRVFGQSRIGR
FT                   DYLFMVDCVSTSNDVQLKALISQPITLWIQQTDKSYLPHHGYIHTARKLGVDGGLACYQ
FT                   LSFSSWLHFLKFRRDQRHWQDKTVDAIIADVFDAHPQARGMYRFELSQPLPSRSYCRQD
FT                   ETDWNFVHRLLESEGLYGVWRQAQDGKSHTLVMTDRLQTLEPLAPATVEFSRAGVHGEV
FT                   DALTQWAGTRTLQSVLLSTRTFDYKNPSTPANPKATSVPTMANQGDLPSQAEVYEYTGG
FT                   YTYPEQERGDHLGKIRMEEWESRAKRYDGVGGVRRIDAGRRFTLTGHPEHDQDAADHRE
FT                   FAVIEVEWIIVNNVPLSGHEANYPHSLYSAVKQADADDPDKLFTVSHDDGSTGFYRVAI
FT                   EAQRTSVPYRSPLEHRKPEAKLESAIVAGPKGQQAYTDSLNRIKVLFIWDRHNEGDERA
FT                   SCWVRVAQSDTGDGYGGVHMPRAGEELLIGHIGNDIDRPIALHRVYNGAAKPRWHSNAL
FT                   LSGYRSQEFSGSGYNQMVMDDSTGQNRVHLYSSSTNAALHLGYLIDQNDNARGGYLGKG
FT                   FDLSSEAYGALRAGRGLFVTTHPVASQPLDASLATRQLNGSANILDGLSQASETSKAES
FT                   LKDGHDTFKAFADATQHSESGATGGGGVTAGGGTGDASAFKQPVILMAAPAGIGLSTQK
FT                   STHVAADQHVNIVSGQSTHVATGKSLVASITEKLSLFVQNAGMKLFAAKGKIEVQTHAD
FT                   NVEVTAQKSLLLASVTEKVQASAQQEILLTSGGAYIRLKGGDIEIHAPGKIDIKGAQHA
FT                   FSGPARMDVTHPAFKDLPTRRLMLNTMASPSATRVVPVGMPYKLYADGALVKQGVFDKT
FT                   GQLPIDHQVTTQKYTLEMANGVKHEIPVPGEYRDAENGKLANQGFQYHEGAPDDGAAPD
FT                   RATHRQIYNELLSPSSEA"
FT   misc_feature    170886..171122
FT                   /locus_tag="BCAM0148"
FT                   /note="HMMPfam hit to PF04524, Protein of unknown function,
FT                   DUF586, score 2.7e-27"
FT                   /inference="protein motif:HMMPfam:PF04524"
FT   CDS_pept        172476..174527
FT                   /transl_table=11
FT                   /locus_tag="BCAM0149"
FT                   /product="putative phospholipase D protein"
FT                   /note="Similar to Ralstonia solanacearum probable
FT                   phospholipase protein rs03737 SWALL:Q8XS51 (EMBL:AL646079)
FT                   (652 aa) fasta scores: E(): 3.5e-85, 50.36% id in 691 aa.
FT                   C-terminus is weakly similar to the C-terminal region of
FT                   Arabidopsis thaliana phospholipase D beta 1 PLDbeta1
FT                   SWALL:PDB1_ARATH (SWALL:P93733) (967 aa) fasta scores: E():
FT                   0.06, 24.01% id in 483 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0149"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54005"
FT                   /db_xref="GOA:B4EH49"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR015679"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH49"
FT                   /protein_id="CAR54005.1"
FT                   /translation="MANINKSITTPIAQNHTSSAMACLPWFVCNSEYSPSAAGFRPLVN
FT                   GRDAFAAVYKAIADAKHSIDIICWGFQPSMYFLRDGTGKRIGELLEQKGKEGVKVRLLC
FT                   WRDPFYMAELSENNMPGNDFITPLKRALPKWVYDHVSMLGRDYQTDEERVFDINWYQRA
FT                   NLNNVTNPVSHSVTDRIIEDTVNLPLNVVAALSKPFTSGSNPVLHKIAGFPNIELATRG
FT                   FDLSVRSEIVGRISGYGTMDGWSGGTKATTSAAMGGEPSHHQKMVLVDYDDSDLATGFV
FT                   MGHNMLDQYWDTDKHSYQAMAPSKGRNGPYPWQDISSRVTGPILQYLNKNFCEAWDDAT
FT                   GQKLAKSREHLAGIHKIRNDAPDDVSVMAQIVRTQSEKNKREIQVMYLNAVNNATQCIF
FT                   IQNQYFRWNDLALKIKDVAKAHAKAGRDFGRDGSIYLFVITNSSDDAVGNGTVRTYQML
FT                   ESLGCGNSMPGVAQLQRSDDYAAQQKDLEAQLAAQQSIQHKFAAQGVDINAASLQGAMN
FT                   FYQDNMAKQQELQQALNELKRKKQLNAHIDPDAPPLDIEGLKVQVCTLVAPDSPGGNWL
FT                   PVYVHAKLMTIDDAFMTIGSANVNLRSMNVDSELNICHENSVVTKSLRQRLWSMHAGDK
FT                   GAQEDFFKSFMAWHDIVEQNKVNKTKNLPPEKSLVKFVRTSAKRTYAD"
FT   misc_feature    172512..172544
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    172521..172553
FT                   /note="PS00133 Zinc carboxypeptidases, zinc-binding region
FT                   2 signature."
FT                   /inference="protein motif:Prosite:PS00133"
FT   misc_feature    173247..173345
FT                   /locus_tag="BCAM0149"
FT                   /note="HMMPfam hit to PF00614, Phospholipase D Active site
FT                   motif, score 0.5"
FT                   /inference="protein motif:HMMPfam:PF00614"
FT   misc_feature    174201..174284
FT                   /locus_tag="BCAM0149"
FT                   /note="HMMPfam hit to PF00614, Phospholipase D Active site
FT                   motif, score 0.0036"
FT                   /inference="protein motif:HMMPfam:PF00614"
FT   CDS_pept        174531..175838
FT                   /transl_table=11
FT                   /locus_tag="BCAM0150"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0150"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54006"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH50"
FT                   /protein_id="CAR54006.1"
FT                   /translation="MNRHILIVFLSVSLCACTEKESKVSQLPDLSAVRANLEFVCAHES
FT                   DHLPSLDPNADILFKYARYLQKNSGPKDYDDILRYYRIAAAYDHYKANTNAQLLISQGL
FT                   ASSPDAEKESVDLASRLVDKGIPSGYYDIGHYLEGGYGLKKNPEMSLRYFRKAADLGSP
FT                   EAQYYVADLLAPMDKAPEVAKQMRECATAQGFGKAASALGIDLKTDKHYAEAVKAFQKG
FT                   VESGDVQSASFLENGFEAPPESDRLYYLALSKDPERTRRYDLIARFLDHNDGRNPKVPD
FT                   IDKIVPLPPAKLPPWDGTFQWQKEQDAATPPQKPSDEFINEMAKAKHLDPATGLPLPGS
FT                   ADKTSQAEQPENVASRLPLGTVAHTGQTCPEDGVWCAKLGAGQFGDTQRRFLKGDALPS
FT                   VVVHEPRKLAVLDSMMGTRRHVEQVAWELVAYLDQA"
FT   sig_peptide     174531..174578
FT                   /locus_tag="BCAM0150"
FT                   /note="Signal peptide predicted for BCAM0150 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.777) with cleavage site
FT                   probability 0.450 between residues 16 and 17"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    174549..174581
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    174909..175016
FT                   /locus_tag="BCAM0150"
FT                   /note="HMMPfam hit to PF08238, Sel1 repeat, score 1.1e-06"
FT                   /inference="protein motif:HMMPfam:PF08238"
FT   CDS_pept        175913..176050
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BCAM0150A"
FT                   /product="putative lipoprotein (fragment)"
FT                   /note="Probable gene remnant. Similar to the N-terminal
FT                   region of Neisseria meningitidis hypothetical protein
FT                   NMB1470 SWALL:Q9JYR0 (EMBL:AE002496) (181 aa) fasta scores:
FT                   E(): 3.7, 46.51% id in 43 aa"
FT   sig_peptide     175913..175978
FT                   /locus_tag="BCAM0150A"
FT                   /note="Signal peptide predicted for BCAM0150A by SignalP
FT                   2.0 HMM (Signal peptide probability 0.998) with cleavage
FT                   site probability 0.501 between residues 22 and 23"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    175931..175963
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        176050..176448
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BCAM0151"
FT                   /product="conserved hypothetical protein (fragment)"
FT                   /note="Probable gene remnant. Similar to the C-terminal
FT                   region of Ralstonia solanacearum probable phospholipase
FT                   protein rs03737 SWALL:Q8XS51 (EMBL:AL646079) (652 aa) fasta
FT                   scores: E(): 1e-16, 50% id in 120 aa"
FT                   /db_xref="PSEUDO:CAR54008.1"
FT   CDS_pept        176452..177762
FT                   /transl_table=11
FT                   /locus_tag="BCAM0152"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0152"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54009"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH52"
FT                   /protein_id="CAR54009.1"
FT                   /translation="MRKSLVIYTVVLLVCACTNKEDSVDSNLPDMSDVRANLALTCVHE
FT                   SEHLPPLDPRADQLFQYGRYLQKIDGPKDFDEIVRYYRIAAAYGHYKANTNAQRLISQG
FT                   LANSPDGAKETIALAKKLIDDGVPGGYYDIGHYLEAGYGVKQDAEMALRYFRKAADMGS
FT                   PEAQTYVAEQLAPHDRAPEIARQMRQCATNQGYGDAANYLGINFKNDSKYSDAVLSFQK
FT                   GVKAGSAQAALALEEGFNGPEASNRLSYLALAHDPERSRRYRLIGKFLDSNESRNPKVP
FT                   DLDKIVPLPPAKLPPWDGTFQWQKEQDAATPPQKPSDEFINEMAKAKHLDPATGLPLPG
FT                   SADKTSQAEQPENVASRLPLGTVAHTGQTCPEDGVWCAKLGAGQFGDTQRRFLKGDALP
FT                   SVVVHEPRKLAVLDSMMGTRQHVEQVAWELVAYLDQA"
FT   sig_peptide     176452..176511
FT                   /locus_tag="BCAM0152"
FT                   /note="Signal peptide predicted for BCAM0152 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.780) with cleavage site
FT                   probability 0.336 between residues 20 and 21"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    176470..176502
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    176833..176940
FT                   /locus_tag="BCAM0152"
FT                   /note="HMMPfam hit to PF08238, Sel1 repeat, score 4.4e-08"
FT                   /inference="protein motif:HMMPfam:PF08238"
FT   CDS_pept        complement(178270..179289)
FT                   /transl_table=11
FT                   /gene="kdgT"
FT                   /locus_tag="BCAM0153"
FT                   /product="2-keto-3-deoxygluconate permease"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0153"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54010"
FT                   /db_xref="GOA:B4EH53"
FT                   /db_xref="InterPro:IPR004684"
FT                   /db_xref="InterPro:IPR018395"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH53"
FT                   /protein_id="CAR54010.1"
FT                   /translation="MKLKQAIDRIPGGLMLVPMLLGACVHTFAPIAGKYFGSFTNGLIA
FT                   GTVPILAVWFFCMGATINLRATGVVLRKSGTLLATKIVVAWLATLIAAQFIPDDGIRTG
FT                   LFAGLSLLAITTSMDMTNGGLYAAVMQQYGSKEEAGAFVLMSIESGPLVSMLILGAAGV
FT                   AVFETRLFVGAVLPFLIGFTLGNLDEDLRELFGRCVHPLIPFFGFALGNGIDLNVIAKS
FT                   GLPGIALGLAVIVVTGVPLILADKFVGGGNGTAGLAASSTAGAAVANPAIIGEMIPKFK
FT                   PMVPAATAIVATACLVTAILVPILTAMWAKRAARVSGVPVRAAARVGNGGAIEHEGHV"
FT   misc_feature    complement(178348..179289)
FT                   /gene="kdgT"
FT                   /locus_tag="BCAM0153"
FT                   /note="HMMPfam hit to PF03812, 2-keto-3-deoxygluconate
FT                   permease, score 4.4e-198"
FT                   /inference="protein motif:HMMPfam:PF03812"
FT   misc_feature    complement(join(178375..178443,178471..178539,
FT                   178558..178614,178642..178710,178729..178788,
FT                   178801..178869,178906..178974,179002..179061,
FT                   179098..179166,179194..179253))
FT                   /gene="kdgT"
FT                   /locus_tag="BCAM0153"
FT                   /note="10 probable transmembrane helices predicted for
FT                   BCAM0153 by TMHMM2.0 at aa 13-32, 42-64, 77-96, 106-128,
FT                   141-163, 168-187, 194-216, 226-244, 251-273 and 283-305"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(178405..178437)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    complement(178756..178803)
FT                   /note="PS00225 Crystallins beta and gamma 'Greek key' motif
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00225"
FT   misc_feature    complement(179218..179250)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        179571..180407
FT                   /transl_table=11
FT                   /gene="kduI"
FT                   /locus_tag="BCAM0154"
FT                   /product="4-deoxy-L-threo-5-hexosulose-uronate
FT                   ketol-isomerase"
FT                   /EC_number="5.3.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0154"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54011"
FT                   /db_xref="GOA:B4EH54"
FT                   /db_xref="InterPro:IPR007045"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR021120"
FT                   /db_xref="InterPro:IPR027449"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EH54"
FT                   /protein_id="CAR54011.1"
FT                   /translation="MDVRQGIHSEHAKALDTAGLRRHFLVENVFAPDALSLTYSHIDRI
FT                   IVGGAWPATRPVEVPASLGAEMGVSHLLARRELGAINIGGPGWVEVDGQRHAVGTEEAI
FT                   YIGQGGQGVVFGSDDHARPAKFYLNCAPAHTAYPTRTITLAQASPETLGDAATSNRRTI
FT                   YKFIVPDVLPTCQLSMGMTKLEPGSLWNTMPCHTHERRMEVYFYFNLAADAAVFHLLGE
FT                   PGETRHVVVHNEQAVISPSWSIHSGVGTQAYTFIWGMAGENQVFKDMDHIAVADLR"
FT   misc_feature    179571..180404
FT                   /gene="kduI"
FT                   /locus_tag="BCAM0154"
FT                   /note="HMMPfam hit to PF04962, 5-keto 4-deoxyuronate
FT                   isomerase, score 7.2e-176"
FT                   /inference="protein motif:HMMPfam:PF04962"
FT   CDS_pept        180412..181218
FT                   /transl_table=11
FT                   /gene="kduD"
FT                   /locus_tag="BCAM0155"
FT                   /product="2-deoxy-D-gluconate 3-dehydrogenase"
FT                   /EC_number="1.1.1.125"
FT                   /note="CDS is extending at the N-terminus in comparison to
FT                   orthologues"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0155"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54012"
FT                   /db_xref="GOA:B4EH55"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011286"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH55"
FT                   /protein_id="CAR54012.1"
FT                   /translation="MKRETPELPAAGAHAALARLFDLTGKVAIVTGCNTGLGAAMAVAL
FT                   ASAGCDIVGANRSSPDATSARVAAAGRRFVDVRADLSTLEPVERIVEGAVDAFGHVDIL
FT                   VNNAGMIRRCDALAFTEADWDAVIDVNLKSVFFLSQAVARQMVRQGRGGKIVNVASMLS
FT                   FQGGIRVPSYTASKSGVLGLTRLLANEWAARGINVNAIAPGYMETDNTAQLREDSRRSD
FT                   EILGRIPAGRWGVPDDLAGAAVFLASRASDYVHGHTLAVDGGWLAR"
FT   misc_feature    180487..180987
FT                   /gene="kduD"
FT                   /locus_tag="BCAM0155"
FT                   /note="HMMPfam hit to PF00106, short chain dehydrogenase,
FT                   score 7.5e-29"
FT                   /inference="protein motif:HMMPfam:PF00106"
FT   misc_feature    180529..180561
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    180889..180975
FT                   /note="PS00061 Short-chain dehydrogenases/reductases family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00061"
FT   CDS_pept        181278..182174
FT                   /transl_table=11
FT                   /gene="kdgR"
FT                   /locus_tag="BCAM0156"
FT                   /product="transcriptional regulator KdgR"
FT                   /note="Lack of similarity at the N-terminus in comparison
FT                   to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0156"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54013"
FT                   /db_xref="GOA:B4EH56"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH56"
FT                   /protein_id="CAR54013.1"
FT                   /translation="MTATPRQRKRDQANQETGGGQPGADLSAAGSVEKPDSVAAVGKVF
FT                   TILAALGERREIGISELSHQLGMSKTTVHRFLQTLKTLGYVAQEGETDRYRLTIRLFEL
FT                   GSKALESVDLVREADLEMRRIGQLTREAVHLGAFDEDAIIYIHKIDADYGLRMQSRIGR
FT                   RNPLYSTAIGKVLLAWMTPGDARAVLAGIEFRKSTAKTLASADAVMSILPHVRQQGYGE
FT                   DNEEQEDGLLCLAVPVFDRFGRVIAGLSLSFPTMRCGADTKAHYVALLKEAGQAISARL
FT                   GHHPEAVGVEATTIAQD"
FT   misc_feature    181404..181565
FT                   /gene="kdgR"
FT                   /locus_tag="BCAM0156"
FT                   /note="HMMPfam hit to PF08279, HTH domain, score 0.0022"
FT                   /inference="protein motif:HMMPfam:PF08279"
FT   misc_feature    181446..181511
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1838.000, SD 5.45 at aa 57-78, sequence
FT                   IGISELSHQLGMSKTTVHRFLQ"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    181734..182117
FT                   /gene="kdgR"
FT                   /locus_tag="BCAM0156"
FT                   /note="HMMPfam hit to PF01614, Bacterial transcriptional
FT                   regulator, score 7e-46"
FT                   /inference="protein motif:HMMPfam:PF01614"
FT   misc_feature    181932..181997
FT                   /note="PS01051 Bacterial regulatory proteins, iclR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS01051"
FT   CDS_pept        182234..182611
FT                   /transl_table=11
FT                   /locus_tag="BCAM0157"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0157"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54014"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH57"
FT                   /protein_id="CAR54014.1"
FT                   /translation="MQMKMTMRMGITMLVLGASLAASGAHATRAVDCGQLDAATSGPDD
FT                   NFRPPASGTVIGTGRAYFYSAPDAQCMTKRTFIVPGDSVTVYKSHGRWYNIMYVNGKTG
FT                   DDFEGWVEQGRVRLDGRYGAQ"
FT   sig_peptide     182234..182314
FT                   /locus_tag="BCAM0157"
FT                   /note="Signal peptide predicted for BCAM0157 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.942 between residues 27 and 28"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(182630..184141)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0158"
FT                   /product="putative diguanylate phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0158"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54015"
FT                   /db_xref="GOA:B4EH58"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR024744"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH58"
FT                   /protein_id="CAR54015.1"
FT                   /translation="MFFAAVIICVLVPAFAIVLADRYARDAVTAHERVVANDIVASVDR
FT                   ILDGVRLRHADELTALVGRPCATVFRTLAEVGTRLRYLRAVALVNDGRVMCSSALGSID
FT                   LPLAAYAREPEPGSMIVTLLRQTPFQHGIPVLSAFRATARGAGVLYLIEGDYVADALNH
FT                   GTGDGAETATLSIAGSGRLDQHGKFAPETAAGPAGGSTMASQRWPFTVSVIASARYASQ
FT                   VQRHYRLICATIVLLADSLVMAAYLLAMAPRRLLLKAVRHALRRNEFHVVYQPIVDVQT
FT                   RRTVGVEALLRWHHPKWGAISPAAFIPQVESSTVLPKVTEFVLRTAVSELTALTPSAPL
FT                   RIAVNVAPQDLERGRFVAVVEEAIRALPPGFTLVLEVTERILLEKNARTTEIFQTLRSK
FT                   GAKFAIDDFGTHHSNLDMLSRFPFDYVKIDRQFISQLDGGSARLIEGIAAVAHHYGLKI
FT                   IAEGVETEAQHRALHAVGIQYAQGYLYQRPLRAENLKRDFAWAPV"
FT   misc_feature    complement(182678..183388)
FT                   /locus_tag="BCAM0158"
FT                   /note="HMMPfam hit to PF00563, EAL domain, score 2.5e-84"
FT                   /inference="protein motif:HMMPfam:PF00563"
FT   misc_feature    complement(join(183389..183457,184082..184132))
FT                   /locus_tag="BCAM0158"
FT                   /note="2 probable transmembrane helices predicted for
FT                   BCAM0158 by TMHMM2.0 at aa 4-20 and 229-251"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(184082..184141)
FT                   /locus_tag="BCAM0158"
FT                   /note="Signal peptide predicted for BCAM0158 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.910) with cleavage site
FT                   probability 0.612 between residues 20 and 21"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        184660..184956
FT                   /transl_table=11
FT                   /locus_tag="BCAM0159"
FT                   /product="conserved ypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0159"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54016"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH59"
FT                   /protein_id="CAR54016.1"
FT                   /translation="MEENAGPTVIVTDGAAVADGGSLWIRIAVDGQTRDYSLDRALASR
FT                   GTPRYDSIRGTHGVLSNEERRALRVLLERIADPAMWAGIVGTFIEVLKRADGP"
FT   CDS_pept        complement(184977..185282)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0160"
FT                   /product="putative exported protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0160"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54017"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH60"
FT                   /protein_id="CAR54017.1"
FT                   /translation="MKRVALAAALTLFAAFNAPAIAGASSGAVAPVPAQAHAKNCVPSR
FT                   DAAPGARSPSGAPPIRVCVGDADTQLNLPWFLTDVLTAVDTHQSPSGLLHKMRNDF"
FT   sig_peptide     complement(185217..185282)
FT                   /locus_tag="BCAM0160"
FT                   /note="Signal peptide predicted for BCAM0160 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.676 between residues 22 and 23"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(185369..186415)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0161"
FT                   /product="AraC family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0161"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54018"
FT                   /db_xref="GOA:B4EH61"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH61"
FT                   /protein_id="CAR54018.1"
FT                   /translation="MPAASPLATQRIYYSSTYVRLLFDYLSGQGKDAARVLGEARPPED
FT                   DRGLTLYASAHWRRLLERAADALDDPLLGLHVGQRITPAHLGALGYALHACRDAGAALA
FT                   RWQQYEHLIANVARMEVRVEATSVAIEWHDAPEPLGPLVDEVALTAIVQFARNITGTRT
FT                   GPDEVGFVHPSPGDEQPYRDYFGCPVRFGQPVNRLAFPLRLLTQPLQRPDDALRQMMER
FT                   QASALLAELRQTDDLEQSVREAVARLLTQGEVSIEQIASDLHVSSRTLHRRLAGLGLNF
FT                   RRLREDTRRRLAIDHLNDPRLTLAEVAWLLGYSEHSAFTRAFRRWTGESPQQWRSRQPA
FT                   RAASVARG"
FT   misc_feature    complement(185408..185542)
FT                   /locus_tag="BCAM0161"
FT                   /note="HMMPfam hit to PF00165, Bacterial regulatory
FT                   helix-turn-helix protei, score 2.4e-07"
FT                   /inference="protein motif:HMMPfam:PF00165"
FT   misc_feature    complement(185591..185656)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1299.000, SD 3.61 at aa 254-275, sequence
FT                   VSIEQIASDLHVSSRTLHRRLA"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        186525..187442
FT                   /transl_table=11
FT                   /locus_tag="BCAM0162"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0162"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54019"
FT                   /db_xref="GOA:B4EH62"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH62"
FT                   /protein_id="CAR54019.1"
FT                   /translation="MTWLHAFLGNDVDWKQVLLIGMTPVFLIAFAVEYAVMTRRGRREP
FT                   FSWKEIVANLSLGAGYQVAETVTGLLLSGAIFAWVYRHRLFDVPVNGFTIVPIFVVVEF
FT                   CYYWFHRTSHRVRWFWAAHVPHHSGEVMNFTTAMRQSLLNAFVGVFLFYLPPVWLGIPP
FT                   AVVLFLLAVDLTYQYFVHTEAIGRLPRWFEYVFDTPSNHRAHHGRNPRYIDRNYGGVLI
FT                   IFDRMFGTYVEETEPVDYGITQQIRSYNFLVLNVHEFVDMWRDVLAPGPVLQRLKHLWM
FT                   PPEWERPGHRPIHTWSVERKGGKG"
FT   misc_feature    join(186567..186635,186696..186764,186792..186851,
FT                   186948..187007)
FT                   /locus_tag="BCAM0162"
FT                   /note="4 probable transmembrane helices predicted for
FT                   BCAM0162 by TMHMM2.0 at aa 15-37, 58-80, 90-109 and
FT                   142-161"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(187493..187867)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0163"
FT                   /product="putative microcin immunity protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0163"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54020"
FT                   /db_xref="GOA:B4EH63"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH63"
FT                   /protein_id="CAR54020.1"
FT                   /translation="MNSIITRSFGGLTRPYYIRNFLFSLIFPTVFIFISSFGKESLPGG
FT                   LLALVLIFMAVSCLLYPYSRFVYESVVNYIVGRNMFFVNAALMLVVKFMTMFLCWYLAI
FT                   FIAPLGLAYLFFRHRPTGAN"
FT   misc_feature    complement(join(187520..187588,187598..187657,
FT                   187676..187744,187754..187807))
FT                   /locus_tag="BCAM0163"
FT                   /note="4 probable transmembrane helices predicted for
FT                   BCAM0163 by TMHMM2.0 at aa 21-38, 42-64, 71-90 and 94-116"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(187694..187726)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   sig_peptide     complement(187754..187867)
FT                   /locus_tag="BCAM0163"
FT                   /note="Signal peptide predicted for BCAM0163 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.624) with cleavage site
FT                   probability 0.359 between residues 38 and 39"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(188051..189679)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0164"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0164"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54021"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH64"
FT                   /protein_id="CAR54021.1"
FT                   /translation="MTRPTRTAAALTIACLLLAACGGDDDPTPPATSVDNNGTAPAPQP
FT                   QPQPTPDPAPATYYQTKTPYRPQQDAATYEAPPADYAPVYTELVARHGSRGLSGFKYDG
FT                   AIYAMLVKAEADGALTALGAQLKADTYAMMKANALLGYGVQGISTPGYGNLTQTGIREH
FT                   QQLAARLAQRLPALFAAGNRQVVVVNSGQDRAVDSSTYFSAALVAAQPALAPAITLPAA
FT                   PAGYPANAPVAQPAGTNRFLLYFHSLKPATDLVTDTSDPYYATYQASQAYQAYANDATV
FT                   AAKLKAIKAAPQAADVARTVLTALVSPAFIAKLGTDGYTFANTGTYAFTSTDGKFTNTL
FT                   KGDGKTKIATAVDAVNVLYNLLQVAPAMTAETGGVTMEKYIGAEQAQYLAYLQDAEDYY
FT                   QKGPGIQEANPVTYRMAKVLQDDFFGEVDAIARGDLTHAAKLRFTHAEIVIPFASIMNL
FT                   KNVFVPTPQAQTYTYANNPWRGDQVSPMAANMQWDVYRNGTRLIVKMLYNERETDFQAA
FT                   CDGAKIAPTSHFYDYAGLKQCYGYQ"
FT   misc_feature    complement(188156..189418)
FT                   /locus_tag="BCAM0164"
FT                   /note="HMMPfam hit to PF00328, Histidine acid phosphatase,
FT                   score 0.00035"
FT                   /inference="protein motif:HMMPfam:PF00328"
FT   sig_peptide     complement(189614..189679)
FT                   /locus_tag="BCAM0164"
FT                   /note="Signal peptide predicted for BCAM0164 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.499 between residues 22 and 23"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(189617..189649)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(189862..190296)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0165"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0165"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54022"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH65"
FT                   /protein_id="CAR54022.1"
FT                   /translation="MVIEAIVTRLDAAFAQIEATPDSRESRHQRDAIIQWLDRASEEGY
FT                   RLGLVTTLPAARLSDMFEGQFGRANLDRFSVVVTDSDQQDSGSNQHPFDVALQALGVPP
FT                   ERAVGIASSEPERREVEHFGLSRCVNITDTVRSIASAGLH"
FT   CDS_pept        complement(190623..191981)
FT                   /transl_table=11
FT                   /gene="ndh"
FT                   /locus_tag="BCAM0166"
FT                   /product="NADH dehydrogenase"
FT                   /EC_number="1.6.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0166"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54023"
FT                   /db_xref="GOA:B4EH66"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH66"
FT                   /protein_id="CAR54023.1"
FT                   /translation="MDNTTPTLATDRAPRVPRIVIVGGGAGGLQLATRLGDTVGRRGQT
FT                   DVVLVDRYPTHFWKPLLHEAASGHRDPASHTIEYAAQAKRHGFRFVQGALRRVDRAART
FT                   ATIAAVRDADGTEILPQRELDYDDLVLAVGSVTNFFNVPGAERHALPLENLDQAEDFRR
FT                   KFLAACTKANHLAEQQPARRGAPICINVIGAGATGVELAAALRHAIQQLTTYRFKALVS
FT                   ARDVHIRLIEGGPRILPALDERLSGKMHAQLRALNVDVLTDTRVAEVGADAVTTAAGER
FT                   LASDITIWAAGVAGPAMLRDIGDIALNRSNQVIVTDTLQTPDDPHVYAFGDCAACPSTG
FT                   AGGFLPPRAQVAHQQAVYLVNAFARRVAGKPVAGFTFRDAGTVVSLGHAGAVYQADIGV
FT                   RSRSLIVDGLAAIGLYKFLYRKHLFSVVGVKRALFQSLSHWLQSRNQPSIKLH"
FT   misc_feature    complement(190791..191930)
FT                   /gene="ndh"
FT                   /locus_tag="BCAM0166"
FT                   /note="HMMPfam hit to PF01266, FAD dependent
FT                   oxidoreductase, score 0.0016"
FT                   /inference="protein motif:HMMPfam:PF01266"
FT   misc_feature    complement(190968..191930)
FT                   /gene="ndh"
FT                   /locus_tag="BCAM0166"
FT                   /note="HMMPfam hit to PF07992, Pyridine
FT                   nucleotide-disulphide oxidoreduc, score 1.9e-16"
FT                   /inference="protein motif:HMMPfam:PF07992"
FT   misc_feature    complement(191106..191420)
FT                   /gene="ndh"
FT                   /locus_tag="BCAM0166"
FT                   /note="HMMPfam hit to PF00070, Pyridine
FT                   nucleotide-disulphide oxidoreduc, score 2e-12"
FT                   /inference="protein motif:HMMPfam:PF00070"
FT   CDS_pept        192082..193035
FT                   /transl_table=11
FT                   /locus_tag="BCAM0167"
FT                   /product="LysR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0167"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54024"
FT                   /db_xref="GOA:B4EH67"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH67"
FT                   /protein_id="CAR54024.1"
FT                   /translation="MYSLIGKTATFRQLKALDMIARLGSVSRAAEELNLTQPAVSLQVR
FT                   LLEEAVGAALLQRVGRGVQLTAAGEIVARYAREILHLWSEAGDEVAALTGDLGGTLRIG
FT                   AITTAEYLIPPLLVKFTATRPHVKTYFKVGNRDDIIRMLATHEIDLAVMGSAPKELRTH
FT                   AVEFAKHPMVFVAAPGHPLMQRKRVALKDLESAHLLVRERGAGTRSTVESLFKNAGHRF
FT                   HVGSELSSNEAIKQMAEAGLGVAFLSLHACALELRTGLLGQLPFPGNPIEREWYVVTLA
FT                   DRRISQVTGLFRDFLIKQGAPVIDGATVASHERRRK"
FT   misc_feature    192112..192291
FT                   /locus_tag="BCAM0167"
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix, score 1e-21"
FT                   /inference="protein motif:HMMPfam:PF00126"
FT   misc_feature    192151..192216
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1382.000, SD 3.89 at aa 24-45, sequence
FT                   GSVSRAAEELNLTQPAVSLQVR"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    192154..192246
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00044"
FT   misc_feature    192361..192984
FT                   /locus_tag="BCAM0167"
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 9.7e-55"
FT                   /inference="protein motif:HMMPfam:PF03466"
FT   CDS_pept        193436..194359
FT                   /transl_table=11
FT                   /locus_tag="BCAM0168"
FT                   /product="AraC family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0168"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54025"
FT                   /db_xref="GOA:B4EH68"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH68"
FT                   /protein_id="CAR54025.1"
FT                   /translation="MSDPILAAPTDNGVPVSLRSSRGLGWHGFGASLLEIRAGTYRIPA
FT                   AEHHRIGVHIGAPVRADCVCDGERVSRIQAHGDVDVIPAGLPGQWTDSADCRILHIALS
FT                   DTFVRRTVEQLELKPSHAQIRRRLQVRDPRLQHIAWAMAAELEAEDASDPLYAESLCTA
FT                   LVARLVDAQPAFRERRRTLAPKAAARVIDYVEANLDRRMTLAELAALVSISVPHFKVLF
FT                   RETLGMPVHQYVVRRRVERAKALLLEGRLSISQIALEAGFAHQSHMANWMNRVLGATPT
FT                   EIARSGVRSGLRLAYDGKDGAKPPRR"
FT   misc_feature    194000..194140
FT                   /locus_tag="BCAM0168"
FT                   /note="HMMPfam hit to PF00165, Bacterial regulatory
FT                   helix-turn-helix protei, score 8.8e-07"
FT                   /inference="protein motif:HMMPfam:PF00165"
FT   misc_feature    194039..194104
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1440.000, SD 4.09 at aa 202-223, sequence
FT                   MTLAELAALVSISVPHFKVLFR"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    194156..194290
FT                   /locus_tag="BCAM0168"
FT                   /note="HMMPfam hit to PF00165, Bacterial regulatory
FT                   helix-turn-helix protei, score 1.2e-06"
FT                   /inference="protein motif:HMMPfam:PF00165"
FT   CDS_pept        194494..195381
FT                   /transl_table=11
FT                   /locus_tag="BCAM0169"
FT                   /product="NmrA-like family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54026"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH69"
FT                   /protein_id="CAR54026.1"
FT                   /translation="MFVIFGASGNVGLSTVTALRNAGHSVRAVLRDARHRERFVQLGCD
FT                   VAIADLTDANAIAAAIDGARAVQMLCPVPAADPDPAATMTRTIDAATAALAANPPPALL
FT                   ALSDYGAELEGNTGITRLFHDFEERLKPIPTQLTLLRSAEHLQNWARVLPVALGTGVLP
FT                   SFHHPVGKVFPTVWAPDVGVVAARLLLDAPEGGSGPRIVSVEGPRRVSVTAIADTLGAA
FT                   AGRSVVAHELPRDTWNATLLRAGLSERHAQLIVDLYDVHNAGRIDVEAGVSERVYGATT
FT                   LEEVLAQLVRRHAH"
FT   misc_feature    194497..195189
FT                   /locus_tag="BCAM0169"
FT                   /note="HMMPfam hit to PF05368, NmrA-like family, score
FT                   0.0016"
FT                   /inference="protein motif:HMMPfam:PF05368"
FT   CDS_pept        complement(195407..196609)
FT                   /transl_table=11
FT                   /gene="benE"
FT                   /locus_tag="BCAM0170"
FT                   /product="benzoate membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0170"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54027"
FT                   /db_xref="GOA:B4EH70"
FT                   /db_xref="InterPro:IPR004711"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH70"
FT                   /protein_id="CAR54027.1"
FT                   /translation="MQPNTPPSAIRTLGNDWSVSAITAGFLAVLISYAGPLAIFFQASQ
FT                   AAHASNEMVTSWVWAISIGAGVSGLFASWKLKVPVVTAWSAPGTALLVGLFPQLTLNQA
FT                   VGAYITAALIILAIGVSGYFDRLVRHIPRGIACGMMAGILLPFGMHAFSAASAQPALAF
FT                   GMIAAYVIFRRLLPRYSIVLVLLTGAALATLLGMTHLGNVSPSLARPVFIAPKWTLGTT
FT                   LSLALPLVVVSLTGQFLPGMAILRVSGYHTPARPIITATSMMSLVVACFGGITIVVAAI
FT                   TAALCTGKDAHEDPDRRYVAGLANGVIYLIGGLFAGTIVTLFFALPKAFVAILAGLALI
FT                   GAISANVHGIFEDENHREASVITFLATASGMTWLGLGSAFWGIVIGSVAYGVLNRVRRP
FT                   A"
FT   misc_feature    complement(join(195431..195499,195557..195625,
FT                   195638..195706,195749..195817,195875..195943,
FT                   196001..196069,196082..196141,196151..196219,
FT                   196238..196297,196307..196375,196394..196453,
FT                   196481..196549))
FT                   /gene="benE"
FT                   /locus_tag="BCAM0170"
FT                   /note="12 probable transmembrane helices predicted for
FT                   BCAM0170 by TMHMM2.0 at aa 21-43, 53-72, 79-101, 105-124,
FT                   131-153, 157-176, 181-203, 223-245, 265-287, 302-324,
FT                   329-351 and 371-393"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(195434..196567)
FT                   /gene="benE"
FT                   /locus_tag="BCAM0170"
FT                   /note="HMMPfam hit to PF03594, Benzoate membrane transport
FT                   protein, score 1.4e-204"
FT                   /inference="protein motif:HMMPfam:PF03594"
FT   misc_feature    complement(195482..196555)
FT                   /gene="benE"
FT                   /locus_tag="BCAM0170"
FT                   /note="HMMPfam hit to PF00860, Permease family, score
FT                   0.0024"
FT                   /inference="protein motif:HMMPfam:PF00860"
FT   misc_feature    complement(195800..195832)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   sig_peptide     complement(196463..196609)
FT                   /gene="benE"
FT                   /locus_tag="BCAM0170"
FT                   /note="Signal peptide predicted for BCAM0170 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.894) with cleavage site
FT                   probability 0.808 between residues 49 and 50"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(196785..197810)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0171"
FT                   /product="putative desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0171"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54028"
FT                   /db_xref="GOA:B4EH71"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH71"
FT                   /protein_id="CAR54028.1"
FT                   /translation="MAEYFDVDHARAIAALDARFTARTEWPTWLLVVVIYGGWLAVLLL
FT                   VRDGHLSLGAATPPLILLGAWHLSLQHELLHGHPTRSAFVNKLLGYPPLTIWYPYTLYR
FT                   DMHLEHHRDEDLTVPGVDPETNYVTQERWARLPRWRRALTVARKTFLGRIVVGPPLAIA
FT                   ATFRDAFAAFRRGDFRYLPMWATHAACVVALLAWLQWAIGVPWWYYLLAVTWPALSLAM
FT                   IRSLYEHRAAPHPKARITINEAGFAMRLLYLNNNYHLVHHDMPKLPWYDLPRAYRMRRA
FT                   AYAEKCGGFVIRGGYRALLARHAWTPTDPPVHPFDAGTASLSTGSGIKVAVVDRVLQIS
FT                   T"
FT   misc_feature    complement(196965..197645)
FT                   /locus_tag="BCAM0171"
FT                   /note="HMMPfam hit to PF00487, Fatty acid desaturase, score
FT                   8.9e-08"
FT                   /inference="protein motif:HMMPfam:PF00487"
FT   misc_feature    complement(join(197127..197195,197205..197273,
FT                   197673..197735))
FT                   /locus_tag="BCAM0171"
FT                   /note="3 probable transmembrane helices predicted for
FT                   BCAM0171 by TMHMM2.0 at aa 26-46, 180-202 and 206-228"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        198053..198880
FT                   /transl_table=11
FT                   /locus_tag="BCAM0172"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0172"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54029"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH72"
FT                   /protein_id="CAR54029.1"
FT                   /translation="MNPWIAVLPMYNVTPRHAVLWRALLRDALDAFANAGGPADVALPD
FT                   APFDDLQALWRRDDLLLSQTCGYPYRMLGLRDVVRLIATPIFEAEGCDGACYSSVLVVS
FT                   ARVHAGGATTLAACRGLRAAFNGADSHSGMNAFRHAVAPHAHDGRFFGSVTPFGSHLNV
FT                   LRALASGEADCAAIDCVTFAYVRDALPDLLTDIRIIGTTASAPGLPFVASRAALADTQV
FT                   VALQDALDRAVAADAERARVLRLKGFDRLSPADYDTIARFAQAAAAHGYPELA"
FT   misc_feature    198374..198406
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(198931..200328)
FT                   /transl_table=11
FT                   /gene="dbpA"
FT                   /locus_tag="BCAM0173"
FT                   /product="ATP-independent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0173"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54030"
FT                   /db_xref="GOA:B4EH73"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH73"
FT                   /protein_id="CAR54030.1"
FT                   /translation="MTQPTATPFSALPLTPATLANLAQLGYVDMTPIQAASLPIALAGQ
FT                   DLIAQAKTGSGKTAAFSLALLARLDARRFDVQAMILCPTRELADQVAQEVRRLARAEEN
FT                   VKVLTLCGGTPMRPQAQSLEHGAHIVVGTPGRIMDHLDRGNLKLDALNTLVLDEADRML
FT                   DMGFFDDIAKVARMCPTTRQTLLFSATYPDGIAKLSQQFLRNPKEIKLAERHDDSKIRQ
FT                   RFYEVTEDERLHAVGQLLNHYRPVSTIAFCNTKQQCRDLLDVLHAQGFHALALHGELDQ
FT                   RERDQVLIQFANRSCSVLVATDVAARGLDIAQLEAVINVDVTPDPEVHVHRIGRTGRAD
FT                   QDGWALSLASMDEMGRVGAIEQAQKREVEWHPLAELKPADDSVLLPPMETLQILGGRKD
FT                   KIRPGDVLGALTGDAGFDGKQIGKINVTEFSTYVAIERGVARDALRKLNAGKIKGKRVK
FT                   VRLMDEE"
FT   misc_feature    complement(198940..199197)
FT                   /gene="dbpA"
FT                   /locus_tag="BCAM0173"
FT                   /note="HMMPfam hit to PF03880, DbpA RNA binding domain,
FT                   score 5.2e-22"
FT                   /inference="protein motif:HMMPfam:PF03880"
FT   misc_feature    complement(199309..199539)
FT                   /gene="dbpA"
FT                   /locus_tag="BCAM0173"
FT                   /note="HMMPfam hit to PF00271, Helicase conserved
FT                   C-terminal domain, score 7.7e-28"
FT                   /inference="protein motif:HMMPfam:PF00271"
FT   misc_feature    complement(199735..200238)
FT                   /gene="dbpA"
FT                   /locus_tag="BCAM0173"
FT                   /note="HMMPfam hit to PF00270, DEAD/DEAH box helicase,
FT                   score 1.6e-68"
FT                   /inference="protein motif:HMMPfam:PF00270"
FT   misc_feature    complement(199840..199866)
FT                   /note="PS00039 DEAD-box subfamily ATP-dependent helicases
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00039"
FT   misc_feature    complement(200155..200178)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   sig_peptide     complement(200269..200328)
FT                   /gene="dbpA"
FT                   /locus_tag="BCAM0173"
FT                   /note="Signal peptide predicted for BCAM0173 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.874) with cleavage site
FT                   probability 0.662 between residues 20 and 21"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(200325..200522)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0174"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0174"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54031"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH74"
FT                   /protein_id="CAR54031.1"
FT                   /translation="MFTCRNQSCGTQWEQSDVVIKDEGQGLLFRCPLCGARNYLERFED
FT                   DEGNVVYEQMEGRPYLGDLS"
FT   CDS_pept        complement(200810..202453)
FT                   /transl_table=11
FT                   /gene="mqo"
FT                   /locus_tag="BCAM0175"
FT                   /product="malate:quinone oxidoreductase"
FT                   /EC_number="1.1.99.16"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0175"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54032"
FT                   /db_xref="GOA:B4EH75"
FT                   /db_xref="InterPro:IPR006231"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH75"
FT                   /protein_id="CAR54032.1"
FT                   /translation="MIKTLRVILSALALCVATSSAHAADTKKVDVLLVGGGIMSSTLGV
FT                   WLHELQPDWSMTMVERLDGVALESSNGWNNAGTGHSALAELNYTPEKADGKVDISKAIE
FT                   INESFQISRQFWAWQVKQGVLKNPHSFINSTPHMSFVWGDDNVRFLKKRYEALQASPLF
FT                   RGMQYSEDYDQIKQWVPLMMEGRDRNQKVAATWTPIGTDVNFGEITRQFVGYLKTQPNF
FT                   TLSLSSEVREITRNADGTWHVSWVKLHSDEPPQAVDAKFVFIGAGGGALHLLQASGIPE
FT                   AKDYGAFPVGGSFLVTDNPEVVKQHLAKAYGKASVGSPPMSVPHLDTRIIDGKKIILFG
FT                   PFATFSTKFLKNGSYFDLAKSTNLHNVAPMMRVGVDEFPLVQYLAGQLMLSDDDRFNAL
FT                   KEYFPNAKKEDWRLWQAGQRVQIIKRDPVKGGVLKLGTEIVASQDGSIAGLLGASPGAS
FT                   TAAPIMLNLMKKVFKDKVATPEWQQKIRQIVPSYGTRLNDSPAKVVEEWTYTSDVLQLS
FT                   PPPKIDLGAPSQATGAAPARPAKASADMAL"
FT   misc_feature    complement(200906..202381)
FT                   /gene="mqo"
FT                   /locus_tag="BCAM0175"
FT                   /note="HMMPfam hit to PF06039, Malate:quinone
FT                   oxidoreductase (Mqo), score 0"
FT                   /inference="protein motif:HMMPfam:PF06039"
FT   misc_feature    complement(201065..202366)
FT                   /gene="mqo"
FT                   /locus_tag="BCAM0175"
FT                   /note="HMMPfam hit to PF01266, FAD dependent
FT                   oxidoreductase, score 0.0001"
FT                   /inference="protein motif:HMMPfam:PF01266"
FT   sig_peptide     complement(202385..202453)
FT                   /gene="mqo"
FT                   /locus_tag="BCAM0175"
FT                   /note="Signal peptide predicted for BCAM0175 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 1.000 between residues 23 and 24"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(202997..203302)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0175a"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0175a"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54033"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH76"
FT                   /protein_id="CAR54033.1"
FT                   /translation="MKRYSPAASFAAAIACAFALSACATPSSTPANASAPADTAAQAAP
FT                   PRVGGDRDAHGCIGSAGYAWCERTRQCERPWELAKAQGFANSAQAYEQFCRSGGAK"
FT   sig_peptide     complement(203204..203302)
FT                   /locus_tag="BCAM0175a"
FT                   /note="Signal peptide predicted for BCAM0175a by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.853 between residues 33 and 34"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(203255..203287)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(203373..203861)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0176"
FT                   /product="AnsC family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0176"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54034"
FT                   /db_xref="GOA:B4EH77"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH77"
FT                   /protein_id="CAR54034.1"
FT                   /translation="MSKNRASVELDGVDRAMLRLLQEDGALSNATLGEKLSLSVTPCWR
FT                   RRKRLEDEHVITGYQANLDRRALGMNVFAFVQVTFNMHSGQDSDHFEDVMRRHDEVTSC
FT                   HKITGAADYILQVVAADLDAYAEFVERVLRKQAGVSSIQSSLALREVKFSSRVPVPDA"
FT   misc_feature    complement(203412..203642)
FT                   /locus_tag="BCAM0176"
FT                   /note="HMMPfam hit to PF01037, AsnC family, score 1.5e-25"
FT                   /inference="protein motif:HMMPfam:PF01037"
FT   CDS_pept        203990..205027
FT                   /transl_table=11
FT                   /gene="aphA"
FT                   /locus_tag="BCAM0177"
FT                   /product="acetylpolyamine aminohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0177"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54035"
FT                   /db_xref="GOA:B4EH78"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH78"
FT                   /protein_id="CAR54035.1"
FT                   /translation="MLTVYSSDHHLHRGVELKDGAITESFEHPLRAETVLAQVRAAGLG
FT                   DVIAPRAFDRASYAGAHSARYVDFLAGAWDEWTATGRTCQALPLVWPVRAMPAAATPPG
FT                   FIDGKLGFFAMDAGAPINAGTWDAVSASANSALTGADLLSGGGARAAFALCRPPGHHAG
FT                   REYMGGYCYLNNAAIAAQHGIARGAARVAVLDVDFHHGNGTQDIFYERSDVLFASLHGE
FT                   PSVSYPYFSGYADERGAGVGAGFNLNLPLPKGTRWDTYSAALDHAAAAIAKHAPDLLVV
FT                   SLGVDTFEHDPISHFKLRSPDYLRIGETLARLNLPTLFVMEGGYMVDEIGINAVNVLLG
FT                   FEGRA"
FT   misc_feature    203993..205018
FT                   /gene="aphA"
FT                   /locus_tag="BCAM0177"
FT                   /note="HMMPfam hit to PF00850, Histone deacetylase domain,
FT                   score 4.1e-60"
FT                   /inference="protein motif:HMMPfam:PF00850"
FT   CDS_pept        205096..206238
FT                   /transl_table=11
FT                   /locus_tag="BCAM0178"
FT                   /product="putative periplasmic solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0178"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54036"
FT                   /db_xref="GOA:B4EH79"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH79"
FT                   /protein_id="CAR54036.1"
FT                   /translation="MNRHHKTVFATAVALTCALPAGAAQADDVVRIGHVAPLTGAIAHL
FT                   GKDSENGARLAVEEINAKGLVIGGRKVTLQLDAQDDAGDPRTATQVAQRLVDDKVVGVV
FT                   GHHNSGTSIPASRVYRDGGVVQISQAATNPTYTQQGFKTTYRVVATDAQQGPALAMYAA
FT                   KNMGIRTVAVVDDSTAYGQGLATEFEKAAKAAGMKVVSRDATNDKAIDFRAILTKIKGA
FT                   SPDAIMYGGMDATGGPLAKQARQLGMRAKILAGDGVCSTDLPKLAGPASDNVVCSEAGI
FT                   ALEKMPGGAAFAKRYEARYHQPMQVYAPFSYDAVYIIVDAMKRANSTDPAKVLAAMPAT
FT                   DYRGVIGETSFTPQGDLKHGAISVFTYKSGRKALLDIVRM"
FT   sig_peptide     205096..205173
FT                   /locus_tag="BCAM0178"
FT                   /note="Signal peptide predicted for BCAM0178 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.919 between residues 26 and 27"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    205237..206205
FT                   /locus_tag="BCAM0178"
FT                   /note="HMMPfam hit to PF01094, Receptor family ligand
FT                   binding region, score 2.5e-57"
FT                   /inference="protein motif:HMMPfam:PF01094"
FT   CDS_pept        complement(206272..207141)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0179"
FT                   /product="putative mechanosensitive ion channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0179"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54037"
FT                   /db_xref="GOA:B4EH80"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH80"
FT                   /protein_id="CAR54037.1"
FT                   /translation="MFLDQLHPERWTFLWNALSTLSLKLSAALALLVAGWWLSKRIGNW
FT                   LNRLLSNKERVDDTLRPILCDVAVWGIRIVAIVGALSQLGIETASIVAVLGAAGLAIGF
FT                   ALQGTMQNIAAGIMLLLLRPFKVGDYIDGGTGVAGTVEEVGLFMTRLTKPDGICEYVPN
FT                   SALWGSSIRNYTRNPTRRLDLEVEVSVHDDIDRALAALRALAVADPDVLQDPAPDVMVM
FT                   RFDDSTAVANMRVWTHTDQFWAMRWRLARQVRKTLADADCALPIRTRELHIVHDAARRA
FT                   DEARVRVS"
FT   misc_feature    complement(206347..206946)
FT                   /locus_tag="BCAM0179"
FT                   /note="HMMPfam hit to PF00924, Mechanosensitive ion
FT                   channel, score 5.4e-56"
FT                   /inference="protein motif:HMMPfam:PF00924"
FT   misc_feature    complement(join(206812..206880,206899..206967,
FT                   207037..207105))
FT                   /locus_tag="BCAM0179"
FT                   /note="3 probable transmembrane helices predicted for
FT                   BCAM0179 by TMHMM2.0 at aa 13-35, 59-81 and 88-110"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        207421..208794
FT                   /transl_table=11
FT                   /locus_tag="BCAM0180"
FT                   /product="metallo peptidase, subfamily M23B"
FT                   /note="subfamily M23B metallo peptidase. Weakly similar to
FT                   Rhizobium loti MLR3423 protein SWALL:Q98GA2 (EMBL:AP003001)
FT                   (476 aa) fasta scores: E(): 1.3e-18, 29.73% id in 454 aa.
FT                   C-terminus is similar to the C-terminal region of
FT                   Bordetella parapertussis hypothetical protein SWALL:Q7W3Z7
FT                   (EMBL:BX640435) (471 aa) fasta scores: E(): 9.1e-27, 39.39%
FT                   id in 264 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0180"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54038"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH81"
FT                   /protein_id="CAR54038.1"
FT                   /translation="MRSDLRFRVAREQGRPASRGVHRFPIGRAFLRGIVAAACVAGAQG
FT                   AAAQAFHDAAPAAPATAETIDLGDVPFFNSARTTWGGLRASSAAPLDVAYASHAWNVST
FT                   GTGRDDPVARFGACVAYRVLCDTARGAVERGYAARFDYGLASALPATGAQPAFAHGPVD
FT                   LASAEPFTLAQPDRGTRAGAIVGSLHASLARADLPAGVAAQIVRMLAGRVDPKQRGAQG
FT                   DTFRVAFEPDHDATRPGRVRVTALDVRFRGQQVAAVWFAAQAGSPGAYYDLDGMPLGGA
FT                   RFAMPVAATRISSTFGARVHPVSGARHVHSGVDLAAPAGRAVHASERGVVTFIGTEPRG
FT                   YGKYVVIRHDGGYASYYAHLSAFEPTLRTGARVMRGQRVGAVGSTGTATGPHLHFEVRR
FT                   HARLVDPIELVHAAQATKLKGAQRVAFNRVARDARVQLAAATWAQPVAMSAPSAPHAG"
FT   misc_feature    207862..207879
FT                   /note="PS00343 Gram-positive cocci surface proteins
FT                   'anchoring' hexapeptide."
FT                   /inference="protein motif:Prosite:PS00343"
FT   misc_feature    208342..208638
FT                   /locus_tag="BCAM0180"
FT                   /note="HMMPfam hit to PF01551, Peptidase family M23, score
FT                   3.4e-41"
FT                   /inference="protein motif:HMMPfam:PF01551"
FT   CDS_pept        209163..210236
FT                   /transl_table=11
FT                   /locus_tag="BCAM0181"
FT                   /product="putative catalase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0181"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54039"
FT                   /db_xref="GOA:B4EH82"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024168"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH82"
FT                   /protein_id="CAR54039.1"
FT                   /translation="MSKLDFTSKRTWGALAAIAAVAGVLTSTLAWTAGWIGSRTTSVSL
FT                   VSETPQPFPAGFRRAHGKGVCFAGTFRPDRAAVPLSTARVFTQADIPVVGRLSIGTGSP
FT                   YAADSSTTTLSMALLLTTDDKQQWRMAMNNQPYFATHEPEGFLAMQQATAPDPATGQPD
FT                   PARLSAFLKAYPEAEKFMKWAAQEPAPGSFAGATFYSVNAFYLVGADGHRQPVRWMMRP
FT                   HDPFMPMSDAQRQKADHDFLFEGVRERLARKPLYWDYVLQLAQPGDPVDDASQPWPADR
FT                   KQLVAGTLEMMRVVEQAEGACRDINFDPSIVPAGVEVSNDPILNARSGAYAHSFNRRER
FT                   EIGYGKATEAVGKQEVK"
FT   sig_peptide     209163..209258
FT                   /locus_tag="BCAM0181"
FT                   /note="Signal peptide predicted for BCAM0181 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.722 between residues 32 and 33"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    209199..209267
FT                   /locus_tag="BCAM0181"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAM0181 by TMHMM2.0 at aa 13-35"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    209211..210233
FT                   /locus_tag="BCAM0181"
FT                   /note="HMMPfam hit to PF00199, Catalase, score 2.2e-06"
FT                   /inference="protein motif:HMMPfam:PF00199"
FT   misc_feature    210006..210047
FT                   /note="PS00287 Cysteine proteases inhibitors signature."
FT                   /inference="protein motif:Prosite:PS00287"
FT   CDS_pept        210233..210799
FT                   /transl_table=11
FT                   /locus_tag="BCAM0182"
FT                   /product="putative cytochrome b561"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0182"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54040"
FT                   /db_xref="GOA:B4EH83"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH83"
FT                   /protein_id="CAR54040.1"
FT                   /translation="MNTRKITSGDAPRHFNALARGLHWLMAAMILAMLFIGAGMMTSLH
FT                   HRIWLIDLHRPLGIAILVLALLRVANRLRSRPPALPRSLPHWQVLAAKASHWALYALML
FT                   ALPLIGWALLSAGGFPIVLFKGVNLPAIVPASPTLFAWLRDAHGLLARLLFVVVLAHLS
FT                   AALVHAWIYRDGVFSSMARGGRQRG"
FT   misc_feature    210266..210781
FT                   /locus_tag="BCAM0182"
FT                   /note="HMMPfam hit to PF01292, Cytochrome b561 family,
FT                   score 6e-40"
FT                   /inference="protein motif:HMMPfam:PF01292"
FT   misc_feature    join(210293..210361,210374..210442,210521..210589,
FT                   210680..210748)
FT                   /locus_tag="BCAM0182"
FT                   /note="4 probable transmembrane helices predicted for
FT                   BCAM0182 by TMHMM2.0 at aa 21-43, 48-70, 97-119 and
FT                   150-172"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        211297..214632
FT                   /transl_table=11
FT                   /locus_tag="BCAM0183"
FT                   /product="putative autotransporter protein"
FT                   /note="Similar to the C-terminal region of Bordetella
FT                   parapertussis autotransporter SWALL:Q7WC79 (EMBL:BX640424)
FT                   (1616 aa) fasta scores: E(): 7.3e-42, 33.64% id in 1165 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0183"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54041"
FT                   /db_xref="GOA:B4EH84"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR013425"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH84"
FT                   /protein_id="CAR54041.1"
FT                   /translation="MKRKARNLGLGGMAILTGAVPVSAYAACSATAPGSGTTVTCTGAN
FT                   APSVVATAGSTGVTINLDSTVTGSYVLTSTPTPFSVDASSTITNNGSLSMSGNGTGVAN
FT                   RGAVLLGVNNGNTLTNAATGVIATSGTYNDGMAANGNNNTLVNNGTITTTGNNSYGMTA
FT                   AWGQSNPGASGNQIVNTGTVTTSGNNARAASLLGGNGTITNGGTLTSNGRDAPAVYMQG
FT                   NNDTLVNSGTIQTTGTATSGGSVDAVVSNTLGSSFTATITNQAGGRIISNNGIGVRSTN
FT                   GATTITNAGLIQGGGGTAIQGGNGNVTLILQTGSQIVGTANGGAGTNTLTLQGTGTASN
FT                   AFTNFQSLTMAGTDWTWAGTGTFSTALVQSGTLNLTGTLGTTTASVVATVNAGATLQAN
FT                   ASNLPLSVTDNGLVRFQQDSAGTYTGTIGGSGAVEKTGAGTLTVAPSSAGGNPYSGGTT
FT                   ITQGTLSVAADNALGASSGSLTFNGGTLQLGSAFDLASSRAVSITSNNGTIDTQGFDSA
FT                   IAQNVTGAGGLTKLGAGTLTMNGANTYAGGTALNAGTLVVGDAAHASAALGGGGPVAVA
FT                   AGATLGGYGSVTGNVTNNGTISVANALASLASGAIGDFRINGNLTNAGRVQLGGSGVGN
FT                   TLTVAGNYVGQNAMLTLNTTLAGDGAPSDKLVVSGGTASGSSTLKVTNVGGAGAQTTGD
FT                   GIQVVQAANGATTSAGAFSLSGGTVSAGAYTYFLAKGGESTGTGDNWYLRNTVPPKPQP
FT                   PVVEPGQPTPPAEPPVIAAEGTPESIVEAVDHAGIGGNPEPIYRPEVPLYAEAPAVARQ
FT                   LGLLQIDTFHDRQGEQGLLAENGSVPASWARVWGGNSNIRQKGDATPSFDGTVWGMQVG
FT                   QDLYADTTASGHRNHYGFFLGFSRAVGDVNGFALAQTDLGVGSLQVNAYDLGGYWTHIG
FT                   PGGWYTDAVLMASALTVRTHSNDNVNGSTNGNALTGSVEAGLPIALGNGLTLEPHAQLV
FT                   WQWLSLDRFNDGVSSIGWNNGNTFVGRIGARLQYAFDANGVSWKPYLRANVLRSFGADD
FT                   KTTFGGSTTIGTQVGQTAGQIGAGLVAQLTKRGSVYATVSYLTNFGGEHQRTITGNAGV
FT                   RWAW"
FT   sig_peptide     211297..211374
FT                   /locus_tag="BCAM0183"
FT                   /note="Signal peptide predicted for BCAM0183 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.718 between residues 26 and 27"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    211315..211383
FT                   /locus_tag="BCAM0183"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAM0183 by TMHMM2.0 at aa 7-29"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    212602..212835
FT                   /locus_tag="BCAM0183"
FT                   /note="HMMPfam hit to PF05594, no description, score 0.2"
FT                   /inference="protein motif:HMMPfam:PF05594"
FT   misc_feature    213148..213531
FT                   /locus_tag="BCAM0183"
FT                   /note="HMMPfam hit to PF03212, Pertactin, score 0.0003"
FT                   /inference="protein motif:HMMPfam:PF03212"
FT   misc_feature    213796..214581
FT                   /locus_tag="BCAM0183"
FT                   /note="HMMPfam hit to PF03797, Autotransporter beta-domain,
FT                   score 3.4e-34"
FT                   /inference="protein motif:HMMPfam:PF03797"
FT   CDS_pept        complement(214786..215520)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0184"
FT                   /product="lectin"
FT                   /note="No significant database matches to the full length
FT                   CDS. C-terminus is similar to Chromobacterium violaceum
FT                   hypothetical protein SWALL:Q7NX84 (EMBL:AE016916) (114 aa)
FT                   fasta scores: E(): 3.7e-18, 56.14% id in 114 aa, and to the
FT                   C-terminal region of Photorhabdus luminescens hypothetical
FT                   protein SWALL:Q937N3 (EMBL:AF346497) (320 aa) fasta scores:
FT                   E(): 4.5e-08, 33.51% id in 182 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0184"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54042"
FT                   /db_xref="InterPro:IPR010907"
FT                   /db_xref="InterPro:IPR036684"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH85"
FT                   /protein_id="CAR54042.1"
FT                   /translation="MSQPFTHDDLYALLQLAGNDATAVQANGDQAVLDRMRQFMTAQLV
FT                   EKLPQYDVFVDIATIPYSFDVGSWQNKVKTDAAGEVVACTVTWAGAPGVLPGAAAKFGV
FT                   GAVVNYFSKATPQPVQPAPVPTGGGERDGIFTLPPNIAFGVTALVNSSAPQTIEVFVDD
FT                   NPKPAATFQGAGTQDANLNTQIVNSGKGKVRVVVTANGKPSKIGSRQVDIFKKTYFGLV
FT                   GSEDGGDGDYNDGIAILNWPLG"
FT   misc_feature    complement(214792..215118)
FT                   /locus_tag="BCAM0184"
FT                   /note="HMMPfam hit to PF07472, Fucose-binding lectin II
FT                   (PA-IIL), score 6.8e-41"
FT                   /inference="protein motif:HMMPfam:PF07472"
FT   CDS_pept        complement(215683..216501)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0185"
FT                   /product="lectin"
FT                   /note="N-terminal region is similar to Photorhabdus
FT                   luminescens hypothetical membrane protein SWALL:Q7MZP1
FT                   (EMBL:BX571873) (139 aa) fasta scores: E(): 2.3e-18, 56.06%
FT                   id in 132 aa. C-terminal region is similar to
FT                   Chromobacterium violaceum hypothetical protein SWALL:Q7NX84
FT                   (EMBL:AE016916) (114 aa) fasta scores: E(): 1.4e-15, 51.75%
FT                   id in 114 aa. Full length CDS is similar to the C-terminal
FT                   region of Photorhabdus luminescens photopexin B PpxB
FT                   SWALL:Q7MZN8 (EMBL:BX571873) (340 aa) fasta scores: E():
FT                   2e-06, 28.62% id in 276 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0185"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54043"
FT                   /db_xref="GOA:B4EH86"
FT                   /db_xref="InterPro:IPR010907"
FT                   /db_xref="InterPro:IPR033790"
FT                   /db_xref="InterPro:IPR036684"
FT                   /db_xref="PDB:2WQ4"
FT                   /db_xref="PDB:2XR4"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH86"
FT                   /protein_id="CAR54043.1"
FT                   /translation="MPLLSASIVSAPVVTSETYVDIPGLYLDVAKAGIRDGKLQVILNV
FT                   PTPYATGNNFPGIYFAIATNQGVVADGCFTYSSKVPESTGRMPFTLVATIDVGSGVTFV
FT                   KGQWKSVRGSAMHIDSYASLSAIWGTAAPSSQGSGNQGAETGGTGAGNIGGGGERDGTF
FT                   NLPPHIKFGVTALTHAANDQTIDIYIDDDPKPAATFKGAGAQDQNLGTKVLDSGNGRVR
FT                   VIVMANGRPSRLGSRQVDIFKKSYFGIIGSEDGADDDYNDGIVFLNWPLG"
FT   misc_feature    complement(215689..216015)
FT                   /locus_tag="BCAM0185"
FT                   /note="HMMPfam hit to PF07472, Fucose-binding lectin II
FT                   (PA-IIL), score 8.8e-39"
FT                   /inference="protein motif:HMMPfam:PF07472"
FT   CDS_pept        complement(216624..217013)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0186"
FT                   /product="lectin"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0186"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54044"
FT                   /db_xref="GOA:B4EH87"
FT                   /db_xref="InterPro:IPR010907"
FT                   /db_xref="InterPro:IPR036684"
FT                   /db_xref="PDB:2VNV"
FT                   /db_xref="PDB:2WR9"
FT                   /db_xref="PDB:2WRA"
FT                   /db_xref="UniProtKB/TrEMBL:B4EH87"
FT                   /protein_id="CAR54044.1"
FT                   /translation="MADSQTSSNRAGEFSIPPNTDFRAIFFANAAEQQHIKLFIGDSQE
FT                   PAAYHKLTTRDGPREATLNSGNGKIRFEVSVNGKPSATDARLAPINGKKSDGSPFTVNF
FT                   GIVVSEDGHDSDYNDGIVVLQWPIG"
FT   misc_feature    complement(216630..216974)
FT                   /locus_tag="BCAM0186"
FT                   /note="HMMPfam hit to PF07472, Fucose-binding lectin II
FT                   (PA-IIL), score 2.8e-18"
FT                   /inference="protein motif:HMMPfam:PF07472"
FT   CDS_pept        217955..219667
FT                   /transl_table=11
FT                   /locus_tag="BCAM0187"
FT                   /product="putative 2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0187"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54045"
FT                   /db_xref="GOA:B4EHL9"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="InterPro:IPR039371"
FT                   /db_xref="UniProtKB/TrEMBL:B4EHL9"
FT                   /protein_id="CAR54045.1"
FT                   /translation="MMLKNPATKYRPFTPVNLPDRTWPSRTITQAPIWMSTDLRDGNQA
FT                   LFEPMDATRKMRMFKTLVAIGFKEIEVAFPSASETDFNFVRELIEGGHIPDDVTIEVLT
FT                   QARDDLIERTFASLRGAKRAIVHLYNATAPEFRKIVFSLDRDGVKQLAVNAARTIKRCA
FT                   DAATDTQFTLQYSPETFTATELDFAKEVCDAVFDVWQPTPERKSIVNLPATVEIGTPNY
FT                   YADQIEWMHRNLARRDSLILSVHPHNDRGTAVAAAELAVMAGADRIEGCLFGNGERTGN
FT                   VDLVTLALNLYTQGVDPGLDFSQINEVARTSEECTQLPVHPRHPYVGDLVFTAFSGSHQ
FT                   DAIKKGFAVQRADTVWEVPYLSIDPNDLGRTYDSIIRVNSQSGKGGIAYLLEQGYGVAL
FT                   PRRMQVDFSAAVQRLTDESGHEVTSAQIWALFQQEYVESDTPLRYVSHELTERDGRETI
FT                   VLTADVHGERRVLRGEGNGPLDALMHALHTPLRIQHYEERALSQGADAKAIAIAELAGT
FT                   GVRGSAFGVGVDANLTTASIRAVISGVNRAYARADEVVQATFFAGQPAVQAVA"
FT   misc_feature    218069..218119
FT                   /note="PS00815 Alpha-isopropylmalate and homocitrate
FT                   synthases signature 1."
FT                   /inference="protein motif:Prosite:PS00815"
FT   misc_feature    218072..218908
FT                   /locus_tag="BCAM0187"
FT                   /note="HMMPfam hit to PF00682, HMGL-like, score 1e-92"
FT                   /inference="protein motif:HMMPfam:PF00682"
FT   misc_feature    218678..218719
FT                   /note="PS00816 Alpha-isopropylmalate and homocitrate
FT                   synthases signature 2."
FT                   /inference="protein motif:Prosite:PS00816"
FT   misc_feature    219215..219598
FT                   /locus_tag="BCAM0187"
FT                   /note="HMMPfam hit to PF08502, LeuA allosteric
FT                   (dimerisation) domain, score 1.8e-25"
FT                   /inference="protein motif:HMMPfam:PF08502"
FT   CDS_pept        complement(219739..220452)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0188"
FT                   /product="N-acylhomoserine lactone dependent regulatory
FT                   protein"
FT                   /note="Similar to Ralstonia solanacearum transcriptional
FT                   activator protein SolR or rsc3287 or rs02516
FT                   SWALL:SLR1_RALSO (SWALL:P58590) (236 aa) fasta scores: E():
FT                   7.1e-29, 38.79% id in 232 aa, and to Burkholderia stabilis
FT                   N-acyl homoserine lactone transcriptional regulator cepR
FT                   SWALL:Q93PF6 (EMBL:AF333005) (239 aa) fasta scores: E():
FT                   6e-26, 38.46% id in 234 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0188"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54046"
FT                   /db_xref="GOA:B4EHM0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="PDB:5L10"
FT                   /db_xref="UniProtKB/TrEMBL:B4EHM0"
FT                   /protein_id="CAR54046.1"
FT                   /translation="MDLTILHDCFDALQRAPTAEAAFPPIAAAAAALGFRYCVYGLRRT
FT                   LPLARPDMQIVGNHPREWEHRYVKFGYVTIDPIIKRVASQPRPVVWNAFDEPGDTAFWH
FT                   DAACFGMRYGWSHGGYDRAGNLGVLTLVRDTTPLDADEISRLRAPCASLSHAAHAYLMP
FT                   RLADPIAPVGTGLTLREREVLAWTADGKTAYEIGMIFGIAERTVKFHLQNAVVKLDAMN
FT                   KTHAATKAAMLGLLP"
FT   misc_feature    complement(219763..219936)
FT                   /locus_tag="BCAM0188"
FT                   /note="HMMPfam hit to PF00196, Bacterial regulatory
FT                   proteins, luxR fami, score 1.7e-16"
FT                   /inference="protein motif:HMMPfam:PF00196"
FT   misc_feature    complement(219802..219885)
FT                   /note="PS00622 Bacterial regulatory proteins, luxR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00622"
FT   misc_feature    complement(219817..219882)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1238.000, SD 3.40 at aa 191-212, sequence
FT                   KTAYEIGMIFGIAERTVKFHLQ"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    complement(219877..219900)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    complement(219964..220401)
FT                   /locus_tag="BCAM0188"
FT                   /note="HMMPfam hit to PF03472, Autoinducer binding domain,
FT                   score 3.5e-27"
FT                   /inference="protein motif:HMMPfam:PF03472"
FT   CDS_pept        220649..221464
FT                   /transl_table=11
FT                   /locus_tag="BCAM0189"
FT                   /product="AraC family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0189"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54047"
FT                   /db_xref="GOA:B4EHM1"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:B4EHM1"
FT                   /protein_id="CAR54047.1"
FT                   /translation="MTSVQDVPLLARAGARAFAFGGIRAIEPPCASAPARALAHEYAPH
FT                   AHQAGQLLFTTRGVLVLDVEGQRWITPPLRAIWIPARTVHAMRVADDVQLCSLYLGDAL
FT                   GARLPATLCAMTVSPLLRELATRVSHPFDCSVDHDPLARLFADELSELAQTPLTLPLPR
FT                   DRRLLKLCERLQREPHCELPLDTLARDAALSARHLARLFRSETGMSVAAWRQQLRLSMS
FT                   LALLASGMPVTQAAHQVGYRSPTTYAATFKRAFGVTPSQYLAAAEAAAR"
FT   misc_feature    220706..221179
FT                   /locus_tag="BCAM0189"
FT                   /note="HMMPfam hit to PF02311, AraC-like ligand binding
FT                   domain, score 3.6e-08"
FT                   /inference="protein motif:HMMPfam:PF02311"
FT   misc_feature    221042..221062
FT                   /note="PS00290 Immunoglobulins and major histocompatibility
FT                   complex proteins signature."
FT                   /inference="protein motif:Prosite:PS00290"
FT   misc_feature    221153..221293
FT                   /locus_tag="BCAM0189"
FT                   /note="HMMPfam hit to PF00165, Bacterial regulatory
FT                   helix-turn-helix pr, score 3.5e-05"
FT                   /inference="protein motif:HMMPfam:PF00165"
FT   misc_feature    221294..221425
FT                   /note="PS00041 Bacterial regulatory proteins, araC family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00041"
FT   misc_feature    221309..221440
FT                   /locus_tag="BCAM0189"
FT                   /note="HMMPfam hit to PF00165, Bacterial regulatory
FT                   helix-turn-helix pr, score 4.7e-07"
FT                   /inference="protein motif:HMMPfam:PF00165"
FT   CDS_pept        complement(221495..222841)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0190"
FT                   /product="putative aminotransferase-class III"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0190"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54048"
FT                   /db_xref="GOA:B4EHM2"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B4EHM2"
FT                   /protein_id="CAR54048.1"
FT                   /translation="MSYSESRFWHPRQHPLAASRPPVRITRGEGCYLYDDTGRPYLDAV
FT                   ASLFNVYVGHGRREIKEAIIRQLDELEYHPVFAGFSHPRAEELSARLVGMLQPEDMSRV
FT                   IFGSGGSDAVEAALMIARQYWKVSGQPERTKFIALRQAYHGSHFGGSSVTGNTVYRRNY
FT                   EPTLAGCFHVETPWIYRNPFTHDPEELGRLCASLVEREILFQGPDTVAAFIAEPVQATG
FT                   GIIVPPANYWPLVREVCDRHGVLLIADEVVTGFGRTGAAFGSRGWGVAPDIMCLAKGVS
FT                   SGYLPLGATVVNRRIENAFASNPGGIGTLMHGYTYSGHPIVCAAALANLQIIVDEDLAG
FT                   NAAREGAYLLERLQPLVDRYPVVGDVRGKGLLVGIDLVKDKVTRESIDPSDGYAAALAD
FT                   AARDAGVLIRSLGNRLAIAPPLVIGREDVDRIVHAIEHAFEAVPRWTAR"
FT   misc_feature    complement(221705..222772)
FT                   /locus_tag="BCAM0190"
FT                   /note="HMMPfam hit to PF00202, Aminotransferase class-III,
FT                   score 4.2e-125"
FT                   /inference="protein motif:HMMPfam:PF00202"
FT   misc_feature    complement(221993..222106)
FT                   /note="PS00600 Aminotransferases class-III
FT                   pyridoxal-phosphate attachment site."
FT                   /inference="protein motif:Prosite:PS00600"
FT   CDS_pept        complement(222898..224259)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0191"
FT                   /product="putative non-ribosomal peptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0191"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54049"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:B4EHM3"
FT                   /protein_id="CAR54049.1"
FT                   /translation="MTDSTLQLPLSAPQRDFWEAALAYPVPSTHIYAAEYFDIRGALDT
FT                   GAFEHALRQVIREAQTLHTTRIVLDGDTPVRVLDAALANDWTLEHVDLAGTKDAHAIAL
FT                   AGMRAHCTGAIDLARGPFFRHTLYRIAPDHYYWYHGYAHILVDGYSGSLIATRAAELYN
FT                   AFASGAKAPPARFASLAELQLDEDAYRASEQFAHDRRYWLERFADQPRTVTLAGPARFP
FT                   ERDDGPDLRETRLATATESARLEAVARDLFTSTMPRLVTALTAAYLYLNTGAHDIVLSV
FT                   AAMARTSARERRTPAQCANMLPLRLHVEPGHTLDDLCRQANREMTALRQHQRYRMGDLH
FT                   RELTSLDNGQGVFGPEINIMAFDYDLRFGDCVTTSHNLSVGTTDDLMVNLTDRRNGEPL
FT                   RFDFDASPQYYSRDALNAHVGQFLTFMRVALDEPFATLGALESRLDFQPAALAG"
FT   misc_feature    complement(223333..224250)
FT                   /locus_tag="BCAM0191"
FT                   /note="HMMPfam hit to PF00668, Condensation domain, score
FT                   2.1e-11"
FT                   /inference="protein motif:HMMPfam:PF00668"
FT   CDS_pept        224656..225438
FT                   /transl_table=11
FT                   /locus_tag="BCAM0192"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0192"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54050"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR024423"
FT                   /db_xref="UniProtKB/TrEMBL:B4EHM4"
FT                   /protein_id="CAR54050.1"
FT                   /translation="MNQLEGLERKIGEQHERLAHHPVFGSIRTIDELRVFMEWHVFAVW
FT                   DFMSLVKRLQQDLTTVAVPWVAPRNANASRLINEIVLGEESDETPNGHMSHYDLYLHAM
FT                   RDVGASTSRIEEMVSLVRSGFSVSAALKAVDAPEPVIRFVEATMAACTSGATHQVLGNF
FT                   FYGRENVIPDMFRTLLDEWKIERSSIPLLVYYLDRHIEVDSGEHGPAARAMIREAADGD
FT                   TAKLEEALQAGLDAIDERMRLWDGLLAHLGQTRNVVPA"
FT   CDS_pept        225435..225824
FT                   /transl_table=11
FT                   /locus_tag="BCAM0193"
FT                   /product="conserved hypothetical protein"
FT                   /note="homology extends only to N terminus of protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0193"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54051"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B4EHM5"
FT                   /protein_id="CAR54051.1"
FT                   /translation="MNARGLSERIVDFAALEWEHPAAFDDGIDQVVLVDTLDEHAKRGI
FT                   RTRIVRFDPGAGTRVPFLHDYHEEVHLIDGDQSLVDVATREYRATYREGSYFVRPAGTP
FT                   HGPFRSDAGCLLLEIHYYGSPEDTR"
FT   misc_feature    225576..225794
FT                   /locus_tag="BCAM0193"
FT                   /note="HMMPfam hit to PF07883, Cupin domain, score 0.00016"
FT                   /inference="protein motif:HMMPfam:PF07883"
FT   CDS_pept        225821..226747
FT                   /transl_table=11
FT                   /locus_tag="BCAM0194"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0194"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54052"
FT                   /db_xref="GOA:B4EHM6"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR025859"
FT                   /db_xref="UniProtKB/TrEMBL:B4EHM6"
FT                   /protein_id="CAR54052.1"
FT                   /translation="MTTAVTYVSHVDRWEARATVRSRPRRIVEDDELRYYPLERQPLCA
FT                   HPAIVDAGDAVRDFVLLQSFYKYIQDVIIFETEIVNATALRIARGRFAHPFPFACRQDA
FT                   MTVVIDEDYHAYVAMDYLRQVEEATGIAPLPPNSEIELSRAIPRAVERVGAQYRDGMEL
FT                   LCVAISENTVTAEVAAFSRDATLKRSVKGVMADHLADEGRHSAFWINLVKLYWSEIDEP
FT                   ARLALGEGLPCFLREYLSADLQLQFDRRLIDALDLPAAERARIADDMVGAYPITSQHPM
FT                   IVNIRQFFRMSGLLDHAPTRAALSDYL"
FT   CDS_pept        226757..230323
FT                   /transl_table=11
FT                   /locus_tag="BCAM0195"
FT                   /product="putative non-ribosomal peptide synthetase"
FT                   /note="homology does not extend to N terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0195"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54053"
FT                   /db_xref="GOA:B4EHM7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR010080"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B4EHM7"
FT                   /protein_id="CAR54053.1"
FT                   /translation="MKAIIIAIGGQTRLAARLASELEATGHTVCIADGRDGPLRDAADA
FT                   LLLPAPAPEPLRNAAEWSIVCGAPDPAVHCAHARPLHCEIVADAFPPREVRVAWLTDAA
FT                   PGDTRVLADATLAFGAALNGADLADEIAACAVDLMHEVASGIARELSDPNDAPRATPPG
FT                   PADIVLDLERLAGWHASNDTAAEWPCEPSLPELVSRAAAAAPDACALVAADGQLTYREL
FT                   VTRARQVAARIAARPAAPRVVAVRLDKGVALYPALVGVLGAGATCVPLDPAFPPERART
FT                   ILRESGAQALVVDGAVEPALLDGFDLDVIDCGAHEQVDADASPDALSGQWPLERDADRA
FT                   ARCAVAIYTSGSTGVPKGVMLSHRNIVQFCHWYRAHVSLDASSRVLQFSTVAFDASLLD
FT                   MFPTWLAGATLVAPSEAQRRELDALAALVADARITHGFLPPALLAALPDCDWPALAHLV
FT                   TGGDVCDPDTIARWSANRRLHNIYGPTECTVLATTGELRAGDSNRRIGRPIANARCHVL
FT                   AADGRPALTGEEGELCIAGAGVGLGYLGRPDLSAERFVADPYGTPGATMYRTGDIASWE
FT                   PDGTLRYVGRRDAQLKIRGFRVEPGEIETAALAAGLYRQCAVVPDERKRIRLFAAKPVD
FT                   AAATPDALRAVLAATLPDYMVPYDITALDVLPATPNGKIDRAALARLPVSRAGSDTRDA
FT                   PRGALELRLAAMWATLLELAPDEIGRDASFFELGGHSLLVSRLMLAVKRELGGNAALAR
FT                   FMERPTIAALAALLTDETGERGANVPARVHDDRRLPDDVRLPAGQSAGDGPGAVLLTGA
FT                   NGFLGSFILSELISRTNQIVYCVVRGDDDASARRRLDEAAFVNGLGHLCGHPRVRVLRG
FT                   DLGAPRLGLSDAVWQTLAAEVGAIHHNGAHVNHVYDYPYLHAENVGSTLELLRLCCSGR
FT                   RKALHFVSTLSAASATGPTGRLIEAAPSEAGPAFVNNGYNLTKWVSEHLVAEAAARGID
FT                   TTILRPGNITGHSRTGLCQPGRNRILLLLKGAVQLGCAPLASEGGLFDLSPVDYLARAI
FT                   VACTLDGARTERVFHLHNPRPLDWAGYLRALARRGYPLRFEAPEVWRERLLSIDESNAL
FT                   FDVVAFYLDDRQDDIGDMAVIDHARTEATLRRLGVTYPDKDDALLDAHFGYLAECGFMP
FT                   PPPEPAPRANDARRDAEPEPAW"
FT   misc_feature    227408..228610
FT                   /locus_tag="BCAM0195"
FT                   /note="HMMPfam hit to PF00501, AMP-binding enzyme, score
FT                   3.9e-133"
FT                   /inference="protein motif:HMMPfam:PF00501"
FT   misc_feature    228857..229057
FT                   /locus_tag="BCAM0195"
FT                   /note="HMMPfam hit to PF00550, Phosphopantetheine
FT                   attachment site, score 2.6e-14"
FT                   /inference="protein motif:HMMPfam:PF00550"
FT   misc_feature    229175..229975
FT                   /locus_tag="BCAM0195"
FT                   /note="HMMPfam hit to PF01370, NAD dependent
FT                   epimerase/dehydratase fam, score 2e-05"
FT                   /inference="protein motif:HMMPfam:PF01370"
FT   misc_feature    229178..230032
FT                   /locus_tag="BCAM0195"
FT                   /note="HMMPfam hit to PF01073, 3-beta hydroxysteroid
FT                   dehydrogenase/iso, score 0.0028"
FT                   /inference="protein motif:HMMPfam:PF01073"
FT   CDS_pept        230379..230867
FT                   /transl_table=11
FT                   /locus_tag="BCAM0196"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0196"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54054"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B4EHM8"
FT                   /protein_id="CAR54054.1"
FT                   /translation="MLQRTATQPRPSTLVYAPQTPILSGSADLDVPARDAWRVVGDFAG
FT                   FSRFITGLDHTDMIGEGVRSLRIKHFADGNVVVEQLNSHDDEAMVMTWSLIHTSFDIGN
FT                   LWALMRVEPRGDHACTVTWDIAGEPSHGGAARQPEFDAFVTGFLDMAMTNLRALFKPQ"
FT   CDS_pept        complement(230896..231864)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0197"
FT                   /product="LysR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0197"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54055"
FT                   /db_xref="GOA:B4EHM9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EHM9"
FT                   /protein_id="CAR54055.1"
FT                   /translation="MQAFVTLADAGTFTETGKRLGITTAHVSRLVASLEHRLGIRLLNR
FT                   TTRSMCLTEAGERYLARARDITLAVDASEREARDARVHPHGRLRAHCSASIANHFVIPL
FT                   IGQFQARYPDVSVDLTLAPHLPKLVRDSYDVAVIAMPSLPSSEQVAIDVGRIRSVLCAS
FT                   PAYLDAHGMPDSPGALVHHRCVQLVAPAYHERIWTLWNGAEAQTVDVDPSMTADVAASL
FT                   AIAVREGAGIGLLPDFVAAADLRSGALVRVLSDYQAEEIGVFLVYASRQHLDAKTRAWV
FT                   DFMKAALRDAFAQVHDDACASPAGRKSHAPGKAGAWAGAAA"
FT   misc_feature    complement(230998..231624)
FT                   /locus_tag="BCAM0197"
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 1.3e-43"
FT                   /inference="protein motif:HMMPfam:PF03466"
FT   misc_feature    complement(231694..231864)
FT                   /locus_tag="BCAM0197"
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix, score 6.6e-15"
FT                   /inference="protein motif:HMMPfam:PF00126"
FT   misc_feature    complement(231769..231834)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1734.000, SD 5.09 at aa 11-32, sequence
FT                   GTFTETGKRLGITTAHVSRLVA"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        complement(232000..232773)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0198"
FT                   /product="AraC family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0198"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54056"
FT                   /db_xref="GOA:B4EHN0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:B4EHN0"
FT                   /protein_id="CAR54056.1"
FT                   /translation="MENFFIALERQARDKQIAVVASDSPAGMAYPPHSHRQGQLIHAIS
FT                   GVMIVHADAGSWVVPTGRAVWVPGGTQHEIRSAGDVQMRTVFVGPEVRPSLPTECRVIE
FT                   VGTLLRELIVTACDLPADYDLSHRPGRVLALILDEIEIAPSLSLHVPMPRHPALVALCT
FT                   RLINDPSSAVTLQAWARDAHMNERTLARAFKRETGMTHGAWCRHARLLLSLPRLAAGTP
FT                   ILELALEHGYDSPSAFAAMFRKALGVAPSEYFRRR"
FT   misc_feature    complement(232009..232155)
FT                   /locus_tag="BCAM0198"
FT                   /note="HMMPfam hit to PF00165, Bacterial regulatory
FT                   helix-turn-helix pr, score 7e-06"
FT                   /inference="protein motif:HMMPfam:PF00165"
FT   misc_feature    complement(232024..232149)
FT                   /note="PS00041 Bacterial regulatory proteins, araC family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00041"
FT   misc_feature    complement(232192..232257)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1603.000, SD 4.65 at aa 173-194, sequence
FT                   VTLQAWARDAHMNERTLARAFK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    complement(232357..232728)
FT                   /locus_tag="BCAM0198"
FT                   /note="HMMPfam hit to PF02311, AraC-like ligand binding
FT                   domain, score 0.00094"
FT                   /inference="protein motif:HMMPfam:PF02311"
FT   misc_feature    complement(232507..232719)
FT                   /locus_tag="BCAM0198"
FT                   /note="HMMPfam hit to PF07883, Cupin domain, score 1.1e-06"
FT                   /inference="protein motif:HMMPfam:PF07883"
FT   CDS_pept        232941..234377
FT                   /transl_table=11
FT                   /locus_tag="BCAM0199"
FT                   /product="outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0199"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54057"
FT                   /db_xref="GOA:B4EHN1"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:B4EHN1"
FT                   /protein_id="CAR54057.1"
FT                   /translation="MPHVRRATCAAVLLASAALAACSVGEPYRPPVSDATRTGPFDAVA
FT                   DVPAAAAGEPPQRWWRLYDDPVLDGLVRDALAQNRDLAAAVARVERARAVFDEAGAARL
FT                   PDTTAGFGVDYGKHAPDQIVAAAKGTEARTRWGFAPSFSLSWEVDLWGRVRHLVDAARA
FT                   DADAVQAASDAMRVVVAAETTAAYAQVCAYGERIDVAEQSVGIADRLAALTAKQRAHGL
FT                   VSDLEVARSRAFADDTRADLPALVGSRRAALYELAALTGRAPGALPDAAAHCRTAPVLA
FT                   RPFPVGDGASLLRRRPDLRESERQLAAANARIGVATAELYPSISLGGSVNWLSTGGDPS
FT                   TLGDKYAIAWGVGPLITWRFPNMAASRARLAQARADDTLARAQFDAQVLRALKETEQAL
FT                   ARYGAAWRRRAALETARAEHARAYHLAELNYEAGALDFLGVLDAQRSLVAVDSALAEST
FT                   QQVSLDQVAVFKALGGGWQP"
FT   sig_peptide     232941..233003
FT                   /locus_tag="BCAM0199"
FT                   /note="Signal peptide predicted for BCAM0199 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.389 between residues 21 and 22"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    232974..233006
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    233142..233723
FT                   /locus_tag="BCAM0199"
FT                   /note="HMMPfam hit to PF02321, Outer membrane efflux
FT                   protein, score 5.8e-27"
FT                   /inference="protein motif:HMMPfam:PF02321"
FT   misc_feature    233793..234359
FT                   /locus_tag="BCAM0199"
FT                   /note="HMMPfam hit to PF02321, Outer membrane efflux
FT                   protein, score 1.7e-29"
FT                   /inference="protein motif:HMMPfam:PF02321"
FT   CDS_pept        234437..235561
FT                   /transl_table=11
FT                   /locus_tag="BCAM0200"
FT                   /product="efflux system transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0200"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54058"
FT                   /db_xref="GOA:B4EHN2"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B4EHN2"
FT                   /protein_id="CAR54058.1"
FT                   /translation="MSTTAVPEKAKSARFSRRQLIAAGVVLAVIALAVFGWHWWTVGRF
FT                   IEGTDDAYVRADVVTVSSRVSGYVAQVAVDDNQPVKRGDVLVRLDDRDYRAKVDDAQAA
FT                   VAAAEATLQAEQAAASTLDAQIGQQRSQIAQADADAAAARAEAARRDADATRYKQLLAE
FT                   SAASGQRWEQAHADALKARAELARAGAAVRVQTDQQTVLQRRREQSTAAIAQARARLAA
FT                   AQAKLALAQLDLDHTVIRATRDGSIGQRAVRAGQYVEVGMPLLAVVPLSDVYVVANFKE
FT                   TQLGAMHDGQPVEIDVDTYSGHTLHGRVIGLAPGSGAQFALLPPDNATGNFTKIVQRIP
FT                   VKIRVDAPPAGVVLRPGMSVIARVDTRGTQEAGT"
FT   sig_peptide     234437..234535
FT                   /locus_tag="BCAM0200"
FT                   /note="Signal peptide predicted for BCAM0200 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.712) with cleavage site
FT                   probability 0.584 between residues 33 and 34"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    234494..234562
FT                   /locus_tag="BCAM0200"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAM0200 by TMHMM2.0 at aa 20-42"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    234605..235522
FT                   /locus_tag="BCAM0200"
FT                   /note="HMMPfam hit to PF00529, HlyD family secretion
FT                   protein, score 1.6e-44"
FT                   /inference="protein motif:HMMPfam:PF00529"
FT   misc_feature    234620..234646
FT                   /note="PS00850 Glycine radical signature."
FT                   /inference="protein motif:Prosite:PS00850"
FT   CDS_pept        235558..237141
FT                   /transl_table=11
FT                   /locus_tag="BCAM0201"
FT                   /product="Major Facilitator Superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0201"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54059"
FT                   /db_xref="GOA:B4EHN3"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4EHN3"
FT                   /protein_id="CAR54059.1"
FT                   /translation="MSTTTAQAAHEDTVSLRAWVAVLGGVFGCFMAGMNVHVTNASLPD
FT                   IRGSLGASFEEGSWITTAYLVAEIVVIPLTGWLVQVFSARRVLLVGATGFLAFSLACSV
FT                   APSISTMIIARALQGAFGGVLIPLSFQLIVTELPPSKHPLGMALFAIANNVAQAAGPSV
FT                   GGWLTDMYSWRWIFYLQIPPAIALVAAIGWAIRPVPVQLGMLRRADWFGIATMAVGLSA
FT                   LQIVLEEGGRKDWFASDLIVELSIVAALGLAAFVAIELRRKEPFINLRLLGRYNFGIAS
FT                   LMQFLFGAVVFGVVFLVPNYFAELHGYSARDIGLAMIPYGLVQFAMSFLTPPLMRRTSP
FT                   RTTIVLGFVLVAAGCLMNIHLDADAASNVIVPSLIVRGVGQSFVVIALAVMAVDGIEKA
FT                   QLGSASGVFNMVRNVGGAIGIAVMSQIVVERQKLHAMRIGEAVTPFSEAFQERMAMLAR
FT                   LLARVHAPRADVLPGGSISGVHELALGLVNQRVMREALLMAYSDTFLIAGIAMIGCTAA
FT                   AFVLKGKKKA"
FT   misc_feature    join(235600..235668,235726..235794,235804..235872,
FT                   235891..235959,235987..236055,236074..236142,
FT                   236185..236238,236275..236331,236389..236457,
FT                   236494..236553,236581..236640,236677..236745,
FT                   236773..236841,237046..237114)
FT                   /locus_tag="BCAM0201"
FT                   /note="14 probable transmembrane helices predicted for
FT                   BCAM0201 by TMHMM2.0 at aa 15-37, 57-79, 83-105, 112-134,
FT                   144-166, 173-195, 210-227, 240-258, 278-300, 313-332,
FT                   342-361, 374-396, 406-428 and 497-519"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    235612..235644
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    235630..236841
FT                   /locus_tag="BCAM0201"
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 1.9e-56"
FT                   /inference="protein motif:HMMPfam:PF07690"
FT   misc_feature    235831..235863
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    236590..236622
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    237067..237099
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        237309..238340
FT                   /transl_table=11
FT                   /locus_tag="BCAM0202"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0202"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54060"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B4EHN4"
FT                   /protein_id="CAR54060.1"
FT                   /translation="MPPAFPTVLLPMLRIPTLFVAVVLSFAVLPAAHAADHARWPTAFG
FT                   GQPRVGVQVKIQSFTPDDARQIRQTGFDFVRFGVWTDRLDRADYRRQIDDAFAAARSAR
FT                   LPVLLTVRTLTRFRRVDWQREEAQVDRESLAATGARLAGTVTRLAAQYSHALVALELWN
FT                   EPDLDRYWPTGDVAHTFPPFAEGLCGGLAARRPDVPVVGFGFARPPLPGSVPDRLLADV
FT                   YAASPACLDAVSYHAYGMTPMQIRDAARDIRARYGLSALVTEDGAASAGVDGDARQARR
FT                   VRTLLDARATLGTPLLSIYEWIDTPKANDAVQRSYGLVRADRSPKLALDAASTSLRATT
FT                   SKP"
FT   misc_feature    237777..237806
FT                   /note="PS00659 Glycosyl hydrolases family 5 signature."
FT                   /inference="protein motif:Prosite:PS00659"
FT   CDS_pept        complement(238348..239397)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0203"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0203"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54061"
FT                   /db_xref="GOA:B4EHN5"
FT                   /db_xref="UniProtKB/TrEMBL:B4EHN5"
FT                   /protein_id="CAR54061.1"
FT                   /translation="MLRKLIASGPLLSRGLRDAIAACLALLYVGVYANARVLLPEFIFR
FT                   DADKIQTQIGGGSTYDGSSFDAVGKLYQALGGAGTAVFVVALGIATIWIALRATRRLGA
FT                   LVAHLALIAPCLFFNLFVASKDTLVVAMSIAVLAVARVRGPAGAMPIAVMLYLGYAATI
FT                   RSYFALIVAIALAAWVWRRVSTLPRLAGALLVVAVLVALPNAAYSLLQQPRDLAVDYLM
FT                   YASPFGARTSFYNPFPPDSFVHFAGNYSYSFVRLNLPVLFSFDPKGFAMQALVALFLGA
FT                   AWRRVPSQRSGERTTGLRRNGELLACLLLGHVAVSMLFEPDLGSYLRHLSSVAPFAVAL
FT                   WAIRTRDPN"
FT   misc_feature    complement(join(238768..238836,238864..238932,
FT                   238966..239019,239032..239091,239110..239178,
FT                   239281..239340))
FT                   /locus_tag="BCAM0203"
FT                   /note="6 probable transmembrane helices predicted for
FT                   BCAM0203 by TMHMM2.0 at aa 5-24, 59-81, 88-107, 112-129,
FT                   141-163 and 173-195"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(239293..239352)
FT                   /locus_tag="BCAM0203"
FT                   /note="Signal peptide predicted for BCAM0203 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.965) with cleavage site
FT                   probability 0.751 between residues 20 and 21"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(239387..240682)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0204"
FT                   /product="putative polysaccharide biosynthesis transporter
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0204"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54062"
FT                   /db_xref="GOA:B4EHN6"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="UniProtKB/TrEMBL:B4EHN6"
FT                   /protein_id="CAR54062.1"
FT                   /translation="MKAASSRLALRVGALGLKFVLTIVVARTLGFDAVAVYGVALAVSV
FT                   VASKVLGLGFSTEINRRLAGPDPRDAIRTCMRLSVLYAGVYVALCGAAALPVGAFIGLP
FT                   RAGALADVPLVLVMLVACAEHAALEVNTWLFSLHRVRAASWVLFARTGAWAGVALAALA
FT                   ARAIVSIDGVFAIWLAGDALVVALGWLLIAGTARRLPAMPALSATRLPLATVWRSGAPF
FT                   FVALLLLSVLQYLERFVASAMLDAGELGRYVFVWSIANAIQTIASATVAAVAAPRLVRA
FT                   LDCPRRAPQAFRGELAHALRGSVILTGAAALAIVTVHPWLFRLAHEGNDLPSTVILAIL
FT                   LLSFVLRAACDVLWAAAVALRAGRVVAGVMAVLTLACVPMTIALVHDQHAIGAAIAHLV
FT                   ASIAVAAWLVWIVSSRAPTARRAIRPGAADAA"
FT   misc_feature    complement(join(239447..239515,239528..239596,
FT                   239615..239683,239726..239794,239855..239923,
FT                   239981..240040,240098..240166,240179..240247,
FT                   240272..240340,240383..240451,240518..240586,
FT                   240596..240664))
FT                   /locus_tag="BCAM0204"
FT                   /note="12 probable transmembrane helices predicted for
FT                   BCAM0204 by TMHMM2.0 at aa 7-29, 33-55, 78-100, 115-137,
FT                   146-168, 173-195, 215-234, 254-276, 297-319, 334-356,
FT                   363-385 and 390-412"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(239552..239584)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    complement(240317..240349)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(240679..241842)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0205"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0205"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54063"
FT                   /db_xref="InterPro:IPR007345"
FT                   /db_xref="UniProtKB/TrEMBL:B4EHN7"
FT                   /protein_id="CAR54063.1"
FT                   /translation="MSRPVHVALLHAYSARNSGDGLLVELSVALLRGAFGTDTRVSVVA
FT                   ADPASFPDQPDVRPAPVLAAGGAGRLIGAAMAALPVGANPALADLRGLLKQADLIVGVG
FT                   GGYLRARNSVEALKLEAGHLVQMRAARAARKPAVYLPQSIGPAAGNTMLAGHLTSLLAG
FT                   FHTVFVRDDRSMALLAANPNTRRAPDLAVLEFGRRAAGLRKHAHVPPAHPGHIALVLRR
FT                   PPAWSAAQCARYHAQTEALVERLGAFCRITFAVQSTGRGNDDAAYYRERGFDDTRTLKD
FT                   VLAGDTPDAVVSVRLHGALESILHGVPAYHLSYERKGFGAYADLGVGHWVANAADFDAN
FT                   AVCDTLFAPDALRRFWTQTDTGIARLGRERDRIVAALRAALHHGAAR"
FT   CDS_pept        complement(241842..243065)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0206"
FT                   /product="glycosyltransferase"
FT                   /note="Similar to Rhizobium meliloti (Sinorhizobium
FT                   meliloti) putative glycosyltransferase protein.
FT                   UniProt:Q92QS8 (414 aa) fasta scores: E()=1.1e-31, 35.092%
FT                   id in 379 aa; homology does not extend to far N and C
FT                   termini"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0206"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54064"
FT                   /db_xref="GOA:B4EHN8"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B4EHN8"
FT                   /protein_id="CAR54064.1"
FT                   /translation="MSDIAFAPSLDERASLQPDTNPPAPSATAAPPLRIALVVEAAGGG
FT                   VAVHLTDLIAGLHARGHAEIHLIAPLGERFDDAMLAGAAAQCTTFHRLPLRRSVGAHDL
FT                   RGAIALRRLLRRIRPDIVHSHSSKAGALARLCRGPWKQVYTPHAVYTLNPTLSPAKRAF
FT                   YGGVERVLGNACSDAVIAVSQDEADHLHTLGIARDRIRLVENGVTPPMLLARQAARIAL
FT                   GLADHPFVVGFVGRFDHQKGVDRLVRIARVLDECFGNRVQVVAIGSGDFDQAAGDEAHD
FT                   LPANLRIAGRVDSARRYFSAFDLLALPSRYEGFPYVCLEAVAAQVPIVATQVSGATELI
FT                   AGHRVGLTVSNSDDPAAFASMVGRLVEHPASHRLMREQCARAYPHFSADAMVDRTLAVY
FT                   RDLLRENA"
FT   misc_feature    complement(241917..242423)
FT                   /locus_tag="BCAM0206"
FT                   /note="HMMPfam hit to PF00534, Glycosyl transferases group,
FT                   score 1.9e-24"
FT                   /inference="protein motif:HMMPfam:PF00534"
FT   CDS_pept        complement(243062..245335)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0207"
FT                   /product="putative tyrosine-protein kinase"
FT                   /EC_number="2.7.1.112"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0207"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54065"
FT                   /db_xref="GOA:B4EHN9"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005700"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:B4EHN9"
FT                   /protein_id="CAR54065.1"
FT                   /translation="MTSSASPEHEIDLIRVLDVLRQARWTIASITAACVAAGALYAFVA
FT                   PPTYQADLMIQTDDATDAASKNLLGDAASFFNVASPASAEAQILSSRLVVTRAVEDLRA
FT                   YIVATPARVPVIGAFVARFNDGAVKPGLFGFGGYAWGQERIDVVRFDVPTRAEGDTFQV
FT                   VRLDNTRYRLTGADMKADAIGTIGRTETFDTRYGPLHIDIIGFDALPGTRFQLVRQSRA
FT                   ETIDTLRTALDVQEKVKQSGVLVASLRGDDPVDISATLNAIANRYIEQNIARRTAEAAQ
FT                   SLAFLNAQLPIVKGQLERAETRYARLRSRTGSVDLEEEGKVVLQQGADLQTRLLELQQK
FT                   HDELSRRFLPTHPDMAALDAQLATLKRQQGALDARIARLPAQQSEEVRARLDVKVNADL
FT                   YTALLNNTQQLELVQAGRTASVRVVDAAVAPADPVRPNRPVVIAAAALAGLALGLIAAF
FT                   AREFLYGGLTAVDEIERHTSLPVRAVLPAAARQRKLMRAVERHDAGLHVLAYDDPYEPA
FT                   IEGLRSLQTALHFALADRAHPLVLVTGPAPGTGKSFVSVNLAAVHAASGRRVLLIDGDL
FT                   RKGYLHQYFGLERGAGFAALLAGHAHADNAIRRNVAPNLDFLPTGELPSAPTALLQQAG
FT                   LGALLASLRARYDLVIVDSAPLLAATDSTWLGAHADATLLVARAGSTRAGELVEAAKRL
FT                   PQRPDAQPGVVLNGLDPRTGASAFGSKYGGYRYEAYRYTCNTRRCTHLARLRAALQRLL
FT                   RRSA"
FT   misc_feature    complement(243548..243571)
FT                   /note="PS00030 Eukaryotic putative RNA-binding region RNP-1
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00030"
FT   misc_feature    complement(join(243959..244018,245201..245269))
FT                   /locus_tag="BCAM0207"
FT                   /note="2 probable transmembrane helices predicted for
FT                   BCAM0207 by TMHMM2.0 at aa 23-45 and 440-459"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(244538..245311)
FT                   /locus_tag="BCAM0207"
FT                   /note="HMMPfam hit to PF02706, Chain length determinant
FT                   protein, score 9.8e-38"
FT                   /inference="protein motif:HMMPfam:PF02706"
FT   CDS_pept        complement(245332..245838)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0208"
FT                   /product="putative protein-tyrosine-phosphatase (low
FT                   molecular weight)"
FT                   /EC_number="3.1.3.48"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0208"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54066"
FT                   /db_xref="GOA:B4EHP0"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:B4EHP0"
FT                   /protein_id="CAR54066.1"
FT                   /translation="MPTPPPFLLAVCEGNVCRSPLAAALLAAKLPHARTGSAGLAPPNG
FT                   RPADPLARDMAAARGLNLDAHAARPVTAALCAQADLIFVMDGGQRRALEARHPFLRGRV
FT                   FRLGEYARIADGAPLGLDIPDPYRGTRDDFVRCAALIDLAVGSWLPRLAARWPHITASF
FT                   SGFQS"
FT   misc_feature    complement(245386..245823)
FT                   /locus_tag="BCAM0208"
FT                   /note="HMMPfam hit to PF01451, Low molecular weight
FT                   phosphotyrosine protein, score 5.2e-32"
FT                   /inference="protein motif:HMMPfam:PF01451"
FT   CDS_pept        complement(245838..246986)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0209"
FT                   /product="putative capsular polysaccharide transport
FT                   protein"
FT                   /note="Similar to Ralstonia solanacearum (Pseudomonas
FT                   solanacearum) EPS I polysaccharide export outer membrane
FT                   protein EpsA precursor UniProt:EPA2_RALSO (377 aa) fasta
FT                   scores: E()=4.9e-43, 43.490% id in 361 aa; homology does
FT                   not extend to N terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0209"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54067"
FT                   /db_xref="GOA:B4EHP1"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:B4EHP1"
FT                   /protein_id="CAR54067.1"
FT                   /translation="MNTSYLGWLADTPDDGAPAPASADSRAAEARAAAASTMAGTPVRA
FT                   QSTGVDSAATPPIVDIEPSLIARQRAARDAAAASFDTPAASRAPSAYRIGPGDVLQITV
FT                   WDHPELAAAQGGAQQTPPRTADPVAGFVVDDLGNLTFPYAGALKVAGLTAAEAQARLKQ
FT                   ALGKIYRDPQVTLRVASFRSQQVYVDGEVHTPGALPVNDVPMTLADAIARAGGFTPGAD
FT                   QSDVTIVRDGTPVRIDLARLIERHRDPSRIVLRSGDLLRVGARDSNGVYVMGEVNRPTL
FT                   ALPKRDGRLTLSDALLQAGSINSNTADAAQMFVIRGAQGRTPTVFHLDARSPVAMVLAN
FT                   QFELEPKDIVYVDGNGLVRISRVLSLLLPSVNTGVAAGIATK"
FT   misc_feature    complement(246333..246746)
FT                   /locus_tag="BCAM0209"
FT                   /note="HMMPfam hit to PF02563, Polysaccharide
FT                   biosynthesis/export protei, score 1.7e-39"
FT                   /inference="protein motif:HMMPfam:PF02563"
FT   CDS_pept        complement(247226..248617)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0210"
FT                   /product="putative transferase"
FT                   /note="Similar to Escherichia coli WcaJ putative colanic
FT                   biosynthesis UDP-glucose lipid carrier transferase
FT                   UniProt:WCAJ_ECOLI (EMBL:ECD842) (464 aa) fasta scores:
FT                   E()=2.8e-47, 39.348% id in 399 aa; homology does not extend
FT                   to the N terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0210"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54068"
FT                   /db_xref="GOA:B4EHP2"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017473"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:B4EHP2"
FT                   /protein_id="CAR54068.1"
FT                   /translation="MNKKHGPRSEIVVCMVDVAAIVAIAVLTHHDSLWNLDALAIEWLL
FT                   IGVSALLGAFLLRLAGIGLDGRPRPATRYAVRTLALWLVVQGFVFLKMIALTTATVMML
FT                   TWFFDWTIEVGIVLAVFRIALSIARRRSLRVPATPARIAVVGNGERIARIVASLAAAGT
FT                   PRYRLVSAYSTGGRAMTLAGDALVTTDLASFAACARRQHADEVWIALPLAEDASITRVI
FT                   DKFRSDFVELRLMPDVSQHALFGSQVDEILGEPAISLAAPPLSRGALCVKAVFDRAFAA
FT                   AVLIVLMPLLLVIAAAIKLSSPGPVMFTQKRRGGDGRTFDIYKFRTMRVHVGQPGKVEQ
FT                   ATRNDPRVTKVGAFLRRTSLDELPQFVNVLFGDMSVVGPRPHAVEHDAQYRTLVDGYIH
FT                   RYRIKPGITGWAQVNGLRGATEQLESMQSRVEYDLYYLRNWSFALDLRIIGATVLKGIV
FT                   HPNAY"
FT   misc_feature    complement(247229..247804)
FT                   /locus_tag="BCAM0210"
FT                   /note="HMMPfam hit to PF02397, Bacterial sugar transferase,
FT                   score 2e-29"
FT                   /inference="protein motif:HMMPfam:PF02397"
FT   misc_feature    complement(join(247724..247783,248243..248302,
FT                   248330..248398,248435..248503,248531..248584))
FT                   /locus_tag="BCAM0210"
FT                   /note="5 probable transmembrane helices predicted for
FT                   BCAM0210 by TMHMM2.0 at aa 12-29, 39-61, 74-96, 106-125 and
FT                   279-298"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(248852..249754)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0211"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to central region of Bacillus cereus (strain
FT                   ATCC 14579/DSM 31) hypothetical protein. UniProt:Q81DW8
FT                   (384 aa) fasta scores: E()=2.9e-18, 30.403% id in 273 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0211"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54069"
FT                   /db_xref="UniProtKB/TrEMBL:B4EHP3"
FT                   /protein_id="CAR54069.1"
FT                   /translation="MDYNLCIVRPPGYAHSGAFTELAEVIAYGLDDLGHLVHVNENNMM
FT                   PDVRNILIGCHLADPDMTAHVPDDTIVVNTEQLHVDEQPWNRNIYRWASRYETWDYSER
FT                   NLAKLHSLGIGHARYLKLGFHPKLRRIPADVEQDIDVLFYGTIGPRRATILDALRARGL
FT                   NVGIVSGGLYGAEREAFITRTKVVLNLHHYASHIFEVVRAFYLMTNGKAIVGEVSPTTS
FT                   VDPDYADGFRAAPYDALVDACIELVRDSAQRRRLEAAALATIGRHPQARSLAPLLAPQA
FT                   DAVATAFREHAFTACSQAV"
FT   CDS_pept        complement(249782..251356)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0212"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Ralstonia solanacearum (Pseudomonas
FT                   solanacearum) rs00434 hypothetical protein rsc3164.
FT                   UniProt:Q8XUM3 (387 aa) fasta scores: E()=4.8e-19, 35.455%
FT                   id in 330 aa; homology does not extend to N terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0212"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54070"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:B4EHP4"
FT                   /protein_id="CAR54070.1"
FT                   /translation="MQITSHDTPAFADTDDTMLAALANAASLGIDDAAVATATQTLIER
FT                   GAADRAARLAAAHWDLRPDSPAAAFNCGYAMQMAGRHADAIAPYRHTLELAPAWPSLKN
FT                   NLALAIRLTGGDPEVEFALIEGALDDAPDDARAWTNAVITRIDRFDLDGALRAATRAVS
FT                   LAPDSALAVNNAATAMKEAQWWGQAERHAQRAVELAPHNPTYRHNVSLLQLARGDFASG
FT                   WPNYEARWDGSAELRGNLPAFAGPRWRGESLRGKTLLLWGEQGLGDALQFCRYVPLLAE
FT                   RVHREGGRIVWNAFPVMGDLFGRSLARHVDVFDTSMRIEDLPAFDVELPLMSIPGMLGL
FT                   DGDALATTVPYLHADASATDAWRTALAAEKRLKVGLAWTGSLSHQRNRFRRVGLERYAE
FT                   AFGGLQQDVAFYSLQPGAQHDIEAARSAGFVVNDCTRDWRTIDDTAAFVGALDLVITVC
FT                   TSAAHLSGALGQRTWVLLDANPHWVWQHERRDSPFYPSALLYRQKTFAQWQPVMDAVAA
FT                   DLRRLAG"
FT   misc_feature    complement(250586..250609)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        251708..252022
FT                   /transl_table=11
FT                   /locus_tag="BCAM0213"
FT                   /product="putative membrane protein"
FT                   /note="N terminus is similar to N terminus of Brucella
FT                   melitensis chloride channel protein. UniProt:Q8YFS5 (555
FT                   aa) fasta scores: E()=4.9, 32.877% id in 73 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0213"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54071"
FT                   /db_xref="GOA:B4EHP5"
FT                   /db_xref="UniProtKB/TrEMBL:B4EHP5"
FT                   /protein_id="CAR54071.1"
FT                   /translation="MSAADFLVKGTVIGMVASAATVGMVHVVVEFGTRWSSSGMVVTMA
FT                   SALLMAMLLLVPPLVDAWRNRKDVVDPFYEPAALKPMLQGRTIGIVVGIVFGVSIVTGW
FT                   "
FT   misc_feature    join(251735..251794,251828..251896,251954..252013)
FT                   /locus_tag="BCAM0213"
FT                   /note="3 probable transmembrane helices predicted for
FT                   BCAM0213 by TMHMM2.0 at aa 10-29, 41-63 and 83-102"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        252025..252825
FT                   /transl_table=11
FT                   /locus_tag="BCAM0214"
FT                   /product="putative glycosyltransferase"
FT                   /note="Similar to C terminus of Rhizobium loti
FT                   (Mesorhizobium loti) mll0582 protein. UniProt:Q98MH1 (931
FT                   aa) fasta scores: E()=1.7e-15, 27.925% id in 265 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0214"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54072"
FT                   /db_xref="GOA:B4EHP6"
FT                   /db_xref="InterPro:IPR002654"
FT                   /db_xref="UniProtKB/TrEMBL:B4EHP6"
FT                   /protein_id="CAR54072.1"
FT                   /translation="MSMPVTDRTDADMVHVNAPGIDAPTVCKTLCVISLRGERGRRDAF
FT                   RANNPALAFEFVDAIDGRALSDDDIARSGLFAPALPYTRGAIGIAMTTHRLWTDIAAGN
FT                   ELVTIVEDDAIFRPDFDETAMQFLAAHANRYDFVAWGYNFDSILRGAIFNGRTPVTMRF
FT                   DEAALAQAVDEFRTDRGPVLVMDLLEFYGICAYTISPAGARFLLDHCFPLQPETLFSHG
FT                   LGRALPNYGIDVAMNKFYGAMRSVAAFPPLAVTMNARATSTIQR"
FT   misc_feature    252103..252681
FT                   /locus_tag="BCAM0214"
FT                   /note="HMMPfam hit to PF01755, Glycosyltransferase family
FT                   25 (LPS bi, score 1.2e-05"
FT                   /inference="protein motif:HMMPfam:PF01755"
FT   CDS_pept        253360..254202
FT                   /transl_table=11
FT                   /gene="RS04811"
FT                   /locus_tag="BCAM0215"
FT                   /product="putative peptidylprolyl isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0215"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54073"
FT                   /db_xref="GOA:B4EHP7"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:B4EHP7"
FT                   /protein_id="CAR54073.1"
FT                   /translation="MKKHHISIVSTLIALACACGAPVARAAGTKTDTPLPPGVEAVVND
FT                   TPIARSDVDSMIEATGQTVTPELRAQAKRELIAQHLVEQAAEKANYGSRPEVNRVVMRA
FT                   RTVAATDLYLRDNVHPQAVTDAQVKARYDDIVANAAQFEYRADVIAVADPAEVNALVAE
FT                   LKQGAAFDAVAKKYNTTPNGGVAQWVELRTPVAEGKTGGLPLPLAQAITSLQPGAVAGP
FT                   IRVGNAFAIVKLDEKRATVVPTFEAAKNVLRQQLEGQAQQRAMTALVDKLAGQATIQQ"
FT   sig_peptide     253360..253437
FT                   /gene="RS04811"
FT                   /locus_tag="BCAM0215"
FT                   /note="Signal peptide predicted for BCAM0215 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.935 between residues 26 and 27"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    253378..253446
FT                   /gene="RS04811"
FT                   /locus_tag="BCAM0215"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAM0215 by TMHMM2.0 at aa 7-29"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    253378..253410
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    253804..254067
FT                   /gene="RS04811"
FT                   /locus_tag="BCAM0215"
FT                   /note="HMMPfam hit to PF00639, PPIC-type PPIASE domain,
FT                   score 6.5e-05"
FT                   /inference="protein motif:HMMPfam:PF00639"
FT   CDS_pept        complement(254723..255043)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0216"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0216"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54074"
FT                   /db_xref="GOA:B4EHP8"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR039554"
FT                   /db_xref="UniProtKB/TrEMBL:B4EHP8"
FT                   /protein_id="CAR54074.1"
FT                   /translation="MNRDASYQHTDCTPTDSGFDDAGELSAKSALVLKLNALIASQGLS
FT                   DEEAAALADMARPVVTPEQRERLRNVSLDLLMRALVSFGQQVEIVVRPAGSSRLAGITV
FT                   SV"
FT   CDS_pept        complement(255040..255381)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0217"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Yersinia pestis hypothetical protein
FT                   UniProt:Q8CLT6 (74 aa) fasta scores: E()=1.1, 38.596% id in
FT                   57 aa; homology does not extend to N- and C-termini"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0217"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54075"
FT                   /db_xref="GOA:B4EHP9"
FT                   /db_xref="InterPro:IPR014944"
FT                   /db_xref="UniProtKB/TrEMBL:B4EHP9"
FT                   /protein_id="CAR54075.1"
FT                   /translation="MANANHSAPTFFQDCFVHSHESFQTRRIFPRLRFAETAPPVFHLW
FT                   MKLSGRWIEEAGFEPEQRLQIEVTHQRLVITPIAEEGRDCFGKDERPDVDPATGQALRQ
FT                   LAAMTGNAQ"
FT   CDS_pept        complement(255662..258694)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0218"
FT                   /product="hybrid two-component system kinase-response
FT                   regulator protein"
FT                   /note="C terminus is similar to C terminus of Rhodobacter
FT                   sphaeroides (Rhodopseudomonas sphaeroides) dors
FT                   dmso/tmao-sensor kinase. UniProt:O30740 (815 aa) fasta
FT                   scores: E()=1.9e-36, 33.663% id in 505 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0218"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54076"
FT                   /db_xref="GOA:B4EHQ0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4EHQ0"
FT                   /protein_id="CAR54076.1"
FT                   /translation="MPIRHLFASHTDASEPFASIDDDARDLSLLNRYQRFTLYGGAVVL
FT                   SLVILIAAGILLVGSVRDYITERRDLFLTHKALVQLEMDAKQASMRRAVINAELLWNGH
FT                   PPHAREASDALRKDGHVLLAPMRGVSEIFLAASPDALANDETDRYVQLMERQTISVAAA
FT                   ERQTGRAVRGYAYSPDRNVIAITPPPSMPYPDLLAHIGVPDTHALIQHLAFDVADWSNP
FT                   AIARYWRLSRRIAWQAPAIDPLTGKTVFRLVEPAFDGQKHFMTFVSDFDVDVIADRLRH
FT                   APEDAVAMLVDQHGRVVLDVDRTDNSEDGAALMKHALAEGTWRRGLVNFDESYRHGVFT
FT                   ITDRISDTGYAIVYAYSWHTIAYAIWATMLREFGTIATILIVLWTLVIAFDLRVFAPLF
FT                   RRSRRVFESERMSRTIVATAPFGIGLVSPDTHQVLLRNRMLELYDREAGAPPLHERLLA
FT                   RYREHADASPAQLDVELPVTLDDGRTRDLLVNFVRVRYKGKDALLCSFSDITTRADAQR
FT                   ALDSANRAKSTFLATISHEIRTPLNAMLGNLELLDKAPDPSRQKPRLHAVTSAARMLLD
FT                   MLNNVLDMTKIEADRMTLEATGFRIDELMRDVADLFEPVAGARGIALRIDVDPAVTHTY
FT                   LGDPMRVRQIAVNLVSNAIKFTDRGAVALSVSASGGGATPVTIRVSDSGIGMTADQLAH
FT                   VFEPFAQADESIARRFGGTGIGLALSYKLAESMGGRIEADSVPGVGSTFVVTLPLPLDR
FT                   QPGALRSRADGDAPNARVLFVDDNPVNRSLIHDQLDVLGYQADVASNVAEALDLVDRHD
FT                   YAVVLTDLNMPGLDGYAFARVLRERGRVQPILAVTAHAEPDELKLAWEAGIDEIVTKPT
FT                   SLKSLEQAITKHAGTWRRPVHPPVPSRAAGPLPKDLHTVLVDATRRSNAAIARALQDGD
FT                   LKVARSEIHSMRGAFAMIGERDISGLCASIEALALAGDAAAFAREFERYRQSASEILAR
FT                   RAASDAKQAADTFSNTSVMKR"
FT   misc_feature    complement(255728..255979)
FT                   /locus_tag="BCAM0218"
FT                   /note="HMMPfam hit to PF01627, Hpt domain, score 2.3e-06"
FT                   /inference="protein motif:HMMPfam:PF01627"
FT   misc_feature    complement(256052..256390)
FT                   /locus_tag="BCAM0218"
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 2.3e-29"
FT                   /inference="protein motif:HMMPfam:PF00072"
FT   misc_feature    complement(256445..256786)
FT                   /locus_tag="BCAM0218"
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HS, score 3.3e-41"
FT                   /inference="protein motif:HMMPfam:PF02518"
FT   misc_feature    complement(256925..257122)
FT                   /locus_tag="BCAM0218"
FT                   /note="HMMPfam hit to PF00512, His Kinase A
FT                   (phosphoacceptor) domain, score 2.7e-20"
FT                   /inference="protein motif:HMMPfam:PF00512"
FT   misc_feature    complement(join(257510..257578,258518..258586))
FT                   /locus_tag="BCAM0218"
FT                   /note="2 probable transmembrane helices predicted for
FT                   BCAM0218 by TMHMM2.0 at aa 37-59 and 373-395"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        259169..268030
FT                   /transl_table=11
FT                   /locus_tag="BCAM0219"
FT                   /product="putative haemagglutinin-related autotransporter
FT                   protein"
FT                   /note="Contains many Hep_Hag repeats and haemagglutinin
FT                   motifs"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0219"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54077"
FT                   /db_xref="GOA:B4EHQ1"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR024973"
FT                   /db_xref="UniProtKB/TrEMBL:B4EHQ1"
FT                   /protein_id="CAR54077.1"
FT                   /translation="MNKSYRTVWNATTGTWTAAAETARMRTKSKSNSAMRSSVTAAVAV
FT                   MAGVGGGAMSADANAQAANGNGSLTLCTPGGSGGYYGSVFGGGSISGTRLTGCGAAVST
FT                   FRLSEGHVRSFQLYNNSAANGSGAGQASAATEAGISGTVDGHLFLLGGSGVHLRGPVDV
FT                   DSNVDMTNHRINNLAAGTAGTDAVNVNQLNTAIANAKAADNPYIKIIGSAAGISDTAAS
FT                   ASSGSVAMGRGAVAGAVYTTAIGNDSHANGQSSTAVGVTSSASGSQSVVVGNSTFAGNQ
FT                   GTAIGYGANARGTNAAALGTRAAASGGDSLALGTNASAAGTGAVALGYGSEATRNNTVS
FT                   VGKTGAERQIANVAAGTQGTDAVNLNQLNTAIAGVKTSDNPYVKIVGNTAAEASGMGSV
FT                   SIGSGSVARSGSSGGNIAIGNGATADTSGGGYGTMALGYGAKAGTSGYSGGMAIGLGAN
FT                   STHGNVAIGDGAQASGKAGDAATYRGVTAIGNNATANAASSVALGYLSVADRDNSVSVG
FT                   SSTLQRQITNVAAGTADTDAVNVSQLKGSGLIGDDGKSIAAVTYDRNADGTPNYGTVTL
FT                   GNGNGPTQIKNVADAKDDHDALNLGQLKDAGLVGDDGAGKLTSAAVTYDKNADGTINHD
FT                   KATLAGTSGTTLSNVKAGVADMDAVNVSQLKGSGLIGDDGKSIAAVTYDRNADGTPNYG
FT                   TVTLGNGNGPTQIKNVADAKDDHDALNLGQLKDTGLVGEDGAGKLTSLAVTYDGAAKDS
FT                   VTLGGTGATAPVALHNVADGVLSATSKDAVNGSQLFATNTRVGDLEDSLSKGGVIDPVT
FT                   GESLAVVYDSNAKDTVTLKGTNGTTLSNVKAGAADMDAVNVSQLKGSGLIGDDGKSIAA
FT                   VTYDRNADGTPNYGTVTLGNGNGPTQVKNVATGVEDTDAVNVKQLTSGLSDLKDEMSRA
FT                   DLRFVKVNADPVTGTPAIASGALAVAIGSDARATSANSLALGSGARVTGAGSVAIGYNS
FT                   VANQNNVVSVGDVGRERKIVNVADGDVAFQSTDAVNGGQLYAALNTLSTSVTSKTQQAI
FT                   DTFSTEIDKKTKAAIDEVSSRSMQPMDVSDPLVAIEGLQGNNVASLNGADPATATAAAI
FT                   GSSTAASGANAVAIGLQSGAGSNNSVALGSFAQTGAGQDYSVAMGSNVQTNGTQAVAMG
FT                   ANTQANGDYALAIGNNGAQAVGDSSIAVGNGANVRAGATNAMAIGTGANVARNVEGAMA
FT                   LGANSTSGAANSIALGSNSFSNRADTLSVGRAGAERQIVNVAAGTQATDAVNVSQLKGV
FT                   TDSLGGGTTIGADGSITKPTYNVGGTDYHNVGDALDALEKSSGSNPLAVAYDSAAKDTV
FT                   TLGGVGATTPVALKNVADAKDDHDALNLGQLKNAGLVGDDGAGKLTSAAVTYDKNADGT
FT                   INHDKATLAGTSGTTLSNVKAGVADMDAVNVSQLKGSGLIGDDGKSIAAVTYDRNADGT
FT                   PNYGSVTLGNGTGPTQLKNVADAKDDHDALNLGQLKDTGLVGEDGAGKLTSAAVTYDKN
FT                   ADGTINHDKATLAGTSGTTLSNVKAGVADMDAVNVSQLKDAGLIDPSTGKPMAAVTYDS
FT                   AAKDTVTLGGVGATTPVALKNVADAKDDHDALNLGQLKDTGLVGEDGAGKLTSLAVTYD
FT                   GASKDSVTLGGTGATAPVALHNIADGVLSATSKDAVNGSQLFATNTRVGDLEDSLKQGG
FT                   VIDPTTGESLAVVYDSTAKNSVTLGNAGTPVGIHNLAAGTVNATSNDAINGSQLFTVSK
FT                   SVADKIGGGAGVGADGSITDPTYSVGGQDYHNVGDALDALDKNSGNNPLAVAYDSAAKD
FT                   TVTLGGVGATTPVALKNVADAKDDHDALNLGQLKNAGLVGDDGAGNLTSAAVTYDKNAD
FT                   GTINHDKATLAGTSGTTLSNVKAGVADMDAVNVSQLKGSGLIGDDGKSIAAVTYDRNAD
FT                   GTPNYGSVTLGNGTGPTQLKNVADATDDGDALNLGQLKNAGLVGEDGAGKLTSAAVTYD
FT                   KNADGTINHDKATLAGTSGTTLSNVKAGVADMDAVNVSQLKGSGLIGDDGKSIAAVTYD
FT                   RNADGTPNYGSVTLGNGTGPTQLKNVADAKDDHDALNLGQMKDAGLVGEDGAGKLTSAA
FT                   VTYDKNADGTINHDKATLAGTSGTTLSNVKAGVADMDAVNVSQLKDAGLIDPSTGKSLA
FT                   AVTYDDATKSTVTLGGVGATTPVALKNVADGTDRHDAINLGQLQDAGLVAPVDPTDPGK
FT                   GLKSLAVAYDSATQDVVTLKGTDGTTITNVKAGAVTATSTDAINGSQLHATAQSVADSL
FT                   GGGSTVDADGKVTNPSYSLADPTDASKKAEYSNVGDALANLDGRTSTNTENITVINKQL
FT                   ADSGLVDPATGQSIAAVTYDRNADGTPNKGSVTLGGAGATAPVALKNVADGVDAHDAVN
FT                   LGQLQGAGLVAPVDPTNPGAGLTSLAVTYDKHADGSANFDQITLKGTDGSTITNVKAGA
FT                   VNATSTDAVNGSQLYGASKSVADSLGGGSTVDANGNVTNPTYTVNNQKFDNVGDAIENI
FT                   SNSLVHGSIGLVQQDDVTRDITVAKDTDGTTVNFAGTAGDRVLTGVGAGAVSATSNDAI
FT                   NGSQLHGTAQSVADVIGGGTTVDADGKLADTSIEVNGNKYKTVAEAVQAAAQYGATDSL
FT                   AVRYDLNADGTPNYGSVTLGGSGSAPVRLTNVADGASKYDAVNFGQLSELNDKIGGLDD
FT                   RVGALEQNPGPGTPNPGGPGNEYFAGTDIGSDGTTPANAGDGTGNTAAGSNARVGTGVN
FT                   NGTAIGSGAGVSKDGGVAIGSNAASAAEGAVAIGRGSDASGSKSTAIGDGAKASGANSV
FT                   ALGSGSQATEANTVSFGDGSEDGNRRIVNIRDGINETDAATKGQLDRAVGGLQGQVNDL
FT                   SRNAYSGIAAATALTMIPGVDPGKTVSFGIGGATYKGYQAVAFGGEARITQNLKMKAGV
FT                   GLSSGGNTVGVGASYQW"
FT   sig_peptide     259271..259333
FT                   /locus_tag="BCAM0219"
FT                   /note="Signal peptide predicted for BCAM0219 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.506 between residues 21 and 22"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    259682..259744
FT                   /locus_tag="BCAM0219"
FT                   /note="HMMPfam hit to PF05662, Haemagglutinin, score
FT                   2.9e-05"
FT                   /inference="protein motif:HMMPfam:PF05662"
FT   misc_feature    259832..259915
FT                   /locus_tag="BCAM0219"
FT                   /note="HMMPfam hit to PF05658, Hep_Hag, score 0.00055"
FT                   /inference="protein motif:HMMPfam:PF05658"
FT   misc_feature    259916..259999
FT                   /locus_tag="BCAM0219"
FT                   /note="HMMPfam hit to PF05658, Hep_Hag, score 0.003"
FT                   /inference="protein motif:HMMPfam:PF05658"
FT   misc_feature    260000..260080
FT                   /locus_tag="BCAM0219"
FT                   /note="HMMPfam hit to PF05658, Hep_Hag, score 0.58"
FT                   /inference="protein motif:HMMPfam:PF05658"
FT   misc_feature    260081..260164
FT                   /locus_tag="BCAM0219"
FT                   /note="HMMPfam hit to PF05658, Hep_Hag, score 2.5e-05"
FT                   /inference="protein motif:HMMPfam:PF05658"
FT   misc_feature    260210..260272
FT                   /locus_tag="BCAM0219"
FT                   /note="HMMPfam hit to PF05662, Haemagglutinin, score
FT                   3.4e-06"
FT                   /inference="protein motif:HMMPfam:PF05662"
FT   misc_feature    260345..260437
FT                   /locus_tag="BCAM0219"
FT                   /note="HMMPfam hit to PF05658, Hep_Hag, score 1.2"
FT                   /inference="protein motif:HMMPfam:PF05658"
FT   misc_feature    260648..260731
FT                   /locus_tag="BCAM0219"
FT                   /note="HMMPfam hit to PF05658, Hep_Hag, score 0.00046"
FT                   /inference="protein motif:HMMPfam:PF05658"
FT   misc_feature    260735..260797
FT                   /locus_tag="BCAM0219"
FT                   /note="HMMPfam hit to PF05662, Haemagglutinin, score
FT                   1.7e-08"
FT                   /inference="protein motif:HMMPfam:PF05662"
FT   misc_feature    260915..260977
FT                   /locus_tag="BCAM0219"
FT                   /note="HMMPfam hit to PF05662, Haemagglutinin, score
FT                   7.5e-05"
FT                   /inference="protein motif:HMMPfam:PF05662"
FT   misc_feature    261101..261163
FT                   /locus_tag="BCAM0219"
FT                   /note="HMMPfam hit to PF05662, Haemagglutinin, score
FT                   0.00013"
FT                   /inference="protein motif:HMMPfam:PF05662"
FT   misc_feature    261281..261343
FT                   /locus_tag="BCAM0219"
FT                   /note="HMMPfam hit to PF05662, Haemagglutinin, score
FT                   7.5e-05"
FT                   /inference="protein motif:HMMPfam:PF05662"
FT   misc_feature    261854..261916
FT                   /locus_tag="BCAM0219"
FT                   /note="HMMPfam hit to PF05662, Haemagglutinin, score
FT                   3.5e-06"
FT                   /inference="protein motif:HMMPfam:PF05662"
FT   misc_feature    262013..262096
FT                   /locus_tag="BCAM0219"
FT                   /note="HMMPfam hit to PF05658, Hep_Hag, score 6.8e-05"
FT                   /inference="protein motif:HMMPfam:PF05658"
FT   misc_feature    262097..262180
FT                   /locus_tag="BCAM0219"
FT                   /note="HMMPfam hit to PF05658, Hep_Hag, score 0.0029"
FT                   /inference="protein motif:HMMPfam:PF05658"
FT   misc_feature    262184..262255
FT                   /locus_tag="BCAM0219"
FT                   /note="HMMPfam hit to PF05662, Haemagglutinin, score
FT                   2.4e-06"
FT                   /inference="protein motif:HMMPfam:PF05662"
FT   misc_feature    262547..262636
FT                   /locus_tag="BCAM0219"
FT                   /note="HMMPfam hit to PF05658, Hep_Hag, score 0.05"
FT                   /inference="protein motif:HMMPfam:PF05658"
FT   misc_feature    262637..262720
FT                   /locus_tag="BCAM0219"
FT                   /note="HMMPfam hit to PF05658, Hep_Hag, score 0.00062"
FT                   /inference="protein motif:HMMPfam:PF05658"
FT   misc_feature    262724..262813
FT                   /locus_tag="BCAM0219"
FT                   /note="HMMPfam hit to PF05658, Hep_Hag, score 0.055"
FT                   /inference="protein motif:HMMPfam:PF05658"
FT   misc_feature    262826..262903
FT                   /locus_tag="BCAM0219"
FT                   /note="HMMPfam hit to PF05658, Hep_Hag, score 0.012"
FT                   /inference="protein motif:HMMPfam:PF05658"
FT   misc_feature    262949..263011
FT                   /locus_tag="BCAM0219"
FT                   /note="HMMPfam hit to PF05662, Haemagglutinin, score
FT                   1.3e-07"
FT                   /inference="protein motif:HMMPfam:PF05662"
FT   misc_feature    263414..263476
FT                   /locus_tag="BCAM0219"
FT                   /note="HMMPfam hit to PF05662, Haemagglutinin, score
FT                   0.00013"
FT                   /inference="protein motif:HMMPfam:PF05662"
FT   misc_feature    263780..263842
FT                   /locus_tag="BCAM0219"
FT                   /note="HMMPfam hit to PF05662, Haemagglutinin, score
FT                   0.00013"
FT                   /inference="protein motif:HMMPfam:PF05662"
FT   misc_feature    264350..264421
FT                   /locus_tag="BCAM0219"
FT                   /note="HMMPfam hit to PF05662, Haemagglutinin, score
FT                   0.00027"
FT                   /inference="protein motif:HMMPfam:PF05662"
FT   misc_feature    264836..264898
FT                   /locus_tag="BCAM0219"
FT                   /note="HMMPfam hit to PF05662, Haemagglutinin, score
FT                   0.00013"
FT                   /inference="protein motif:HMMPfam:PF05662"
FT   misc_feature    265202..265264
FT                   /locus_tag="BCAM0219"
FT                   /note="HMMPfam hit to PF05662, Haemagglutinin, score
FT                   0.00013"
FT                   /inference="protein motif:HMMPfam:PF05662"
FT   misc_feature    265568..265630
FT                   /locus_tag="BCAM0219"
FT                   /note="HMMPfam hit to PF05662, Haemagglutinin, score
FT                   0.00013"
FT                   /inference="protein motif:HMMPfam:PF05662"
FT   misc_feature    265925..265996
FT                   /locus_tag="BCAM0219"
FT                   /note="HMMPfam hit to PF05662, Haemagglutinin, score 1e-06"
FT                   /inference="protein motif:HMMPfam:PF05662"
FT   misc_feature    266333..266395
FT                   /locus_tag="BCAM0219"
FT                   /note="HMMPfam hit to PF05662, Haemagglutinin, score
FT                   0.00011"
FT                   /inference="protein motif:HMMPfam:PF05662"
FT   misc_feature    266531..266602
FT                   /locus_tag="BCAM0219"
FT                   /note="HMMPfam hit to PF05662, Haemagglutinin, score
FT                   1.3e-06"
FT                   /inference="protein motif:HMMPfam:PF05662"
FT   misc_feature    266858..266929
FT                   /locus_tag="BCAM0219"
FT                   /note="HMMPfam hit to PF05662, Haemagglutinin, score
FT                   0.0002"
FT                   /inference="protein motif:HMMPfam:PF05662"
FT   misc_feature    267170..267232
FT                   /locus_tag="BCAM0219"
FT                   /note="HMMPfam hit to PF05662, Haemagglutinin, score
FT                   3.4e-05"
FT                   /inference="protein motif:HMMPfam:PF05662"
FT   misc_feature    267386..267475
FT                   /locus_tag="BCAM0219"
FT                   /note="HMMPfam hit to PF05658, Hep_Hag, score 1.9"
FT                   /inference="protein motif:HMMPfam:PF05658"
FT   misc_feature    267476..267559
FT                   /locus_tag="BCAM0219"
FT                   /note="HMMPfam hit to PF05658, Hep_Hag, score 0.0049"
FT                   /inference="protein motif:HMMPfam:PF05658"
FT   misc_feature    267560..267643
FT                   /locus_tag="BCAM0219"
FT                   /note="HMMPfam hit to PF05658, Hep_Hag, score 1.6e-07"
FT                   /inference="protein motif:HMMPfam:PF05658"
FT   misc_feature    267797..268027
FT                   /locus_tag="BCAM0219"
FT                   /note="HMMPfam hit to PF03895, YadA-like C-terminal region,
FT                   score 4.4e-07"
FT                   /inference="protein motif:HMMPfam:PF03895"
FT   misc_feature    267902..267949
FT                   /note="PS00225 Crystallins beta and gamma 'Greek key' motif
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00225"
FT   CDS_pept        268132..268851
FT                   /transl_table=11
FT                   /locus_tag="BCAM0220"
FT                   /product="putative outer membrane protein"
FT                   /note="Similar to Bordetella avium ompa outer membrane
FT                   protein A precursor. UniProt:OMPA_BORAV (EMBL:A45275) (194
FT                   aa) fasta scores: E()=2.6e-08, 39.552% id in 134 aa;
FT                   homology does not extend to the N terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0220"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54078"
FT                   /db_xref="GOA:B4EHQ2"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B4EHQ2"
FT                   /protein_id="CAR54078.1"
FT                   /translation="MTMKTLLLRAASIGAIAMALGACTTQSGVTYDIRAVSIPGKADNV
FT                   FRVSCDGLLGSANSCARAAEEFCRGQGFTPLEMIDRVRSGAPMKDPREITFMCGKPQPV
FT                   VQATPPAPPPPPQPAPQPVPQRQVLLQGDANFAFDSAALTPDARAQLDRFVDINSGIEF
FT                   RRVAITGFTDSTGSNTHNLALSASRARNVMNYLRSNGLKAQSFVSEGLGAADPVASNAT
FT                   AEGRAQNRRVEIRIDAK"
FT   sig_peptide     268132..268197
FT                   /locus_tag="BCAM0220"
FT                   /note="Signal peptide predicted for BCAM0220 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.424 between residues 22 and 23"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    268168..268200
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    268534..268821
FT                   /locus_tag="BCAM0220"
FT                   /note="HMMPfam hit to PF00691, OmpA family, score 1.7e-25"
FT                   /inference="protein motif:HMMPfam:PF00691"
FT   CDS_pept        269146..269865
FT                   /transl_table=11
FT                   /locus_tag="BCAM0221"
FT                   /product="two-component regulatory system, response
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0221"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54079"
FT                   /db_xref="GOA:B4EHQ3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B4EHQ3"
FT                   /protein_id="CAR54079.1"
FT                   /translation="MGSYLIRVVLADDHPAMLVGVEHGLSSVPTIQLTGKAVNSTELIR
FT                   LVEAGVCDVVVSDYAMPGSAHGDGITLFSYLQRNHPAVKLVVLTMLDNPAVIGALTRLG
FT                   IECIVSKSDTIDHLIPAIHAAATGGSYFSPSVEKVVRTLTSHSSARAADQKRELSDREL
FT                   EVVRLYASGLTVNEIADQLSRSKKTISTQKARAMEKLGIEKDIDLLRYAIEHGIVAASA
FT                   SEGRGGDANEEGRVDPA"
FT   misc_feature    269161..269514
FT                   /locus_tag="BCAM0221"
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 9.2e-12"
FT                   /inference="protein motif:HMMPfam:PF00072"
FT   misc_feature    269587..269745
FT                   /locus_tag="BCAM0221"
FT                   /note="HMMPfam hit to PF08281, Sigma-70, region, score
FT                   1.8e-05"
FT                   /inference="protein motif:HMMPfam:PF08281"
FT   misc_feature    269608..269781
FT                   /locus_tag="BCAM0221"
FT                   /note="HMMPfam hit to PF00196, Bacterial regulatory
FT                   proteins, luxR fami, score 9.9e-18"
FT                   /inference="protein motif:HMMPfam:PF00196"
FT   misc_feature    269659..269742
FT                   /note="PS00622 Bacterial regulatory proteins, luxR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00622"
FT   misc_feature    269662..269727
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1045.000, SD 2.75 at aa 173-194, sequence
FT                   LTVNEIADQLSRSKKTISTQKA"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        complement(269998..270690)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0222"
FT                   /product="two-component regulatory system, response
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0222"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54080"
FT                   /db_xref="GOA:B4EHQ4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B4EHQ4"
FT                   /protein_id="CAR54080.1"
FT                   /translation="MNRTFPIRIVIADDHPAVVIGARYELSATNTVAVVATAHNSTELM
FT                   DALSHHPCDVLVSDYAMPGTEYGDGLAMFTILLKRFPGLKIVVMTMMENAVALRALMDI
FT                   GIACIVSKSDMPNHLTMAIHAAYTNGRYLSPSMDRILRNTGSVGGKAPALSVREVEVIR
FT                   LFASGLSVNEIAEKLNRSKKTISTQKSSAMQKLGIERDVDLVRYAIACGLVTDYGYAPP
FT                   VRSDEANA"
FT   misc_feature    complement(270067..270240)
FT                   /locus_tag="BCAM0222"
FT                   /note="HMMPfam hit to PF00196, Bacterial regulatory
FT                   proteins, luxR fami, score 6.7e-21"
FT                   /inference="protein motif:HMMPfam:PF00196"
FT   misc_feature    complement(270106..270189)
FT                   /note="PS00622 Bacterial regulatory proteins, luxR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00622"
FT   misc_feature    complement(270121..270186)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1195.000, SD 3.26 at aa 169-190, sequence
FT                   LSVNEIAEKLNRSKKTISTQKS"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    complement(270319..270672)
FT                   /locus_tag="BCAM0222"
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 1e-11"
FT                   /inference="protein motif:HMMPfam:PF00072"
FT   CDS_pept        complement(270927..275579)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0223"
FT                   /product="putative haemagglutinin-related autotransporter
FT                   protein"
FT                   /note="Contains many Hep_Hag repeats and haemagglutinin
FT                   motif"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0223"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54081"
FT                   /db_xref="GOA:B4EHQ5"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR024973"
FT                   /db_xref="UniProtKB/TrEMBL:B4EHQ5"
FT                   /protein_id="CAR54081.1"
FT                   /translation="MNKTYRSVWNAVTNTWTAAAETAKSHSKGSSRIARQALIAIALGG
FT                   TAIGGAAAAEVCTTEDGSSGTVDEAGVCKAAGGGAIGTMGAIGTMATLDDARIKVGGTG
FT                   LASIGGGNAIAIGSGSLAGSSGAISIGYNATTTGQNDIAVGRGALANASSAPGSGVSDY
FT                   SMAVGYGASAVGGRSVAIGPGAIATNGVGATALEAVSIGSAASVSEIGGVAIGRNSSVA
FT                   TNATDGVALGRGSTASAANTVSVGNIMLQRRITNMDRGIDDTDAVNVGQMNAGLSTTNA
FT                   SIAATNTALSTTNASLSTTNSTLAATNATLSTTNATLSTTNTTLATTNATLSTANTQIA
FT                   ALNGDMTTAKTGISTNTSDITKLNDKLSELSNGTVGLVQQANAGDDLTVGANTDGAAVN
FT                   FAGTAGDRKLSGIAEGTLDSDAVNVGQMNAGLSTTNAAIAATNAGLSTTNTNLAETKAT
FT                   LSTTSTQVAELGSDMTIAKDNIATHTTEIKSINDQLSELSSGTIGLVQQSAAGDDLTVG
FT                   ANTDGAAVNFAGTAGDRKLSGIAEGTLDSDAVNVGQMNAGLSTTNAAIAATNAMLSTTN
FT                   ATLSTTNTTLADTNATLSTANTQIAALNGDMTTAKDNIATHTTEIKSINDQLSDLSSGT
FT                   IGLVQQSAAGADLTVGANTDGAAVNFAGTAGDRKLSGIATGTLDSDAVNVGQMNAGLST
FT                   TNAAITATNAELSTTNTTLAATNTALSTTNTNLAETNATLSTTSTQVAELGSDMTIAKD
FT                   NITQHTTEIKSINDQLSELSSGTIGLVQQSAAGADLTVGANTDGAAVNFAGTAGDRKLS
FT                   GIATGTLDSDAVNVGQMNAGLSTTNASITSLDGRVTSNETTITNLDGRVTSNETTITNL
FT                   DGRVTNNETAITNLDGRVTSNETAITNLDGRVTNNETSITNLDGRMTTSETAITNLDGR
FT                   VTSNETAITNLDGRVTSNETSITNLDGRVTSNETSITNLDGRMTTSETAITNIDNRVTI
FT                   NEGAITKLADEIGSGSLGLVRQANAGADLTVGANADGAAVNFAGTAGNRKLSGIAEGTL
FT                   DSDAVNVGQMNAGLSTTNASITSLDGRVTNNETSITNLDGRMTTSETTITNIDNRVTAN
FT                   EGSITSLDNRVTVNEGAITKLADQIGSGSLGLVQQASAGDDLTVGANTDGAAVNFAGTA
FT                   GNRKLTGVDAGAVSAASTEAINGMQLHGVSESVASALGGTSTVDADGKLTNVSFDINGT
FT                   KYSTVEQAIQAAAAFGASDPLSVRYDLNGDGTPNFGSVTLGGIGAAPVILTNVADGVNP
FT                   YDAVNFGQLSALNDKFSDLDGRVGSLEQNAGGSGPGGPGDGSGTPGTGGPGSIVVGDGA
FT                   DASGANSSAIGQGAVASGNNGSAVGQGAIASGNNGTAIGQGSLASGENSTALGQGASAT
FT                   GSGSVAIGQGSVATETNTVSFGNGTEEGNRRLVNIADGINASDAATKGQLDRAMESVDA
FT                   RFNDTNRAINDVAKNAYAGIAAAMAMPNMTPSAPGKTVVAVGTANFKSGSAIAAGATYR
FT                   SRNGKWLVNGAASLTSVGDAGVRAQVGYEF"
FT   misc_feature    complement(270930..271163)
FT                   /locus_tag="BCAM0223"
FT                   /note="HMMPfam hit to PF03895, YadA-like C-terminal region,
FT                   score 3.6e-07"
FT                   /inference="protein motif:HMMPfam:PF03895"
FT   misc_feature    complement(271296..271379)
FT                   /locus_tag="BCAM0223"
FT                   /note="HMMPfam hit to PF05658, Hep_Hag, score 5.1e-06"
FT                   /inference="protein motif:HMMPfam:PF05658"
FT   misc_feature    complement(271380..271463)
FT                   /locus_tag="BCAM0223"
FT                   /note="HMMPfam hit to PF05658, Hep_Hag, score 1.4e-05"
FT                   /inference="protein motif:HMMPfam:PF05658"
FT   misc_feature    complement(271464..271547)
FT                   /locus_tag="BCAM0223"
FT                   /note="HMMPfam hit to PF05658, Hep_Hag, score 0.0013"
FT                   /inference="protein motif:HMMPfam:PF05658"
FT   misc_feature    complement(274764..274826)
FT                   /locus_tag="BCAM0223"
FT                   /note="HMMPfam hit to PF05662, Haemagglutinin, score
FT                   2.8e-05"
FT                   /inference="protein motif:HMMPfam:PF05662"
FT   misc_feature    complement(274830..274913)
FT                   /locus_tag="BCAM0223"
FT                   /note="HMMPfam hit to PF05658, Hep_Hag, score 0.48"
FT                   /inference="protein motif:HMMPfam:PF05658"
FT   misc_feature    complement(274920..275003)
FT                   /locus_tag="BCAM0223"
FT                   /note="HMMPfam hit to PF05658, Hep_Hag, score 0.0026"
FT                   /inference="protein motif:HMMPfam:PF05658"
FT   misc_feature    complement(275022..275105)
FT                   /locus_tag="BCAM0223"
FT                   /note="HMMPfam hit to PF05658, Hep_Hag, score 0.44"
FT                   /inference="protein motif:HMMPfam:PF05658"
FT   misc_feature    complement(275133..275216)
FT                   /locus_tag="BCAM0223"
FT                   /note="HMMPfam hit to PF05658, Hep_Hag, score 0.26"
FT                   /inference="protein motif:HMMPfam:PF05658"
FT   sig_peptide     complement(275418..275579)
FT                   /locus_tag="BCAM0223"
FT                   /note="Signal peptide predicted for BCAM0223 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.933) with cleavage site
FT                   probability 0.455 between residues 54 and 55"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(275952..278813)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0224"
FT                   /product="putative haemagglutinin-related autotransporter
FT                   protein"
FT                   /note="contains many Hep_Hag repeats and haemagglutinin
FT                   motifs"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0224"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54082"
FT                   /db_xref="GOA:B4EHQ6"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR024973"
FT                   /db_xref="UniProtKB/TrEMBL:B4EHQ6"
FT                   /protein_id="CAR54082.1"
FT                   /translation="MNKTYRSIWNAVTNTWTAAAETAKSHSRGSSRVARQAVIAIALGG
FT                   AAIGAAAAAEVCTAEDGANGTVDTAGVCQTTTHNLIGPMETTSSIGVMAGGWSGGNGIS
FT                   IWTGTGTAANATNASDIAIGNGASSIAGNGVALGTNATITSGSAGLAMGAYSTASASYG
FT                   IAIGGATGSGRGAVVEGTGSVAIGTISHVTSGTSNAVALGMGSVAHESNTVSVGAGVPN
FT                   IDGHTFTRRIVNVSPGIADTDVVNVSQLAPVVTALGGGAAIDPTTGAVTGPTYTLANGG
FT                   TQTTIGGALGALDGALTTTNGNVTALTTRMDTAETDISDLQTAVGSGSVGLVQQAGAGA
FT                   NLTVGKDTDGAAVNFAGTAGNRKLTGVAAGDVSAASTEAVNGSQLHGVSESVASAIGGG
FT                   STVNPDGSISAPSFTVGDGHGGTTTVGTVADAVSNLDGRTTTNEGAITDLASQIGSGTL
FT                   GLVQQANAGDNITVGASTDGAAVNFAGTAGNRKLTGIAAGDVSAASTEAVNGSQLHGVS
FT                   ESVASAIGGGSTVNPDGSISAPSFTVGDGSGGTKVVNSVGDAVTNLDGRTTINEGAITN
FT                   LAAQIGSGTLGIVQQDPASGAITVGAASGGSMVNFAGTGGARVLSGVANGVADDDVVTV
FT                   SQLRATGLIDYSGKEVGAVTYDSGLSFDSVTFAGTNGTVLHRVAAGDISATSMDAVNGS
FT                   QLYALQQEFAQKYGDLSGRVGDLEAGGGSDGGSGSGVGTGTGGPGSIVVGDGADASGSN
FT                   SSAIGQGSVASGNNGSAVGQGAVASGNNGTATGQGAVASGDNSSAFGQGAVASGGSSTA
FT                   IGQNANASGNNSVALGAGSVADRDNAVSVGSAGAERQITNVAAGTAPTDAVNVQQMNNT
FT                   VSSARQDAMGGVAAAMAVAGLPQSTQPGRTFVSMAGSTYGGEYGSAMGLSYMTRDGKWT
FT                   VKAAVNTSSRGEVGGVIGGGFYW"
FT   misc_feature    complement(275955..276191)
FT                   /locus_tag="BCAM0224"
FT                   /note="HMMPfam hit to PF03895, YadA-like C-terminal region,
FT                   score 4.5e-15"
FT                   /inference="protein motif:HMMPfam:PF03895"
FT   misc_feature    complement(276210..276272)
FT                   /locus_tag="BCAM0224"
FT                   /note="HMMPfam hit to PF05662, Haemagglutinin, score
FT                   7.6e-07"
FT                   /inference="protein motif:HMMPfam:PF05662"
FT   misc_feature    complement(276276..276359)
FT                   /locus_tag="BCAM0224"
FT                   /note="HMMPfam hit to PF05658, Hep_Hag, score 0.0063"
FT                   /inference="protein motif:HMMPfam:PF05658"
FT   misc_feature    complement(276360..276443)
FT                   /locus_tag="BCAM0224"
FT                   /note="HMMPfam hit to PF05658, Hep_Hag, score 2.6e-05"
FT                   /inference="protein motif:HMMPfam:PF05658"
FT   misc_feature    complement(276444..276527)
FT                   /locus_tag="BCAM0224"
FT                   /note="HMMPfam hit to PF05658, Hep_Hag, score 0.071"
FT                   /inference="protein motif:HMMPfam:PF05658"
FT   misc_feature    complement(276528..276611)
FT                   /locus_tag="BCAM0224"
FT                   /note="HMMPfam hit to PF05658, Hep_Hag, score 0.017"
FT                   /inference="protein motif:HMMPfam:PF05658"
FT   misc_feature    complement(277659..277730)
FT                   /locus_tag="BCAM0224"
FT                   /note="HMMPfam hit to PF05662, Haemagglutinin, score
FT                   9.9e-05"
FT                   /inference="protein motif:HMMPfam:PF05662"
FT   misc_feature    complement(277734..277808)
FT                   /note="PS00583 pfkB family of carbohydrate kinases
FT                   signature 1."
FT                   /inference="protein motif:Prosite:PS00583"
FT   misc_feature    complement(278064..278126)
FT                   /locus_tag="BCAM0224"
FT                   /note="HMMPfam hit to PF05662, Haemagglutinin, score
FT                   0.00024"
FT                   /inference="protein motif:HMMPfam:PF05662"
FT   misc_feature    complement(278193..278282)
FT                   /locus_tag="BCAM0224"
FT                   /note="HMMPfam hit to PF05658, Hep_Hag, score 0.73"
FT                   /inference="protein motif:HMMPfam:PF05658"
FT   misc_feature    complement(278301..278384)
FT                   /locus_tag="BCAM0224"
FT                   /note="HMMPfam hit to PF05658, Hep_Hag, score 0.16"
FT                   /inference="protein motif:HMMPfam:PF05658"
FT   misc_feature    complement(278388..278471)
FT                   /locus_tag="BCAM0224"
FT                   /note="HMMPfam hit to PF05658, Hep_Hag, score 0.068"
FT                   /inference="protein motif:HMMPfam:PF05658"
FT   sig_peptide     complement(278655..278813)
FT                   /locus_tag="BCAM0224"
FT                   /note="Signal peptide predicted for BCAM0224 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.955) with cleavage site
FT                   probability 0.623 between residues 53 and 54"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(279139..279774)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BCAM0225"
FT                   /product="putative haemagglutinin-related protein
FT                   (fragment)"
FT                   /note="Possible gene remnant. Partial similarity to
FT                   Escherichia coli O6 putative adhesin. UniProt:Q8FCB2 (1778
FT                   aa) fasta scores: E()=1e-05, 36.527% id in 167 aa"
FT                   /note="contains two haemagglutinin motifs"
FT                   /db_xref="PSEUDO:CAR54083.1"
FT   misc_feature    complement(279562..279624)
FT                   /locus_tag="BCAM0225"
FT                   /note="HMMPfam hit to PF05662, Haemagglutinin, score
FT                   7.4e-07"
FT                   /inference="protein motif:HMMPfam:PF05662"
FT   sig_peptide     complement(279688..279774)
FT                   /locus_tag="BCAM0225"
FT                   /note="Signal peptide predicted for BCAM0225 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.997) with cleavage site
FT                   probability 0.675 between residues 29 and 30"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        join(281058..281186,281190..281309)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BCAM0225A"
FT                   /product="putative haemagglutinin-related protein
FT                   (fragment)"
FT                   /note="Probable gene remnant. Similar to an internal region
FT                   of Burkholderia xenovorans (strain LB400) outer membrane
FT                   protein, putative autotransporter and adhesin
FT                   UniProt:Q13WU9 (EMBL:CP000270 (810 aa) fasta scores:
FT                   E()=3e-07, 51.190% id in 84 aa"
FT   CDS_pept        complement(281630..284665)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0227"
FT                   /product="hybrid two-component system kinase-response
FT                   regulator protein"
FT                   /note="C terminus similar to C terminus of Bordetella
FT                   pertussis bvgs virulence sensor protein bvgs precursor (ec
FT                   2.7.3.-). UniProt:BVGS_BORPE (EMBL:A40185) (1238 aa) fasta
FT                   scores: E()=1.7e-42, 33.185% id in 672 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0227"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54085"
FT                   /db_xref="GOA:B4EHQ8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4EHQ8"
FT                   /protein_id="CAR54085.1"
FT                   /translation="MGAPWPTAPLSMDHRAAPDPARSAAAHAPAAPTRVGRRQRALLYA
FT                   GGAAVTVSILLASGLMLYTMAREAIQARYTTFAVRQFLVQIEFKMRTTGMDTLVTHDEA
FT                   VWNSRAIDPARVAALAAGRGRLIIQGSPTFPPTLVLADLSPAHPADSYAHDLAMASDMS
FT                   YRVGAYVAKHDADRAIAGYAYRPDRSFAVVIPEPVPPDPLTASPATDAATLVAKVAAGV
FT                   GTPSPGQYEWHPPVYDPVQRRDVFRIAGAVYDAQSPRAVFLSTLPVDVLRTRLSAGDTT
FT                   DAAIIVDAHGRTLLRAGSADDDDATRAAIERLDARTREAARRGGPRTAFGDGLFSLSQP
FT                   IPETDWTLVQTFTLRSLLATIGLRAGWYVAIMLAVIALVWWLLVRFDRRVLKPDDARTR
FT                   RVIDSENLNRTIVEAAPSGIALLSLADGAVLLQNDTMRDYDARRAGEPSLPARLLEHFD
FT                   RSPAAAAWQPDLHVTLPTAGGETVDLLVNLVRTRFRDTDVVLCNFSDITSQKNIERQLD
FT                   EAARAADAANDAKSAFLATMSHEIRTPLNAILGNLELIGREPLAATQRERLQTVEGASS
FT                   VLLDLINDILDLSKIEAGQMTIEAIPFDLAETIRQTGAMFEPLATAKGLQFDVFVDDAL
FT                   PARYLGDPTRIRQIAANLVGNAIKFTNHGEITLEVYLRDDTDPASPIAIGVSDTGIGMT
FT                   DAQRAALFRPFTQADTSITRRYGGTGLGLALTKQLTQMMHGTVDVKSEPGKGSTFVVTL
FT                   PLRPATDAQVAEHDAAQADDTTLPAVTARVLVVDDHPVNRTLLQGQLVTLGYAADSAEE
FT                   GASALRRCADTRYDLVMTDLNMPGMDGYTLARVLRSQYPEMPVVAVTAHASAAEHARCA
FT                   EAGIVAVLVKPVLLDTIDRTVRRHAHAAAAQAPARRALVDLAEGPLPPDVHALLEASLT
FT                   QSLAATHDALAHDDLPALRHELHSLRGAFATIHEHAVADAIGELQAVVHGGDLTSFDAR
FT                   LADAEALARDALQRRATQAPSA"
FT   misc_feature    complement(281987..282325)
FT                   /locus_tag="BCAM0227"
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 2.8e-31"
FT                   /inference="protein motif:HMMPfam:PF00072"
FT   misc_feature    complement(282398..282745)
FT                   /locus_tag="BCAM0227"
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HS, score 5e-40"
FT                   /inference="protein motif:HMMPfam:PF02518"
FT   misc_feature    complement(282884..283081)
FT                   /locus_tag="BCAM0227"
FT                   /note="HMMPfam hit to PF00512, His Kinase A
FT                   (phosphoacceptor) domain, score 1.2e-23"
FT                   /inference="protein motif:HMMPfam:PF00512"
FT   misc_feature    complement(282923..282970)
FT                   /note="PS00038 Myc-type, 'helix-loop-helix' dimerization
FT                   domain signature."
FT                   /inference="protein motif:Prosite:PS00038"
FT   misc_feature    complement(join(283517..283585,284477..284545))
FT                   /locus_tag="BCAM0227"
FT                   /note="2 probable transmembrane helices predicted for
FT                   BCAM0227 by TMHMM2.0 at aa 41-63 and 361-383"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(284809..285693)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0228"
FT                   /product="two-component regulatory system, response
FT                   regulator protein"
FT                   /note="Similar to Bordetella parapertussis probable
FT                   two-component response regulator. UniProt:Q7W2G4 (244 aa)
FT                   fasta scores: E()=9e-18, 29.911% id in 224 aa; contains 50
FT                   amino acid N terminal extension"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0228"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54086"
FT                   /db_xref="GOA:B4EHQ9"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B4EHQ9"
FT                   /protein_id="CAR54086.1"
FT                   /translation="MDGVTPLAARNLSGHDRALLSSLAHARCDRIVTDAPSTAIAILTI
FT                   DHPSRGTFDDRLRRAGYGYDRLRIDDILRRAGYRPSRFEYLPDLLTTCDTRAFDLFIVQ
FT                   CETACRRTTDAIQALRARFAGTVAIVSISQRDAELARSACFVAGANEHHSYTVPPDTLI
FT                   ASIATWLRWSHHRATHHRHWRIGAFEFDTATRSVNVAGREHVLTEKHFQIATAFFLNMG
FT                   RALDRAHVSQLVWGSLVAASSRRLDTHVAYLRDRLELDGRHGVKMMTMYGFGYRLVTCE
FT                   PGAEPAEEDAARQ"
FT   misc_feature    complement(284863..285093)
FT                   /locus_tag="BCAM0228"
FT                   /note="HMMPfam hit to PF00486, Transcriptional regulatory
FT                   protein, C ter, score 6.1e-06"
FT                   /inference="protein motif:HMMPfam:PF00486"
FT   CDS_pept        285989..287419
FT                   /transl_table=11
FT                   /locus_tag="BCAM0229"
FT                   /product="two-component regulatory system, sensor kinase
FT                   protein"
FT                   /note="C terminus is similar to C terminus Chromobacterium
FT                   violaceum probable two-component sensor (ec 2.7.3.-).
FT                   UniProt:Q7NVL8 (417 aa) fasta scores: E()=3.3e-20, 36.290%
FT                   id in 248 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0229"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54087"
FT                   /db_xref="GOA:B4EHR0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4EHR0"
FT                   /protein_id="CAR54087.1"
FT                   /translation="MKPSFRIAALAAWLSLSLAGTAFVVSRAVSDAYNRFFQDSSITIR
FT                   LLAQKAAQHEAILATLGASSLAAPPAHMLDNLRERMPQLDGLAYWRPGAGWQTDGGPSP
FT                   DALPQQRPGKPFTLAFDGPAAYWLIAGTGWAVRVEPGQMLQPGDWSPAISSAALELRDR
FT                   RVELLQRVKDDATPLWTMHLDKHLPVQPQAFVLRTTRTLTAADLPWLPIALWNAVAALL
FT                   AAGALGAWRLREARRREDARARLDRFGRLDTFGEMAAGLAHELNQPLTAIVSHTRAAER
FT                   LLDQPAERDSVRRALQTSVAQAKRAAAILERMREAVTTAHGGERRPLDPDAIMQTLLFL
FT                   YRDDCAREQIALVWHNAAVRARPFAEPIAVEQILHNLIQNARDALAGTSRGEIRVSGAH
FT                   VGKHYRFSVTDNGPGVPEDALPRLFEPFFTTRSRGLGLGLPLCDTLAQRQDGTLTVRNL
FT                   PSGGVEAALLLPLAGEVA"
FT   sig_peptide     285989..286060
FT                   /locus_tag="BCAM0229"
FT                   /note="Signal peptide predicted for BCAM0229 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.522 between residues 24 and 25"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(285998..286066,286607..286675)
FT                   /locus_tag="BCAM0229"
FT                   /note="2 probable transmembrane helices predicted for
FT                   BCAM0229 by TMHMM2.0 at aa 4-26 and 207-229"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    286745..286954
FT                   /locus_tag="BCAM0229"
FT                   /note="HMMPfam hit to PF00512, His Kinase A
FT                   (phosphoacceptor) domain, score 7e-09"
FT                   /inference="protein motif:HMMPfam:PF00512"
FT   misc_feature    287081..287404
FT                   /locus_tag="BCAM0229"
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HSP90, score 1e-30"
FT                   /inference="protein motif:HMMPfam:PF02518"
FT   CDS_pept        287416..288060
FT                   /transl_table=11
FT                   /locus_tag="BCAM0230A"
FT                   /product="two-component regulatory system, response
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0230A"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54088"
FT                   /db_xref="GOA:B4EHR1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B4EHR1"
FT                   /protein_id="CAR54088.1"
FT                   /translation="MTDSLRPAATCDASVVAIVDDDEAVRDGLALLLRTVGVPTRRYPD
FT                   ASAFLADADDAALGCVLLDIRMPGMSGLDALDELRARRDLPVIVMTGHGNVDACRRAFK
FT                   RGALDFLRKPVDDDELIDTVQQALRRQAAQRGQDDADQTRAARLATLSTREREVLEGIV
FT                   RGGSNKAIARALGLSPRTVETYRANVFDKLQAASLVELVRDYAALAGGSPP"
FT   misc_feature    287455..287790
FT                   /locus_tag="BCAM0230A"
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 8.3e-28"
FT                   /inference="protein motif:HMMPfam:PF00072"
FT   misc_feature    287836..287994
FT                   /locus_tag="BCAM0230A"
FT                   /note="HMMPfam hit to PF08281, Sigma-70, region, score
FT                   0.0031"
FT                   /inference="protein motif:HMMPfam:PF08281"
FT   misc_feature    287857..288033
FT                   /locus_tag="BCAM0230A"
FT                   /note="HMMPfam hit to PF00196, Bacterial regulatory
FT                   proteins, luxR fami, score 1.2e-21"
FT                   /inference="protein motif:HMMPfam:PF00196"
FT   misc_feature    287908..287991
FT                   /note="PS00622 Bacterial regulatory proteins, luxR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00622"
FT   misc_feature    287911..287976
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1411.000, SD 3.99 at aa 166-187, sequence
FT                   GSNKAIARALGLSPRTVETYRA"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        288168..288884
FT                   /transl_table=11
FT                   /locus_tag="BCAM0231"
FT                   /product="opacity family porin protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0231"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54089"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:B4EHR2"
FT                   /protein_id="CAR54089.1"
FT                   /translation="MIKCFALPSALALLFSGAAFADTVAAPETKKTADAGDAGYYATGR
FT                   VIGAFDNAVNMELTSPRVASRVGGPETGSNVTGSLGLGYQFGNGWRAEGEYVFKRTNNF
FT                   TSYWAPFDANANEFHVSAQRLMLNGYKDFDLGRGFSVYGTLGIGVAIVSADGWQTNDTR
FT                   RFASKTQTNLAYSAGAGVSYAINKRFSIDLGYRYVDMGNIETGFNTFANRINARDEQLK
FT                   SKLSSNEVFIGLRGRF"
FT   sig_peptide     288168..288230
FT                   /locus_tag="BCAM0231"
FT                   /note="Signal peptide predicted for BCAM0231 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 1.000 between residues 21 and 22"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    288411..288881
FT                   /locus_tag="BCAM0231"
FT                   /note="HMMPfam hit to PF02462, Opacity family porin
FT                   protein, score 0.00046"
FT                   /inference="protein motif:HMMPfam:PF02462"
FT   CDS_pept        289221..290228
FT                   /transl_table=11
FT                   /locus_tag="BCAM0232"
FT                   /product="conserved hypothetical protein"
FT                   /note="C-terminus similar to Chlamydomonas reinhardtii
FT                   cgcr-4 product (fragment). UniProt:Q39598 (265 aa) fasta
FT                   scores: E()=0.00014, 35.616% id in 219 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0232"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54090"
FT                   /db_xref="UniProtKB/TrEMBL:B4EHR3"
FT                   /protein_id="CAR54090.1"
FT                   /translation="MSMQDITGHYAIPLVHPFSDVPPPYGRRRRPFVASRRARQLVFDI
FT                   HGAPRMPAPAEDGGGVAKAARPAKVVRAADFGSDNRAWVRPHPLRRRWRLTLMACALFG
FT                   ATCILATHLVDERQHAAEHDAAYSAAVTAAPTAAVAATEVARATGRPAEVAIVRADRAA
FT                   PTDAQMKAAATVVAETASAEARALHVAGSGSAGEPVAVAMAVASNAVVAEAAAPRADRG
FT                   SSARKPVAVAGARPAAKSAGASRGNAVRQAGANASAAQRAVTAARGATPHAQPAARAAD
FT                   TPTTAPVSSSAQAVGMTAAEFTQWLAATRDTSRSTAGGTDLTVELPSHTRLIPR"
FT   repeat_region   290274..290290
FT                   /note="Direct repeat, 17mer, flanking Cenocepacia Island"
FT   misc_feature    290291..334378
FT                   /note="Cenocepacia Island"
FT                   /note="BcenGI11"
FT   CDS_pept        290334..290681
FT                   /transl_table=11
FT                   /locus_tag="BCAM0233"
FT                   /product="ArsR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0233"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54091"
FT                   /db_xref="GOA:B4EHR4"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EHR4"
FT                   /protein_id="CAR54091.1"
FT                   /translation="METNETIAALAALAHESRLAVFRALVQAGPQGMPAGQIATLLDVP
FT                   PSSLSFHLKELAHAQLVTSRQEGRFVFYGANFDTMNGLLGYLTENCCGGNPCSPVSVCS
FT                   PSGKINRTRRS"
FT   misc_feature    290376..290525
FT                   /locus_tag="BCAM0233"
FT                   /note="HMMPfam hit to PF01022, Bacterial regulatory
FT                   protein, arsR family, score 0.0026"
FT                   /inference="protein motif:HMMPfam:PF01022"
FT   misc_feature    290430..290495
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1327.000, SD 3.71 at aa 33-54, sequence
FT                   MPAGQIATLLDVPPSSLSFHLK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        290704..291198
FT                   /transl_table=11
FT                   /locus_tag="BCAM0234"
FT                   /product="putative arsenate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0234"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54092"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:B4EHR5"
FT                   /protein_id="CAR54092.1"
FT                   /translation="MTTNVLILCTHNSARSVLSEGMLNHWAAKLGKEVRAYSAGSAPSG
FT                   RLNPFALEALTNAGVDVRGCRSKSWDEFVGDGAPEMRVVITVCDSAASEACPYWPGSPV
FT                   KVHWGYADPSNATGGDDGKRLAFELTRQAIGYRMLQLLALPLDSMSDDALRAALIEISR
FT                   H"
FT   misc_feature    290710..291135
FT                   /locus_tag="BCAM0234"
FT                   /note="HMMPfam hit to PF01451, Low molecular weight
FT                   phosphotyrosine protein, score 4.9e-24"
FT                   /inference="protein motif:HMMPfam:PF01451"
FT   CDS_pept        291263..292360
FT                   /transl_table=11
FT                   /locus_tag="BCAM0235"
FT                   /product="putative sodium bile acid symporter family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0235"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54093"
FT                   /db_xref="GOA:B4EI46"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B4EI46"
FT                   /protein_id="CAR54093.1"
FT                   /translation="MNTSNVTPPGNAVANPAINFFERYLSVWVALCIVAGIALGQALPG
FT                   PFQAVGRMAYAQVNLPVGLLIWVMIVPMLVKVDFGALHDVRRHAKGIGVTLVVNWLVKP
FT                   FSMAFLGWLFIRHLFAPLLPADQIDSYIAGLILLAAAPCTAMVFVWSRLTGGDPLFTLS
FT                   QVALNDSIMVIAFAPLVGLLLGMSAITVPWATLLTSVVLYIVMPVILAQMLRKRLLAKG
FT                   PTAFDAAMTRIGPWSIAALLATLVLLFAFQGEAILKQPLVIALLAVPILIQVFFSSALA
FT                   YGLNRAVGEQHDIACPSALIGASNFFELAVAAAISLFGFHSGAALATVVGVLIEVPVML
FT                   LVVRLVNRSKGWYECRARDHGRTDP"
FT   misc_feature    join(291323..291391,291419..291487,291548..291607,
FT                   291650..291718,291755..291814,291827..291895,
FT                   291959..292018,292046..292114,292151..292219,
FT                   292232..292300)
FT                   /locus_tag="BCAM0235"
FT                   /note="10 probable transmembrane helices predicted for
FT                   BCAM0235 by TMHMM2.0 at aa 21-43, 53-75, 96-115, 130-152,
FT                   165-184, 189-211, 233-252, 262-284, 297-319 and 324-346"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    291449..292039
FT                   /locus_tag="BCAM0235"
FT                   /note="HMMPfam hit to PF01758, Sodium Bile acid symporter
FT                   family, score 2.6e-29"
FT                   /inference="protein motif:HMMPfam:PF01758"
FT   CDS_pept        292357..293079
FT                   /transl_table=11
FT                   /locus_tag="BCAM0236"
FT                   /product="putative NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0236"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54094"
FT                   /db_xref="GOA:B4EI47"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR014063"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B4EI47"
FT                   /protein_id="CAR54094.1"
FT                   /translation="MNDYLNDLPQLDAELFRVPDGARLRPAVLSTHAPRFLLLYGSLRE
FT                   RSFSRLLVEEAARLLAAMGAEVRVFNPSGLPLPDDAPDSHPKVVELRELVMWSEGMVWC
FT                   SPERHGAMTGIMKAQIDWIPLSAGAVRPTQGKTLAVMQVSGGSQSFNAVNQLRVLGRWM
FT                   RMLTIPNQSSVAKAFMEFDEAGRMKPSAYFDRVVDVMEELMKFTLLTRDVGPYLVDRYS
FT                   ERKESAQALSQRVNQRSI"
FT   misc_feature    292456..292983
FT                   /locus_tag="BCAM0236"
FT                   /note="HMMPfam hit to PF03358, NADPH-dependent FMN
FT                   reductase, score 2.6e-54"
FT                   /inference="protein motif:HMMPfam:PF03358"
FT   CDS_pept        293331..294002
FT                   /transl_table=11
FT                   /locus_tag="BCAM0237A"
FT                   /product="MarC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0237A"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54095"
FT                   /db_xref="GOA:B4EI48"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:B4EI48"
FT                   /protein_id="CAR54095.1"
FT                   /translation="MQLDRLIPEILFGFTGLIGIINPFGMAFVFLERTQSLSEAERAIL
FT                   SKQLAANVFFTLLVIFFVGAPVLNFFGISMEALRIGGGFAVAVAGWSMLNAPDVPAGGD
FT                   VAAHGDDLQKLMSRGFFPLTVPLTIGPGSIAAGIALHANRAHTASDYLLSGVVSVAVAA
FT                   LVAFAIWQIYSRATTLARYLGSEGTKVAMRVSAFLLLCVGVQIMLTGLAAFVQMLGGQA
FT                   G"
FT   misc_feature    293349..293975
FT                   /locus_tag="BCAM0237A"
FT                   /note="HMMPfam hit to PF01914, MarC family integral
FT                   membrane protein, score 2.2e-20"
FT                   /inference="protein motif:HMMPfam:PF01914"
FT   misc_feature    join(293358..293426,293487..293555,293688..293756,
FT                   293781..293849,293907..293975)
FT                   /locus_tag="BCAM0237A"
FT                   /note="5 probable transmembrane helices predicted for
FT                   BCAM0237A by TMHMM2.0 at aa 10-32, 53-75, 120-142, 151-173
FT                   and 193-215"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(294118..295020)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0238"
FT                   /product="putative ion transporter"
FT                   /note="Similar to Xanthomonas campestris (pv. campestris)
FT                   Kch ion transporter. UniProt:Q8P5Q3 (290 aa) fasta scores:
FT                   E()=6.9e-43, 47.547% id in 265 aa; homology does not extend
FT                   to N terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0238"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54096"
FT                   /db_xref="GOA:B4EI49"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="UniProtKB/TrEMBL:B4EI49"
FT                   /protein_id="CAR54096.1"
FT                   /translation="MARRYAARTLGRMISLIQSSFDTARGVLTHVARRPSFLRKLDIAV
FT                   LALIVASVLVVMADSVQALHAQYGHALYAAEWAFTLLFSAEYLLRLCTARKPAAYARSF
FT                   FGIVDLVSVLPTYLAFFFPGLHALIDVRLLRLLRVFRILGLSIYLEEGQLLIRALTRAR
FT                   RKIFVFIGGMFVLVVILGTVIFLVEGPEHGITSIPVGVYWAAVTMSTTGYGDLTPVTPL
FT                   GRLITSCAILLGYGIIAFPTGIMGAELVASAMERNRANARPADGDRPCCPHCGVTLPVQ
FT                   RAPDTHAHGSVPAKGRDAR"
FT   misc_feature    complement(join(294265..294333,294457..294525,
FT                   294634..294702,294826..294894))
FT                   /locus_tag="BCAM0238"
FT                   /note="4 probable transmembrane helices predicted for
FT                   BCAM0238 by TMHMM2.0 at aa 43-65, 107-129, 166-188 and
FT                   230-252"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(294268..294507)
FT                   /locus_tag="BCAM0238"
FT                   /note="HMMPfam hit to PF07885, Ion channel, score 2.5e-15"
FT                   /inference="protein motif:HMMPfam:PF07885"
FT   misc_feature    complement(294286..294798)
FT                   /locus_tag="BCAM0238"
FT                   /note="HMMPfam hit to PF00520, Ion transport protein, score
FT                   2.1e-22"
FT                   /inference="protein motif:HMMPfam:PF00520"
FT   CDS_pept        complement(295309..295605)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0238A"
FT                   /product="H-NS histone family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0238A"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54097"
FT                   /db_xref="GOA:B4EI50"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:B4EI50"
FT                   /protein_id="CAR54097.1"
FT                   /translation="MPTYLELKAQAEQLRQQAEQARLAELDIVLAEVRARVAEYALTPE
FT                   QIFGRRRSASATQVAQGRIPARYRDPKTGATWSGRGREPGWIKGKKRERFLIE"
FT   CDS_pept        296017..296496
FT                   /transl_table=11
FT                   /locus_tag="BCAM0239"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to C-terminus of Ralstonia solanacearum
FT                   (Pseudomonas solanacearum) rs06006 hypothetical protein
FT                   rsc1870. UniProt:Q8XY93 (413 aa) fasta scores: E()=5.1e-11,
FT                   41.447% id in 152 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0239"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54098"
FT                   /db_xref="UniProtKB/TrEMBL:B4EI51"
FT                   /protein_id="CAR54098.1"
FT                   /translation="MRRAEQEVGRLHNRLELKTRELANLTRAIVNSSVSHCDVEMRLQR
FT                   ELRAVCTGLGGATMPMSGLPTQADLPGKLVTVELPYTTTILGVLFENMFTFWADCDPRR
FT                   LPKSSTVARAIDERLGFSAQANGEASRTAQAYASVIRPDWVKDADRRHHRAGPRM"
FT   repeat_region   296378..296390
FT                   /note="13 bp imperfect repeat"
FT   CDS_pept        complement(296654..297277)
FT                   /transl_table=11
FT                   /gene="cciI"
FT                   /locus_tag="BCAM0239a"
FT                   /product="N-acylhomoserine lactone synthase"
FT                   /note="Similar to Ralstonia solanacearum autoinducer
FT                   synthesis protein SolI or rsc3286 or rs02515
FT                   SWALL:SLI1_RALSO (SWALL:P58584) (204 aa) fasta scores: E():
FT                   1.1e-18, 40.21% id in 184 aa, and to Burkholderia cepacia
FT                   AHL synthase CepI SWALL:Q9AM52 (EMBL:AF330017) (202 aa)
FT                   fasta scores: E(): 1.3e-18, 39.22% id in 181 aa.
FT                   Contributes to virulence of B. cenocepacia. The CciI
FT                   autoinducer synthase produces C6-HSL and smaller amounts of
FT                   C8-HSL"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0239a"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54099"
FT                   /db_xref="GOA:B4EI52"
FT                   /db_xref="InterPro:IPR001690"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR018311"
FT                   /db_xref="UniProtKB/TrEMBL:B4EI52"
FT                   /protein_id="CAR54099.1"
FT                   /translation="MPSIFAGSFDDMPTTMHRRLGVFRYDVFVGRLGWQLPGADATSLT
FT                   EWDQFDRGRTIHVVSVDQAQHICGCARLIPTTQPYLLQTLCAPSAALHLPRAPTVWELS
FT                   RFAARCGANPTMRASTGMQLFPAILAIAASLGATCVIGAMTRAVARLYQRCGLALQLLD
FT                   TAETADRPAYLIGAIEITRSTFTNLGCDAHELLAAVTWLGAHAT"
FT   misc_feature    complement(296711..297256)
FT                   /gene="cciI"
FT                   /locus_tag="BCAM0239a"
FT                   /note="HMMPfam hit to PF00765, Autoinducer synthetase,
FT                   score 5.8e-10"
FT                   /inference="protein motif:HMMPfam:PF00765"
FT   misc_feature    complement(296846..296914)
FT                   /gene="cciI"
FT                   /locus_tag="BCAM0239a"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAM0239a by TMHMM2.0 at aa 122-144"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(297125..297211)
FT                   /note="PS00949 Autoinducers synthetases family signature."
FT                   /inference="protein motif:Prosite:PS00949"
FT   CDS_pept        complement(297531..298319)
FT                   /transl_table=11
FT                   /gene="cciR"
FT                   /locus_tag="BCAM0240"
FT                   /product="N-acylhomoserine lactone dependent regulatory
FT                   protein"
FT                   /note="Similar to Pseudomonas aeruginosa regulatory protein
FT                   RhlR or LasM or VsmR or pa3477 SWALL:RHLR_PSEAE
FT                   (SWALL:P54292) (241 aa) fasta scores: E(): 2.6e-11, 29.83%
FT                   id in 238 aa. C-terminus similar to the C-terminal region
FT                   of Vibrio anguillarum transcriptional activator protein
FT                   VanR SWALL:VANR_VIBAN (SWALL:P74946) (240 aa) fasta scores:
FT                   E(): 6.1e-14, 30.31% id in 188 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0240"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54100"
FT                   /db_xref="GOA:B4EI53"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:B4EI53"
FT                   /protein_id="CAR54100.1"
FT                   /translation="MDRVCQRGAGDTPTVPQPLTSSLAGRWAPLATAFLNTVDLSSLLK
FT                   LFGDVSASLGFPRFAISRVSRRHTGNGRAMAVETLCARYPDHWVAHYAQRDYGPVDPVH
FT                   RMAFARATPYRWADIRGLNRIEQRVLGEARDAGLTSGVSIPLRETNGDILLVNLASPSP
FT                   EIKTEVHMRLASSIGALFHQELHRLMKPHRPEPALELSPRQQECLAWVARGKSSWAIAS
FT                   IVGISPHTVDYHIAEAMKILGINSRTAAAVHAVTTGLIHV"
FT   misc_feature    complement(297558..297731)
FT                   /gene="cciR"
FT                   /locus_tag="BCAM0240"
FT                   /note="HMMPfam hit to PF00196, Bacterial regulatory
FT                   proteins, luxR fami, score 3.9e-17"
FT                   /inference="protein motif:HMMPfam:PF00196"
FT   misc_feature    complement(297612..297677)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1269.000, SD 3.51 at aa 215-236, sequence
FT                   KSSWAIASIVGISPHTVDYHIA"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    complement(297672..297695)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    complement(297759..298205)
FT                   /gene="cciR"
FT                   /locus_tag="BCAM0240"
FT                   /note="HMMPfam hit to PF03472, Autoinducer binding domain,
FT                   score 1.8e-10"
FT                   /inference="protein motif:HMMPfam:PF03472"
FT   CDS_pept        complement(298612..299541)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0241"
FT                   /product="putative 3-oxoacyl-[acyl-carrier-protein]
FT                   synthase"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0241"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54101"
FT                   /db_xref="GOA:B4EI54"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:B4EI54"
FT                   /protein_id="CAR54101.1"
FT                   /translation="MVDTSIGIPCVAYHLPEHVDCVRHWARRTGQSAAVVAKLEQAGVR
FT                   NFHVARGQSAFSLAIQAVDSLLRNAPISPESIDCLVYTHTLQGSIAPPPVSLPRQLCEY
FT                   FRLVGVPSFSFAQQHCASSLGALRIIRAMFIAHPAIHRVLLVGADVMPMETERAMGTSG
FT                   LLGDGAFAALIERHARTNRLVALATHASGRGWRGMLGQTEASFLAQYQLVARKLITKVA
FT                   QDAHIALSELDRILPPHLNQPAWRRLVQSMRLPPERLFAHNFSRIAHVTVSDPFINLAD
FT                   SGPLAPGAPLVLYAQGVGGFSAAALLIH"
FT   misc_feature    complement(298618..298878)
FT                   /locus_tag="BCAM0241"
FT                   /note="HMMPfam hit to PF08541,
FT                   3-Oxoacyl-[acyl-carrier-protein (ACP)], score 3.3e-07"
FT                   /inference="protein motif:HMMPfam:PF08541"
FT   misc_feature    complement(298966..299193)
FT                   /locus_tag="BCAM0241"
FT                   /note="HMMPfam hit to PF08545,
FT                   3-Oxoacyl-[acyl-carrier-protein (ACP)], score 9.4e-06"
FT                   /inference="protein motif:HMMPfam:PF08545"
FT   CDS_pept        complement(299535..300578)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0242"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0242"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54102"
FT                   /db_xref="GOA:B4EI55"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:B4EI55"
FT                   /protein_id="CAR54102.1"
FT                   /translation="MMPPVVTALCSYVPPIMKLDEQVSAIEPTATRPLTGWDAWMALWR
FT                   TECTPLGPTAMPRIGPGDGPARAPVAHTTDLSGLAAYVTRAICAARPRAAAPVDIVIFC
FT                   HSSVDEHISTTTAGRLASVVGAPDSPCFSFSISQQGSTAPFTALRLAQDLFVAERDLHT
FT                   ILIVAAEKWVAPFSRHTGTGPLQGDAAAALLLERFGTSTRGLRLIDAQTHPCPAPSHDS
FT                   PHRHAHPDSPHLQTMLQLIAALLAKHAIAPCNVTAVGQRHMHALAAALQQELGIASLAG
FT                   VRTHDANLGAADSIEQLMSMAQTHTFPSQGTLLLWNIASCGYVGCALLDAHSAPVLARP
FT                   LGERSSW"
FT   CDS_pept        complement(300575..301168)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0243"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0243"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54103"
FT                   /db_xref="GOA:B4EI56"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B4EI56"
FT                   /protein_id="CAR54103.1"
FT                   /translation="MNAHQYSHRRHLCEPHSGRSATSPHECWLREANRDDMRDIADWLV
FT                   RPAIAQWFDFGLGRQSLSLLAVQAMAQSDRHRLRVFGVRGTDRPSGLVAISDVTHRFGL
FT                   GSFWVLRDSTRAACANMTLAASRQVLREGFECDQLHCIGAWAAQRNIRSQCLLARLGFR
FT                   LIGLQRDCHVIDGQRMGRLLYDLLPQDLSLPTPI"
FT   CDS_pept        complement(301165..302283)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0244"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0244"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54104"
FT                   /db_xref="GOA:B4EI57"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:B4EI57"
FT                   /protein_id="CAR54104.1"
FT                   /translation="MMRNPIPSSSDLVPPTWIVSDDQRALVAACQRFARDQLEPLLAAP
FT                   PSQAGWRDIVTHASSLDFGTMILPTSLGGMAIGQHDLCGIVSTLACGPIERTVQLTQSI
FT                   PALMTLRAYDMLDALAPHPIGDYFNGTCAIALTVPDFHAATLWHLHDQDCAPVAPLMLT
FT                   PHTRGLALIDSAHGDAHACRRCLVVLGALSLEQWRCNGTLCAAPLASIDQCGAQNDSPS
FT                   QTWLTNIALYVSALLSGAMQHDVAFALRYGAERRAFRKPIMLHQRVATRLADMLIATQG
FT                   THLFLRALTLAEPNISTALVRQLVRHIAAESMELTHELVQFCGAHGYVSGLPPAARLTT
FT                   CHWFAMLLMRVDTALAQLTARHTSDSTTGASA"
FT   CDS_pept        complement(join(302317..302993,305518..306049))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BCAM0245"
FT                   /product="putative pyridoxal-dependent decarboxylase
FT                   (pseudogene)"
FT                   /note="Interrupted by IS element after codon 177"
FT                   /db_xref="PSEUDO:CAR54105.1"
FT   misc_feature    complement(302320..302661)
FT                   /locus_tag="BCAM0245"
FT                   /note="HMMPfam hit to PF00278, Pyridoxal-dependent
FT                   decarboxylase, C-, score 1.6e-27"
FT                   /inference="protein motif:HMMPfam:PF00278"
FT   misc_feature    complement(join(302668..302993,305518..305947))
FT                   /locus_tag="BCAM0245"
FT                   /note="HMMPfam hit to PF02784, Pyridoxal-dependent
FT                   decarboxylase, py, score 1e-38"
FT                   /inference="protein motif:HMMPfam:PF02784"
FT   repeat_region   302994..303001
FT                   /note="duplicated insertion sequence target"
FT   mobile_element  303002..305517
FT                   /mobile_element_type="insertion sequence:ISBcen14"
FT                   /note="putative IS element - ISBcen14"
FT   repeat_region   303002..303023
FT                   /note="IS element inverted repeat region"
FT   CDS_pept        303100..303495
FT                   /transl_table=11
FT                   /locus_tag="BCAM0246"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0246"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54106"
FT                   /db_xref="GOA:B4EDQ5"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:B4EDQ5"
FT                   /protein_id="CAR54106.1"
FT                   /translation="MDRVTQTVEIPPKRQTRRHPTEWKRTIVALTFEPGASVARVAREN
FT                   GINANQVWAWRRLHAQGLLTDDAIPDAMLPVVVNEPSQPSMALEVPTETDNIPSGSIQI
FT                   QHGKTSIRIEGAPDPDVLRSVLDRILR"
FT   misc_feature    303145..303372
FT                   /locus_tag="BCAM0246"
FT                   /note="HMMPfam hit to PF01527, Transposase, score 1.2e-10"
FT                   /inference="protein motif:HMMPfam:PF01527"
FT   CDS_pept        303492..303839
FT                   /transl_table=11
FT                   /locus_tag="BCAM0247"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0247"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54107"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:B4EDQ4"
FT                   /protein_id="CAR54107.1"
FT                   /translation="MIGLPQNTRIWIAAGVTDMRCGFNSLAAKVQTVLEKDPFSGHVFV
FT                   FRGKRGDLLKCLYWSDGGLCLLAKRLEKGRFAWPRADSGVVALTTAQLSLLLEGFDWRQ
FT                   PVEAVRPRSAL"
FT   misc_feature    303507..303833
FT                   /locus_tag="BCAM0247"
FT                   /note="HMMPfam hit to PF05717, IS66 Orf2 like protein,
FT                   score 3.2e-62"
FT                   /inference="protein motif:HMMPfam:PF05717"
FT   CDS_pept        303891..305462
FT                   /transl_table=11
FT                   /locus_tag="BCAM0248"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0248"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54108"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:B4EDQ3"
FT                   /protein_id="CAR54108.1"
FT                   /translation="MESTSTALPDDINALRALLLERDAQVAELRKQLSSRALEIEHLKL
FT                   TIAKLRRMQFGRKSEKLDLQIEQLELRLEDLQADEGAADASAAPEAKRPRREGASRKPL
FT                   PGHLEREERVHLPADDDCPDCGGQLKPLGEDIAEQLEYVRAHFRVIRHRRPKLACARCD
FT                   RIVQAAAPSRPIDRGIPGPALLAHIAVSKFAYHLPLHRQAVMYARDGVEIDPGAMGYWM
FT                   GSITALLAPLVDAVRRYTLACGKVHADDTPLPVLVPGNGRTKTGRLWVYVRDDRQSGSD
FT                   EPPAAWFAYTPDRRGEHPQRHLADFAGVLQADAFAGYAELYLDGRVQEAACMAHARRKI
FT                   HDLHAVRPNAVTEEALRRIGALYKIEEQIRGKPPDERRSVRQARAVPLLDDMKRWFEAT
FT                   LATLSAKSDTTKAIRYALNRWPALVYYCSDGCTEIDNLIAERALRGVALGRRNYLFAGA
FT                   DSGGERAAAMYSLIGTARLNGLDPEAYLAYVLERIADHPANRVDELLPWNVAPSLPPTA
FT                   RVEPIR"
FT   misc_feature    304275..304889
FT                   /locus_tag="BCAM0248"
FT                   /note="HMMPfam hit to PF03050, Transposase IS66 family,
FT                   score 1.1e-99"
FT                   /inference="protein motif:HMMPfam:PF03050"
FT   repeat_region   complement(305496..305517)
FT                   /note="IS element inverted repeat"
FT   repeat_region   305518..305525
FT                   /note="duplicated insertion sequence target"
FT   CDS_pept        complement(306046..307635)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0251"
FT                   /product="putative AMP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0251"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54109"
FT                   /db_xref="GOA:B4EI62"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR017529"
FT                   /db_xref="InterPro:IPR020459"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B4EI62"
FT                   /protein_id="CAR54109.1"
FT                   /translation="MQATAHQAPDSHAIVFGDIRLSYQELVERACALGHAIASLGIAPG
FT                   ARIGIFLDKRIETVVSLLGIAATGCVFVPINPLLKPQQVAHILHDCGAICLITSAMRAR
FT                   LLAENGPLALTHTILTDAPDETAPTYDGTARVRRWSECFARDAIDTQPKASDVPTSGID
FT                   TDLAAILYTSGSTGRPKGVMLSHRNLLEGAWSVAHYLNHTCADRILAVLPLSFDAGLSQ
FT                   LTSAWASGATAVLVNYLGPQDVIEACARERITAITGVPPLWMQLAHARWPDAACATLRY
FT                   FANTGGRMPRAVLQRLRVLFPQAKPYLMYGLTEAFRSTYLDPAEVDHRPDSIGKAVPNA
FT                   RILVVRPDGSRCAPEEPGELVHVGACVTMGYWGDAARTSERYRPSPEQKPGGAAPDTAV
FT                   WSGDLVRRDAHGFLYFIARNDAQIKSSGYRISPEEVEEIIHESGLVSEVAAVGVPDDAL
FT                   GETITLVVVPAVTPFLAQTLLSWCKQRLPSYMVPHRIIVQTDIPHNANGKFDRVALRDA
FT                   LVSAPNNQARPI"
FT   misc_feature    complement(306286..307572)
FT                   /locus_tag="BCAM0251"
FT                   /note="HMMPfam hit to PF00501, AMP-binding enzyme, score
FT                   1.5e-114"
FT                   /inference="protein motif:HMMPfam:PF00501"
FT   misc_feature    complement(307096..307131)
FT                   /note="PS00455 Putative AMP-binding domain signature."
FT                   /inference="protein motif:Prosite:PS00455"
FT   misc_feature    complement(307426..307458)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(307702..308637)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0252"
FT                   /product="putative 3-oxoacyl-[acyl-carrier-protein]
FT                   synthase"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0252"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54110"
FT                   /db_xref="GOA:B4EI63"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:B4EI63"
FT                   /protein_id="CAR54110.1"
FT                   /translation="MITSPFSLSAVAHSLPARTVHVNQWVERCGLSDASARALRDHGVG
FT                   QFHDAEGESPANLAVRAITTLLRETATPRSTVDALIHTHTIQTGVLAPPAGTAHYIQRH
FT                   CGLNRALTFSVTQQQCVSPMAAIRVLLALAARYPTIERAIVVCADVIGSGCDRLRAIGD
FT                   LALHSDGACALLLERGAEHNVIASLHLYTDARFFRGTDDTLQPIPDDRYYWSAFTTMRA
FT                   AIRQANIAPDDIAHVLPHHVNLPGWARLMGMLTIPETRLFTANFGTVGHAFGADPFINF
FT                   ETCRNQQAGEWSLLFSSGLAGCFGALVIRH"
FT   misc_feature    complement(307705..307968)
FT                   /locus_tag="BCAM0252"
FT                   /note="HMMPfam hit to PF08541,
FT                   3-Oxoacyl-[acyl-carrier-protein (ACP)], score 5.5e-07"
FT                   /inference="protein motif:HMMPfam:PF08541"
FT   misc_feature    complement(307729..307761)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(308634..309659)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0253"
FT                   /product="putative 3-oxoacyl-[acyl-carrier-protein]
FT                   synthase"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0253"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54111"
FT                   /db_xref="GOA:B4EI64"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:B4EI64"
FT                   /protein_id="CAR54111.1"
FT                   /translation="MLPQTESRVPAPRIVATAQYIPFARSAHPTLTDVSSPLGQRPFDS
FT                   VMQAVYGDTLRWRDECEPQRAPKAPSPPTLSDELAVAESNLSLSDMALCAARLLYDGAS
FT                   QLPRPDQIIVCSTSFEHDLALSCAGRLHHELASRRPPFAIGQLRDVSFATALDLTLAMM
FT                   DADIELNTVLIVAAERWLPPFSRHVHLHTLLADGAAAALVTRHPAPGWRVRGLTICTPA
FT                   TPSSSSVIATPVDSATLMGAINKALARAACQATQMDWIVPAKTDNRLLRSIRTHGDLPL
FT                   ERIWLADDTPGHLCAAHTPARLDSLTRAVSPRDDQHLLIWSTGFHGQVACAILQFCEAP
FT                   S"
FT   misc_feature    complement(308652..308921)
FT                   /locus_tag="BCAM0253"
FT                   /note="HMMPfam hit to PF08541,
FT                   3-Oxoacyl-[acyl-carrier-protein (ACP)], score 0.0011"
FT                   /inference="protein motif:HMMPfam:PF08541"
FT   CDS_pept        complement(309643..309921)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0254"
FT                   /product="putative acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0254"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54112"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:B4EI65"
FT                   /protein_id="CAR54112.1"
FT                   /translation="MTSDSVSNRPDDIATALKSCLLSTLGTHLSAELIEGDTNLFDLGV
FT                   DSMNMTELLLQVEQRFKFMLDPEDLSSDLFLRFDNLVAFVASHAPSN"
FT   misc_feature    complement(309751..309798)
FT                   /note="PS00012 Phosphopantetheine attachment site."
FT                   /inference="protein motif:Prosite:PS00012"
FT   CDS_pept        complement(309952..311208)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0255"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /note="Similar to Geobacillus kaustophilus acyl-CoA
FT                   dehydrogenase. UniProt:Q5KW71_GEOKA (EMBL:BA000043) (404
FT                   aa) fasta scores: E()=1.5e-40, 39.578% id in 379 aa;
FT                   homology does not extend to far N and C termini"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0255"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54113"
FT                   /db_xref="GOA:B4EI66"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B4EI66"
FT                   /protein_id="CAR54113.1"
FT                   /translation="MPDALQTSQPCHEVATLKVALAASGLDLDRLCAQIRAHRDEADRT
FT                   GQIPATFWQGDTVRALNLNLVPSQFGGCPGVQSLVSRVMLMEYLGYADAALALALPGPG
FT                   LAMPPVLALANEQQQAAFFAGFHSDAPRWGAFAITEPDCGSDATAMRTSARKTAHGWVL
FT                   NGTKCFITNGARANTIITFATINRNAGRFGIRAFRVEHDTPGFSVMRVEHMAGLRASQL
FT                   AVLSYSDCEVPDDACLTRDDQAPLSDAFSGAQRSWDYFRPLLSAVMVGTCRRVRDELTA
FT                   YFESGSHPADPRCTPGDVDVHLLDLDRHITTARLLCHHAAWLADQGQPSAMHASMAKAY
FT                   AARETAHVTRTALALVGLGGIAHCPSLEQCCRDAKAFDIMEGTGDMQRLMIARAAQRAP
FT                   QLPWESSDPLAHSAALPRA"
FT   misc_feature    complement(310021..310461)
FT                   /locus_tag="BCAM0255"
FT                   /note="HMMPfam hit to PF00441, Acyl-CoA dehydrogenase,
FT                   C-terminal doma, score 2.9e-18"
FT                   /inference="protein motif:HMMPfam:PF00441"
FT   misc_feature    complement(310072..310425)
FT                   /locus_tag="BCAM0255"
FT                   /note="HMMPfam hit to PF08028, Acyl-CoA dehydrogenase,
FT                   C-terminal doma, score 0.0042"
FT                   /inference="protein motif:HMMPfam:PF08028"
FT   misc_feature    complement(310651..310806)
FT                   /locus_tag="BCAM0255"
FT                   /note="HMMPfam hit to PF02770, Acyl-CoA dehydrogenase,
FT                   middle domain, score 3.3e-22"
FT                   /inference="protein motif:HMMPfam:PF02770"
FT   misc_feature    311431..312849
FT                   /note="BCESM - Burkholderia cepacia epidemic strain marker"
FT   CDS_pept        311448..312281
FT                   /transl_table=11
FT                   /gene="esmR"
FT                   /locus_tag="BCAM0256"
FT                   /product="epidemic strain marker regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0256"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54114"
FT                   /db_xref="GOA:B4EI67"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EI67"
FT                   /protein_id="CAR54114.1"
FT                   /translation="MAGRQRATRKTQSMPPDKRGPRTTKRGDQVAELIKGWINDGRVRP
FT                   GKRLNKEAELQQMFNVSRGSMRDALKALEVQGLVSLSTGPEGGATITRVPLARAFQALQ
FT                   NYLFFENVTLEELYAVRRTLEPIVAAGAVAHLTDADFEALERSISVCEPFVAGHEQALD
FT                   QRCEDIHFHDVLAAAHPNAFLRCLCRIINQMLHSLVIVAGNVTQRDYQAFGRTTLAAHR
FT                   AILEAARRRDAQAVERLMAAHMDEAEAQLRKVHAALRQKLVLDSELDTQMSRDAS"
FT   misc_feature    311523..311720
FT                   /gene="esmR"
FT                   /locus_tag="BCAM0256"
FT                   /note="HMMPfam hit to PF00392, Bacterial regulatory
FT                   proteins, gntR family, score 5.6e-11"
FT                   /inference="protein motif:HMMPfam:PF00392"
FT   misc_feature    311793..312185
FT                   /gene="esmR"
FT                   /locus_tag="BCAM0256"
FT                   /note="HMMPfam hit to PF07729, FCD domain, score 8.3e-27"
FT                   /inference="protein motif:HMMPfam:PF07729"
FT   CDS_pept        complement(312675..312956)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0257"
FT                   /product="putative transcriptional regulator"
FT                   /note="Similar to Bacillus licheniformis (strain DSM
FT                   13/ATCC 14580) hypothetical protein. UniProt:Q65M07_BACLD
FT                   (EMBL:AE017333) (65 aa) fasta scores: E()=0.058, 40.351% id
FT                   in 57 aa, and to N terminus of Bacteriophage phi-105
FT                   immunity repressor protein. UniProt:RPC_BPPH1 (EMBL:A93579)
FT                   (144 aa) fasta scores: E()=0.11, 31.250% id in 80 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0257"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54115"
FT                   /db_xref="GOA:B4EI68"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B4EI68"
FT                   /protein_id="CAR54115.1"
FT                   /translation="MNSPTTAHFIRALGDEVRTRRQTKKLTQVGLATRANVHPNTISLV
FT                   ERAQIVPKIDALLALAAALDTSLSQLVKAAETRTDLRQTPSASHKQQP"
FT   misc_feature    complement(312744..312908)
FT                   /locus_tag="BCAM0257"
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix, score
FT                   2e-10"
FT                   /inference="protein motif:HMMPfam:PF01381"
FT   misc_feature    complement(312816..312881)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1344.000, SD 3.76 at aa 26-47, sequence
FT                   LTQVGLATRANVHPNTISLVER"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        complement(312973..313272)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0258"
FT                   /product="repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0258"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54116"
FT                   /db_xref="GOA:B4EI69"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B4EI69"
FT                   /protein_id="CAR54116.1"
FT                   /translation="MFSKRLKQARLRTDLTQEQLGILAGIDEFSASARVNQYEKGKHAP
FT                   TVQTSQRLARALLIPTSFLYEEDDLLANLLLIAGRLSKEKKRALVAAAESLAQE"
FT   misc_feature    complement(313081..313257)
FT                   /locus_tag="BCAM0258"
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix, score
FT                   2.6e-06"
FT                   /inference="protein motif:HMMPfam:PF01381"
FT   CDS_pept        complement(313367..313702)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0259"
FT                   /product="putative repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0259"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54117"
FT                   /db_xref="GOA:B4EI70"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B4EI70"
FT                   /protein_id="CAR54117.1"
FT                   /translation="MRRTLSTSSIFPKRLREARLRSGLSQEQLGIEAGIDEFSASARVN
FT                   QYETGKHAPKLQTAHRLARVLHVPTSFLYEGNDLLARLLVAAAPLPQDSLEALLEYAER
FT                   LSRTAAS"
FT   misc_feature    complement(313484..313660)
FT                   /locus_tag="BCAM0259"
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix, score
FT                   2.4e-08"
FT                   /inference="protein motif:HMMPfam:PF01381"
FT   CDS_pept        313884..314672
FT                   /transl_table=11
FT                   /locus_tag="BCAM0260"
FT                   /product="putative amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0260"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54118"
FT                   /db_xref="GOA:B4EI71"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B4EI71"
FT                   /protein_id="CAR54118.1"
FT                   /translation="MATILNILSYVSVLTLVALGLAIVFGLMDIVNLAHAEWVTMGAYT
FT                   LAVAQSVGGQHAFWAALLAAPIVGAGLGWCLERFVIRLLYARPLDTLLATYAVSLIVQK
FT                   AIELVFGTQPTLVYAPFNATVEVPGGSYPAYRMFVIGVALAVTAGCWVLFTRTRFGTKL
FT                   RAVIQHPAMAEAVGINTRRLNRVAFCGGAALASLAGVLVAPMVSVESHLGMSYLAKAFF
FT                   VIVLGGIGSVAGSILGSAFVGTIETLLAIALIRRSRRRSF"
FT   sig_peptide     313884..313991
FT                   /locus_tag="BCAM0260"
FT                   /note="Signal peptide predicted for BCAM0260 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.981) with cleavage site
FT                   probability 0.944 between residues 36 and 37"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    313890..314642
FT                   /locus_tag="BCAM0260"
FT                   /note="HMMPfam hit to PF02653, Branched-chain amino acid
FT                   transport syst, score 3.1e-29"
FT                   /inference="protein motif:HMMPfam:PF02653"
FT   misc_feature    join(313896..313964,314052..314111,314130..314189,
FT                   314277..314345,314439..314507,314550..314618)
FT                   /locus_tag="BCAM0260"
FT                   /note="6 probable transmembrane helices predicted for
FT                   BCAM0260 by TMHMM2.0 at aa 5-27, 57-76, 83-102, 132-154,
FT                   186-208 and 223-245"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    314301..314333
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        314763..315836
FT                   /transl_table=11
FT                   /locus_tag="BCAM0261"
FT                   /product="putative branched-chain amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0261"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54119"
FT                   /db_xref="GOA:B4EI72"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B4EI72"
FT                   /protein_id="CAR54119.1"
FT                   /translation="MFDRHFSRARTWLSQPALSGSDVSPVMTGFAIVVAGAILPLVVGA
FT                   YELTVIRDALVLAILALSYDLLWGRAGVLTLGHTTFFGIGAYGFAVTTVQFGQTPLVGF
FT                   LAGLACAAVAAAVLGYFLLYAGVRLHFFAILSMAVLIIAQQLATSWQSVTGGDTGLLGI
FT                   PGLSFQLAGHTLDLSGPVASWYAVATILVALLGVVWLLCRSRYGKVLAAISTNEWRALA
FT                   CGYHTSWHLLLMFTASAVLAAVAGCLMAATAGVVAPDVFSPVLATEVILWVAIGGRGSL
FT                   GGPVLAAVGLTLLKHGASSLSTQWWPLILGAVFLACVLCLPNGVRLGGMLKGLRQFTGI
FT                   SLKRMPRSCAQRVEGGS"
FT   misc_feature    join(314838..314906,314964..315032,315060..315128,
FT                   315147..315206,315300..315368,315453..315521,
FT                   315669..315737)
FT                   /locus_tag="BCAM0261"
FT                   /note="7 probable transmembrane helices predicted for
FT                   BCAM0261 by TMHMM2.0 at aa 26-48, 68-90, 100-122, 129-148,
FT                   180-202, 231-253 and 303-325"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    314898..315716
FT                   /locus_tag="BCAM0261"
FT                   /note="HMMPfam hit to PF02653, Branched-chain amino acid
FT                   transport syst, score 4e-26"
FT                   /inference="protein motif:HMMPfam:PF02653"
FT   misc_feature    315060..315092
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    315471..315503
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    315681..315713
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        315836..316570
FT                   /transl_table=11
FT                   /locus_tag="BCAM0262"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0262"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54120"
FT                   /db_xref="GOA:B4EI73"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4EI73"
FT                   /protein_id="CAR54120.1"
FT                   /translation="MNAPIIKGVGLYRAFGGINAIAGVDVEIGARDLLCVIGPNGAGKS
FT                   TLVGLMSGAIVPGAGELYLAGERMTGRPMYQYCRRGVVRKFQGTNVFQTMSVRENLEVA
FT                   ALGVSNRQAFSMRDLDGVLEQIGLAAQADMLAMHLPHGERQWLEIGMAMMCRPALLLLD
FT                   EPAAGLSATDAQRLVHLIHRLREQCAVLAIEHDLHFVQSLDCETWVMHRGQIVRQGRYD
FT                   DIAKDEEVRRIYLGQGASHAAH"
FT   misc_feature    315932..316474
FT                   /locus_tag="BCAM0262"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   5.2e-32"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    315947..315970
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        316557..317312
FT                   /transl_table=11
FT                   /locus_tag="BCAM0263"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0263"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54121"
FT                   /db_xref="GOA:B4EI74"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4EI74"
FT                   /protein_id="CAR54121.1"
FT                   /translation="MLHIENLSAGYGDIAVLHQITLAVQPNEVVGVLGCNGAGKTTLVK
FT                   AIMGFLPHVSGEVRFGEHVVNGMRAHEIARLGIGLVPQGRWIFPKLTVRENLMMGTAAA
FT                   GDAEILDELFEYFPVLKTRLSQHGGTLSGGEQQVLAIARALCGRPKLLLLDEPSDGVQP
FT                   NLVELIGDVIPVLCRRSKLAVLLVEQNLDLVLRCAQRCIVLKNGRLAHAGKIEPHRGTD
FT                   SAHPLAQFLSPAAERTADSQAAFVEREPT"
FT   misc_feature    316635..317177
FT                   /locus_tag="BCAM0263"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   7.7e-47"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    316656..316679
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    316947..316991
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        317309..318487
FT                   /transl_table=11
FT                   /locus_tag="BCAM0264"
FT                   /product="putative membrane protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0264"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54122"
FT                   /db_xref="GOA:B4EI75"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B4EI75"
FT                   /protein_id="CAR54122.1"
FT                   /translation="MNRRDFSRSALWGALGVFSAAVCPNLVRAAAPIKIGLLAPLSGPL
FT                   TRVGETNRHCAMLAIEEINAAGGLLGRPLELAVEDTQMSTAVTLEKARQLLMRDEVAML
FT                   TGMVLPSEREAALQAAKTAARLVVYPNFDEGRCDPLLLSTGLSVAQRVEPLITWLMRGG
FT                   GKSVSAVVSDVGSNRKVLVPALEAAVSRHGGRLLNVYWLPFGTRDYGAVLQRIAAQQPQ
FT                   LVWHSIGDDPVTFVKQYRSFAMRPQLVTDIAHESLSIATAGASTGAIGVSSYFMSIDST
FT                   ENHRFLARYTARVADTRALRLGPYAVMLPHGECTYAGIRLFAQAAQDAGSVEVMHVKTA
FT                   LSGISLNLPRGKTGVSRAGDHVTCMTRIAQAQADNSFALLDSVGPILPTCQG"
FT   sig_peptide     317309..317395
FT                   /locus_tag="BCAM0264"
FT                   /note="Signal peptide predicted for BCAM0264 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.995) with cleavage site
FT                   probability 0.755 between residues 29 and 30"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    317333..317401
FT                   /locus_tag="BCAM0264"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAM0264 by TMHMM2.0 at aa 9-31"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        318540..319955
FT                   /transl_table=11
FT                   /gene="amiI"
FT                   /locus_tag="BCAM0265"
FT                   /product="putative amidase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0265"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54123"
FT                   /db_xref="GOA:B4EI76"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:B4EI76"
FT                   /protein_id="CAR54123.1"
FT                   /translation="MNDISMMSAETLLVEYRRHALSPRECMEAVLERIQQFDPLVNCMC
FT                   SFHADMALQAARESEQRWMRGEPLGLLDGVPVSVKDLIDVQGFPTRYGSLTSPDTLQRS
FT                   DAPAVSRLRRAGALLFGKTTTSEYGNKIVTDSPLTGITRNPWDRRVTPGGSSGGSSVAV
FT                   ALGMGALSLATDGGGSIRVPACWSGVVGFKPTFDLVPTGVAGSWTRLSTLGPIARNVRD
FT                   TALMLSVASGAHDPLQSESDRPVDYRIGLEHGVAGLRVAYCPGIAGVTVDPMVAASVAQ
FT                   AADVFEALGAHVEQVDVKPLANYLDSRMHAIQWSVFFAQRACAMSEAQRAQLDSDVQVL
FT                   VEAGLQVTAPELAGALRARHLLGVEMAAFFECYDLLVTPVFHCGPLPVPGLPKTLLTAP
FT                   QQTSWCNQTGLPAASVPCGLPGGLPTGVQIVGRLHADALVLRAARAYELARGAFPTAPL
FT                   LQGEHAVATEVTP"
FT   misc_feature    318612..319859
FT                   /gene="amiI"
FT                   /locus_tag="BCAM0265"
FT                   /note="HMMPfam hit to PF01425, Amidase, score 6.4e-98"
FT                   /inference="protein motif:HMMPfam:PF01425"
FT   misc_feature    318885..318908
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    318996..319091
FT                   /note="PS00571 Amidases signature."
FT                   /inference="protein motif:Prosite:PS00571"
FT   CDS_pept        319952..320497
FT                   /transl_table=11
FT                   /locus_tag="BCAM0266"
FT                   /product="conserved hypothetical protein"
FT                   /product="blr3824 protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0266"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54124"
FT                   /db_xref="InterPro:IPR009569"
FT                   /db_xref="InterPro:IPR035936"
FT                   /db_xref="UniProtKB/TrEMBL:B4EI77"
FT                   /protein_id="CAR54124.1"
FT                   /translation="MSVQVAKIVVHLVERRAELNTAIYPPHRQAIAAAVLSRQIWRLDD
FT                   PLEPLYELGAELGTSLTEHARCALGVQRGAIQVYGKAALVGTAVPLECAAALLHPRMGK
FT                   AIRACLPGTTSLIPSVTKRGAAGACLDIPLHGAVDMWNFDHFDTASLIVPDSPAPDELV
FT                   VAIALAEHGRPLARVVSA"
FT   misc_feature    319964..320488
FT                   /locus_tag="BCAM0266"
FT                   /note="HMMPfam hit to PF06684, Protein of unknown function
FT                   (DUF1185), score 2.5e-25"
FT                   /inference="protein motif:HMMPfam:PF06684"
FT   CDS_pept        320550..321584
FT                   /transl_table=11
FT                   /gene="opcI"
FT                   /locus_tag="BCAM0267"
FT                   /product="putative porin"
FT                   /note="Contributes to virulence of B. cenocepacia"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0267"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54125"
FT                   /db_xref="GOA:B4EI78"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:B4EI78"
FT                   /protein_id="CAR54125.1"
FT                   /translation="MRKIVWGLARACAVSVGMWGIPGVVHAHSSVSLYGLIDAFVGETH
FT                   APGAAGSAWQVGSGGMTTSYWGVTGSEDLGHGMKAVFTLEGFFRVNAGQLGSFNGQSFF
FT                   GRNAFVGLSGRFGEVTIGRNTAPLFVSTLLFNPFGNSFAFSPMISHGYLGSAMGAASVQ
FT                   SDTAIDSSVLYQTPEVGGLSGSLLYSNAGVAGHTGQANYSANVLYFAGAFSATAAVQSL
FT                   HTASLFLNGATAQTAWLVGGAYRIHATKLMFQYERVSNNSNVTDDTVQVGASARFGMGS
FT                   MLLSWAGTRRRPVTGSGLRWSTFALGYDYPLSKRTDIYAAWRYDTVTHASSGNGVGAGV
FT                   RMRF"
FT   sig_peptide     320550..320630
FT                   /gene="opcI"
FT                   /locus_tag="BCAM0267"
FT                   /note="Signal peptide predicted for BCAM0267 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.995) with cleavage site
FT                   probability 0.990 between residues 27 and 28"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    320625..321581
FT                   /gene="opcI"
FT                   /locus_tag="BCAM0267"
FT                   /note="HMMPfam hit to PF00267, Gram-negative porin, score
FT                   0.00058"
FT                   /inference="protein motif:HMMPfam:PF00267"
FT   CDS_pept        321591..321815
FT                   /transl_table=11
FT                   /locus_tag="BCAM0268"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0268"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54126"
FT                   /db_xref="InterPro:IPR024467"
FT                   /db_xref="UniProtKB/TrEMBL:B4EI79"
FT                   /protein_id="CAR54126.1"
FT                   /translation="MQTRQVERLVGPGRLAWIVATATSVWSDEDDAREFLSTPHPDLER
FT                   RTPLDPALTELGARRVEELDWKLFYGLSA"
FT   CDS_pept        complement(322124..323473)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0270"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0270"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54127"
FT                   /db_xref="UniProtKB/TrEMBL:B4EI80"
FT                   /protein_id="CAR54127.1"
FT                   /translation="MTFPHWLSLVKEVPDFHAVPTFNHMAQRTQETQHRYPDLVTVTRA
FT                   DLSGQGEPIDLISIGDGPLSALFIGAPHPNEPIGCLLIDYLIDRLCRDPALRQSLPYRW
FT                   HFIKAIEPDALRLNEGRFSAYGDLGVYLKHLYRPPFAEQAEYTFPFEPDDRLARYPLPE
FT                   NLAWRAAIELAKPDFMYSLHNAEFGGVFHLALAMPAELAATLAGVSGQYGLTLNSVGEA
FT                   ALGRWADGIFQFRDMEKERMRAQEAAALVQPDERPLGNSSAGYTASRGTFSFVTEVPFW
FT                   DHARLHDDGRSNRSLGELEADLRAWSMDIFPLARRALSLDYAATNAAALSIWRGLREFI
FT                   GNYEKDFPPTMSESEQQRTLTWAEYTIRHVTGRLFLLRLVALARRLSMLALDRGEGFRV
FT                   SAACSDFLSREIDRLTHSDHLQPIPLRTLVQIQLHAGLSVLTHLAAPRAG"
FT   CDS_pept        323992..324261
FT                   /transl_table=11
FT                   /locus_tag="BCAM0271"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0271"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54128"
FT                   /db_xref="GOA:B4EI81"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR014795"
FT                   /db_xref="UniProtKB/TrEMBL:B4EI81"
FT                   /protein_id="CAR54128.1"
FT                   /translation="MATTRFEARIETDVHAAIRRAAEIQGRTMSDFVVSAAREAAQRAI
FT                   ADAEVIRLSVAESERFAHAILTPAEPVEALKRAIDLHDQLLRNA"
FT   CDS_pept        324258..324746
FT                   /transl_table=11
FT                   /locus_tag="BCAM0272"
FT                   /product="putative acetyltransferase-GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0272"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54129"
FT                   /db_xref="GOA:B4EI82"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B4EI82"
FT                   /protein_id="CAR54129.1"
FT                   /translation="MSGAQLVVAALEAAHDRSRFACGTPALDRYLREVVTQDVRRRVAA
FT                   CFVMLDGNVVAGYYTLSAASVALTDLPHAIARKLPRYPAIPVVRMGRLAVDQAYRGRRL
FT                   GAALLVNALQRAAKSEIAAVALTVDAKDETAAAFYRHFGFAPLTSDPLALFMPLATVK"
FT   misc_feature    324396..324692
FT                   /locus_tag="BCAM0272"
FT                   /note="HMMPfam hit to PF00583, Acetyltransferase (GNAT)
FT                   family, score 3.3e-12"
FT                   /inference="protein motif:HMMPfam:PF00583"
FT   CDS_pept        324761..325819
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BCAM0273"
FT                   /product="conserved hypothetical protein (fragment)"
FT                   /note="Probable gene remnant. CDS is truncated at the
FT                   N-terminus in comparison to similar proteins, for example:
FT                   similar to Escherichia coli hypothetical protein YhcG
FT                   UniProt:YHCG_ECOLI (EMBL:U00096) (375 aa) fasta scores:
FT                   E()=2.8e-65, 62.463% id in 341 aa"
FT                   /db_xref="PSEUDO:CAR54130.1"
FT   misc_feature    324761..325783
FT                   /locus_tag="BCAM0273"
FT                   /note="HMMPfam hit to PF06250, Protein of unknown function
FT                   (DUF1016), score 1.4e-136"
FT                   /inference="protein motif:HMMPfam:PF06250"
FT   CDS_pept        join(325926..325964,325963..326355)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BCAM0274a"
FT                   /product="conserved hypothetical protein (pseudogene)"
FT                   /note="CDS contains a frameshift after codon 13. Similar to
FT                   Burkholderia cenocepacia (strain HI2424) hypothetical
FT                   protein UniProt:A0B4X6 (EMBL:CP000461 (142 aa) fasta
FT                   scores: E()=3.2e-17, 48.120% id in 133 aa"
FT                   /db_xref="PSEUDO:CAR54131.1"
FT   CDS_pept        326635..327486
FT                   /transl_table=11
FT                   /locus_tag="BCAM0275"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0275"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54132"
FT                   /db_xref="InterPro:IPR014966"
FT                   /db_xref="UniProtKB/TrEMBL:B4EI85"
FT                   /protein_id="CAR54132.1"
FT                   /translation="MSTSSSLDPNLRDVQCVGEATDLVSFLQHVDKWLASVPVMDLDFP
FT                   LFRGQEVESWRLVPSIGRAPYQMRLRPGTEQRMLDEFKQRAVPHVESTVELTNADWLAI
FT                   AQHHAMPTRLLDWSGSALSALWFAVRKPAVEKPCENRSCESEEGRGVWPGAIWMLPVTL
FT                   GDLISSEESKDPLGLGQTRLFKPRHVSRRIAAQDGWFTVHRGKQSGLDTKYFALDTNPE
FT                   FRDRLRYIRIPGEKFGIIRGQLQRAGINRGMLFPDLDGVAGRITDTILYPADQPTPGAD
FT                   NL"
FT   repeat_region   328096..328108
FT                   /note="13 bp imperfect repeat"
FT   CDS_pept        328358..328813
FT                   /transl_table=11
FT                   /locus_tag="BCAM0275a"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0275a"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54133"
FT                   /db_xref="UniProtKB/TrEMBL:B4EI86"
FT                   /protein_id="CAR54133.1"
FT                   /translation="MAVVLLALGACAGSQRAATFRSTETQLLEGRQAASLRCSTRSECD
FT                   GAWNHTQRYIESHSATRVIPSGMDRIETAQPYVAGEVYLWASRTVSDGGGYVIRLKPMC
FT                   KGMYDSDGGPGWQYDTCAKKILGIQSGFLSYVRQPPSPHIPSLPSER"
FT   CDS_pept        329025..329495
FT                   /transl_table=11
FT                   /locus_tag="BCAM0276"
FT                   /product="putative universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0276"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54134"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B4EI87"
FT                   /protein_id="CAR54134.1"
FT                   /translation="MYTSIMVAVDGSPSSKKALDEGLKMARSCGARLFAVFVVDKSILF
FT                   AYGGRMEPAALLDEIRHYGKTILRSADRAISHAGVNGETEIVETDIGQDVVERLQRYVD
FT                   DRSIDLAVIGTHGRRGIRRMLLGSVAERFLRESRCPVLLVRDEGPTPAAVAA"
FT   misc_feature    329025..329459
FT                   /locus_tag="BCAM0276"
FT                   /note="HMMPfam hit to PF00582, Universal stress protein
FT                   family, score 2.5e-22"
FT                   /inference="protein motif:HMMPfam:PF00582"
FT   CDS_pept        329613..329888
FT                   /transl_table=11
FT                   /locus_tag="BCAM0277"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0277"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54135"
FT                   /db_xref="InterPro:IPR009962"
FT                   /db_xref="InterPro:IPR036692"
FT                   /db_xref="UniProtKB/TrEMBL:B4EI88"
FT                   /protein_id="CAR54135.1"
FT                   /translation="MQISFPSEPPTYCGVDPALRFFALVDGHRVRCAITAAALEDHFRA
FT                   VSPREQDLVDAFARHRPVIERAARCLLEEMGGRPVLLHSGYFRFCT"
FT   CDS_pept        330064..330498
FT                   /transl_table=11
FT                   /locus_tag="BCAM0278"
FT                   /product="putative heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0278"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54136"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:B4EI89"
FT                   /protein_id="CAR54136.1"
FT                   /translation="MNNMTRYDPFSLEPVSDLFQGLFRPLRGMTLADEPDLASMKIDVT
FT                   ENDNAYTVNAELPGVAKDDIDVQVTGNTVSINAKIERNNEQKDGERVIRRERYSGAVSR
FT                   SFSLSGEIDDANATATYQDGVLSLTLPKKAPVGQKKLAIS"
FT   misc_feature    330190..330495
FT                   /locus_tag="BCAM0278"
FT                   /note="HMMPfam hit to PF00011, Hsp20/alpha crystallin
FT                   family, score 1.6e-23"
FT                   /inference="protein motif:HMMPfam:PF00011"
FT   CDS_pept        complement(330593..331258)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0279"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0279"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54137"
FT                   /db_xref="GOA:B4EI90"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:B4EI90"
FT                   /protein_id="CAR54137.1"
FT                   /translation="MTEPQLLAYSPAPAAQPAPPRGESREAVDLPRPMLDNDVPLMAAL
FT                   ATRMSSREFAATPLPPATLGTMLWAADGINRPASGGRTAPSAHAFNEIDVYVALPAGVY
FT                   RYDAPAHRLVLKHAVDARNLTGYQDFVGRAPLDLVYVVRTSAILDMPPRQRDMFSAIAA
FT                   GAIAQNVSLYCAAAGIGTVVRCWIDHRLLADALRLNEDELPILAQTVGYRTGGTPSHA"
FT   CDS_pept        331489..332139
FT                   /transl_table=11
FT                   /locus_tag="BCAM0280"
FT                   /product="putative phospholipid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0280"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54138"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:B4EI91"
FT                   /protein_id="CAR54138.1"
FT                   /translation="MKTDKQLKQDVEDELESDPSIDATRIGVEVADRIVTLSGHPPSYA
FT                   EKLAIERAANRVGGVKALVVDMTVHLPDDDVRTDEDIAKAVRSVLHWTVGLHDDAVKVQ
FT                   VERGWITLSGKVDWAYQSHLAVRAISQMRSVTGVTDHIAVQGAVGVEDIGGNIKRAIMR
FT                   HAEREVKHIAIDVHDGTVRLSGKVGSFSERKAVRGAAWSARGVRAVVDDLVID"
FT   misc_feature    331510..331701
FT                   /locus_tag="BCAM0280"
FT                   /note="HMMPfam hit to PF04972, Putative
FT                   phospholipid-binding domain, score 1.3e-09"
FT                   /inference="protein motif:HMMPfam:PF04972"
FT   misc_feature    331735..331926
FT                   /locus_tag="BCAM0280"
FT                   /note="HMMPfam hit to PF04972, Putative
FT                   phospholipid-binding domain, score 7.8e-12"
FT                   /inference="protein motif:HMMPfam:PF04972"
FT   misc_feature    331948..332121
FT                   /locus_tag="BCAM0280"
FT                   /note="HMMPfam hit to PF04972, Putative
FT                   phospholipid-binding domain, score 0.00021"
FT                   /inference="protein motif:HMMPfam:PF04972"
FT   CDS_pept        332176..332379
FT                   /transl_table=11
FT                   /locus_tag="BCAM0280A"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0280A"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54139"
FT                   /db_xref="UniProtKB/TrEMBL:B4EI92"
FT                   /protein_id="CAR54139.1"
FT                   /translation="MILSGEVHETDWSVASEAVTAEPDGFRYRIHVTLESPDGACEREA
FT                   VIDGLRVGMTWIEMKKANIFTL"
FT   CDS_pept        complement(332471..334228)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0281"
FT                   /product="putative sulfate transporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0281"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54140"
FT                   /db_xref="GOA:B4EI93"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:B4EI93"
FT                   /protein_id="CAR54140.1"
FT                   /translation="MNRPLSGYIARVLPGVALLANYRRAWLARDLYAGIALSAVLVPVG
FT                   MSYAQAAGLPAITGLHASVAALLAYALLGPSRILVLGPDSALAALIAGAIVPLAGHDPP
FT                   RAIALAGALALSAGTICILLGVLDLGFVTDLLSRPIQYGYLNGIAIALALGRLPELLGM
FT                   PVSAGDVFSSVPHIVHALAGGRFSVAAGLLGVAVLATIILFKQVAPRWPGVLIAVLAAT
FT                   IVARLPPLHGIPTVGALPAGLPAPRLPAVSLADLSALASGAVAVALVSFADISMLSRAL
FT                   SARAGDAPNRNQELIALGAANLLAGMTQGCAVSSSASRTPVAIAAGAQSQITNLVAAAC
FT                   ITILLVAAPALLIFVPRTALAAVVIYAAFGIADVRSVVRLYRMRRGECLISMLCFAGVI
FT                   GMGVVPGILLASALSLLSFVWRAWHPYDAVLGRLTGVRGYHDIARHPGAAQTSGLVLFR
FT                   WDAPLFYANVEIFCEHLRAAIARSTKPVTRIVVAAEPVTDIDVSAADRLVALHAELAER
FT                   GIAMNFAEMKGPVKDRLRAYGLFDVFGAASFFPTVTDAVARHVRRPGRQTRPCKRKRAT
FT                   RRRVSHETR"
FT   misc_feature    complement(332564..332896)
FT                   /locus_tag="BCAM0281"
FT                   /note="HMMPfam hit to PF01740, STAS domain, score 1.1e-14"
FT                   /inference="protein motif:HMMPfam:PF01740"
FT   misc_feature    complement(332963..333859)
FT                   /locus_tag="BCAM0281"
FT                   /note="HMMPfam hit to PF00916, Sulfate transporter family,
FT                   score 3.1e-52"
FT                   /inference="protein motif:HMMPfam:PF00916"
FT   misc_feature    complement(join(332999..333067,333086..333154,
FT                   333167..333235,333413..333481,333539..333598,
FT                   333617..333685,333728..333796,333833..333901,
FT                   333929..333997,334010..334078,334088..334156))
FT                   /locus_tag="BCAM0281"
FT                   /note="11 probable transmembrane helices predicted for
FT                   BCAM0281 by TMHMM2.0 at aa 25-47, 51-73, 78-100, 110-132,
FT                   145-167, 182-204, 211-230, 250-272, 332-354, 359-381 and
FT                   388-410"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(333209..333241)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    complement(333296..333328)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   repeat_region   334379..334395
FT                   /note="Direct repeat, 17mer, flanking Cenocepacia Island"
FT   CDS_pept        complement(334394..334627)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0282"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0282"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54141"
FT                   /db_xref="UniProtKB/TrEMBL:B4EI94"
FT                   /protein_id="CAR54141.1"
FT                   /translation="MSYVDYRSDPGMRATTSDTSGTASLDTVALVALARDAGMLVTLDG
FT                   QIGRERYESVTGSIATLARFAQALQLAGLKAA"
FT   CDS_pept        complement(334767..335774)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0283"
FT                   /product="putative lysine decarboxylase"
FT                   /note="Similar to Prochlorococcus marinus subsp. pastoris
FT                   (strain CCMP 1378/MED4) putative dape gene and orf2.
FT                   UniProt:Q7V091 (294 aa) fasta scores: E()=3.8e-41, 44.444%
FT                   id in 252 aa; homology does not extend to N terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0283"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54142"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:B4EI95"
FT                   /protein_id="CAR54142.1"
FT                   /translation="MIKRAPASNARHRPASGATIVKTRGKRSRTRLDAVVGGDVGRQPV
FT                   PRPTRTANSPNSAWIDEDATLLRRSGMRGIRLQLDYWKAEERLQNERIGHAVVIYGSTR
FT                   IVAPSVANARLDDANRLLAERPHDASRRRAATIASRLVEHSGYYRVAREFGRIVAHADR
FT                   CTRTARLAIVTGGGPGIMEAANRGAYERGAPSIGFNIELPREQAPNPYITPALCFRFHY
FT                   FAIRKLHLLERAKAAVFFPGGYGTFDELFEVLTLLQTRKIAPLPVILVGEAYWRRAVDL
FT                   AFLADEGMIDRRDLELFTYCESAAQIWHAIGSWYARRRERPPARCDVSSKSHAV"
FT   misc_feature    complement(334833..335234)
FT                   /locus_tag="BCAM0283"
FT                   /note="HMMPfam hit to PF03641, Possible lysine
FT                   decarboxylase, score 2.7e-48"
FT                   /inference="protein motif:HMMPfam:PF03641"
FT   CDS_pept        complement(335806..336141)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0284"
FT                   /product="putative cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0284"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54143"
FT                   /db_xref="GOA:B4EI96"
FT                   /db_xref="InterPro:IPR002324"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B4EI96"
FT                   /protein_id="CAR54143.1"
FT                   /translation="MNIMRCAALCVIAVTASTAAAQTAVPEPTELVEAQHCMFCHTPDM
FT                   TFLGPSFHEIAERYRGDPRAAAELERKLRVGGPAHWGNTPMPSAVDRGGPLSSDDSHRL
FT                   VQWVLSQ"
FT   misc_feature    complement(336016..336033)
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00190"
FT   sig_peptide     complement(336079..336141)
FT                   /locus_tag="BCAM0284"
FT                   /note="Signal peptide predicted for BCAM0284 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.890 between residues 21 and 22"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(336161..337168)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0285"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0285"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54144"
FT                   /db_xref="GOA:B4EI97"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:B4EI97"
FT                   /protein_id="CAR54144.1"
FT                   /translation="MISVPPLAASMRPDHDPRSLVGYAVLAPSSHNSQPWRFLVNGNTI
FT                   SVCADRTRALPVVDPFDRELIISCGAALLNLRVALDHAGFAHTISTFPSEVDPDLLAQV
FT                   RICDDGYSDAALGTLFDAIPARVTTRAPFESSLVPEAIQQALIEAGIAEGADVACVDSI
FT                   AHRARVAELVAEADRQQFADPRFRRELASWIDPRRHVDGMPAFAAGVPALLDFAAPVVT
FT                   MAVRTFDLGNGLAALHHQLVGASPLIVCIATVRDDREAWLAAGQALERILLVATRAGYT
FT                   ASYLNQPVETAGLRAHLRHMLGLRGEPQLLLRVGRGPHTPHSPRRPLDEVLSFS"
FT   CDS_pept        337347..338336
FT                   /transl_table=11
FT                   /locus_tag="BCAM0286"
FT                   /product="putative alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0286"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54145"
FT                   /db_xref="GOA:B4EI98"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014187"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4EI98"
FT                   /protein_id="CAR54145.1"
FT                   /translation="MLAMMFDGTTPHLRETRVPDPSPAAGQLLIDVHACGVCRTDLHVV
FT                   DGELAHAKLPLIPGHQIVGTVRGLGEGVMSFAVGDRVGVPWLGSTCGHCAYCISGRENL
FT                   CDNPGFTGYTIDGGYAECAVADHRYCVHLPRRYSDLEAAPLLCAGLIGYRTLRMAGDAR
FT                   RIGIYGFGAAAHLVAQVAQGEGRKVFALTKPGDTAAQQLALSLGAAWAGGSDEAPPERL
FT                   DAALIFAPAGALVPAALRALDKGGIVVCGGIHMSDIPSFPYAWLWGERRIASVANLTRA
FT                   DAVAFMRIAAATPLRVEAVRYALTDANSALDDLRGGRVSGAAVLGMHD"
FT   misc_feature    337419..337745
FT                   /locus_tag="BCAM0286"
FT                   /note="HMMPfam hit to PF08240, Alcohol dehydrogenase
FT                   GroES-like domain, score 5.1e-45"
FT                   /inference="protein motif:HMMPfam:PF08240"
FT   CDS_pept        complement(338362..339135)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0287"
FT                   /product="CRP family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0287"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54146"
FT                   /db_xref="GOA:B4EI99"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EI99"
FT                   /protein_id="CAR54146.1"
FT                   /translation="MQSSAEVSTTMPLRPFIPLHPVEPADQPKRAASRCSTCALRTVCM
FT                   PPDLSPDDFVRVDAMICTTRHVRRGETLFRSGDAFNSIYAVRTGSFKTIVMHRDGDEQI
FT                   TGFQIVGESLGLDGVHTGHHNGDAIALEDSTVCIIPFGQLEQMCREVRPMQHHVYQMMS
FT                   GEIVRESSQMLLLGTMSAEQRVAAFLLNLSARFKARGYSAAEFVLRMTRDEIGEYLGMK
FT                   LETVSRMLSKFQHKGLVAAQGKQIRIVDSDGLRQI"
FT   misc_feature    complement(338419..338514)
FT                   /locus_tag="BCAM0287"
FT                   /note="HMMPfam hit to PF00325, Bacterial regulatory
FT                   proteins, crp famil, score 1.3e-11"
FT                   /inference="protein motif:HMMPfam:PF00325"
FT   misc_feature    complement(338443..338508)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1607.000, SD 4.66 at aa 210-231, sequence
FT                   MTRDEIGEYLGMKLETVSRMLS"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    complement(338677..338946)
FT                   /locus_tag="BCAM0287"
FT                   /note="HMMPfam hit to PF00027, Cyclic nucleotide-binding
FT                   domain, score 1.7e-17"
FT                   /inference="protein motif:HMMPfam:PF00027"
FT   CDS_pept        complement(339443..340090)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0288"
FT                   /product="two-component regulatory system, response
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0288"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54147"
FT                   /db_xref="GOA:B4EIA0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIA0"
FT                   /protein_id="CAR54147.1"
FT                   /translation="MIRVLIADDHALVRDGLRHILQNASGFDVVGEAQDSASTIALMRD
FT                   TDANVLVLDLSMPGRNGVELIKQIKDEKPGLHILVLTMHAEQQYAVRAFRAGASGYMTK
FT                   ESASAELVAALTKIAAGGVYVSLTMAEQFAQSLNEPTDLLPHQRLSDREFDVFRRVTTG
FT                   ESISEIAQALCVSVKTVSTYKTRILEKMQMPNDTALVRYAMRHKLFEDPDEL"
FT   misc_feature    complement(339482..339655)
FT                   /locus_tag="BCAM0288"
FT                   /note="HMMPfam hit to PF00196, Bacterial regulatory
FT                   proteins, luxR fami, score 9.8e-17"
FT                   /inference="protein motif:HMMPfam:PF00196"
FT   misc_feature    complement(339536..339601)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1738.000, SD 5.11 at aa 164-185, sequence
FT                   ESISEIAQALCVSVKTVSTYKT"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    complement(339743..340087)
FT                   /locus_tag="BCAM0288"
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 1.1e-34"
FT                   /inference="protein motif:HMMPfam:PF00072"
FT   CDS_pept        complement(340087..342084)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0289"
FT                   /product="two-component regulatory system, sensor kinase
FT                   protein"
FT                   /note="Similar to Xanthomonas campestris (pv. campestris)
FT                   hrpx hrpx related protein. UniProt:Q8P9A6 (697 aa) fasta
FT                   scores: E()=7.1e-23, 27.436% id in 667 aa, and C terminus
FT                   is similar to Ralstonia solanacearum (Pseudomonas
FT                   solanacearum) rs00623 probable transmembrane two component
FT                   system sensor kinase transcription regulator protein (ec
FT                   2.7.-.-). UniProt:Q8Y2Z0 (458 aa) fasta scores:
FT                   E()=8.9e-64, 49.438% id in 445 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0289"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54148"
FT                   /db_xref="GOA:B4EIA1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIA1"
FT                   /protein_id="CAR54148.1"
FT                   /translation="MTVNAPPFRTGPAPRRIRPPARYAGLAALLTLALGLTATFAASRV
FT                   LENNVRHATQVRFEQAATRATAGLRRSLLDAAVILRGTRAFASALSAEPSGAAWLRYLA
FT                   SLDLDALQSPVRSLGRIEPSAAEDNQATRQALQRAAETGKVALAANAIQDSIDTAFART
FT                   ELTLYLPIGAKAEDGTSFEARHATATGYVYAALNPDRLVDPSLLDRLHLEIVADTPAAP
FT                   VYTAGFSGDDATDSRKALERTDSLVFGGTPLSLHYRAASADTARTAMAVLLTGTVLSLT
FT                   LAALVRQILSQRTRVAETAGNSQPTEARMMGIIRSSMEAIVTVDENQTIVIFNPAAEHV
FT                   FGVSAMEAVGAPLSRFIPERFRAAHARHVEQFGVTGVSERQMGRQRVLFGLRGDGTEFP
FT                   IEASISQIRDGAGKLYTVMLRDVTERVRAENALKQSREELRDLSANLQNVREEEKTRIA
FT                   RELHDDLGQQLTALKMDLSAVELGLAGVVAPHTGVREQLGAMHRLIDSTVASVRRIAAD
FT                   LRPVMLDDLGLIPAIEWLANDFTRRYRITVDRDIGPVDTKFTGAGATALFRIVQEALTN
FT                   VARHSDATNVTLTLKTADGYCMLRVADNGHGAPKHPRDSQDRPSFGLIGIRERAHMLDG
FT                   TVTIDNRPGSGFTITVALPLHAIQQGDVLS"
FT   misc_feature    complement(340117..340404)
FT                   /locus_tag="BCAM0289"
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HSP90, score 5.7e-20"
FT                   /inference="protein motif:HMMPfam:PF02518"
FT   misc_feature    complement(340516..340728)
FT                   /locus_tag="BCAM0289"
FT                   /note="HMMPfam hit to PF07730, Histidine kinase, score
FT                   1.1e-16"
FT                   /inference="protein motif:HMMPfam:PF07730"
FT   misc_feature    complement(340804..341145)
FT                   /locus_tag="BCAM0289"
FT                   /note="HMMPfam hit to PF08448, PAS fold, score 5.6e-11"
FT                   /inference="protein motif:HMMPfam:PF08448"
FT   misc_feature    complement(340819..341163)
FT                   /locus_tag="BCAM0289"
FT                   /note="HMMPfam hit to PF00989, PAS fold, score 5e-13"
FT                   /inference="protein motif:HMMPfam:PF00989"
FT   misc_feature    complement(341956..342024)
FT                   /locus_tag="BCAM0289"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAM0289 by TMHMM2.0 at aa 21-43"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(341962..342084)
FT                   /locus_tag="BCAM0289"
FT                   /note="Signal peptide predicted for BCAM0289 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.989) with cleavage site
FT                   probability 0.915 between residues 41 and 42"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        342336..342806
FT                   /transl_table=11
FT                   /locus_tag="BCAM0290"
FT                   /product="putative universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0290"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54149"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIA2"
FT                   /protein_id="CAR54149.1"
FT                   /translation="MYRRIFTALDGSRSARLALDEAISLARDSGSLVIATCVVSDAPRL
FT                   ADVDGGYIDQRDPAGLDADKAAIAVSDAETAFQLSGVRGIAQTIDACGQDVSDVLARAA
FT                   AECDADLIVMGTHGRRGVRRALLGSVAESLVRVADRPVLVVREGPGACAGML"
FT   misc_feature    342336..342773
FT                   /locus_tag="BCAM0290"
FT                   /note="HMMPfam hit to PF00582, Universal stress protein
FT                   family, score 1.5e-19"
FT                   /inference="protein motif:HMMPfam:PF00582"
FT   CDS_pept        complement(342879..343712)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0291"
FT                   /product="putative universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0291"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54150"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIA3"
FT                   /protein_id="CAR54150.1"
FT                   /translation="MSYKTLLVHLDDSARCATRVDLALELAGRWNAHLVGLYVVCQDLF
FT                   EPLRRPDEPLKLAVYERLCDQRRKEAEERFLTAAERAGRSVEWQAPTGNATEAAILHAR
FT                   HADLLVLGQEDPDDRTTYVARHFVEDVVMGGGRPAIVVPYAGDVRTIGENVLIGWDGGR
FT                   EAARVMADALPLLARARFVNVETVSRGHPDPDKTPPGVDVAAYLERHGIRASFSTTPRT
FT                   RSVGVGATLLNRVTDLHADLLVMGLYSHARMHERVLGGATRTILETMTVPVLLSH"
FT   misc_feature    complement(342882..343259)
FT                   /locus_tag="BCAM0291"
FT                   /note="HMMPfam hit to PF00582, Universal stress protein
FT                   family, score 6.5e-14"
FT                   /inference="protein motif:HMMPfam:PF00582"
FT   misc_feature    complement(343068..343112)
FT                   /note="PS00616 Histidine acid phosphatases phosphohistidine
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00616"
FT   misc_feature    complement(343284..343709)
FT                   /locus_tag="BCAM0291"
FT                   /note="HMMPfam hit to PF00582, Universal stress protein
FT                   family, score 3.9e-09"
FT                   /inference="protein motif:HMMPfam:PF00582"
FT   CDS_pept        complement(343709..344212)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0292"
FT                   /product="putative universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0292"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54151"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIA4"
FT                   /protein_id="CAR54151.1"
FT                   /translation="MYSNILVALDGSDTSSRALDAALDLAAETGARLTPVYVVDFLVPA
FT                   YDMYGYDPSILVDSFREEGLRVTEDAARRMKARDVVGAPRISNVAPAGEDIPHRIVGLA
FT                   GEIDADLIVMGTHGRRGFPRLFLGSVAERVLRQARCPVLMIPASAAAKASAEATAASTE
FT                   KEPS"
FT   misc_feature    complement(343775..344212)
FT                   /locus_tag="BCAM0292"
FT                   /note="HMMPfam hit to PF00582, Universal stress protein
FT                   family, score 1.9e-28"
FT                   /inference="protein motif:HMMPfam:PF00582"
FT   CDS_pept        complement(344282..345481)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0293"
FT                   /product="putative acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0293"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54152"
FT                   /db_xref="GOA:B4EIA5"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIA5"
FT                   /protein_id="CAR54152.1"
FT                   /translation="MRTLALLVVNAGSSSVKFSIFAYPPHGDPVQRPLHDGEAVAAGNG
FT                   VSIRFDADPDGSLPLGAGDPYRAVLAQIAMWIRVRLPHITLGAIAHRVVHGGARYTEPV
FT                   IVDGDVLDELRTLTPLAPLHQPHSLDAIDALRNAFPDVPQIAVFDTAFHRTLPRTEQLL
FT                   PLPHAWFDRGVRRYGFHGLSYEYLSVALDDSFGARAHGRVIAAHLGSGASLCALRECRS
FT                   VATTMGFSALDGLMMSTRCGTLDPGVVLHLLEADNLSGDALGHLFYHESGLKGVSGASG
FT                   DPRVLLECEAAGDPLARDALALYVHRIVRETGALTALLGGLDMLVFTAGIGEHSAPLRE
FT                   RICASLGWLGIELDTRANVDNAHVVSSASSAVTVVVEPTNEAWIAARAAVRVLRGNRDA
FT                   "
FT   misc_feature    complement(344321..345469)
FT                   /locus_tag="BCAM0293"
FT                   /note="HMMPfam hit to PF00871, Acetokinase family, score
FT                   3.3e-101"
FT                   /inference="protein motif:HMMPfam:PF00871"
FT   misc_feature    complement(345431..345466)
FT                   /note="PS01075 Acetate and butyrate kinases family
FT                   signature 1."
FT                   /inference="protein motif:Prosite:PS01075"
FT   CDS_pept        complement(345490..346329)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0294"
FT                   /product="putative universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0294"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54153"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIA6"
FT                   /protein_id="CAR54153.1"
FT                   /translation="MSYKSMVVHLDTSARAHSRLEFALRLARRFGAHLTGLFAVYTPEP
FT                   HSFYVMAGSADYFRAHREQRDERMAALERLFHAETARAKVPATWVRADERANVAVPRAA
FT                   RLADLVIAGQSDPNDPETYIDDQFPENLVLSAGRPVLFWPYTGEFPSVGERVFVAWDGS
FT                   REAARAAHDALPFLEHAKRTTVVAVVDGDSESATTRIPAADAALMLARHARDVNVLDIA
FT                   TGSGASVGDTLLSRAYETGSDLLVMGAYGHPRWRELMIGGATRTVLASMTLPVLMSH"
FT   misc_feature    complement(345493..345873)
FT                   /locus_tag="BCAM0294"
FT                   /note="HMMPfam hit to PF00582, Universal stress protein
FT                   family, score 1.6e-13"
FT                   /inference="protein motif:HMMPfam:PF00582"
FT   misc_feature    complement(345898..346326)
FT                   /locus_tag="BCAM0294"
FT                   /note="HMMPfam hit to PF00582, Universal stress protein
FT                   family, score 3.7e-08"
FT                   /inference="protein motif:HMMPfam:PF00582"
FT   CDS_pept        346519..347052
FT                   /transl_table=11
FT                   /locus_tag="BCAM0295"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0295"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54154"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIA7"
FT                   /protein_id="CAR54154.1"
FT                   /translation="MSTDALTIPNDVCRAGCDLALRMVAQNRDWQHEWHALAGRRIERD
FT                   RIAVRRLQQALAETREWTAFAEASRQVMTDYTVASVAIWQDATELCMRAQFESAGAWRT
FT                   WLREYGAGALSRYQTDWLPDLGRLAVVNEASMPWADWMAALERGIEDVAGAKNGVAAGR
FT                   LNGIAGARESDHVR"
FT   CDS_pept        347042..347788
FT                   /transl_table=11
FT                   /gene="phbB"
FT                   /locus_tag="BCAM0296"
FT                   /product="acetoacetyl-CoA reductase"
FT                   /EC_number="1.1.1.36"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0296"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54155"
FT                   /db_xref="GOA:B4EIA8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011283"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIA8"
FT                   /protein_id="CAR54155.1"
FT                   /translation="MCADRVAFVTGGMGGLGASIGRRLHDAGMTVAVSHRERNDHVATW
FT                   LTKEREAGRAFHAFEVDVADYDSCQHCAARVLAEFGRVDVLVNNAGITHDATFVKMTKS
FT                   MWDAVLRTNLDGIFNMTKPFVPGMIEGGFGRIVNIGSVNGSRGAYGQTNYAAAKAGIHG
FT                   FTKALALELARHGVTVNTVAPGYLATAMLETVPKEVLDTKILPQIPVGRLGNPDEIAAL
FT                   VAFLCSDAASFATGAEFDVNGGMHMK"
FT   misc_feature    347054..347560
FT                   /gene="phbB"
FT                   /locus_tag="BCAM0296"
FT                   /note="HMMPfam hit to PF00106, short chain dehydrogenase,
FT                   score 3e-37"
FT                   /inference="protein motif:HMMPfam:PF00106"
FT   misc_feature    347462..347548
FT                   /note="PS00061 Short-chain dehydrogenases/reductases family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00061"
FT   CDS_pept        347785..349605
FT                   /transl_table=11
FT                   /locus_tag="BCAM0297"
FT                   /product="putative poly(3-hydroxyalkanoate) polymerase"
FT                   /note="Similar to Methylobacterium extorquens PhaC
FT                   poly(3-hydroxyalkanoate) polymerase UniProt:PHAC_METEX
FT                   (EMBL:MEPHAC) (605 aa) fasta scores: E()=3.2e-68, 39.920%
FT                   id in 501 aa; homology does not extend to N terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0297"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54156"
FT                   /db_xref="GOA:B4EIA9"
FT                   /db_xref="InterPro:IPR010941"
FT                   /db_xref="InterPro:IPR022211"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIA9"
FT                   /protein_id="CAR54156.1"
FT                   /translation="MKAAVIRAPFRPEPTRPPDAIEIATSAAGCAPVRAAPADEWNRAA
FT                   HANVAAMTFGLSPVSLALAILDWGAHLAVAPGKCFVLATQAWLGAVASATNGRDGEAGD
FT                   ADTSGLAVHAGHADPRFAAPAWGGWPFCAYRDGFLSIQRWWRDATRGVPGVDRHHEELV
FT                   GFVARQWLDACSPGNFLATNPVVLDATMRSGGANLAAGWRHWLDDANALIERASGTRGD
FT                   DARAYLPGRDVAITPGRVVWRNALCELLQYAPTTADVAREPIVVVPSWIMKYYILDLQP
FT                   HDSLIRFLVDAGYTVFAVSWRNPGAEARDLGLDDYLRDGCMAALDAARTICGEAVHAAG
FT                   YCLGGTLLAIAAAALARDGRQHEALRSVTLLAAQTDFSEPGELGLFIDASELSALDALM
FT                   WRQGYLDGAQMSAAFELLNARDLIWSRMMSEYLLGTRTKPNDLMSWNADTTRMPYRMHT
FT                   EYLTQLFLDNDLATGRYCVDGRPVALSDIDVPTFVVGTERDHVSPWRSVYKLHLLTHHA
FT                   LTFVLTSGGHNAGIVSEPGHPGRHYRCVTREPGAAYRSRHDFVRDTPAVDGSWWFCWRD
FT                   WLHTRSSGDVPARTPAAGFAAAPGTYVLET"
FT   misc_feature    348130..348651
FT                   /locus_tag="BCAM0297"
FT                   /note="HMMPfam hit to PF07167, Poly-beta-hydroxybutyrate
FT                   polymerase (P, score 5.7e-58"
FT                   /inference="protein motif:HMMPfam:PF07167"
FT   misc_feature    348664..349419
FT                   /locus_tag="BCAM0297"
FT                   /note="HMMPfam hit to PF00561, alpha/beta hydrolase fold,
FT                   score 0.00051"
FT                   /inference="protein motif:HMMPfam:PF00561"
FT   CDS_pept        349602..350633
FT                   /transl_table=11
FT                   /locus_tag="BCAM0298"
FT                   /product="putative phosphate acetyl/butyryl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0298"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54157"
FT                   /db_xref="GOA:B4EIB0"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIB0"
FT                   /protein_id="CAR54157.1"
FT                   /translation="MNDNLHLGVPDDACLPGLLPQANGELPSLIARTRHARPLVVAVVH
FT                   PCDAASVVALAALRASPLGASIEPLIVAPRTKVLRAANDAGVDLSTWTIEDVPHSHAAA
FT                   ARAVELAAAGRAGALMKGSLHTDELMGAVVAADSGLRTDKRMSHCFLIETPAYPRPFIL
FT                   TDAAVNIAPDLAQKAAITQNAIDVAHALGVACPRVAVLCAVETVSPAMRSTLDAAALAK
FT                   MAERGQLEGAIVDGPLAFDNAISQRAARDKGIDSPVAGHADILVVPDIEAGNMLAKQLE
FT                   YLGGAASAGIVVGARVPIVLTSRADSVAVRVASCALAALLAQQRHAPASINEPATFSME
FT                   EQR"
FT   misc_feature    349683..350558
FT                   /locus_tag="BCAM0298"
FT                   /note="HMMPfam hit to PF01515, Phosphate acetyl/butaryl
FT                   transferase, score 4.7e-23"
FT                   /inference="protein motif:HMMPfam:PF01515"
FT   CDS_pept        350630..351670
FT                   /transl_table=11
FT                   /locus_tag="BCAM0299"
FT                   /product="putative zinc-binding alcoholdehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0299"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54158"
FT                   /db_xref="GOA:B4EIB1"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIB1"
FT                   /protein_id="CAR54158.1"
FT                   /translation="MKALVYHGSGRKALEERPKPELQSPTDAIIRVTRTTICGTDLHIL
FT                   KGDVSTCESGRILGHEGVGVVDQIGAAVESLKPGDHVLISCISSCGRCEYCRRGLYSHC
FT                   TTGGWILGNRIDGTQAEYVRIPHAQTSLYRIPAGADEDALVMLSDILPTGFECGVLNGK
FT                   VQPGCTVAIVGAGPIGLAALLTAQFYSPAQIIMIDPDSNRREIARHFGATDCFDSRAGD
FT                   PVAEVMKLTDGIGVDCAIEAVGIPATFEMCTALVAPGGVVANVGVHGVKADLHLEKLWD
FT                   RNIAITTRLVDTVSTPMLLKTVRAGRLDPKRLITHRFSLDDVERAYDTFGRAAQTHALK
FT                   VIIEAG"
FT   misc_feature    350702..351034
FT                   /locus_tag="BCAM0299"
FT                   /note="HMMPfam hit to PF08240, Alcohol dehydrogenase
FT                   GroES-like domain, score 2.8e-46"
FT                   /inference="protein motif:HMMPfam:PF08240"
FT   misc_feature    350804..350848
FT                   /note="PS00059 Zinc-containing alcohol dehydrogenases
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00059"
FT   misc_feature    351125..351544
FT                   /locus_tag="BCAM0299"
FT                   /note="HMMPfam hit to PF00107, Zinc-binding dehydrogenase,
FT                   score 8e-32"
FT                   /inference="protein motif:HMMPfam:PF00107"
FT   CDS_pept        complement(351752..353155)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0300"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0300"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54159"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIB2"
FT                   /protein_id="CAR54159.1"
FT                   /translation="MKLTFLGATETVTGSKYLVEHGGRRVLIDCGLFQGTKNLRLRNWN
FT                   PLPLAPDTLDAVVLTHAHIDHTGYLPVLVREGYRGPVYCTAATAELCDIMLRDSARLQE
FT                   EEAEFANRHGYSKHHPAQPLYTLDDAQRALRLLKPVALDECTTLGGGLAFRLLPAGHIL
FT                   GAASVVMHGNHKVLAFSGDLGRYHDPIMQPPRPPAHADYLVVESTYGDRLHPASDPENE
FT                   LAMLFDTTFARGGVVVMPCFTVGRAQEILHYIARLKASGRMARVPVFLDSPMATDVTEI
FT                   YRHHILEHRLTLSEANALGHAATMIQSVDQSKAIAEHHGPMVIIAGSGMATGGRVLHHL
FT                   SRYAPDVRNTIALVGYQAAGTRGAALAAHEPTVKIHGEYVRVRAQVESITTLSAHADYE
FT                   EILQWLGTMQSAPVCTFITHGEPASADALRRRISERLHWPCEVPTYAQTVDLDAVESGD
FT                   AREPAALSS"
FT   misc_feature    complement(351887..352024)
FT                   /locus_tag="BCAM0300"
FT                   /note="HMMPfam hit to PF07521, RNA-metabolising
FT                   metallo-beta-lactamase, score 1.4e-08"
FT                   /inference="protein motif:HMMPfam:PF07521"
FT   misc_feature    complement(352430..353119)
FT                   /locus_tag="BCAM0300"
FT                   /note="HMMPfam hit to PF00753, Metallo-beta-lactamase
FT                   superfamily, score 3.2e-21"
FT                   /inference="protein motif:HMMPfam:PF00753"
FT   CDS_pept        complement(353286..353471)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0301"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0301"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54160"
FT                   /db_xref="GOA:B4EIB3"
FT                   /db_xref="InterPro:IPR021347"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIB3"
FT                   /protein_id="CAR54160.1"
FT                   /translation="MIHHSCRTALATLSVFIALASLLGVVHAMLVDAHVLPYAIVTLVS
FT                   GIVAFVSQLEPAPRER"
FT   misc_feature    complement(join(353310..353369,353379..353447))
FT                   /locus_tag="BCAM0301"
FT                   /note="2 probable transmembrane helices predicted for
FT                   BCAM0301 by TMHMM2.0 at aa 9-31 and 35-54"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(353388..353471)
FT                   /locus_tag="BCAM0301"
FT                   /note="Signal peptide predicted for BCAM0301 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.786 between residues 28 and 29"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(353629..354753)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0302"
FT                   /product="putative ABC transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0302"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54161"
FT                   /db_xref="GOA:B4EIB4"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIB4"
FT                   /protein_id="CAR54161.1"
FT                   /translation="MSRLLAIYRLGIKELWSLARDPILLALIVYTFSASIYVAATARPE
FT                   TLHKVPIALVDEDASPLSARIAAAFFPPQFAPPPIIDTGAADRGLDNGDYTFSLDIPPN
FT                   FQRDVLAGRHATIQLNVDATRMTQAFTGSTYIQQIVSGEIDAFVRRYRGTPLPGVDLAM
FT                   RMRFNPNLDEVWFGALMELINNVTMLSMILTGAALIREREHGTIEHLLVMPVTAAEIML
FT                   AKVWSMGLVVTVAAVASLTCVVGGALHVPIPGSIPLFVAGMALHLFATTSLGIFLATLV
FT                   RSMPQFGMLLVLVLLPLQLLSGGLTPRESMPAAVRDIMLAAPTTHFVELAQRILYRGAG
FT                   LDAVWPQFAALSAIGSVLFLLSLMRFRKTIGQMT"
FT   misc_feature    complement(join(353656..353724,353836..353895,
FT                   353914..353982,354010..354078,354634..354687))
FT                   /locus_tag="BCAM0302"
FT                   /note="5 probable transmembrane helices predicted for
FT                   BCAM0302 by TMHMM2.0 at aa 23-40, 226-248, 258-280, 287-306
FT                   and 344-366"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(353746..354411)
FT                   /locus_tag="BCAM0302"
FT                   /note="HMMPfam hit to PF01061, ABC-2 type transporter,
FT                   score 3.4e-28"
FT                   /inference="protein motif:HMMPfam:PF01061"
FT   misc_feature    complement(353758..353871)
FT                   /note="PS00890 ABC-2 type transport system integral
FT                   membrane proteins signature."
FT                   /inference="protein motif:Prosite:PS00890"
FT   CDS_pept        complement(354756..357548)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0303"
FT                   /product="ABC transporter ATP-binding membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0303"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54162"
FT                   /db_xref="GOA:B4EIB5"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIB5"
FT                   /protein_id="CAR54162.1"
FT                   /translation="MPVDTGAGAGEGPPASIESGAVARLSGVSLRYGATYALDDVTLDI
FT                   PAGRMVGLIGPDGVGKSSLLALVSGARAMQQGRVRVLRGDLSSRVHRARVCRRIAYMPQ
FT                   GLGRNLYATLSVEENLQFFARLFGHDAAERRRRIDALTHSTGLHAFLDRPAGKLSGGMK
FT                   QKLGLCCALIHDPDLLILDEPTTGVDPLSRAQFWELIERIRSARPAMSVLVATAYMDEA
FT                   QRFDWLIAMDAGRVLATGSPGELLARTRCDTLEAAFIALLPEARRHGHQPIRLTPFQPD
FT                   ETDGYAIEADALTMRFGDFVAVDHVSLKIRRGEIFGFLGSNGCGKSTTMKMLTGLLAAS
FT                   EGTATLFGRPVAANDIDARRRVGYMSQGFSLYGELTVRQNLVLHARLFGVPEPDLPARI
FT                   DEMVGRFGLAEVLDALPERLPLGMRQRLSLAVAMVHKPELLILDEPTSGVDPVARDDFW
FT                   RLMIELARNDRVTIFISTHFMNEAARCDRISLMHAGRVLASAAPDELVRLRGAATLEDA
FT                   FIGYLTDAQRVDGAPTDTSSGTGWLAASPETGNAGHRAAWFSPARAGSYLWREVLELRR
FT                   DPLRATLALFGSLVLMCVISIGISLDVDNLTFAVLDRDQSMLSQDYAQNLAGSRYFVPR
FT                   ARLADDRDIDRRMRNGQLSLAIEIPPGFAHDVAHGRHVEIGAWVDGAMPMRAETIRGYV
FT                   AGMHENWLRDQAKRRLGVSLVPAVDVAIRYRYNPDVKSLPAMIPAIMPMLLLMLPAMLT
FT                   ALAVVRERELGSIVNLYVTPVTRAEFLLGKQAPYVMLAMLNFLLMVVLADVVFGVRIKG
FT                   SFPTLAAAVLVFNVVATGIGLFASTFTRSQIAAIFMTIVGTLIPVVQFSGLLTPLSSLE
FT                   GSGRWIGTVYPATYMLAISRGVYNKALGLADLSSQFWPLLAAVPVIMVTTGVLLRKQER
FT                   "
FT   misc_feature    complement(join(354774..354833,354954..355022,
FT                   355035..355103,355146..355214,355275..355343))
FT                   /locus_tag="BCAM0303"
FT                   /note="5 probable transmembrane helices predicted for
FT                   BCAM0303 by TMHMM2.0 at aa 740-762, 783-805, 820-842,
FT                   847-869 and 910-929"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(354864..355487)
FT                   /locus_tag="BCAM0303"
FT                   /note="HMMPfam hit to PF01061, ABC-2 type transporter,
FT                   score 7.4e-10"
FT                   /inference="protein motif:HMMPfam:PF01061"
FT   misc_feature    complement(356067..356612)
FT                   /locus_tag="BCAM0303"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   4.6e-53"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    complement(356568..356591)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    complement(356847..357407)
FT                   /locus_tag="BCAM0303"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   6.1e-44"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    complement(357033..357077)
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    complement(357363..357386)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(357557..358630)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0304"
FT                   /product="transporter system transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0304"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54163"
FT                   /db_xref="GOA:B4EIB6"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIB6"
FT                   /protein_id="CAR54163.1"
FT                   /translation="MKTIKRPILIGAGAAVLAIGLIYYGWTRWRDARTDAGLVSGNGRI
FT                   EAIEIDVATKLPGRVTAMLVDEGDFVSAGQPLARMDVVVLRAQLDEAQAREQQAVNTAA
FT                   SIDAQVAQRRSDKAAADALVVQRESELDAATRRLARSETLSRDGASSLQELDDDRARAG
FT                   SLRATVNAARAQVEAAQAGIDATRAQLVAARSAVTAAQATVARVQADISDSELTSPRDG
FT                   RVQYRIAESGEVLPAGGKVLNVVDLSDVYMTFFLPETVVGRVPLGADVRIVLDAAPEYV
FT                   IPARVSYVSSTAQFTPKTVETATERQKLMFRVKARIDRDLLQRHLKLVKTGLPGVAWLK
FT                   TDPNAGWPARLAIKVPQ"
FT   misc_feature    complement(357608..358489)
FT                   /locus_tag="BCAM0304"
FT                   /note="HMMPfam hit to PF00529, HlyD family secretion
FT                   protein, score 3.1e-24"
FT                   /inference="protein motif:HMMPfam:PF00529"
FT   misc_feature    complement(358544..358612)
FT                   /locus_tag="BCAM0304"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAM0304 by TMHMM2.0 at aa 7-29"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(358577..358630)
FT                   /locus_tag="BCAM0304"
FT                   /note="Signal peptide predicted for BCAM0304 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.936) with cleavage site
FT                   probability 0.585 between residues 18 and 19"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(358627..360123)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0305"
FT                   /product="outer membrane transport system protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0305"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54164"
FT                   /db_xref="GOA:B4EIB7"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIB7"
FT                   /protein_id="CAR54164.1"
FT                   /translation="MRAVAVPPLFLPAIARCIRLVALAAGAGLLSGCLSLAPPDELPAT
FT                   PIAAAFPDPSARSVSIAQAPPAWYDYFVDVRLRALIGQALANNRDLRAAVARVEQARAV
FT                   YGIRSADQWPTIGAGAAYVRFRTPGGFLTPAPVIGQVYEVQLAETQWEIDFWGRVRNLK
FT                   ASALQRYLASDAARQAVTLSVITSVADAYLTLCELDERIALTRATIDSRHESLRIFQLR
FT                   HAAGAISRLDLTQSEILLQQAESLGVQLQQARASAANALALLVGATPALADAPLTLDDG
FT                   AVTPSLAPGLPSSLLARRPDVIAAEHELQATRANIGAARAAFFPRIALTSAIGSGSTAL
FT                   HDLLSSGTGVWSVIPNVTLPLVDGGRNRSNLALAHAQRDEALAQYEKTMQRAFRDVSDA
FT                   LAARYWLADQVAIERATLASQAERARLAKLRYDSGATRFLEVLDAQRDLMNAEQQWVMT
FT                   RRALLSSRVALYGALGGGTPDTYSAAAASNHLSIDSGSIP"
FT   misc_feature    complement(358702..359262)
FT                   /locus_tag="BCAM0305"
FT                   /note="HMMPfam hit to PF02321, Outer membrane efflux
FT                   protein, score 2.2e-38"
FT                   /inference="protein motif:HMMPfam:PF02321"
FT   misc_feature    complement(359326..359895)
FT                   /locus_tag="BCAM0305"
FT                   /note="HMMPfam hit to PF02321, Outer membrane efflux
FT                   protein, score 7e-32"
FT                   /inference="protein motif:HMMPfam:PF02321"
FT   misc_feature    complement(360025..360057)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   sig_peptide     complement(360052..360123)
FT                   /locus_tag="BCAM0305"
FT                   /note="Signal peptide predicted for BCAM0305 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.803) with cleavage site
FT                   probability 0.645 between residues 24 and 25"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(360306..360494)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0306"
FT                   /product="putative membrane protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0306"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54165"
FT                   /db_xref="GOA:B4EIB8"
FT                   /db_xref="InterPro:IPR021347"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIB8"
FT                   /protein_id="CAR54165.1"
FT                   /translation="MNRKQYRIALATLSVFIALASLAGIVHGMLFDERVFRYSIVTLIL
FT                   SILSFVVLLNLAPGDRP"
FT   misc_feature    complement(join(360324..360392,360402..360470))
FT                   /locus_tag="BCAM0306"
FT                   /note="2 probable transmembrane helices predicted for
FT                   BCAM0306 by TMHMM2.0 at aa 9-31 and 35-57"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(360426..360494)
FT                   /locus_tag="BCAM0306"
FT                   /note="Signal peptide predicted for BCAM0306 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.597 between residues 23 and 24"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        360777..361424
FT                   /transl_table=11
FT                   /locus_tag="BCAM0307"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0307"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54166"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIB9"
FT                   /protein_id="CAR54166.1"
FT                   /translation="MKSDAALKQDVEQALFWNPAIDSRRIDVDVRDRIVTLRGTVDSWA
FT                   QKLEAQKTALHVADARALVLELNVEPPEDACADHELAIAITFALGWQEALRDHRIRVEV
FT                   DHGCVTLDGEVDHAFQSRAAEKMVSRMKGVVGVANRIRVRADHTVPDVGTRIAEALARR
FT                   AQRESAGISIDADDGIVTLTGTVASLAERRAACGAAASVRGVREVVDRLSVA"
FT   misc_feature    360798..360989
FT                   /locus_tag="BCAM0307"
FT                   /note="HMMPfam hit to PF04972, Putative
FT                   phospholipid-binding domain, score 5.1e-10"
FT                   /inference="protein motif:HMMPfam:PF04972"
FT   misc_feature    361020..361211
FT                   /locus_tag="BCAM0307"
FT                   /note="HMMPfam hit to PF04972, Putative
FT                   phospholipid-binding domain, score 2.6e-12"
FT                   /inference="protein motif:HMMPfam:PF04972"
FT   misc_feature    361233..361406
FT                   /locus_tag="BCAM0307"
FT                   /note="HMMPfam hit to PF04972, Putative
FT                   phospholipid-binding domain, score 2.7e-09"
FT                   /inference="protein motif:HMMPfam:PF04972"
FT   CDS_pept        361465..361974
FT                   /transl_table=11
FT                   /locus_tag="BCAM0308"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Geobacter sulfurreducens hypothetical
FT                   protein. UniProt:Q747B6 (165 aa) fasta scores: E()=1.5e-09,
FT                   31.429% id in 140 aa; homology does not extend to the N
FT                   terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0308"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54167"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIC0"
FT                   /protein_id="CAR54167.1"
FT                   /translation="MNRSHSGPGRNYLRRDKRMQPHTKDSYRDPKRPSGDRICEGCGAV
FT                   CDAGRWTWYATPLDRRQLECPACKRMRENAPAGELVLRGEYVRRHRSAILELLERQADL
FT                   EMSEHALERIMEIEQTGDALVIRTTGVHVVRRMGEALLHAHHGALAFNYRDSEDVLRAN
FT                   WTRDAA"
FT   CDS_pept        362008..363915
FT                   /transl_table=11
FT                   /locus_tag="BCAM0309"
FT                   /product="putative cell division-related metallo peptidase"
FT                   /note="family M41 metallo peptidase. Similar to Shigella
FT                   flexneri cell division protein FtsH (ec 3.4.24.-).
FT                   UniProt:FTSH_ECOLI (EMBL:AE015333) (644 aa) fasta scores:
FT                   E()=4.1e-87, 51.005% id in 547 aa; homology does not extend
FT                   to N-terminus or far C-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0309"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54168"
FT                   /db_xref="GOA:B4EIQ0"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIQ0"
FT                   /protein_id="CAR54168.1"
FT                   /translation="MKKTFDYSGLMIPIAFAVLVAYQLLAAQPATTSISYSDFHRLVDA
FT                   RLVDELDIGQSSISGALRMPQAATMLPASDAVAVKKAGSPWRFTTNRVGDDHLVAALTA
FT                   AGIRYRGMPDSGWIAMLATWLLPMIVLVLVWNFMMRRPGGMRDLSGMGKSQARVYVQQE
FT                   TGITFDDIAGIDEAKAELQQIVAFLRSPERYQRLGGKIPKGVLIVGAPGTGKTLLARAV
FT                   AGEAGVPFFTISGSAFVEMFVGVGAARVRDLFEQAQQKAPCIVFIDELDALGKARGVGL
FT                   MSGNDEREQTLNQLLVEMDGFQANSGVIIMAATNRPEILDPALLRPGRFDRHIAIDRPD
FT                   LVGRKQILAVHTKRVKLAPEVDLAELAQRTPGFVGADLANVVNEAALRAAELGKPAIAM
FT                   TDFDEAIDRAMTGMERKSRVMNEQEKRTIAYHEAGHALVAQSRPHCDPVKKVSIIPRGI
FT                   AALGYTQQVPTEDRYVLRRSELLDRLDVLLGGRVAEEIAFGDVSTGAQNDLERATALAR
FT                   HMVMQYGMSDRLGLMTLDDAVSQGGVPAVWTPGDGHCSEHTAQLIDEEVRALLDDAHAR
FT                   VAATLGEHRDALERIASSLLQHESIDHDRLTALITPPDDTGDARRPTQADTETTTDASV
FT                   "
FT   sig_peptide     362008..362085
FT                   /locus_tag="BCAM0309"
FT                   /note="Signal peptide predicted for BCAM0309 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.983) with cleavage site
FT                   probability 0.594 between residues 26 and 27"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(362026..362085,362353..362421,362683..362751)
FT                   /locus_tag="BCAM0309"
FT                   /note="3 probable transmembrane helices predicted for
FT                   BCAM0309 by TMHMM2.0 at aa 7-26, 116-138 and 226-248"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    362101..362541
FT                   /locus_tag="BCAM0309"
FT                   /note="HMMPfam hit to PF06480, FtsH Extracellular, score
FT                   4.1e-25"
FT                   /inference="protein motif:HMMPfam:PF06480"
FT   misc_feature    362617..363180
FT                   /locus_tag="BCAM0309"
FT                   /note="HMMPfam hit to PF00004, ATPase family associated
FT                   with various c, score 1.9e-93"
FT                   /inference="protein motif:HMMPfam:PF00004"
FT   misc_feature    362617..363021
FT                   /locus_tag="BCAM0309"
FT                   /note="HMMPfam hit to PF07728, ATPase family associated
FT                   with various c, score 8.8e-05"
FT                   /inference="protein motif:HMMPfam:PF07728"
FT   misc_feature    362632..362655
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    362929..362985
FT                   /note="PS00674 AAA-protein family signature."
FT                   /inference="protein motif:Prosite:PS00674"
FT   misc_feature    363085..363120
FT                   /note="PS01034 Glycosyl hydrolases family 16 active sites."
FT                   /inference="protein motif:Prosite:PS01034"
FT   misc_feature    363196..363834
FT                   /locus_tag="BCAM0309"
FT                   /note="HMMPfam hit to PF01434, Peptidase family M41, score
FT                   5.4e-96"
FT                   /inference="protein motif:HMMPfam:PF01434"
FT   CDS_pept        complement(363968..365794)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0310"
FT                   /product="putative ribonucleotide reductase"
FT                   /note="Similar to N terminal 600 amino acids of
FT                   Chromobacterium violaceum nrde ribonucleotide reductase
FT                   system (ec 1.17.4.1). UniProt:Q7NY29 (950 aa) fasta scores:
FT                   E()=2.8e-98, 46.193% id in 591 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0310"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54169"
FT                   /db_xref="GOA:B4EIQ1"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR013344"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIQ1"
FT                   /protein_id="CAR54169.1"
FT                   /translation="MSHSSLPSPAMDEQPLCTTVFTERYAQPGETSRTALFHRVAHTLS
FT                   LAEPADLRAQVERAFFRNLQHGAIGAGRILANAGADTGGTMVNCFVHPLAIPPGARWPA
FT                   VDAALARALSDAWRTLLMGGGIGYDFSPVPPAGAYERCVSSERGACVAIDRFDAMCRAL
FT                   PFTGPRRGAQMGVLRCDHPDLAAFVASKRGRSRWPTFNLSVGVTDAFMEAVRQDLPWAL
FT                   VHHARPRSGACAPIRRPDGRYLYATIPARTLWHEIVGAARDSAEPGLLFLDTIRDTNPL
FT                   REHERIDATNPCGEQPLPPYGNCVLGPIDLSRFVHHPFGVGGKPRFDFPGLADAVRIQV
FT                   RMLDNVLDLTEWPLAAHEHEARRTRRIGVGITGLGDALTMLRLRYDGTEARAFARSIVL
FT                   TMREHAFAASAALAAERGVFPAYDPAAYLTGPAHRTLLPLKVHHAIARHGLRNSHLLSF
FT                   APAGSVSLAFCDNCSNGIEPALGWTQRRLVRTADGRVRPFRVENHAYRLFRDLHGDSVG
FT                   LPDYFVTAADIAPADQVAMLAALQPCVDAGISKTVTLPEQCSLAEVDALFFQAWRDGLK
FT                   GVTVFRPDPRLASVVTDDAAQARRKRPGCIGC"
FT   misc_feature    complement(364046..365539)
FT                   /locus_tag="BCAM0310"
FT                   /note="HMMPfam hit to PF02867, Ribonucleotide reductase,
FT                   barrel doma, score 5.3e-14"
FT                   /inference="protein motif:HMMPfam:PF02867"
FT   misc_feature    complement(365318..365368)
FT                   /note="PS00237 G-protein coupled receptors signature."
FT                   /inference="protein motif:Prosite:PS00237"
FT   CDS_pept        365974..366909
FT                   /transl_table=11
FT                   /locus_tag="BCAM0311"
FT                   /product="putative 6-phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0311"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54170"
FT                   /db_xref="GOA:B4EIQ2"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIQ2"
FT                   /protein_id="CAR54170.1"
FT                   /translation="MTGIVTVTLNPAVDVATSVEHIVDTHKLRCARPRRDPGGGGINVA
FT                   RTVHRLGGDCVALYLAGGPTGDVLTALLEAEHLPSERIRIAGETRENVCVTETATGREY
FT                   RFLMPGPLVTGAEWRACAARTDAMQPSPRYLVLSGSLPPGAPDDLYATLARTAKARGSR
FT                   VVVDAAGRALQAALKAGVHLVKPSIGELSALAGEPLDDTSACRKASELVARGQADIVAL
FT                   TLGARGAWVVTRDRTLRLPGRPAAVCSTVGAGDSFVGGMVWALACGVPFDDACRYALAA
FT                   SAASVERPGTALCTRDDVERIHAELVAQAS"
FT   misc_feature    365992..366867
FT                   /locus_tag="BCAM0311"
FT                   /note="HMMPfam hit to PF00294, pfkB family carbohydrate
FT                   kinase, score 6.8e-50"
FT                   /inference="protein motif:HMMPfam:PF00294"
FT   misc_feature    366085..366159
FT                   /note="PS00583 pfkB family of carbohydrate kinases
FT                   signature 1."
FT                   /inference="protein motif:Prosite:PS00583"
FT   misc_feature    366718..366759
FT                   /note="PS00584 pfkB family of carbohydrate kinases
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00584"
FT   misc_feature    366742..366774
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        367028..367816
FT                   /transl_table=11
FT                   /locus_tag="BCAM0312"
FT                   /product="putative polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0312"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54171"
FT                   /db_xref="GOA:B4EIQ3"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIQ3"
FT                   /protein_id="CAR54171.1"
FT                   /translation="MVYRLIACLLLLSCMRPVASADVATVVSPPERVLILVYHRFAAAR
FT                   LDSMTVRIDTFRNQLQAIDANGYRIVPLADVVRWHDGQRDAVPARAVAITVDDGHRSVY
FT                   EVLRPLLAAHPAPVTLFIYPSAISNASYAMTWDQLLALGRAGFDIESHTVWHPNFRVER
FT                   ARLAPDDYQRFVSFQLSRSRARLEAETGRPVRLLAWPFGVHDALTDQLAAREGYVAAFT
FT                   LDARPVRITDSAMALPRYLMTDACDTRCMNGLLRTVGGNP"
FT   sig_peptide     367028..367090
FT                   /locus_tag="BCAM0312"
FT                   /note="Signal peptide predicted for BCAM0312 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.792 between residues 21 and 22"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    367280..367687
FT                   /locus_tag="BCAM0312"
FT                   /note="HMMPfam hit to PF01522, Polysaccharide deacetylase,
FT                   score 1.8e-23"
FT                   /inference="protein motif:HMMPfam:PF01522"
FT   CDS_pept        367813..369069
FT                   /transl_table=11
FT                   /locus_tag="BCAM0313"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0313"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54172"
FT                   /db_xref="GOA:B4EIQ4"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025275"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIQ4"
FT                   /protein_id="CAR54172.1"
FT                   /translation="MIERLIVCLLVSLAGFAARAAPVTITVVDATNGRALAGAIGHAPG
FT                   VNRTADREGSFSLEIDAAGTRLSVRAPGYARIEVTLAPAAAAYTIRMTPVRPKAVYLSA
FT                   YGVADRTLRDAALSLQDQTAINALVIDVKGDSGVTPYRSKAREISGAASHVAGAIVHQP
FT                   DLPDLLRTFHARGLYLIARIVVFKDDPLARAHPEWAVRDAAGEIWQDREHQRWIDPTSR
FT                   AAWQHNYDVAEEAARMGFDEIQFDYLRFPDANGLRFAEPNTEANRVTAIAGFLTGARER
FT                   LQPYNLYTSADIFGYVCWNTDDTAIGQRLDALGPALDYVSPMLYPSGFTWGLPGCRKPT
FT                   EHPGEIVARSLAEAKRRTGLDGVRFRPWLQAFRDYAFDRRPFDADEVRAQVDAADAAGT
FT                   DGWMLWNPRNRYDPAMLPH"
FT   sig_peptide     367813..367872
FT                   /locus_tag="BCAM0313"
FT                   /note="Signal peptide predicted for BCAM0313 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.989 between residues 20 and 21"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(369124..369621)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0314"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to N-terminus of Acinetobacter sp. (strain
FT                   ADP1) hypothetical protein. UniProt:Q6FB16 (181 aa) fasta
FT                   scores: E()=5.6e-14, 41.818% id in 110 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0314"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54173"
FT                   /db_xref="InterPro:IPR007053"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIQ5"
FT                   /protein_id="CAR54173.1"
FT                   /translation="MSHPTAVHADDAIPDGEPPVGAHLVTRRHGYLHHGIYVGDGNVIH
FT                   YAGWSRHLSGGAVEVVTLDGFRAGFELAVIRHARAPYDGTEAARRAASRLGECRYRLLT
FT                   NNCEHFCLWCLFGVGRSDQVTSCLRNPVHGVAVVVMLVACVLVARWHPAAAGRECPLGY
FT                   PA"
FT   misc_feature    complement(369190..369222)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        370085..370561
FT                   /transl_table=11
FT                   /locus_tag="BCAM0315"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0315"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54174"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIQ6"
FT                   /protein_id="CAR54174.1"
FT                   /translation="MRTGTVKALLLAACLLNVGANALAETSTEPVVRNGVAYITGGIGQ
FT                   DEVAAFRDVAPRYNLRITFASNAGQYLADIDVTLSSGKSKLLDVHTSGPFLFARVPPGR
FT                   YTVSAHDRAVQEVRRVVVPARGAVDVRFYWHDPDRRGTMRLCMACPASQPQADR"
FT   sig_peptide     370085..370156
FT                   /locus_tag="BCAM0315"
FT                   /note="Signal peptide predicted for BCAM0315 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.900 between residues 24 and 25"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(370691..371164)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0316"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0316"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54175"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIQ7"
FT                   /protein_id="CAR54175.1"
FT                   /translation="MRSRIFPVLLAGLALLAGEVSTACANDLTRTVTTPTLVVHYGVVP
FT                   ASRAATPGGHAGDASNNVNLYLLTVALFDKSNGNRIEHARVAAVVQGPRSEASSFHSKP
FT                   TRMQLDPTPDGNAVTYGNVFDARWKGVYHIDLTITGDGLAHPEHVRLNYDQQF"
FT   misc_feature    complement(370796..370828)
FT                   /note="PS00178 Aminoacyl-transfer RNA synthetases class-I
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00178"
FT   CDS_pept        complement(371345..371962)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0317"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0317"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54176"
FT                   /db_xref="GOA:B4EIQ8"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIQ8"
FT                   /protein_id="CAR54176.1"
FT                   /translation="MLTLAVLFLLILLLNLIPAFAPPTWMAMSWVGFNLPDGNPWVFAV
FT                   VAAGAATTGRVILATFARSLVRSRWMRESDRANIEVATRWLRKHRTLTAGAFFFYALSP
FT                   LPSNYLFIAYGLSGLPLRIIAAAFFVGRATTYAIWAYLGRFASTRLDVESELEGTYLGG
FT                   YFVVTQLVLLGVVFALMKLDWRALVEQRRLTFRRGHPSRGAE"
FT   misc_feature    complement(join(371423..371491,371528..371596,
FT                   371624..371692,371777..371845,371882..371950))
FT                   /locus_tag="BCAM0317"
FT                   /note="5 probable transmembrane helices predicted for
FT                   BCAM0317 by TMHMM2.0 at aa 5-27, 40-62, 91-113, 123-145 and
FT                   158-180"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(371900..371962)
FT                   /locus_tag="BCAM0317"
FT                   /note="Signal peptide predicted for BCAM0317 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.982) with cleavage site
FT                   probability 0.496 between residues 21 and 22"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        372185..374476
FT                   /transl_table=11
FT                   /locus_tag="BCAM0318"
FT                   /product="putative cation-transporting ATPase"
FT                   /note="Similar to central regions of Synechocystis sp.
FT                   (strain PCC 6803) ziaa zinc-transporting atpase (ec
FT                   3.6.3.5) (zn(ii)-translocating p-type atpase).
FT                   UniProt:ATZN_SYNY3 (EMBL:SSSLRG) (721 aa) fasta scores:
FT                   E()=2.5e-39, 30.237% id in 549 aa, and to Chromobacterium
FT                   violaceum probable cation transport p-type atpase (ec
FT                   3.6.3.4). UniProt:Q7NUF1 (721 aa) fasta scores:
FT                   E()=2.5e-113, 51.573% id in 731 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0318"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54177"
FT                   /db_xref="GOA:B4EIQ9"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIQ9"
FT                   /protein_id="CAR54177.1"
FT                   /translation="MVMPRIPWSIDLALLVLAAVTLAAGGMCAAFGAPSLARFAWLLGT
FT                   VPVLLALTVSLAMAAAKRQAGIDVLAWLAIGLAIMLDETLTAAVIGLMLASGRMLERYA
FT                   QDRAQREMTALLGRAPRQATRFENGEWRSVAPATIVQGDRLLVRSGECAPVDGTLTGDA
FT                   ELDESMLTGESSIQRRRSGENACSGVVNAGAPFEMVARTTAADSTFAGIVRMVERARHE
FT                   RGPSVRLADRYAAFFVLASLLVAGTAWLLTGDVARALSVLVVATPCPLILAVPVAIVSG
FT                   LSRCSKRGILVKGGGVLERLAQATILFFDKTGTLTGGRARIVAIECGASVGRGDVLRFA
FT                   ASLAQASGHVVSDALTVAARERGIRLSPPSAVMETAGEGVTGRVDGRVVAIGKFGYVRA
FT                   GATVAPWCEAFLKRVGNAGGAAVFVGIDGAMVGAIQMADQVRLETPRALRLLKREGVER
FT                   LVMLTGDRLDIAQAVGELLGVTDVRAEQTPADKLAAVQAARAEGVTIMVGDGVNDAPAL
FT                   AAADVGVAMGARGAAASSEAADVVLLVDRLDRLVDAMRIARRSRRIALESVLIGMSLSV
FT                   VAMTIAAAGFLPPIAGAVIQEAVDVVVIVNALRVLLVRPPEARLAGVDVEQLRREHAAL
FT                   SPLLDRLRDLADRLPQLSGVTAASELVDAVDSLDQRLLPHERADDLEVYARLAPLLGGE
FT                   DPLAAMSGAHREIFRMVRSLREMVSDLPRDGTNPLQVQAIQRLLYGLEAIVRLHCAQEE
FT                   ELFHAVGADA"
FT   sig_peptide     372185..372280
FT                   /locus_tag="BCAM0318"
FT                   /note="Signal peptide predicted for BCAM0318 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.730 between residues 44 and 45"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(372212..372280,372299..372367,372395..372463,
FT                   372881..372937,372965..373033,373871..373939)
FT                   /locus_tag="BCAM0318"
FT                   /note="6 probable transmembrane helices predicted for
FT                   BCAM0318 by TMHMM2.0 at aa 22-44, 51-73, 83-105, 245-263,
FT                   273-295 and 575-597"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    372449..373084
FT                   /locus_tag="BCAM0318"
FT                   /note="HMMPfam hit to PF00122, E1-E2 ATPase, score 1e-39"
FT                   /inference="protein motif:HMMPfam:PF00122"
FT   misc_feature    373094..373774
FT                   /locus_tag="BCAM0318"
FT                   /note="HMMPfam hit to PF00702, haloacid dehalogenase-like
FT                   hydrolase, score 6.7e-27"
FT                   /inference="protein motif:HMMPfam:PF00702"
FT   misc_feature    373112..373132
FT                   /note="PS00154 E1-E2 ATPases phosphorylation site."
FT                   /inference="protein motif:Prosite:PS00154"
FT   misc_feature    374054..374242
FT                   /locus_tag="BCAM0318"
FT                   /note="HMMPfam hit to PF01814, Hemerythrin HHE cation
FT                   binding domain, score 0.0059"
FT                   /inference="protein motif:HMMPfam:PF01814"
FT   misc_feature    374270..374461
FT                   /locus_tag="BCAM0318"
FT                   /note="HMMPfam hit to PF01814, Hemerythrin HHE cation
FT                   binding domain, score 0.00046"
FT                   /inference="protein motif:HMMPfam:PF01814"
FT   CDS_pept        complement(374498..375448)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0319"
FT                   /product="putative universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0319"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54178"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIR0"
FT                   /protein_id="CAR54178.1"
FT                   /translation="MSTCPSPAQAVPAPRRVLIAVDGSSASAHALAYAKAFLPTNTEVH
FT                   IVSVAENPRTLVPLGSKTMAFLESARDELLGDASDALSRAQSVMKRDDLAVDTETFDLA
FT                   TRGGDVVHALADSARAWRADLLIVGARQHHGLLRWVEGTISGPLGKFVGCPLLIVPEGF
FT                   ASVAEHLPRRMLFAVDGSTIALNALGTGLKWSRPDTEFRTICVLDRPVSLGDFVPVETL
FT                   DNALIGEGNRALKEATALLGDRAVQVQSQLIQTDWAGADVAHLIVRHAVEWNADMIVMG
FT                   THGRHGVTGWLVGSVAARVARITKTPVLLVNPPRA"
FT   misc_feature    complement(374513..374938)
FT                   /locus_tag="BCAM0319"
FT                   /note="HMMPfam hit to PF00582, Universal stress protein
FT                   family, score 1.9e-13"
FT                   /inference="protein motif:HMMPfam:PF00582"
FT   misc_feature    complement(374969..375409)
FT                   /locus_tag="BCAM0319"
FT                   /note="HMMPfam hit to PF00582, Universal stress protein
FT                   family, score 2.5e-16"
FT                   /inference="protein motif:HMMPfam:PF00582"
FT   CDS_pept        complement(375658..376224)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0320"
FT                   /product="putative cytochrome b561"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0320"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54179"
FT                   /db_xref="GOA:B4EIR1"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIR1"
FT                   /protein_id="CAR54179.1"
FT                   /translation="MKTVTRYPLSISVLHWLLAAALIGNLIVGLLLDDNEDLVGLHKSI
FT                   GVAILVLVAIRVANRLRMRRRLPPSVNPVGTLNRLAERCVHALLYVLMLAIPVLGWMKT
FT                   NAAGHAASCFGLFSLPTLVPESRELSHWLGELHALTAYGLAALVGLHVLGAVAHRLFKS
FT                   ENVLPRILPLPTRVARPRIPPGDRN"
FT   misc_feature    complement(375706..376188)
FT                   /locus_tag="BCAM0320"
FT                   /note="HMMPfam hit to PF01292, Cytochrome b561 family,
FT                   score 5.9e-28"
FT                   /inference="protein motif:HMMPfam:PF01292"
FT   misc_feature    complement(join(375742..375810,375919..375972,
FT                   376054..376113,376126..376185))
FT                   /locus_tag="BCAM0320"
FT                   /note="4 probable transmembrane helices predicted for
FT                   BCAM0320 by TMHMM2.0 at aa 2-21, 26-45, 73-90 and 127-149"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(376268..376642)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0321"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to C-terminus of Vibrio cholerae
FT                   hypothetical protein vca0893. UniProt:Q9KL55 (169 aa) fasta
FT                   scores: E()=0.00016, 32.381% id in 105 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0321"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54180"
FT                   /db_xref="GOA:B4EIR2"
FT                   /db_xref="InterPro:IPR009155"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIR2"
FT                   /protein_id="CAR54180.1"
FT                   /translation="MNRLPFRLRFCVTLGVLLSVAAAPARAGEIKTLMTDMKHALQGAL
FT                   GSRTIPEMKSYATRLESDVQRASRQRYRNDQPTYDEGMRVLHDELTAVDRAIEANDLPG
FT                   AKQALRRINGSKKHYHDLLG"
FT   CDS_pept        376806..377468
FT                   /transl_table=11
FT                   /locus_tag="BCAM0322"
FT                   /product="two-component regulatory system, response
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0322"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54181"
FT                   /db_xref="GOA:B4EIR3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIR3"
FT                   /protein_id="CAR54181.1"
FT                   /translation="MRVLLVEDDKLVGSGVEDGLIEAGMTVDWAHDGRHAQLALETTPY
FT                   DLVVLDLGLPRMSGTDLLGWIRKRRDHTPVLVMTARDTVADRVSGLSAGADDYLGKPFD
FT                   LAELIARCRALVRRSQGRGTDTIEYGELTVDPALMTVVRGAERIALTSRECALLVELLA
FT                   NQGRPLSRAQLQDSLYGWNEEIESNAIEVHVSNLRKKLGAELIRTIRGVGYVVEKAS"
FT   misc_feature    376806..377144
FT                   /locus_tag="BCAM0322"
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 1.5e-33"
FT                   /inference="protein motif:HMMPfam:PF00072"
FT   misc_feature    377238..377453
FT                   /locus_tag="BCAM0322"
FT                   /note="HMMPfam hit to PF00486, Transcriptional regulatory
FT                   protein, C te, score 1e-19"
FT                   /inference="protein motif:HMMPfam:PF00486"
FT   CDS_pept        377465..378817
FT                   /transl_table=11
FT                   /locus_tag="BCAM0323"
FT                   /product="two-component regulatory system, sensor kinase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0323"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54182"
FT                   /db_xref="GOA:B4EIR4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIR4"
FT                   /protein_id="CAR54182.1"
FT                   /translation="MMRSIRQRLALLVLSGVVAVWAYSLVSSYRQAIHEAEEWDDTRVE
FT                   QIARAFVALDAADLPVFADIALGSAEDRDGDNDASPRMLYQVSDTGGRILAASPGLESL
FT                   DLPVFPAAASSPSRFDNPKWHAYVLTDATRGRSVRIFEQRTHRSDLSAEVARRIARPLA
FT                   FALPVLAVLIWLAIGHSLTPLRTLSEAIDARSPDSLDAIGTKDIPDEVRPLVAALNALL
FT                   LRLRGSLDRERAFTSDAAHELKTPLAALKVQAQVALTARDPARQRRAMQRVVEGVDRST
FT                   HLADQLLALARLDEAVPMPGEDVDLARTVQTCIDDHRANAERKGVSLVSCVDGPVVAHA
FT                   PPTLMRVLLDNLVDNAIKYGREQGCIEIRSSQDGGVISIRVQDDGPGVPEEDLSRLQDR
FT                   FFRGADHDESGSGLGLSIVARIVVKLGGNLTYIDGLNGGGFGVHVTLPLPA"
FT   sig_peptide     377465..377530
FT                   /locus_tag="BCAM0323"
FT                   /note="Signal peptide predicted for BCAM0323 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.892 between residues 22 and 23"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    377939..378145
FT                   /locus_tag="BCAM0323"
FT                   /note="HMMPfam hit to PF00672, HAMP domain, score 2.5e-07"
FT                   /inference="protein motif:HMMPfam:PF00672"
FT   misc_feature    377948..378016
FT                   /locus_tag="BCAM0323"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAM0323 by TMHMM2.0 at aa 162-184"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    378155..378352
FT                   /locus_tag="BCAM0323"
FT                   /note="HMMPfam hit to PF00512, His Kinase A
FT                   (phosphoacceptor) domain, score 4.5e-13"
FT                   /inference="protein motif:HMMPfam:PF00512"
FT   misc_feature    378482..378811
FT                   /locus_tag="BCAM0323"
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HSP90, score 1.7e-33"
FT                   /inference="protein motif:HMMPfam:PF02518"
FT   CDS_pept        379651..380298
FT                   /transl_table=11
FT                   /locus_tag="BCAM0324"
FT                   /product="putative type IV secretion system protein VirB1"
FT                   /note="Similar to Brucella abortus VirB1 UniProt:Q9KIT0
FT                   (238 aa) fasta scores: E()=3e-27, 44.749% id in 219 aa;
FT                   truncated by C terminal 23 amino acids; type IV secretion
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0324"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54183"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIR5"
FT                   /protein_id="CAR54183.1"
FT                   /translation="MTTQDFVALAQQCAPAVAPQTLAAIVRIESGFNPYAIGVVHGRLA
FT                   RQPRHENEAIATVEALQAAGWNYSAGLAQINRANWSRYGLTARTVFDVCRNLSAGAAIL
FT                   RACFLRARVIHIHPQEALRAALSCYASGNFVTGFRVGYVRRITEAAASGDTFVPALTSV
FT                   AKPIPVIPDRVTGSRAESRGRSTPVSPPPSNPNDDTAQSQNNGGVAGSAVIF"
FT   misc_feature    379666..380106
FT                   /locus_tag="BCAM0324"
FT                   /note="HMMPfam hit to PF01464, Transglycosylase SLT domain,
FT                   score 2.3e-16"
FT                   /inference="protein motif:HMMPfam:PF01464"
FT   CDS_pept        380323..380676
FT                   /transl_table=11
FT                   /locus_tag="BCAM0325"
FT                   /product="putative type IV secretion system protein VirB2"
FT                   /note="Similar to Brucella melitensis attachment mediating
FT                   protein VirB2 homolog. UniProt:Q9RPY3 (105 aa) fasta
FT                   scores: E()=5.1e-06, 43.478% id in 69 aa; homology does not
FT                   extend to the N terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0325"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54184"
FT                   /db_xref="GOA:B4EIR6"
FT                   /db_xref="InterPro:IPR007039"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIR6"
FT                   /protein_id="CAR54184.1"
FT                   /translation="MECIMKSVFLINISVVKLRKTYVAWISLNWRRIAVLSVLVMATPT
FT                   ASAQLSQVNTLLITIQNTLLGVGGVVCSISIIWAGFKMMFQHARFGDIAHVFIGGLFVG
FT                   CATVIAGMLIPTA"
FT   sig_peptide     380323..380466
FT                   /locus_tag="BCAM0325"
FT                   /note="Signal peptide predicted for BCAM0325 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.922 between residues 48 and 49"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(380383..380451,380494..380562,380599..380667)
FT                   /locus_tag="BCAM0325"
FT                   /note="3 probable transmembrane helices predicted for
FT                   BCAM0325 by TMHMM2.0 at aa 21-43, 58-80 and 93-115"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    380605..380637
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        380678..381016
FT                   /transl_table=11
FT                   /locus_tag="BCAM0326"
FT                   /product="putative type IV secretion system protein VirB3"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0326"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54185"
FT                   /db_xref="GOA:B4EIR7"
FT                   /db_xref="InterPro:IPR007792"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIR7"
FT                   /protein_id="CAR54185.1"
FT                   /translation="MNTELIVDTLSDPVFKGCTRPAMLWGVPLVPLLTVGGGMLIPAIW
FT                   VLMASAALGVAIALLIVPVFATMRMITRQDDQRLAQRMLRAKMRLHQRNRRFWGAHAYA
FT                   PIRFKARG"
FT   misc_feature    380714..380992
FT                   /locus_tag="BCAM0326"
FT                   /note="HMMPfam hit to PF05101, Type IV secretory pathway,
FT                   VirB3-like protei, score 5.6e-19"
FT                   /inference="protein motif:HMMPfam:PF05101"
FT   misc_feature    join(380738..380797,380807..380875)
FT                   /locus_tag="BCAM0326"
FT                   /note="2 probable transmembrane helices predicted for
FT                   BCAM0326 by TMHMM2.0 at aa 21-40 and 44-66"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        381018..383498
FT                   /transl_table=11
FT                   /locus_tag="BCAM0327"
FT                   /product="putative type IV secretion system protein VirB4"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0327"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54186"
FT                   /db_xref="GOA:B4EIR8"
FT                   /db_xref="InterPro:IPR004346"
FT                   /db_xref="InterPro:IPR018145"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIR8"
FT                   /protein_id="CAR54186.1"
FT                   /translation="MSAPSAHATLIPREVVLADFIPFSSHVTDRVIRTREGDYIQIWKV
FT                   PGIAFETADPADILARHVTFNQLVRNLPGGHVALWTHRLRRRTADRFETTYLNRFCQDL
FT                   AERYYASFAGYTMMTNELYVSAVYRPHRTRLGRLFSRAARRTPDDIQRDQQDALRALAD
FT                   IAAQIETGLKPWSPCALSVYERGDPLTKRPCRYSAALEMLGYLVNGTWELVPVGYGRIC
FT                   DTLPTSRLFFHREKLEIRTPTRTRYAALLDLKDYPEQTEPGMLNGLLYGDFEYIETQSF
FT                   TVLDRPSAKEALERQRNQLIAGDDVAVSQIEAMDQAANDLVNGDFVLGEYHYTLAVLGD
FT                   TLDEVVRHVAQARTKLADAGFQSALIDLVADAAWFAQCPGNWRYRPREAKLTSRNFCAM
FT                   ASLHNFATGKREGNPWGEAITIVKTPSGQPLYLNFHATPEKVDSNDEKALANTQIIGRA
FT                   GAGKTVLELFLLAMAMKYGVMGVLFDKDRGAEIGIRAMGGQYTVFHRGEPTGMNPFQLE
FT                   VDEATHSFWMRLVCKLVDNGVPLSAKDELDISRAIREVARMDRSLRRLSMVRQLLPNVG
FT                   DNSLHARLAKWCAGGRLGWVLDNPVDRIDLDAHQLFGFDDTELLDDPEVCAPLTMVLLH
FT                   LTERLIDGRRFIYVMTEFWKRLRDPVFSEFANDKQKTIRKQNGLGIFDTQSPADVLSSP
FT                   ISRALVEQTATFFFLPNPSADHDDYVHGFKLTEAEFNIVRRMGEHSRLFLVKQGHRSAV
FT                   GRLDLSGLGDVLDVLSGTSDNVALLNTIRAKVGDDPDVWLPRFHDALTARRRQTSAFQT
FT                   ALSSTATHVQGGVL"
FT   misc_feature    381576..382178
FT                   /locus_tag="BCAM0327"
FT                   /note="HMMPfam hit to PF03135, CagE, TrbE, VirB family,
FT                   component of, score 5.9e-55"
FT                   /inference="protein motif:HMMPfam:PF03135"
FT   misc_feature    382383..382406
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        383495..384646
FT                   /transl_table=11
FT                   /locus_tag="BCAM0328"
FT                   /product="putative type IV secretion system protein VirB6"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0328"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54187"
FT                   /db_xref="GOA:B4EIR9"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIR9"
FT                   /protein_id="CAR54187.1"
FT                   /translation="MNGLFSAVGGTLENGMHTYVSDASSALSSALVPVATTGVLIWVLA
FT                   YGMAVIRGEAHEPVPAFAWRGMKVVITLAFALSAGLYQSQVVTAVSETTTGVAQAIQAA
FT                   AVRTGAGNVGCGSVKQASEASEHAVGIYRTLDCYDRQLNLVVDAYFDKATHEGLSMSGI
FT                   VAGIGDLACGLVAAFGGAIFLMVLGVEVMMARMLLDLVLALGPMFIACGAFSPTVRFFE
FT                   AWTAKLVNYALLQVLVAAFLGLALAAFSANLAPFQVTIADPDTSADALAAAARQALQAS
FT                   APWAAAFGMFVTSVLLATIGWQLPAVASGLAGGATVSGFGAFVAGYASRRAAGAMAFAL
FT                   RSANRSAYSGGRISRPGALVSTVSPHPPAYQRAAREQLDRVPD"
FT   misc_feature    join(383570..383638,383675..383743,383993..384061,
FT                   384080..384148,384176..384244,384332..384400,
FT                   384410..384478)
FT                   /locus_tag="BCAM0328"
FT                   /note="7 probable transmembrane helices predicted for
FT                   BCAM0328 by TMHMM2.0 at aa 26-48, 61-83, 167-189, 196-218,
FT                   228-250, 280-302 and 306-328"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    383591..384454
FT                   /locus_tag="BCAM0328"
FT                   /note="HMMPfam hit to PF04610, TrbL/VirB6 plasmid conjugal
FT                   transfer protein, score 2e-21"
FT                   /inference="protein motif:HMMPfam:PF04610"
FT   misc_feature    384095..384127
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        384662..385372
FT                   /transl_table=11
FT                   /locus_tag="BCAM0329"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0329"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54188"
FT                   /db_xref="InterPro:IPR014158"
FT                   /db_xref="InterPro:IPR023220"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIS0"
FT                   /protein_id="CAR54188.1"
FT                   /translation="MKRYLFTHIVLLSAVVAGAASFIEPVNAEIYSVYDEKNVAQAIAM
FT                   VGQLKQQVQQEMALYRSFSGARGFGALLDRPGVVNALPDNWQSVYAAIREGGYAGLTGP
FT                   AQALRAQSKLYDCEDQQGIDQRICQRALNKPFQDKALGLQAYQTELAELDRIELLMRHI
FT                   DTTRDPKGIAELQARIQSESVAVGNEMTKLQMFKMLAETEDRLIAEQQTELLLKRAGNT
FT                   RRLQDQMAPVTFGR"
FT   misc_feature    384662..385366
FT                   /locus_tag="BCAM0329"
FT                   /note="HMMPfam hit to PF07996, Type IV secretion system
FT                   proteins, score 2.1e-50"
FT                   /inference="protein motif:HMMPfam:PF07996"
FT   sig_peptide     384662..384745
FT                   /locus_tag="BCAM0329"
FT                   /note="Signal peptide predicted for BCAM0329 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.820 between residues 28 and 29"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        385384..385557
FT                   /transl_table=11
FT                   /locus_tag="BCAM0330"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0330"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54189"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIS1"
FT                   /protein_id="CAR54189.1"
FT                   /translation="MTRRWVMCMLIGLSMSMSGCNGVPSSLVLPDGAHRVPVNQQLPVP
FT                   PGASLSLDGACP"
FT   sig_peptide     385384..385449
FT                   /locus_tag="BCAM0330"
FT                   /note="Signal peptide predicted for BCAM0330 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.883 between residues 22 and 23"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    385411..385443
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        385554..386258
FT                   /transl_table=11
FT                   /locus_tag="BCAM0331"
FT                   /product="putative type IV secretion system protein VirB8"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0331"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54190"
FT                   /db_xref="GOA:B4EIS2"
FT                   /db_xref="InterPro:IPR007430"
FT                   /db_xref="InterPro:IPR026264"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIS2"
FT                   /protein_id="CAR54190.1"
FT                   /translation="MNDQSDYRRALDFEASLTALQACSERRAWQVAFAAVIVAIGSAAA
FT                   LAVMTPFYRVVPLPIEVNKLTGEAQLIEVLDAKHVPLREIEDKHWVEVYVRARERYDWG
FT                   LLQMDYDRVLEMSDESVARAYRQIYSGPNALDQQLGASVQYRTRIVSTTLVPDEPGHAV
FT                   VHLERTVRKNGIDTGEPAKRFVITLAFTYRPTVLVRERSAIENPFGFKVTAYSRDAEDT
FT                   PPPPQPSAGAGR"
FT   misc_feature    385644..385712
FT                   /locus_tag="BCAM0331"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAM0331 by TMHMM2.0 at aa 31-53"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    385689..386207
FT                   /locus_tag="BCAM0331"
FT                   /note="HMMPfam hit to PF04335, VirB8 protein, score
FT                   7.8e-30"
FT                   /inference="protein motif:HMMPfam:PF04335"
FT   CDS_pept        386255..387079
FT                   /transl_table=11
FT                   /locus_tag="BCAM0332"
FT                   /product="putative type IV secretion system protein VirB9"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0332"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54191"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="InterPro:IPR033645"
FT                   /db_xref="InterPro:IPR038161"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIS3"
FT                   /protein_id="CAR54191.1"
FT                   /translation="MNTLATMAILLTCFAAQAVDAHITPDWTRDARVRKVRYVPDEVVR
FT                   IIAQRGFATHVELDPTEHILVVAPGDRDGWYVVANRGDHDVYLKPKLAAHDTNLIVRTD
FT                   RRSYSFDLLVLPLKARFGNAHEMYRVSFVYPDTAASDASIAARLACLQKRLSQPSVVRN
FT                   AAYSMQVMPHAEDIAPSAVWDDGRFTYIRIPNNRRIPAIFRVEDDDTERVVDKHMDRDV
FT                   VVVHELARRLVLRLGDEAVGLWNDAFDIDGVAPQHGVTVDGVRRTLRSREHD"
FT   sig_peptide     386255..386308
FT                   /locus_tag="BCAM0332"
FT                   /note="Signal peptide predicted for BCAM0332 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.937 between residues 18 and 19"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    386342..386995
FT                   /locus_tag="BCAM0332"
FT                   /note="HMMPfam hit to PF03524, Conjugal transfer protein,
FT                   score 2e-57"
FT                   /inference="protein motif:HMMPfam:PF03524"
FT   CDS_pept        387072..388295
FT                   /transl_table=11
FT                   /locus_tag="BCAM0333"
FT                   /product="putative type IV secretion system protein VirB10"
FT                   /note="Similar to Rhizobium meliloti (Sinorhizobium
FT                   meliloti) virb10 transmembrane type IV secretion protein.
FT                   UniProt:Q92Z02 (390 aa) fasta scores: E()=8.6e-28, 37.709%
FT                   id in 358 aa; homology does not extend to the N terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0333"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54192"
FT                   /db_xref="GOA:B4EIS4"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="InterPro:IPR042217"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIS4"
FT                   /protein_id="CAR54192.1"
FT                   /translation="MTEDTSPNGAATDDEIRRTSPADMDTGMGSESSAMLDRGMPSLDG
FT                   FGRRSFINWLVPLAIIVLALIGAVWTVHGVLAHRDEAARARRSALHARGAHEKVFDEVP
FT                   ALAESASAAAMPTPTPAPAAVQPAPSSDRAAPLRSYYDAPLLAVGASNGQMAGASESES
FT                   ASPSILPVQADQQPSNATAGMAEERSKSFSHPQSQALAPTRVPKVMAAFIGNRSLLLAQ
FT                   GTKIDCAGDTAFDSTQAGISTCTVARNVYSDDGRVVLIERGSQINCEYRANLSPGQRRV
FT                   FVLSARIATPHGVTVQIDSPVADALGRMGVDGSIENHWGARVGAAMMLGLSHDAIGYLA
FT                   TRGGNGNGTIVYQNTQAQGNDMATRVLDQTINIAPTLRQHQGTEFTIVLARDLDFSSVY
FT                   TLEPEGLR"
FT   misc_feature    387219..387287
FT                   /locus_tag="BCAM0333"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAM0333 by TMHMM2.0 at aa 50-72"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    387729..388271
FT                   /locus_tag="BCAM0333"
FT                   /note="HMMPfam hit to PF03743, Bacterial conjugation
FT                   TrbI-like protein, score 2.9e-65"
FT                   /inference="protein motif:HMMPfam:PF03743"
FT   misc_feature    387951..387971
FT                   /note="PS00307 Legume lectins beta-chain signature."
FT                   /inference="protein motif:Prosite:PS00307"
FT   CDS_pept        388346..389443
FT                   /transl_table=11
FT                   /locus_tag="BCAM0334"
FT                   /product="putative type IV secretion system protein VirB11"
FT                   /note="homology does not extend to far C-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0334"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54193"
FT                   /db_xref="GOA:B4EIS5"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR014155"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIS5"
FT                   /protein_id="CAR54193.1"
FT                   /translation="MPVLPDDASVTELMRSFAPFLADEAVTELVINRPQRILTETHRGW
FT                   QAHDLPELDFERLMAFAVAIATLTNQGVSTEHPLLSALLPDNARLQLVVPPVVPSRTVS
FT                   VTIRRPSADEKTLECHRADGMFEDTVWRHVSGLGKTGQALRAVDRMLVEQLEARDFAAF
FT                   FEGAVRAHRNIVIVGSTGSGKTSFMRSLCRYLGATERIVTIEDVRELFIRHVENCVHLL
FT                   YSKGSQGRAHVTPADLIACAMRMRPDRVLLAELRGAEAYDFLKLLTTGHAGSMTSFHAS
FT                   SAGIAIERFALMAKEHPEAAAWNIASLKRVLRLTIDVIAHMEAQPVLDSHGVQVGKRWA
FT                   MTEVWFDPREKAAIEFDPTERYCDG"
FT   misc_feature    388358..389323
FT                   /locus_tag="BCAM0334"
FT                   /note="HMMPfam hit to PF00437, Type II/IV secretion system
FT                   protein, score 1.4e-62"
FT                   /inference="protein motif:HMMPfam:PF00437"
FT   misc_feature    388877..388900
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    389195..389224
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00339"
FT   CDS_pept        join(389466..389807,389807..391519)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BCAM0335"
FT                   /product="putative conjugal transfer protein (pseudogene)"
FT                   /note="Similar to Xanthomonas axonopodis (pv. citri) VirD4
FT                   protein UniProt:Q8PJB2 (557 aa) fasta scores: E()=1.6e-91,
FT                   45.611% id in 581 aa; homology does not extend to C
FT                   terminus; frameshift after codon 114"
FT                   /note="Possibly not pseudogene, but begins at codon 115.
FT                   However, this would seem to be missing full N-terminus, so
FT                   more likely to be a pseudogene"
FT                   /db_xref="PSEUDO:CAR54194.1"
FT   misc_feature    join(389766..389807,389807..391192)
FT                   /locus_tag="BCAM0335"
FT                   /note="HMMPfam hit to PF02534, TraG/TraD family, score
FT                   1.6e-110"
FT                   /inference="protein motif:HMMPfam:PF02534"
FT   CDS_pept        391516..393363
FT                   /transl_table=11
FT                   /locus_tag="BCAM0337"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0337"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54195"
FT                   /db_xref="GOA:B4EIS7"
FT                   /db_xref="InterPro:IPR014819"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIS7"
FT                   /protein_id="CAR54195.1"
FT                   /translation="MSVAYISEADRVRAALAAIPAGDYSTWVDMAFAVKHGLGEAGFDL
FT                   WDAWSQTAPNYDARSARATWRSASESGAITLASLFWLAREHGFDLAGSRAFGDRAARSA
FT                   SAHAPIVGADASLERKRRARRAAVARQALSIWNWARPVAPDHPYLARKQIAPLPTLREL
FT                   EAEELHVLLGYVPKSNDTALLGRVLIVPVRIGHQISTLELIDCEGRKSSLAGGAKAGGW
FT                   WSVTPEQHRRDACLPVLIAEGVATAVSAWQATGWYTLAALSSGNLSKVATVWRAQHPKD
FT                   ALVILADLGAGFTHAEHAARNAHARLVVPRFASGAHIANQLPTDFNDMAVLDGKEAVGE
FT                   LLRRAVLETPAPTSTDAKASRTQTEGMSFYLTGDADMGSRKTDKGTGADDVRRHAEADR
FT                   SDGDCASTQPSGTPEEGKQAFTHEPAASSATETTDDGQHSNQGPRHATGELIYGLDAVP
FT                   TEVKVAAERRFGAVLRMSTPRENGGPYRGEVLNTEHFLVQAVAPRSVVFHAKGRMTFVS
FT                   DRLRWMDEHHRLDGADVQIVYEGERAKLYPWDRARDQLERAVASLKKSAREMGLDGMDA
FT                   KLDALHAASWARVKAARADALAQARSRVDGRGDIDDPQR"
FT   CDS_pept        393441..394451
FT                   /transl_table=11
FT                   /locus_tag="BCAM0338"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0338"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54196"
FT                   /db_xref="InterPro:IPR040677"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIS8"
FT                   /protein_id="CAR54196.1"
FT                   /translation="MDDTQSPALFAPSADFAVNAIEPEWTADVGIARRRPSDHFPAQQF
FT                   GYLAMLARRRSEFNAARALLREQAGGSRFEAGRDDAGTDGVSDTGAINSVPKFTEIADA
FT                   PERVRRSYLRAGSQYFLKEAPYPLAFEDRGRYLVTMQTRTDIVASMMDMVQAKAWTRIR
FT                   VSGHDAFCREVWLQAVSIGIEVSGYTPKPADLARLSELNAPTEHTRDRDSERPVLQPQV
FT                   GTTATPAGARDESPDRRMGAPMRHSRSLDDEIQLAVIVAAMREQGFSDRSVDRVKRRAV
FT                   RMLDALHAEGVELPRPRVFDPTAPSARAEKDEPQQSSAPSREINHAPAMQLPGQR"
FT   CDS_pept        394458..394976
FT                   /transl_table=11
FT                   /locus_tag="BCAM0339"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0339"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54197"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIS9"
FT                   /protein_id="CAR54197.1"
FT                   /translation="MGSRNRARIAVELGALKPLWQARCAQNGVSAGEGIRRLVAEALDI
FT                   AHDPPDTAAILSAPSEPFVRIGVGLMPAELQCIKGLAHVQGFTANRWIAALIRAHLTGE
FT                   PQLGNREMMLLAESNRQLAAIRTRLGELARDTGEGHHVPDWEHARAMILTHLRFVAQLL
FT                   QTNLDRWSR"
FT   CDS_pept        394978..396033
FT                   /transl_table=11
FT                   /locus_tag="BCAM0340"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bordetella bronchiseptica (Alcaligenes
FT                   bronchisepticus) vird2 plasmid-related protein.
FT                   UniProt:Q7WQ38 (331 aa) fasta scores: E()=1.1e-41, 43.607%
FT                   id in 305 aa; homology does not extend to far C terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0340"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54198"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIT0"
FT                   /protein_id="CAR54198.1"
FT                   /translation="MPFPRQYVDALLVNWGDRLFHDPLRHVRAPHLPGVALPRDARRLR
FT                   ERLALTLRRAPEVMVKITNKASGAQGMGAVRRHLQYISRDGHVELEDQDARVLIGDAAL
FT                   QDLFDEWRWGGWGMPEESRRRETFNLMLSMPAGTDRAAVREASRAFAREIFGDGRLYVF
FT                   AQHDDQPHPHVHLCVRVRGPDGRCLNPRKRDLRTWREVFARQLREHGVDANATPRLARG
FT                   ETQRLPTQAVVRMQSRGVAPRFYRSVLDERAQMALWDAHIETLAVWRGVAQALAHSGIP
FT                   EDRTMAMAIVDFVQHMPARQLEPGATRLDPATTRSYRDRPVEHRYIAHFAGRQRSVDGR
FT                   PTEPDPPFDRD"
FT   CDS_pept        complement(396236..396835)
FT                   /transl_table=11
FT                   /gene="azoR"
FT                   /locus_tag="BCAM0341"
FT                   /product="FMN-dependent NADH-azoreductase"
FT                   /EC_number="3.1.4.14"
FT                   /EC_number="1.7.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0341"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54199"
FT                   /db_xref="GOA:B4EIT1"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIT1"
FT                   /protein_id="CAR54199.1"
FT                   /translation="MARILVLKSSINGSQSHTGTLIDTFLAQRNANGHADDVIVRDLVA
FT                   DALPVLDSELFHALRGAEHPSERARQAIALSDALIAELKGSDLLLIGAPMYNHNVPTQL
FT                   KNWFDLVARARVTFRYTDTYPMGLVEGVRAIVFSTRGGVHVGQATDAVTPYLRAVLGLM
FT                   GIADVEFVYAEGLDMKPHGFNAGLEHAHKQMDALHA"
FT   misc_feature    complement(396239..396832)
FT                   /gene="azoR"
FT                   /locus_tag="BCAM0341"
FT                   /note="HMMPfam hit to PF02525, Flavodoxin-like fold, score
FT                   2.2e-31"
FT                   /inference="protein motif:HMMPfam:PF02525"
FT   CDS_pept        396948..397865
FT                   /transl_table=11
FT                   /locus_tag="BCAM0342"
FT                   /product="LysR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0342"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54200"
FT                   /db_xref="GOA:B4EIT2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIT2"
FT                   /protein_id="CAR54200.1"
FT                   /translation="MRNNLKGIDVFVAAVEASSFAQAAEKLHITRSAVGKSIARLEERL
FT                   GVVLFHRTTRSQSLTDEGSLFYEHCLRAMDEIQAGEALLETGKWQMKGRLRVSMPTLFG
FT                   HLCVAPILIGVAKAHPDLDLELSFSDRSVDLAEERFDLAVRIGTLPNSSGLVARALAEH
FT                   RMAFCASPAYLSRYGEPQTWRELEQHKALAYTRFGQVHRWPVLVDGERVELQPAVRLLS
FT                   DDLRALMDAALADLGVAWLPYWLVRDALRGGALRELLPAQPGVVYPIHAVWPATPHLPL
FT                   KVRAAVDALREHLPARLAAVEARM"
FT   sig_peptide     396948..397016
FT                   /locus_tag="BCAM0342"
FT                   /note="Signal peptide predicted for BCAM0342 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.937) with cleavage site
FT                   probability 0.914 between residues 23 and 24"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    396960..397139
FT                   /locus_tag="BCAM0342"
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix, score 3.9e-17"
FT                   /inference="protein motif:HMMPfam:PF00126"
FT   misc_feature    396999..397064
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1497.000, SD 4.29 at aa 18-39, sequence
FT                   SSFAQAAEKLHITRSAVGKSIA"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    397002..397094
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00044"
FT   misc_feature    397209..397832
FT                   /locus_tag="BCAM0342"
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 2.7e-45"
FT                   /inference="protein motif:HMMPfam:PF03466"
FT   CDS_pept        complement(397905..398714)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0343"
FT                   /product="putative redoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0343"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54201"
FT                   /db_xref="GOA:B4EIT3"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIT3"
FT                   /protein_id="CAR54201.1"
FT                   /translation="MLSIGPFSIRVVAVAVAALLAWLVARVIQRRPPDGHHKSASSLIL
FT                   DVLLLGLIAARVGYVAQWWPDYAASPRAIVALGDGGFDARIGIAAALVFVGWRLRRLPA
FT                   LRQPVLAGIVAGLGAWGIAQGTLATLQRGAPPLAAMPLQALDSTPVLPAGFVGKPVVVN
FT                   LWATWCAPCRREMPILEQAQRDHPGITVLMLNQGENAQAVRAFLEQQSLRFDHVLLDPS
FT                   LHAMHTYGSRGLPTTLFFNAKGELVESHMGELTAARLKDTVTQCFRQ"
FT   misc_feature    complement(397917..398324)
FT                   /locus_tag="BCAM0343"
FT                   /note="HMMPfam hit to PF08534, Redoxin, score 7.8e-10"
FT                   /inference="protein motif:HMMPfam:PF08534"
FT   misc_feature    complement(398178..398234)
FT                   /note="PS00194 Thioredoxin family active site."
FT                   /inference="protein motif:Prosite:PS00194"
FT   misc_feature    complement(join(398325..398393,398430..398498,
FT                   398526..398594,398631..398699))
FT                   /locus_tag="BCAM0343"
FT                   /note="4 probable transmembrane helices predicted for
FT                   BCAM0343 by TMHMM2.0 at aa 6-28, 41-63, 73-95 and 108-130"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(398916..399059)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0344"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0344"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54202"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIT4"
FT                   /protein_id="CAR54202.1"
FT                   /translation="MHDAEKAAARERSGRQGEIPMRDTGGHHTKPACVLLMNDMPLTIR
FT                   PV"
FT   CDS_pept        complement(399253..400257)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0345"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0345"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54203"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIT5"
FT                   /protein_id="CAR54203.1"
FT                   /translation="MPSIYAVPADAPPSPVAAETRMVHDVATLRPSDYRSADGASWVIS
FT                   VITPAADSGARVTGSTYFDTAKGQTVPVPDARRRYANRGTWQVVASSSPAVPATGRYDW
FT                   LTLAWLPINRRPLPQTAEHLYSPFIRGGTIVYRWNPSAEGGEQFGNVRMIFPEWTQQVA
FT                   DALRSAPAGMQDGASSAPQPALDRLKADTNPMTAVLDFADALRDEPMEQIIARLPALLR
FT                   VKDRHALSAIVYLCLSAPRAEDRSRFVETINATIAGTDDRARLLAIAYGAFAAGRTQPV
FT                   PFRDGAQRAFIDDVFGALKQRTAALGVPVAQGSPWYEFFTAYRLGGAASGKAP"
FT   CDS_pept        400441..400692
FT                   /transl_table=11
FT                   /locus_tag="BCAM0346"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0346"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54204"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIT6"
FT                   /protein_id="CAR54204.1"
FT                   /translation="MTITTLSSRELNQDVTKAKKATKDGPVFITDRGRPAHVLLSFEEY
FT                   QRLTRQRRNIADALAMPGVEDIEFDPPRANVKIKEVDF"
FT   CDS_pept        400695..401111
FT                   /transl_table=11
FT                   /locus_tag="BCAM0347"
FT                   /product="putative PIN-domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0347"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54205"
FT                   /db_xref="GOA:B4EIT7"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIT7"
FT                   /protein_id="CAR54205.1"
FT                   /translation="MFVLDTNVVWELRKVRAGKADRNVAAWCSTVDAPVLFVSAITIME
FT                   LETGVLQVGRRDAEQGALLRAWLDGHVLPEFAGRVLPVDTAVAQRCARLHVPDRRYERD
FT                   ALIAASAIVHGMTVVTRNVADFVETGVAILNPWD"
FT   misc_feature    400698..401102
FT                   /locus_tag="BCAM0347"
FT                   /note="HMMPfam hit to PF01850, PIN domain, score 6.7e-16"
FT                   /inference="protein motif:HMMPfam:PF01850"
FT   CDS_pept        401231..401956
FT                   /transl_table=11
FT                   /locus_tag="BCAM0348"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0348"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54206"
FT                   /db_xref="GOA:B4EIT8"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIT8"
FT                   /protein_id="CAR54206.1"
FT                   /translation="MTDTKAITEHWTRVADQWIGWAGKPGHDAFWKYRAGLAAYIGRGT
FT                   GVALEVGCGEGRVSRELKALGYDVTASDAVPAMLDAARHADSAHRYRLADAAALPFDTA
FT                   SFDLVMAYNVLMDLDDMQGALHEARRVLKPDGTLFISLVHPFRDRGSFAGPQPDAPFVL
FT                   TGSYFGREHFDGVETRDGLSMHFAGWSLPLQAYMEALEAAGFAIVSLREPPPDHADTDQ
FT                   LKQWARVPLFLWIKARPLR"
FT   misc_feature    401375..401650
FT                   /locus_tag="BCAM0348"
FT                   /note="HMMPfam hit to PF08241, Methyltransferase domain,
FT                   score 4.4e-32"
FT                   /inference="protein motif:HMMPfam:PF08241"
FT   misc_feature    401375..401644
FT                   /locus_tag="BCAM0348"
FT                   /note="HMMPfam hit to PF08242, Methyltransferase domain,
FT                   score 9.5e-21"
FT                   /inference="protein motif:HMMPfam:PF08242"
FT   CDS_pept        complement(402119..402583)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0348a"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0348a"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54207"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIT9"
FT                   /protein_id="CAR54207.1"
FT                   /translation="MEEPAPYSLSGALSVQDDLDDEQLDRVSRHLSGIASVYVKHDAVA
FT                   HTVSLCISGTLMRDDARYIEQRIERFAEEHARAASILLSEWNGVTSELVVGMNWDAQCL
FT                   IKLAAIQEQLGKLPERYFDFLLRLEPAGAPARGKQFLSVSIETSDDQQVV"
FT   CDS_pept        complement(402662..403063)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0348b"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0348b"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54208"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIU0"
FT                   /protein_id="CAR54208.1"
FT                   /translation="MTSTYEICGALSVVGHFRRNHAQQFAQSLPASATVYCVTDAVTHS
FT                   VMIRLRGALTDQEVTSIEGKLKEFSQKWARTAAVFSRIRFGERSLMPLAPGRHVERLKG
FT                   PATEYVRHHTSTPPHSDAQNTQVLAAPLG"
FT   CDS_pept        403174..403554
FT                   /transl_table=11
FT                   /locus_tag="BCAM0354"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0354"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54209"
FT                   /db_xref="GOA:B4EIU1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIU1"
FT                   /protein_id="CAR54209.1"
FT                   /translation="MNQPDIFSVRLRLERKRLGMNQTEFAAAGGVQQHAQVNYEKGARL
FT                   PDVSYLVGIADLGVDVQYLLTGRTSDPVTLALTSDEELLLAGFRELKLRERRGVLALVA
FT                   AINGTPTERPGTDKPSDETEGV"
FT   misc_feature    403231..403296
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1028.000, SD 2.69 at aa 20-41, sequence
FT                   MNQTEFAAAGGVQQHAQVNYEK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        complement(join(403828..403920,403922..404077,
FT                   404080..404256,404258..404302))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BCAM0354a"
FT                   /product="putative acetyltransferase-GNAT family
FT                   (pseudogene)"
FT                   /note="Contains frameshift mutations after codons 15, 74
FT                   and 126"
FT                   /db_xref="PSEUDO:CAR54210.1"
FT   misc_feature    complement(join(403861..403920,403922..404077,
FT                   404080..404121))
FT                   /locus_tag="BCAM0354a"
FT                   /note="HMMPfam hit to PF00583, Acetyltransferase (GNAT)
FT                   family, score 8.1e-07"
FT                   /inference="protein motif:HMMPfam:PF00583"
FT   CDS_pept        404492..406201
FT                   /transl_table=11
FT                   /gene="RS04417"
FT                   /locus_tag="BCAM0355"
FT                   /product="ABC transporter ATP-binding membrane protein"
FT                   /note="Similar to Ralstonia solanacearum (Pseudomonas
FT                   solanacearum) rs04417 probable composite atp-binding
FT                   transmembrane abc transporter protein. UniProt:Q8Y258 (592
FT                   aa) fasta scores: E()=1.1e-40, 31.016% id in 561 aa;
FT                   contains 32 amino acid C terminal truncation"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0355"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54211"
FT                   /db_xref="GOA:B4EIU3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIU3"
FT                   /protein_id="CAR54211.1"
FT                   /translation="MAACRHPGRAPVHCAMNEHHAPNPITEVLRAYWKADRWMLLTVAA
FT                   VVVLSSATAVAAPYLFSRLIDALSHRGALHALMAGFVVYAVLLGLSSALQRVVQYLAFM
FT                   TSGNLGFITSTRFFERVLKKTTAFFVEHNPTEIQSANTRGSRALAVLVQLALMDLIPGT
FT                   LQIVFTLVTLGAMINLEVAAITAAYGAIAVTIAIVSARRSRVYLDRAIEAGQDNARFVG
FT                   GAINAMETLRHFGSHRWMSERFAEKARAERDNWRAYVMQHVGFLALLGLGLAVQFSVTF
FT                   WLLLPRHAAGALSIGDIVLFNTLLLQLNLPFDMLARSIDESVRSRAALVPFTALWTAPE
FT                   ERQVSHASAFVPREGRIVFERVGYAYGNGRGVRDVDFVAERGGITFIVGETGAGKSTVF
FT                   RLALKSIEPTAGRILVDGVDLATIDRADWYGAVAVVPQDVVLLNESLEDNILLGRPRDA
FT                   RRLRDAAAKATILPFIEGLPDGLRTTVGERGLKLSGGERQRIAIARALYGDPTVLFLDE
FT                   ASSALDEATERDIMEHVRLLARDVTVIAITHRRSVIGPTDKVVRLGTARVPA"
FT   misc_feature    404609..405427
FT                   /gene="RS04417"
FT                   /locus_tag="BCAM0355"
FT                   /note="HMMPfam hit to PF00664, ABC transporter
FT                   transmembrane region, score 5.7e-06"
FT                   /inference="protein motif:HMMPfam:PF00664"
FT   misc_feature    join(404609..404677,404705..404773,404936..405004,
FT                   405032..405091,405278..405346)
FT                   /gene="RS04417"
FT                   /locus_tag="BCAM0355"
FT                   /note="5 probable transmembrane helices predicted for
FT                   BCAM0355 by TMHMM2.0 at aa 40-62, 72-94, 149-171, 181-200
FT                   and 263-285"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    405497..405523
FT                   /note="PS00037 Myb DNA-binding domain repeat signature 1."
FT                   /inference="protein motif:Prosite:PS00037"
FT   misc_feature    405635..406180
FT                   /gene="RS04417"
FT                   /locus_tag="BCAM0355"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   1.2e-52"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    405656..405679
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    405965..406009
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        complement(406220..407257)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0356"
FT                   /product="putative aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0356"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54212"
FT                   /db_xref="GOA:B4EIU4"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIU4"
FT                   /protein_id="CAR54212.1"
FT                   /translation="MEYRTLGRSGLQVPVLSFGAGTFGGTGPLFSAWGNTGVDEARRLI
FT                   DICLDAGVNLFDTADVYSDGASERVLGAALKGRRDQVLISTKTGLPTGDGPNDAGTSRA
FT                   RLVRAVDDALRRLDTDYIDLLQLHAFDAGTPVEEVMSTLDDLVRAGKLRYIGVSNFAGW
FT                   QIMKSLAAADRHGWSRYVANQVYYSLVGRDYEWDLMPLGADQGLGALVWSPLGWGRLTG
FT                   KIRRNAPLPEGSRLHETASYGPPVDDARLYDVVDALDAIAEETGKTVPQIALKWLLQRP
FT                   TVSSVIVGARNEEQLRQNLGAVGWALTDAQVAKLDAASAVEAPYPYFPYRRQAAFARLN
FT                   PPMRG"
FT   misc_feature    complement(406298..407239)
FT                   /locus_tag="BCAM0356"
FT                   /note="HMMPfam hit to PF00248, Aldo/keto reductase family,
FT                   score 1.5e-68"
FT                   /inference="protein motif:HMMPfam:PF00248"
FT   misc_feature    complement(406778..406831)
FT                   /note="PS00062 Aldo/keto reductase family signature 2."
FT                   /inference="protein motif:Prosite:PS00062"
FT   CDS_pept        407385..408266
FT                   /transl_table=11
FT                   /locus_tag="BCAM0357"
FT                   /product="LysR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0357"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54213"
FT                   /db_xref="GOA:B4EIU5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIU5"
FT                   /protein_id="CAR54213.1"
FT                   /translation="MLLGNLALFLRIVEKGGLAAAGREVGLSPATVSERLTALERHYGA
FT                   ALLTRTTRAISLTDEGRTLVDGARRLLAEADELESRVRLGVRTLSGPVRLSAPADLGRE
FT                   RVVPVVDAFLADHPGVTVDLHLGDGYVDLVGQGLDFAIRRGTLADSSLRSRSLGRARRV
FT                   VCASPAYLAAHGTPAHPDELASHDCIVMRFGQELYAEWPFSIDGVLKRVVVRGRRVAND
FT                   GALVRAWCVAGHGIALKSLVDVERDLASGALVEILRDFSPDKVDLQIVYPGRAAQPRRV
FT                   RALIDRLAQALA"
FT   misc_feature    407391..407570
FT                   /locus_tag="BCAM0357"
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix, score 6.3e-16"
FT                   /inference="protein motif:HMMPfam:PF00126"
FT   misc_feature    407430..407495
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1336.000, SD 3.74 at aa 16-37, sequence
FT                   GGLAAAGREVGLSPATVSERLT"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    407433..407525
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00044"
FT   misc_feature    407640..408263
FT                   /locus_tag="BCAM0357"
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 4.2e-45"
FT                   /inference="protein motif:HMMPfam:PF03466"
FT   CDS_pept        408444..408743
FT                   /transl_table=11
FT                   /locus_tag="BCAM0358"
FT                   /product="ArsR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0358"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54214"
FT                   /db_xref="GOA:B4EIU6"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIU6"
FT                   /protein_id="CAR54214.1"
FT                   /translation="MDDVTRLSALANESRLAVMRWLRQPRKHFPPQPHGDVDELGVCCT
FT                   YITEKLGIAPATTTRHMRILADAGLVQATRVGKFTYYKRIDGALQRLGRDLSQL"
FT   CDS_pept        408764..410116
FT                   /transl_table=11
FT                   /locus_tag="BCAM0359"
FT                   /product="putative pyridoxal-dependent decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0359"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54215"
FT                   /db_xref="GOA:B4EIU7"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIU7"
FT                   /protein_id="CAR54215.1"
FT                   /translation="MDELSLLADADRRAHAYLAATNERRAFPDAAALAGLAAFDEPLPD
FT                   AGRPADDVLRLLDEHGTPATVASNGPNYFGFVIGATLPAAAAAERLMLAWDQCASSYAN
FT                   SPVAATLERQAARWVVDALGLPEGSAVGFGTSATACTLVALVAARRALLARKGWDIDED
FT                   GLIGAPEVKVVISALAHITVKKALRVLGFGMKRIVVAPVDMHGRIDPAQLPPLDDMTIF
FT                   CVQAGEVNTGEFDPFAALIPPAKAAGAWVHVDGAFGLWARASSKRALTDGIDGADSWTT
FT                   DGHKWLNTPYDGAMVICRDAAALATAMNSDAVYLSGAHDAQKNLNLEFSRRARGIPVWA
FT                   ALRSLGRAGVATMVERHCAQAARVADGLRAAGYDVLNRVVLNQVLVRAGTDEETAAILE
FT                   AAQASGDVWFGATVWQGRPAFRISVSSWRTEDAHIDRLVALLTKLRGVHVG"
FT   misc_feature    408869..409930
FT                   /locus_tag="BCAM0359"
FT                   /note="HMMPfam hit to PF00282, Pyridoxal-dependent
FT                   decarboxylase conse, score 1.4e-14"
FT                   /inference="protein motif:HMMPfam:PF00282"
FT   misc_feature    409151..409183
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    409154..409231
FT                   /note="PS00107 Protein kinases ATP-binding region
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00107"
FT   misc_feature    409238..409276
FT                   /note="PS00018 EF-hand calcium-binding domain."
FT                   /inference="protein motif:Prosite:PS00018"
FT   CDS_pept        complement(410120..411037)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0360"
FT                   /product="LysR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0360"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54216"
FT                   /db_xref="GOA:B4EIU8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIU8"
FT                   /protein_id="CAR54216.1"
FT                   /translation="MKLKQLDAFLAVAEHRTIRGAARALGVTQPAVSGIVRELEHELGV
FT                   PLVVRSVKGIALTDYGSAFAIRARLIVEEIQRTRDEIEQLRLGTTGSVSIAVSPTVALT
FT                   ILPRAFAAFTRDLPGATLNVDDALTATDLARLRDGSLDFIVTHQLSNALPDPDEFASIP
FT                   LFRTAFAVVARSRHRLARARSLRELVDAHWCVPRYGEGGDDLIRSIFMPFGLDVPKRVV
FT                   HCPSFAATLGLVSQTEALGVFARPLAEVERQSRGIVALNLAEPMPALTVAIVMRRHALL
FT                   TPAALHFIECLKGASATVSAADDA"
FT   misc_feature    complement(410147..410782)
FT                   /locus_tag="BCAM0360"
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 4e-34"
FT                   /inference="protein motif:HMMPfam:PF03466"
FT   misc_feature    complement(410852..411031)
FT                   /locus_tag="BCAM0360"
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix, score 2.4e-21"
FT                   /inference="protein motif:HMMPfam:PF00126"
FT   misc_feature    complement(410897..410989)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00044"
FT   misc_feature    complement(410927..410992)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1718.000, SD 5.04 at aa 16-37, sequence
FT                   RTIRGAARALGVTQPAVSGIVR"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        411182..412405
FT                   /transl_table=11
FT                   /locus_tag="BCAM0361"
FT                   /product="putative amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0361"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54217"
FT                   /db_xref="GOA:B4EIU9"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIU9"
FT                   /protein_id="CAR54217.1"
FT                   /translation="MMRVNQQRLWDSLMEMATIGATAHGGSCRLALSDDDAQGRRRFIA
FT                   WCEAAGCEIRIDPIGNVFARRPGTQPGLPAVMCGSHLDTQPLGGRFDGVYGVLAGLEAI
FT                   RTLNEHGIATRHPIDVVAWTNEEGSRFTPGMMGSAVYAGALDLDYALTRPCMQTGVLLR
FT                   DELERTGFAGTARERQMPKAYFEAHIEQGPVLEQAGLPIGVVTGVQGIYELDVTVTGFE
FT                   SHAGTTPMSVRRDAMGVAAAMIAAIVEHGHAFDADARVTVGHVACEPNSPSTIPGKVRF
FT                   SVDVRHPSRPALQQLVADIEAICMERTALRGTRVQVQTIAEYAPVVFDADCVARVRQAT
FT                   AAAGYPYLEMCSGAGHDAVNLSYVAPSAMVFVPCKAGLSHNEAEDADPVHLAHGASVLA
FT                   NLLADCAR"
FT   misc_feature    411410..412393
FT                   /locus_tag="BCAM0361"
FT                   /note="HMMPfam hit to PF01546, Peptidase family
FT                   M20/M25/M40, score 2.4e-36"
FT                   /inference="protein motif:HMMPfam:PF01546"
FT   misc_feature    411797..412117
FT                   /locus_tag="BCAM0361"
FT                   /note="HMMPfam hit to PF07687, Peptidase dimerisation
FT                   domain, score 0.0022"
FT                   /inference="protein motif:HMMPfam:PF07687"
FT   CDS_pept        412444..412992
FT                   /transl_table=11
FT                   /locus_tag="BCAM0362"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Ralstonia solanacearum (Pseudomonas
FT                   solanacearum) rs04533 hypothetical protein rsc2672.
FT                   UniProt:Q8XW03 (159 aa) fasta scores: E()=6.5e-13, 35.294%
FT                   id in 153 aa; contains extra 26 amino acids on N terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0362"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54218"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIV0"
FT                   /protein_id="CAR54218.1"
FT                   /translation="MKMSDNGRCARRAGAAFNRSIHACEIPMSTPFPRELLKAADIAKM
FT                   EPTRAVHSLNPNAVRLKRPLSDLTGLTQFGVHLLTLMPGHESAEYHRHLYEEEFVYVLS
FT                   GTGAVTIGEHASEIGPGDFIGFPRGGDAHTVQNTGDAPLELLVGGQRLEHDVCEYPRIG
FT                   KRLYIAGELEEYVELPKQP"
FT   misc_feature    412597..412965
FT                   /locus_tag="BCAM0362"
FT                   /note="HMMPfam hit to PF00190, Cupin, score 0.0019"
FT                   /inference="protein motif:HMMPfam:PF00190"
FT   misc_feature    412672..412890
FT                   /locus_tag="BCAM0362"
FT                   /note="HMMPfam hit to PF07883, Cupin domain, score 2.5e-19"
FT                   /inference="protein motif:HMMPfam:PF07883"
FT   CDS_pept        413319..415784
FT                   /transl_table=11
FT                   /locus_tag="BCAM0363"
FT                   /product="putative lipoprotein"
FT                   /note="Similar to Bacteroides thetaiotaomicron hypothetical
FT                   protein. UniProt:Q8A0C8 (717 aa) fasta scores: E()=6.8e-40,
FT                   34.505% id in 768 aa; higher similarity at C terminus than
FT                   N terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0363"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54219"
FT                   /db_xref="GOA:B4EIV1"
FT                   /db_xref="InterPro:IPR005887"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012939"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR041371"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIV1"
FT                   /protein_id="CAR54219.1"
FT                   /translation="MSRNWGLGTALLALCVAVASCGGDGDSPSAVAANMSTSAQSQGNE
FT                   NGNGGNDNSNGNESGNEAARKNADIRVVQYVNPLIGTDYATDQPADPVGSGLGGGTFPG
FT                   PTVPFGMMQWSPMTPTAQYDGRKGDGSGFSGGYWYGDTSINAFSILHLSGTGCWANGGY
FT                   LNVMPQLAPGDAGTPATFDHANETAQAGYYGVTLGNGIKAELTTTLRTGFARFTYPALA
FT                   QGQQATIAIDPTVLNNRAQGTTSDTVSQVGDRALSGTIAGGGFCWAGHAVPVYYYAEFS
FT                   QPFAAKPALSNNRPVTLTFNVDSKHPDVMMKLGISFVSEANAKANLRAENPATDARGER
FT                   NWRFDKVRRAASAAWNARLNAIQVAGGSDADKTKFYTALYHASLHPNVFNDVNGQYPDF
FT                   YASNGASTAPTRRVENGRTMYANFSGWDIDRSFIQLQALLDPVRTSDIVQSLVLDAKAC
FT                   GAFPRWAYFNTETAVMPGDAGSIITANAYAFGATHFDTQAALSIMKASTAPGAACAGTP
FT                   VMGSRADYDRLGYVPASGSGDNQSASNTLEYALRDFAVSRFATALGDTATAGALLKSSG
FT                   NWQHLFDRGAIRPKTSAGAWVTDGSGFMEGNAEQYTWYVPHDLAGVIAQAGGAAPVVKR
FT                   LDTFFTHLNIGTEQPYFYVGNEVTMAVPWVYAWAGAPSHTQRVLHASLANAFGPGAAGL
FT                   PGNDDLGALSGWYVWAALGLYPVVPGVSGVALSSPQFEAITVRVGQQDGSYRLLHIAAP
FT                   GAGSGDSASFYVKSLKLNGTSWPAAWLPLEHIAKGGKLTYAMTADASAATWGADASAMP
FT                   SFPRAAGAQ"
FT   sig_peptide     413319..413414
FT                   /locus_tag="BCAM0363"
FT                   /note="Signal peptide predicted for BCAM0363 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.882 between residues 32 and 33"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    413349..413381
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    413757..413789
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    414189..415715
FT                   /locus_tag="BCAM0363"
FT                   /note="HMMPfam hit to PF07971, Glycosyl hydrolase family,
FT                   score 6.2e-153"
FT                   /inference="protein motif:HMMPfam:PF07971"
FT   CDS_pept        415850..418528
FT                   /transl_table=11
FT                   /locus_tag="BCAM0364"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0364"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54220"
FT                   /db_xref="GOA:B4EIV2"
FT                   /db_xref="InterPro:IPR005887"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012939"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR041371"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIV2"
FT                   /protein_id="CAR54220.1"
FT                   /translation="MKLRHVVGIGCLAVLSGCGGDQGATDASVLAQMSNAPGNQNDQGN
FT                   QNDQGDQNDQGENGGAHKRSVLRSVDPMIGTANLDINADWSSGVRGHGHVYPGATVPFG
FT                   MVQLGPDTAGGAHTLPWNWDRTSGYQYDDPFITGFTHTHLSGTGIGSGGEVRFLPTLAP
FT                   VDTATLAKVAADASITYDASFSHDDETASPGYYRVKLAPVGSGNTPWNVQGAKILAEMT
FT                   ATTHAGVHRYTYFPSAATQKRSLIVSIDNPIGGSTASGKIQVVDARTIAGWQFTNNWAN
FT                   DKPTYFVARFSKPFDTQHVAFSADGFKAYLTFADGGDGGAVTVKVGISPSSITDAQANL
FT                   ASEVGAKSFDQVRGAAERVWSAALDRVRIKGGSADQRTMFYTSLYRTMLAPTVYNNADG
FT                   SYVGMDSSNDGTTSPPTTSKHANPGFDYSSTFSLWDTFRAEAPLMTLVQPERVDGWVKS
FT                   LLTQFAQNGKGELPVWPLAQTETFTMAGHPSIPMIADAYLKHLTSAGIDDIWTALTTTQ
FT                   RASAHGFDQYRQRGYVYAGDNASVSTTQDYAFDDWATAAVGKAAGKSTADYQPYLTRSQ
FT                   NYRNVFNPAPNNGWKFSQPKDAQGNWVAGFDPTAAEKTDFSESNSWVDTWNIFHDFPGL
FT                   ITLLGGTSQFVAQLDRTFDPANPLTFQYNQGFPDLTGRSGQYFAGNEPANHLPYLYDVA
FT                   GMPSKTQDRVRMVMDDMYSLTLTAGDRALLSGDSLKAALNDPRRVRDAAIPGNDDCGQL
FT                   SAWYVLSALGIYSLNPVGGVFYFGTPLFEEASIDIPMASGSGAGGALTFGGARRFTITA
FT                   HTASGAAPSSVNRYVQSVSLNGAPLHRPYITYDEIKAGGRLDFVMGSTPNDAWVGQWNG
FT                   QDPNSALAPSLLAAGGTTRAQ"
FT   sig_peptide     415850..415918
FT                   /locus_tag="BCAM0364"
FT                   /note="Signal peptide predicted for BCAM0364 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.983) with cleavage site
FT                   probability 0.893 between residues 23 and 24"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    415871..415903
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    416753..418432
FT                   /locus_tag="BCAM0364"
FT                   /note="HMMPfam hit to PF07971, Glycosyl hydrolase family,
FT                   score 6.3e-161"
FT                   /inference="protein motif:HMMPfam:PF07971"
FT   CDS_pept        418702..419502
FT                   /transl_table=11
FT                   /locus_tag="BCAM0365"
FT                   /product="putative short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0365"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54221"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIV3"
FT                   /protein_id="CAR54221.1"
FT                   /translation="MSAPIAETAPETETAGEPRAARLHRPVALVTGSTSGIGAAVARRL
FT                   AADGYAVILHSRRSAETGRAMARELGAAYVQADLADDAERVRLIRDALAVHGRLDVLVN
FT                   NAGVSRVIAHDDLAAATPDVWREMHEINVIAPFRLVAEAEAALRESASRGRAGCVVNVS
FT                   SHAGVRPKGASIPYAAAKAALNHTTRLLARTLAPAIRVNAVAPGLVDTPLTADWTDAQQ
FT                   LWRERAPMRRAATPDDIAQTVAMLVASDYVTGEIVMLDGGLNLT"
FT   misc_feature    418777..419289
FT                   /locus_tag="BCAM0365"
FT                   /note="HMMPfam hit to PF00106, short chain dehydrogenase,
FT                   score 3e-16"
FT                   /inference="protein motif:HMMPfam:PF00106"
FT   misc_feature    418783..419481
FT                   /locus_tag="BCAM0365"
FT                   /note="HMMPfam hit to PF01370, NAD dependent
FT                   epimerase/dehydratase family, score 2.6e-05"
FT                   /inference="protein motif:HMMPfam:PF01370"
FT   CDS_pept        complement(419590..420369)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0366"
FT                   /product="putative acid phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0366"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54222"
FT                   /db_xref="GOA:B4EIV4"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR030048"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIV4"
FT                   /protein_id="CAR54222.1"
FT                   /translation="MQATRPLFDRVLLTNDDGFDAPGLDILEQVATQLAREVWIVAPAE
FT                   DQSGTSHSLSLHEPLRVHRKGERRFAVRGTPGDCVAIAVSHLMKGARPDVVLSGVNRGA
FT                   NLGTETVFSGTVGAAMTSMLVGVPAIALSQAFTDRNAVPWGTALAHAPDVIRRLVAAGW
FT                   DSDACLNVNFPPRPADDVRGLKVTNQGAGTLQGVEIVSGRDPREIGYHWLKLARAPRDD
FT                   DADSETVALGEGYIAVTPLKFERTHDQALARLRSNLG"
FT   misc_feature    complement(419779..420345)
FT                   /locus_tag="BCAM0366"
FT                   /note="HMMPfam hit to PF01975, Survival protein SurE, score
FT                   1e-66"
FT                   /inference="protein motif:HMMPfam:PF01975"
FT   CDS_pept        complement(420559..420867)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0367"
FT                   /product="putative branched-chain amino acid transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0367"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54223"
FT                   /db_xref="GOA:B4EIV5"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIV5"
FT                   /protein_id="CAR54223.1"
FT                   /translation="MPELPDFGTVATIVLMASTTYLSRILGYVLLRNRTLSPRMASVME
FT                   NVPGCVLISVIAPAFVSTRPADLLALALTLLAATRLSILPTVIVGVVSAGLLRYLLG"
FT   misc_feature    complement(join(420568..420636,420679..420747,
FT                   420772..420840))
FT                   /locus_tag="BCAM0367"
FT                   /note="3 probable transmembrane helices predicted for
FT                   BCAM0367 by TMHMM2.0 at aa 10-32, 41-63 and 78-100"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(420571..420843)
FT                   /locus_tag="BCAM0367"
FT                   /note="HMMPfam hit to PF05437, Branched-chain amino acid
FT                   transport protein, score 2.2e-25"
FT                   /inference="protein motif:HMMPfam:PF05437"
FT   CDS_pept        complement(420860..421594)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0368"
FT                   /product="putative branched-chain amino acid transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0368"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54224"
FT                   /db_xref="GOA:B4EIV6"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIV6"
FT                   /protein_id="CAR54224.1"
FT                   /translation="MSSSVSTSSGLRDKPAYVAEMGRGLRAALPVMLGFVPFALVLGAQ
FT                   AAQKGLSLFEVPMMTGLNFGGGSEFAAIHLWTSPPHIALIVAMSFLVNSRHILMGAAFE
FT                   PYIRRLPRRRAFVALFFMCDESWAMSLADARERSATHISVPYYAGICMGLYLTWISMTT
FT                   LGAAVGPTIGNVEQYGFDMAFTAVFLVLLRGMWKGVRASRPWFVSLVVAAATHLALPGA
FT                   WYVAAGACAGLIAALLWEPRDA"
FT   misc_feature    complement(join(420878..420946,421007..421063,
FT                   421091..421159,421319..421387,421457..421525))
FT                   /locus_tag="BCAM0368"
FT                   /note="5 probable transmembrane helices predicted for
FT                   BCAM0368 by TMHMM2.0 at aa 24-46, 70-92, 146-168, 178-196
FT                   and 217-239"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(420905..420937)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    complement(421076..421510)
FT                   /locus_tag="BCAM0368"
FT                   /note="HMMPfam hit to PF03591, AzlC protein, score 6.2e-53"
FT                   /inference="protein motif:HMMPfam:PF03591"
FT   CDS_pept        421720..422178
FT                   /transl_table=11
FT                   /locus_tag="BCAM0369"
FT                   /product="AnsC family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0369"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54225"
FT                   /db_xref="GOA:B4EIV7"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIV7"
FT                   /protein_id="CAR54225.1"
FT                   /translation="MKLDAIDRRILSALQRDGRMQNVELAHEVGLSPSPCLRRVRLLEE
FT                   AGVIEKYVAVLNPAKVGKGLTIFTRVWLKGQDAESVNRFAEAVQQMPEVVECHLMAGDC
FT                   DFLLRVVAADIDDYRRFQMEYLTRIPGVLSVKTDIPMQKVKLTSALPT"
FT   misc_feature    421918..422148
FT                   /locus_tag="BCAM0369"
FT                   /note="HMMPfam hit to PF01037, AsnC family, score 2.1e-27"
FT                   /inference="protein motif:HMMPfam:PF01037"
FT   CDS_pept        422393..422962
FT                   /transl_table=11
FT                   /locus_tag="BCAM0370"
FT                   /product="putative membrane protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0370"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54226"
FT                   /db_xref="GOA:B4EIV8"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIV8"
FT                   /protein_id="CAR54226.1"
FT                   /translation="MQPFNTPWNSLEIVKLALGVLTPLSVACLGWLVARRLKRLELVQW
FT                   TNQRLIEKRLSLYDTVAPQLNALLCFYTWIGYWKDISPDDVIRAKRDLDRTFHIYRYLF
FT                   DDDVYDAYHTFIHALFEMHTGPGRDARIRSLIQAPDGDRSVHGSYQWKPAWSERFSTAN
FT                   VVSKDDVLRHYTRLMERLRVALGATR"
FT   misc_feature    422429..422497
FT                   /locus_tag="BCAM0370"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAM0370 by TMHMM2.0 at aa 13-35"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    422444..422476
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        423111..423788
FT                   /transl_table=11
FT                   /locus_tag="BCAM0371"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli O6 hypothetical protein
FT                   YebB UniProt:Q8FGR2_ECOL6 (EMBL:AE016761) (224 aa) fasta
FT                   scores: E()=3.7e-29, 43.548% id in 186 aa; homology does
FT                   not extend to the N terminus."
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0371"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54227"
FT                   /db_xref="InterPro:IPR024453"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIV9"
FT                   /protein_id="CAR54227.1"
FT                   /translation="MVVDTGRQPLLIRSPGARRRLLFAGAPDSLAEPLPAEPEIGDIVF
FT                   IRVTVRPFLEVASATRSWTNHVGIVVGERGGETLIAESTFPLSRVTTMSRFLARSDRGA
FT                   CVIARLRQPLDAAQRRELVAAAMRRIGVVYDTGFNLASRRQFCSRFVREVVCEATRIVL
FT                   GDVETFYTLLHRNPDHPLGFWRIWYFGRIPWHRRTVTPASILDSGALRVVMDTRDSGTG
FT                   RDD"
FT   misc_feature    423198..423761
FT                   /locus_tag="BCAM0371"
FT                   /note="HMMPfam hit to PF06520, Protein of unknown function
FT                   (DUF1105), score 5e-46"
FT                   /inference="protein motif:HMMPfam:PF06520"
FT   CDS_pept        complement(423843..424475)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0372"
FT                   /product="putative transporter-LysE family"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0372"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54228"
FT                   /db_xref="GOA:B4EIW0"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIW0"
FT                   /protein_id="CAR54228.1"
FT                   /translation="MIDFSTLALFSGACLALTITPGPDMLLIASRSVSQGRRAGFATLA
FT                   GIQAGTYCHALAAAFGLSQLFVAVPLAYDAVRFAGAAYLLYLAWKTFRSSAAALSPVAS
FT                   PRRHSTATIFRQGLTTNLLNPKMALFVLALFPQFVRPEHGSIAVQILVLATVLNLIGIV
FT                   VNGAVILSASRLSQRIGARRRPSKVPQYLLGSVFVGLAARLAIAGRH"
FT   misc_feature    complement(423852..424433)
FT                   /locus_tag="BCAM0372"
FT                   /note="HMMPfam hit to PF01810, LysE type translocator,
FT                   score 6.9e-32"
FT                   /inference="protein motif:HMMPfam:PF01810"
FT   misc_feature    complement(join(423855..423914,423972..424040,
FT                   424215..424283,424302..424361,424389..424457))
FT                   /locus_tag="BCAM0372"
FT                   /note="5 probable transmembrane helices predicted for
FT                   BCAM0372 by TMHMM2.0 at aa 7-29, 39-58, 65-87, 146-168 and
FT                   188-207"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(424428..424475)
FT                   /locus_tag="BCAM0372"
FT                   /note="Signal peptide predicted for BCAM0372 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.926) with cleavage site
FT                   probability 0.670 between residues 16 and 17"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(424434..424466)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(424618..425487)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0373"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0373"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54229"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIW1"
FT                   /protein_id="CAR54229.1"
FT                   /translation="MLPSVASPLTRHLASIVSVAVFAGATFGGTASAEPLRTASDIAGA
FT                   SLVPLGTLPHSPERGSLDPFCTQYRAKPTTAAGREVAKRDWIVTSEAPLGRYTVVSFAS
FT                   GFNAGTSAICFARNGNLGVFEGATLVALGYTARKAGWQLGSVDRLENGALLVWGGDGPG
FT                   APVGELHEENGGLRLTRVAAESTHCSGRAVVPNVYGKPLDAARKILIAHGWQPLRPREK
FT                   PDAMDGAATLAKHGIIEAEACSGTGIGYCALRYRNAAGVLGVTTVGGEPDRPSENTVID
FT                   YQVACRKQ"
FT   sig_peptide     complement(425389..425487)
FT                   /locus_tag="BCAM0373"
FT                   /note="Signal peptide predicted for BCAM0373 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.996) with cleavage site
FT                   probability 0.811 between residues 33 and 34"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(425594..425926)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0374"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0374"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54230"
FT                   /db_xref="InterPro:IPR016755"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIW2"
FT                   /protein_id="CAR54230.1"
FT                   /translation="MIQPTPVFKDNLAQLPAIDGIARIDLVGANGDVVATIENQPGKQG
FT                   SLAVYHYLKQAFGTLDAKAAEHGLAVFAEHTADARNRPGAHPNVDRLLAIVAGGDALRI
FT                   DVVAKD"
FT   CDS_pept        complement(425980..427413)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0375"
FT                   /product="Major Facilitator Superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0375"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54231"
FT                   /db_xref="GOA:B4EIW3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIW3"
FT                   /protein_id="CAR54231.1"
FT                   /translation="MNPIRRPAAPRAADVAAPARHRLALPALCIAVLIAQIDTAIVNLA
FT                   TEPIGTAFGTRVGALQWVIDAYNLAYAVLLLTGGLIGDLYGRRRAFVLGATVLSGASVV
FT                   CALAPTLGVLIAGRALAGAGAALLIPASLAIVRVLWRHPAERARALGIWAACGGIAMIV
FT                   GPTLGGVLIHALGWRSIFGVVIPFGIAAIALTSAVVPESADPRGRRFDPAAQVLGAIAI
FT                   GCVVFATIDARHDPQRAALLIGTGAAAIALFVRIERRLGTAALVPLDLFANRAFRGMLV
FT                   GNGAMTFGGYGMLFVLPLAWQSHHVLDASGASLALLPMSVPFALVSFGSGAVAARVGAR
FT                   TAGAGGVALMGLGLAAIGIGAAGSTNPHAPMLAWAEAGLALTGTGLGLAVGSLAATAVG
FT                   AVDAARAGTAASLMNVTRMIGAVFGVALLGALYDACGGGASGLRVAMLTGSALQLAGAA
FT                   LAWRTASTGTRAGAPRPIG"
FT   misc_feature    complement(join(426031..426090,426118..426177,
FT                   426214..426282,426325..426393,426412..426480,
FT                   426508..426576,426646..426699,426727..426780,
FT                   426817..426885,426898..426966,427003..427071,
FT                   427081..427149,427168..427236,427279..427347))
FT                   /locus_tag="BCAM0375"
FT                   /note="14 probable transmembrane helices predicted for
FT                   BCAM0375 by TMHMM2.0 at aa 23-45, 60-82, 89-111, 115-137,
FT                   150-172, 177-199, 212-229, 239-256, 280-302, 312-334,
FT                   341-363, 378-400, 413-432 and 442-461"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(426115..427332)
FT                   /locus_tag="BCAM0375"
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 1.2e-48"
FT                   /inference="protein motif:HMMPfam:PF07690"
FT   misc_feature    complement(426742..426774)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(427436..428137)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0376"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0376"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54232"
FT                   /db_xref="GOA:B4EIW4"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIW4"
FT                   /protein_id="CAR54232.1"
FT                   /translation="MNAPHCVTEPNILYFGTPVVLVSTLNENGTANLAPISSAFWLGWR
FT                   GVIGIAASSQTTRNLLRTGECVLNLPSSAQADAVDRIARTTGTYPVPDGKRAKGYVFEP
FT                   DKFGTAGLTEAASQTVTPPRALECPVHMEAIVAATYGIGDDTPDLRGRIRVFELRIQRV
FT                   HAHPDLLMDGHPDRIDPDKWSPLIMSFQKFYGLAPQQVHPSRLAEIPERAYRSPDIERS
FT                   RDAGMLAGSAR"
FT   CDS_pept        428349..428675
FT                   /transl_table=11
FT                   /locus_tag="BCAM0377"
FT                   /product="putative thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0377"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54233"
FT                   /db_xref="GOA:B4EIW5"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIW5"
FT                   /protein_id="CAR54233.1"
FT                   /translation="MDTEQRYTANAPTRAEVDALGGATVIEFGANWCGICAGAQPAITA
FT                   SFSAHPAVRHLKIEDGPGRPLGRSFGVKLWPTLVFLRDGVEVARVVRPADAKQIEADGF
FT                   AALA"
FT   CDS_pept        428686..429105
FT                   /transl_table=11
FT                   /locus_tag="BCAM0378"
FT                   /product="conserved hypothetical protein"
FT                   /product="hypothetical upf0047 protein sll1880"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0378"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54234"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIW6"
FT                   /protein_id="CAR54234.1"
FT                   /translation="MQQAITHVGVDTRGGGLVEITPQVRAFVDQQAIRTGLLTVFCRHT
FT                   SASLLIQENADPSVQRDIERYFATLAPEDDTRYEHDTEGADDMPAHLRTALTQVQLSIP
FT                   VEHGRMVLGTWQGIYLFEHRRAAHRRDIVLHLLGE"
FT   misc_feature    428734..429096
FT                   /locus_tag="BCAM0378"
FT                   /note="HMMPfam hit to PF01894, Uncharacterised protein
FT                   family UPF0047, score 3.6e-54"
FT                   /inference="protein motif:HMMPfam:PF01894"
FT   CDS_pept        complement(429194..431014)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0379"
FT                   /product="hybrid two-component system kinase-response
FT                   regulator protein"
FT                   /note="Similar to Chromobacterium violaceum probable sensor
FT                   histidine kinase/response regulator (ec 2.7.3.-).
FT                   UniProt:Q7NVX8 (734 aa) fasta scores: E()=7.7e-24, 26.592%
FT                   id in 628 aa; truncated by 100+ amino acids at C terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0379"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54235"
FT                   /db_xref="GOA:B4EIW7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIW7"
FT                   /protein_id="CAR54235.1"
FT                   /translation="MTRRRWKNRKIILVLGSLWIMGFAAWAFLLWDLLATSVNEGVLEG
FT                   PREGVFWTAAQYRNVYTRFDRQLILYATREDEDFDHLQMQLDSLSVSFGFLQRPSEVSQ
FT                   YWLRIPRARNEIDALGEFMTRLKREVPLLRESPMQARQVIDEVNAYWPKVNGLANYFRA
FT                   IEMAQRDFTFHQLKDKQRAILILGIVLGVLLCALFLLLLYTMRTRDDLLERQNAALDAE
FT                   RKASDRAFEMIEAKNAFLGMVSHELRTPLQAICGSIEILLARSQSDANLKTIRRLQNSA
FT                   LSLEALVKDLTDYIKLRSTKRVAELETVGIAPLLAEALEPLREKIVAKRIAVTQLVEPP
FT                   GLAIRSDRKLLRQVLSNLIENSVKYTVGGSITVAITLADAAAGQQLKIAVRDTGAGIAK
FT                   QHLSKIFEPFYRANDAVGLHVDGIGMGLAVVREIVTTLRGHVDVRSVVGEGSEFVVTLP
FT                   VEVPGVDTAGTAAGDAPAPPPALAYHGRRALVVDDNDNARETLGAMLSALGVDADLCGT
FT                   GQEGVARFGTGRYDLVVLDLELPDLSGFDVARRIRAVAEPDDNGRHPAILGVSAYESAA
FT                   LRENQRVFDAFLPKPVHLRELGALVETLLA"
FT   misc_feature    complement(429209..429559)
FT                   /locus_tag="BCAM0379"
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 1e-16"
FT                   /inference="protein motif:HMMPfam:PF00072"
FT   misc_feature    complement(429635..429979)
FT                   /locus_tag="BCAM0379"
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HS, score 1.1e-34"
FT                   /inference="protein motif:HMMPfam:PF02518"
FT   misc_feature    complement(430115..430312)
FT                   /locus_tag="BCAM0379"
FT                   /note="HMMPfam hit to PF00512, His Kinase A
FT                   (phosphoacceptor) domain, score 1.3e-12"
FT                   /inference="protein motif:HMMPfam:PF00512"
FT   misc_feature    complement(join(430403..430471,430910..430978))
FT                   /locus_tag="BCAM0379"
FT                   /note="2 probable transmembrane helices predicted for
FT                   BCAM0379 by TMHMM2.0 at aa 13-35 and 182-204"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(430934..431014)
FT                   /locus_tag="BCAM0379"
FT                   /note="Signal peptide predicted for BCAM0379 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.787 between residues 27 and 28"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(431016..431519)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0380"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0380"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54236"
FT                   /db_xref="GOA:B4EIW8"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIW8"
FT                   /protein_id="CAR54236.1"
FT                   /translation="MRISTIWIKSLLTTCLLGMATAAWAASSFTFTVDGKISKSNQQGK
FT                   MSYVFSEQALMALPQHTIVTSTSWTPKATFTGPRLSDVLKTVGAHGTQIEFRCIDEYTF
FT                   TIPVSDADKYGVILARTMNGKVLGNDNYGPLWIMYPRDQYPDELKTPLGEAKFAWQIIG
FT                   LTVK"
FT   misc_feature    complement(431037..431465)
FT                   /locus_tag="BCAM0380"
FT                   /note="HMMPfam hit to PF00174, Oxidoreductase molybdopterin
FT                   binding d, score 6.5e-07"
FT                   /inference="protein motif:HMMPfam:PF00174"
FT   misc_feature    complement(431412..431519)
FT                   /note="PS00430 TonB-dependent receptor proteins signature
FT                   1."
FT                   /inference="protein motif:Prosite:PS00430"
FT   misc_feature    complement(431433..431501)
FT                   /locus_tag="BCAM0380"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAM0380 by TMHMM2.0 at aa 7-29"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(431445..431519)
FT                   /locus_tag="BCAM0380"
FT                   /note="Signal peptide predicted for BCAM0380 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.986 between residues 25 and 26"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(431588..432463)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0381"
FT                   /product="two-component regulatory system, response
FT                   regulator protein"
FT                   /note="Similar to Chromobacterium violaceum hypothetical
FT                   protein. UniProt:Q7NTP6 (287 aa) fasta scores: E()=8e-14,
FT                   29.555% id in 247 aa; homology does not extend to the C
FT                   terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0381"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54237"
FT                   /db_xref="GOA:B4EIW9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013975"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIW9"
FT                   /protein_id="CAR54237.1"
FT                   /translation="MSTTEQANVDLITANKVRDLLNRNGIPPRSHNTTIANVLGLSFSV
FT                   VTRKMKGLIPWNLSQLQDIATHFGVPPAILLDDKGTQPAAAEMIDATFVIESKRFRCRA
FT                   AISTKATSQIETDFVALQWQGEWIVTEREHAREGRTYPVDVIELRSAQPNVYAARIAVV
FT                   DDSHDVAETVCEYFIEKGVNAIPYFDGASFRKALEVEDFDGYILDWMLGDQTAAELVRG
FT                   IRSSENSGAPIFLLTGKISTGEASEDEIAHIVSHYNARCEEKPVRLPILFAEVARELKL
FT                   TLPAAAAATN"
FT   misc_feature    complement(431636..431992)
FT                   /locus_tag="BCAM0381"
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 0.00089"
FT                   /inference="protein motif:HMMPfam:PF00072"
FT   CDS_pept        432828..433415
FT                   /transl_table=11
FT                   /locus_tag="BCAM0382"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0382"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54238"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B4EIX0"
FT                   /protein_id="CAR54238.1"
FT                   /translation="MYRRLLAPGLLLLLAACAQDPSVTGNTVRICDDTGCSDRPKDQVS
FT                   YQKRDEAEDLEEPRIAALKQTAKTQPKAAYDLGLRYFRGDGVRQDSYQALKWMREAAER
FT                   GDLNAQKALGSFYLFGLEEMGSDAREAEKWLSIAAGRGDKESKKLLDLARKAKKEDEED
FT                   WKWRTQWRDVYYGYWYSGYPYYGVWQQTYWYY"
FT   sig_peptide     432828..432881
FT                   /locus_tag="BCAM0382"
FT                   /note="Signal peptide predicted for BCAM0382 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.778 between residues 18 and 19"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    432846..432878
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    433038..433145
FT                   /locus_tag="BCAM0382"
FT                   /note="HMMPfam hit to PF08238, Sel1 repeat, score 1.1e-09"
FT                   /inference="protein motif:HMMPfam:PF08238"
FT   misc_feature    433146..433256
FT                   /locus_tag="BCAM0382"
FT                   /note="HMMPfam hit to PF08238, Sel1 repeat, score 0.018"
FT                   /inference="protein motif:HMMPfam:PF08238"
FT   CDS_pept        433538..434365
FT                   /transl_table=11
FT                   /locus_tag="BCAM0383"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0383"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54239"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJA4"
FT                   /protein_id="CAR54239.1"
FT                   /translation="MKTNLLQRLTQGALIAALGASVAGCGGVVTPGGQNAGVTGAAAGG
FT                   ASAGADSQLQRCTSPLGTIAVDDGRNADWWGPFGSATKMTTIDPLLRLAVQQSNCFVIT
FT                   SIGNQKSDARLSRITQLQRNSGEYRAGSKQQKGQRVAADYYMEPQIVINDSPIGGIGSM
FT                   IGGLIGNSAVAAVAGHLQTKASVVTLTLFDVRSAVQIAASEGSSTATNYGAALGGFGGG
FT                   VGGALAGFSSTPEGKATVVAFIDAYNKMVVALRSYKAQDVKGGLGRGGQLQVN"
FT   sig_peptide     433538..433645
FT                   /locus_tag="BCAM0383"
FT                   /note="Signal peptide predicted for BCAM0383 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.992) with cleavage site
FT                   probability 0.380 between residues 36 and 37"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    433580..433612
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        434497..435504
FT                   /transl_table=11
FT                   /locus_tag="BCAM0384"
FT                   /product="putative lipoprotein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0384"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54240"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJA5"
FT                   /protein_id="CAR54240.1"
FT                   /translation="MKAVALIALTCLALTACGGGDDNSSPAASGGSGTTNNGGSGGTGG
FT                   TGSGGSGGSGGSGGVTLTWRYEAQPVAADKASFLTLINNEGAKGYRYLGDYFYTAGNGG
FT                   TQSIFVNDGTAQTYTYQLQTAPADMTSFVNAANAQGASGYRYEGPLTYGDLYRKDGGSS
FT                   ATYTYTTTSLPADANAFLTQANGQGQSGYWLLGPLMVGAVQANVYMKNNASNATYTYDA
FT                   LAPTSTVNDFIAQANSEGAKGYRAKGGMAFGTAISWIYVKDQTQSPTFTYQSAAIQSTG
FT                   ASFVQQANTFGAQGGAYLSDLALGTPTPVMASFYFTPKNCTGFLCTTLNPLTQN"
FT   sig_peptide     434497..434586
FT                   /locus_tag="BCAM0384"
FT                   /note="Signal peptide predicted for BCAM0384 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.995) with cleavage site
FT                   probability 0.409 between residues 30 and 31"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    434515..434547
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(435704..436720)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0385"
FT                   /product="1-aminocyclopropane-1-carboxylate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0385"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54241"
FT                   /db_xref="GOA:B4EJA6"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005965"
FT                   /db_xref="InterPro:IPR020601"
FT                   /db_xref="InterPro:IPR027278"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EJA6"
FT                   /protein_id="CAR54241.1"
FT                   /translation="MNLQRFPRYPLTFGPTPIQPLKRLSAHLGGKVELYAKREDCNSGL
FT                   AFGGNKTRKLEYLVPDALAQGADTLVSIGGVQSNQTRQVAAVAAHLGMKCVLVQEHWVN
FT                   YEDPVYDRVGNIQLSRMMGADVRLVADGFDIGIRRSWEEAMESVRQAGGKPYPIPAGCS
FT                   EHPLGGLGFVGFAEEVRAQEAELGFRFDYVVVCSVTGSTQAGMVVGFAADGRADRVIGI
FT                   DASAKPEQTREQITRIARHTAELVGLGRDIVERDVVLDTRYGGPEYGLPSDGTLEAIRL
FT                   CARLEGMLTDPVYEGKSMHGMIDKVRLGEFEPGSKVLYAHLGGAPALSAYNGIFRNG"
FT   misc_feature    complement(435749..436696)
FT                   /locus_tag="BCAM0385"
FT                   /note="HMMPfam hit to PF00291, Pyridoxal-phosphate
FT                   dependent enzyme, score 2.1e-06"
FT                   /inference="protein motif:HMMPfam:PF00291"
FT   CDS_pept        436915..437415
FT                   /transl_table=11
FT                   /locus_tag="BCAM0386"
FT                   /product="AnsC family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0386"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54242"
FT                   /db_xref="GOA:B4EJA7"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJA7"
FT                   /protein_id="CAR54242.1"
FT                   /translation="MKLDRSSASPADAAPALDRIDRAILRQLQQDASISNVSLAAKVKL
FT                   SAPACLRRVERLKEMGLIRGIVALLDPKPLGAGMLVVIGFVLDRSTPETFAAFEKAAQN
FT                   VLGCVECHVVTGEFDYFMLVRTRDNDSFNRLHAEQLLYLPGVRQVRSFMVLKEILSTHA
FT                   LPL"
FT   misc_feature    437155..437385
FT                   /locus_tag="BCAM0386"
FT                   /note="HMMPfam hit to PF01037, AsnC family, score 1.8e-22"
FT                   /inference="protein motif:HMMPfam:PF01037"
FT   misc_feature    437236..437253
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00190"
FT   CDS_pept        437577..439283
FT                   /transl_table=11
FT                   /gene="poxB"
FT                   /locus_tag="BCAM0387"
FT                   /product="pyruvate dehydrogenase [cytochrome]"
FT                   /EC_number="1.2.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0387"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54243"
FT                   /db_xref="GOA:B4EJA8"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJA8"
FT                   /protein_id="CAR54243.1"
FT                   /translation="MAEYLAKTLAAAGVERIWGVTGDSLNGLSFSLSQLGSIRWMHTRH
FT                   EESAAFAAGADAASTGRLAVCAGSCGPGNLHLINGLYDCHRNHQPVLAIAAHIPSTEIG
FT                   LGYFQETHPQELFRECSHFAELVTNASQFPRVLARAMRTAIDERGVAVIVLPGDIALGD
FT                   GPDEAPAWSDAAPPAILPADADLDRLAALLNGSDAVTLLCGSGTQGAHDEVVALADTLG
FT                   APVVHALRGKQFVEWDNPFDVGMTGLIGFSSGYHAMESCDTLLMLGTDFPYRPFYPAHA
FT                   KIAQIDWKGSQLGHRAPLALGLVGTVKETIAALLPRLTRKTQRRFLENALKHYAAARKG
FT                   LDDLAVAEPPGRAIHPQYLTKIIDEVAADDAIFTADVGTPTLWAARYLTMNGKRQLHGS
FT                   FNHGSMANAMPQALGAQGAHPGRQVVSLSGDGGLSMLLGDLLSARQLKLPIKIVVYNNS
FT                   LLGFVSMELKAAGYLDTNVDLSPTDFAAIAKGAGIFSVRVEHSENVEHALRTAFEHDGP
FT                   AVVDVVTSKYELAMPPKIELAHAKGFSLFMLRAILSGRGDEIVELARTNLR"
FT   misc_feature    437580..438080
FT                   /gene="poxB"
FT                   /locus_tag="BCAM0387"
FT                   /note="HMMPfam hit to PF02776, Thiamine pyrophosphate
FT                   enzyme, N-termina, score 2.3e-61"
FT                   /inference="protein motif:HMMPfam:PF02776"
FT   misc_feature    437607..437636
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00339"
FT   misc_feature    438129..438569
FT                   /gene="poxB"
FT                   /locus_tag="BCAM0387"
FT                   /note="HMMPfam hit to PF00205, Thiamine pyrophosphate
FT                   enzyme, central d, score 1.7e-22"
FT                   /inference="protein motif:HMMPfam:PF00205"
FT   misc_feature    438702..439142
FT                   /gene="poxB"
FT                   /locus_tag="BCAM0387"
FT                   /note="HMMPfam hit to PF02775, Thiamine pyrophosphate
FT                   enzyme, C-termina, score 2.6e-50"
FT                   /inference="protein motif:HMMPfam:PF02775"
FT   misc_feature    438813..438872
FT                   /note="PS00187 Thiamine pyrophosphate enzymes signature."
FT                   /inference="protein motif:Prosite:PS00187"
FT   CDS_pept        439751..440341
FT                   /transl_table=11
FT                   /locus_tag="BCAM0388"
FT                   /product="putative phospholipid n-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0388"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54244"
FT                   /db_xref="GOA:B4EJA9"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJA9"
FT                   /protein_id="CAR54244.1"
FT                   /translation="MTWPNAWRVSALFVREWVGRPAAVGALCPSSRHLAREMADAVPDG
FT                   DGLVVELGGGTGAITAALLERGVAPRRLVVVERSPAFVQHLRRRFPGISIVSGDARQLE
FT                   RLLPPGATVDAIVSCLPLRTLRREAVAAIVGQCHRVLSADGVMIQFTYDLRPPGRHPLG
FT                   DSAFVASGSRIVWANLPPARIVTVRCAAAAYAG"
FT   misc_feature    439898..440197
FT                   /locus_tag="BCAM0388"
FT                   /note="HMMPfam hit to PF08241, Methyltransferase domain,
FT                   score 3e-08"
FT                   /inference="protein motif:HMMPfam:PF08241"
FT   misc_feature    439898..440191
FT                   /locus_tag="BCAM0388"
FT                   /note="HMMPfam hit to PF08242, Methyltransferase domain,
FT                   score 2e-07"
FT                   /inference="protein motif:HMMPfam:PF08242"
FT   CDS_pept        440495..441928
FT                   /transl_table=11
FT                   /locus_tag="BCAM0389"
FT                   /product="putative alkaline phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0389"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54245"
FT                   /db_xref="GOA:B4EJB0"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJB0"
FT                   /protein_id="CAR54245.1"
FT                   /translation="MNRIKMAALLCAGAFALAGCGSDDGPTSSTPAPVKTAARNVIFFL
FT                   GDGMGMTTLTAARIYGVGEDGALTIDTLPESAFVKTYSNDAQVTDSAPSMSAYMTGVKT
FT                   NNEVISMSPDTKAIEPSAGLTGNCGANNGKSVSTLLEIAKANGMATGVVTTTRVTHATP
FT                   AATYAHVCHRDAENDIAAQLVPGGAGYNGALGDGVDVVLGGGAQFFVPKDGGGKRTDGR
FT                   NLVNELKAKGYAFAQNRDDLLAADATKRGKLVGLFASSHMSYDLDRGATREPSLADMAT
FT                   RALDVLQANPNGYFLMVEGGRIDHALHDTNAKRALQDTIAFDNAIKATLDKVRKTDPDL
FT                   TNTLIVVTADHDHTLVLNGYAARTGKTEAGKPGVLGVLRSYQTGAIAKDADGAPYTIIG
FT                   FGNGENRVQGSRAGTALTDAVTGADDYRQEAVVRMDKGNETHGGTDVFLGAIGRGADAF
FT                   HGVIENNRVFELVRNAVQL"
FT   sig_peptide     440495..440557
FT                   /locus_tag="BCAM0389"
FT                   /note="Signal peptide predicted for BCAM0389 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.306 between residues 21 and 22"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    440522..440554
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    440588..441607
FT                   /locus_tag="BCAM0389"
FT                   /note="HMMPfam hit to PF00245, Alkaline phosphatase, score
FT                   4.6e-68"
FT                   /inference="protein motif:HMMPfam:PF00245"
FT   CDS_pept        441961..443352
FT                   /transl_table=11
FT                   /locus_tag="BCAM0390"
FT                   /product="putative alkaline phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0390"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54246"
FT                   /db_xref="GOA:B4EJB1"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJB1"
FT                   /protein_id="CAR54246.1"
FT                   /translation="MSTIKCIAAALAVAGFACGAAQAAGQAKNVIFFLGDGMGPTTVTA
FT                   SRIYKVGESGQLTMEKLARTARVKTFSNDAQTTDSAPSMAAYMTGVKMNNEVLSMSSDT
FT                   RAVAPGSDVNGNKTVNHCAPGNGQPVATLLELAKARGKAVGAITTTELTHATPAATYSH
FT                   ICHRDAQYDIAAQAAPGGAGYNAALGDGVDVLMGGGRNHWTPFDPVSNKRGRADGRNLL
FT                   DEMKAKGYTVVATRDQLAQAGNGKLVGLFSSTSHLEYELDRVAGKGEGPTQPSLADMTS
FT                   KAIDVLSKNSNGYFLMVEGGRIDHALHGTNAKRALEDTAAFDEAIRVALSKVDLANTLI
FT                   VVTADHDHTMTINGYSKRGNPILDISRNYRDGQPSKDADGNTYTTLVFGNGANRPNVRA
FT                   SVDSATAMNEAYLQEVGVRMGSAGSETHGGGDVMLFADGADAKAFKGTIDNTKVFGLVR
FT                   SAFGF"
FT   sig_peptide     441961..442029
FT                   /locus_tag="BCAM0390"
FT                   /note="Signal peptide predicted for BCAM0390 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.997 between residues 23 and 24"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    441979..442032
FT                   /locus_tag="BCAM0390"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAM0390 by TMHMM2.0 at aa 7-24"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    441982..442014
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    442021..443085
FT                   /locus_tag="BCAM0390"
FT                   /note="HMMPfam hit to PF00245, Alkaline phosphatase, score
FT                   3.5e-59"
FT                   /inference="protein motif:HMMPfam:PF00245"
FT   CDS_pept        443369..444112
FT                   /transl_table=11
FT                   /locus_tag="BCAM0391"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0391"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54247"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJB2"
FT                   /protein_id="CAR54247.1"
FT                   /translation="MKRQLLCVLACGWVALPAVAAADLDAVLQHESRTVTADGVTRTTL
FT                   YRERMVRRDGHVWVERVLPAAAAGGEHGDDHGHDHDHDAGRRAGVKPAAAHAGHKHFNF
FT                   QAAARHVTYDGKSARIEYVDVANRTVVSVPPAEYETTGFDGSWDNAYYVTPPSQLKRLA
FT                   VAKRGDAPGTVWYEQAVDTPGARGANRILWSERLQAPLSVEYRSADGRVTRKLTLTPAP
FT                   AARRDTLPWQTLAGYSRKEYADYLD"
FT   sig_peptide     443369..443428
FT                   /locus_tag="BCAM0391"
FT                   /note="Signal peptide predicted for BCAM0391 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.804 between residues 20 and 21"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(444218..445357)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0392"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0392"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54248"
FT                   /db_xref="GOA:B4EJB3"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJB3"
FT                   /protein_id="CAR54248.1"
FT                   /translation="MSAAPRNARIDLLRGISILLVLLHHFNIAYSLRDTALARVPGWDT
FT                   IHAIVRNGNYGVTMFFAISGYLITSNARRRWGSLGALDVRAFYVSRIARIVPCLLLLLA
FT                   LVNGLAAAGVPIFANHAPQGVAVSYCLVNLASLTFWMNVLIGAYGWVNYALGVLWSLSV
FT                   EEVFYLSFPLLCIALRRDTRLLAFWLLIAAIGPVYRYTHPGDEGGFLYAYFACFDGIAI
FT                   GCCTALLAERAQWRKLAAAPVQWLVATLMTALYLAWPIAESHVLGVSAMALGTAVLLIG
FT                   AHAERAPARGRLLAPLRWSGRLSYELYLFHLIVLGALRTFWPPSATHGDGKLVLLVAYL
FT                   ALSAGVSAVIARGYATPLDRFIKRAASRPAARVTDSARV"
FT   misc_feature    complement(444275..445339)
FT                   /locus_tag="BCAM0392"
FT                   /note="HMMPfam hit to PF01757, Acyltransferase family,
FT                   score 2.3e-24"
FT                   /inference="protein motif:HMMPfam:PF01757"
FT   misc_feature    complement(join(444293..444361,444389..444448,
FT                   444506..444565,444578..444646,444671..444739,
FT                   444752..444808,444881..444949,445007..445075,
FT                   445154..445222,445265..445324))
FT                   /locus_tag="BCAM0392"
FT                   /note="10 probable transmembrane helices predicted for
FT                   BCAM0392 by TMHMM2.0 at aa 12-31, 46-68, 95-117, 137-159,
FT                   184-202, 207-229, 238-260, 265-284, 304-323 and 333-355"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(445354..446160)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0393"
FT                   /product="putative beta-lactamase, class D"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0393"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54249"
FT                   /db_xref="GOA:B4EJB4"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJB4"
FT                   /protein_id="CAR54249.1"
FT                   /translation="MKPWRPALLAFAGLLAAASSGAHPVCTVVADAATGKVLVQQGDCT
FT                   TRVTPASTFKVAIGLMGFDAGVLKDAHTPTLDFHAGYPDWGGAPWREPTDPARWMKLSI
FT                   FWYSQQVTQALGQARFQQYTSAFGYGNADVTSNEGERPGVMGAWVNASLRISPLEQVAF
FT                   MRRIAQRTLPVSAHAYDMIARITLIDAQPGGWTVHGKTGTGSPGIQYDAAHAYGWFVGW
FT                   ATQGARTLVFANLIQDDARQTPNAGLRARDTFLAALPTLAEPARPQ"
FT   misc_feature    complement(445381..446088)
FT                   /locus_tag="BCAM0393"
FT                   /note="HMMPfam hit to PF00905, Penicillin binding protein
FT                   transpeptid, score 4.1e-51"
FT                   /inference="protein motif:HMMPfam:PF00905"
FT   misc_feature    complement(445558..445581)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   sig_peptide     complement(446095..446160)
FT                   /locus_tag="BCAM0393"
FT                   /note="Signal peptide predicted for BCAM0393 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.420 between residues 22 and 23"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        446486..446836
FT                   /transl_table=11
FT                   /locus_tag="BCAM0394"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0394"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54250"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJB5"
FT                   /protein_id="CAR54250.1"
FT                   /translation="MTFIHPFPAFDVAGRRLRAGPSGDVVPFPPPRPRLQLPVTLTAGS
FT                   AAAAHARLAALLHSPLGVYVVSARAVRNVIHVHFDIAAEDLDFTLHALIAQQVDAVIGP
FT                   IARRLRLPADAG"
FT   CDS_pept        446887..447531
FT                   /transl_table=11
FT                   /locus_tag="BCAM0395"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to middle section of Oryza sativa (japonica
FT                   cultivar-group) p0640e12.104 hypothetical protein
FT                   p0640e12.104. UniProt:Q84NP0 (413 aa) fasta scores:
FT                   E()=1.5, 32.203% id in 118 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0395"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54251"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJB6"
FT                   /protein_id="CAR54251.1"
FT                   /translation="MLFAGWRWWTFVRCVERGATPEQGGPMYLTEEVRVARPAARRAHT
FT                   AALPSGRQLARQLTVTVRAADVLLRQAIRVPDRHQWSVDAERVDAAGGPLAAWDSHVTF
FT                   RIVKAFAPAFDADACAADPDQAAVEIRLFLPEQAYVAERRIGIFGRRHGQRFSATLSVT
FT                   AGSQWGGRRSEHVPPAGRHVHGDTLEALVDTVAGIVNAALRAAGHGATGHR"
FT   CDS_pept        complement(447559..448434)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0396"
FT                   /product="LysR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0396"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54252"
FT                   /db_xref="GOA:B4EJB7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJB7"
FT                   /protein_id="CAR54252.1"
FT                   /translation="MKMLDHDVLATVVAVAETGNMTRAAEAVNRSQSAVSMQIKSLEDA
FT                   IGRPLFVRKPRSIVLTREGEVLLGFARRMLALRDEAWAAVVRPEVTGKVVIGVPDDYAS
FT                   SLLPSVLKKFSATYPKVEIQVMGLPSSALAPLIKEGTVDLVCGTRIKGLSGDFIRHEPM
FT                   AWAAMTNGPRVWEERPLPIAVFMPGSVARENAIRSLERAKVPYRTSYESPSLLGLLSMV
FT                   EAGLAVAPLARCAIPAQLSMLGRSHGLPDLPPLELILARSTKSKRPPCDFLAEQLMEDL
FT                   QRQTGQTGDA"
FT   misc_feature    complement(447577..448176)
FT                   /locus_tag="BCAM0396"
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 1.1e-21"
FT                   /inference="protein motif:HMMPfam:PF03466"
FT   misc_feature    complement(448240..448419)
FT                   /locus_tag="BCAM0396"
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix, score 2.3e-21"
FT                   /inference="protein motif:HMMPfam:PF00126"
FT   misc_feature    complement(448285..448377)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00044"
FT   misc_feature    complement(448315..448380)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1625.000, SD 4.72 at aa 19-40, sequence
FT                   GNMTRAAEAVNRSQSAVSMQIK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        448563..449915
FT                   /transl_table=11
FT                   /locus_tag="BCAM0397"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0397"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54253"
FT                   /db_xref="InterPro:IPR021830"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJB8"
FT                   /protein_id="CAR54253.1"
FT                   /translation="MQHRTRKRGVSMIDHPLRAALAAELHARPFLRLAEAVSLTHYAIY
FT                   ADGQPDIHETLLHALCRDTGIDAPHEGATHHAVQSPCGWYLKWERHTEFSTFTFVAPRR
FT                   DTGYFDDRAIAGIPVAWFARLAGIRFVAVRMELLSGDAARRVCGDLRRWIDGPALVGSH
FT                   VLGGGKVFCDWHVRDDGFMRFLVVDEDFREEQGGRLLQRLYEIETYRMMALLALPVARG
FT                   MSRELDEIHAALHALMQRMDASGADGDDAALLVKLTHLAVRVESLSGSGARFSASRAYE
FT                   KLVLARIQELREERIEGMPTLAEFMERRFAPAMETCRSVWARHEQIAARIARAVDLLRT
FT                   RVNLAQEKDVTRLLAGMERTARNQLHLQHAVEGLSVAAISYYVLSLATAAFKALHVMNL
FT                   PVDPELAEGLLIAPVVFAVIHITRRTRAQLARSEAAHDGTPVQAVALKQAS"
FT   CDS_pept        449959..450150
FT                   /transl_table=11
FT                   /locus_tag="BCAM0398"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0398"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54254"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJB9"
FT                   /protein_id="CAR54254.1"
FT                   /translation="MQTQSDCLSGIDAFDQPVRDEAGAPEAGRVTSYQALLQEPTTSLV
FT                   GGAIDRPEVAAVAILGYN"
FT   CDS_pept        complement(450257..451186)
FT                   /transl_table=11
FT                   /gene="cynR"
FT                   /locus_tag="BCAM0399"
FT                   /product="LysR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0399"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54255"
FT                   /db_xref="GOA:B4EJC0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJC0"
FT                   /protein_id="CAR54255.1"
FT                   /translation="MLLRHIHYFLAVAEHRSFTRAAAALHVSQPALSQQIRQLEDTLGA
FT                   QLFDRTGRVTRLTDAGDVYFRYARQALHDLAEGRRAIHDVQDLSRGSLRLAVTPTFTSY
FT                   LVGPLVEAFHDRYPDVSLSVREMSQERIEALLVDDELDVGIAFEDVQTADIDAQTLLVE
FT                   TLALVVNRGHALGGKRKAGLRALHDAPLVLLTAEFATRTQIDRYFRAHDVQPRVLMEAN
FT                   SLGAVIEIVRRTTLATLLPATIAVEHDDLVAVALDPAVLRRTAVLLQRRGAYRSAAARA
FT                   FVELALAHGAERSRREGSARATRNKASG"
FT   misc_feature    complement(450314..450931)
FT                   /gene="cynR"
FT                   /locus_tag="BCAM0399"
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 8.1e-48"
FT                   /inference="protein motif:HMMPfam:PF03466"
FT   misc_feature    complement(451001..451180)
FT                   /gene="cynR"
FT                   /locus_tag="BCAM0399"
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix, score 2.7e-25"
FT                   /inference="protein motif:HMMPfam:PF00126"
FT   misc_feature    complement(451046..451138)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00044"
FT   misc_feature    complement(451076..451141)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1958.000, SD 5.86 at aa 16-37, sequence
FT                   RSFTRAAAALHVSQPALSQQIR"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        451300..451959
FT                   /transl_table=11
FT                   /gene="cynT"
FT                   /locus_tag="BCAM0400"
FT                   /product="carbonic anhydrase"
FT                   /EC_number="4.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0400"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54256"
FT                   /db_xref="GOA:B4EJC1"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJC1"
FT                   /protein_id="CAR54256.1"
FT                   /translation="MKDIIEGFLKFQRDAYPARAALFRDLARSQNPRALFISCSDSRLV
FT                   PELVTQREPGDLFVIRNAGNIVPSYGPEPGGVSASVEYAVAALRVTDVVICGHSDCGAM
FT                   TAIATCQCMDHMPAVGHWLRYADSARVVNEARTHRSERERIDSMVRENVVAQLANLKTH
FT                   PAVRLALEEGRLALHGWVYDIESGCIDAYDGATGRFVSLADHPGVRATPATLPVAA"
FT   misc_feature    451378..451878
FT                   /gene="cynT"
FT                   /locus_tag="BCAM0400"
FT                   /note="HMMPfam hit to PF00484, Carbonic anhydrase, score
FT                   5.9e-86"
FT                   /inference="protein motif:HMMPfam:PF00484"
FT   misc_feature    451414..451437
FT                   /note="PS00704 Prokaryotic-type carbonic anhydrases
FT                   signature 1."
FT                   /inference="protein motif:Prosite:PS00704"
FT   misc_feature    451543..451605
FT                   /note="PS00705 Prokaryotic-type carbonic anhydrases
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00705"
FT   CDS_pept        451990..452460
FT                   /transl_table=11
FT                   /gene="cynS"
FT                   /locus_tag="BCAM0401"
FT                   /product="cyanate hydratase"
FT                   /EC_number="4.2.1.104"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0401"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54257"
FT                   /db_xref="GOA:B4EJC2"
FT                   /db_xref="InterPro:IPR003712"
FT                   /db_xref="InterPro:IPR008076"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR036581"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EJC2"
FT                   /protein_id="CAR54257.1"
FT                   /translation="MIQSQHSQTARHALAETVVLAKARKNLSFAQLTDGTGLSEAFVTA
FT                   ALLGQHALPADAARIVADKLGLDDDAVLLLQTIPLRGSIDDRVPTDPTIYRFYEMLQVY
FT                   GTTLKALVHEKFGDGIISAINFRLDVKKVDDPEGGSRAVITLDGKYLPTKPF"
FT   misc_feature    452236..452457
FT                   /gene="cynS"
FT                   /locus_tag="BCAM0401"
FT                   /note="HMMPfam hit to PF02560, Cyanate lyase C-terminal
FT                   domain, score 9.2e-54"
FT                   /inference="protein motif:HMMPfam:PF02560"
FT   CDS_pept        452558..453025
FT                   /transl_table=11
FT                   /gene="guaD"
FT                   /locus_tag="BCAM0402"
FT                   /product="guanine deaminase"
FT                   /EC_number="3.5.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0402"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54258"
FT                   /db_xref="GOA:B4EJC3"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJC3"
FT                   /protein_id="CAR54258.1"
FT                   /translation="MDFVKRTIDLAMKNVEEGGRPFATVIVRDGEIVAESPNLVAQTSD
FT                   PTAHAEILAVRDACRTLGTEHLTDCEIYILASPCPMCLGSLYYCSPKRVIYITTREDYA
FT                   PFYRDDRKYFELDTFYAEYAKPIEERRLPMVQRKHDGAIDVYRRWKELNAK"
FT   misc_feature    452558..452851
FT                   /gene="guaD"
FT                   /locus_tag="BCAM0402"
FT                   /note="HMMPfam hit to PF00383, Cytidine and deoxycytidylate
FT                   deaminas, score 2.1e-20"
FT                   /inference="protein motif:HMMPfam:PF00383"
FT   misc_feature    452702..452815
FT                   /note="PS00903 Cytidine and deoxycytidylate deaminases
FT                   zinc-binding region signature."
FT                   /inference="protein motif:Prosite:PS00903"
FT   CDS_pept        453189..453623
FT                   /transl_table=11
FT                   /locus_tag="BCAM0403"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0403"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54259"
FT                   /db_xref="GOA:B4EJC4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJC4"
FT                   /protein_id="CAR54259.1"
FT                   /translation="MTPHPDVILQLTDTGQPAARDFISRKLGEFNHAMTGRADAAALDV
FT                   YVTDSATGEVLGGLTGRTSLGLFFIDLFYLPESLRGGGFGSRLLREAEAEAKRRGCARA
FT                   VLYTISFQAPDFYRKHGYETFGEVPCEPAGAARVFMVKVL"
FT   misc_feature    453327..453557
FT                   /locus_tag="BCAM0403"
FT                   /note="HMMPfam hit to PF00583, Acetyltransferase (GNAT)
FT                   family, score 4.1e-10"
FT                   /inference="protein motif:HMMPfam:PF00583"
FT   CDS_pept        complement(453685..454581)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0404"
FT                   /product="LysR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0404"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54260"
FT                   /db_xref="GOA:B4EJC5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJC5"
FT                   /protein_id="CAR54260.1"
FT                   /translation="MKIDTLGVQAFVAIADGGSFRQAADTLHVTQTAITQRLRKLESYL
FT                   GVALVERTTRRTTLTEIGRRFLPQARRLLNELSDALTEIRETGLSQRGDVTIACVPTVG
FT                   VQYLPRILRAFSGHRPHDRVKILDHASASVLQAVLRREAEFGISIAGDQHPELVSVPLT
FT                   HDPYVLVCRDDHPLAKRRRIRWAALQPHPLIFAGEVSGNRGLLEGALKTSGVSLHSFYE
FT                   VQRSSTALGLVAEGLGAAVVPKLAIQKNAYPMIRTIELVEPSVSRTLVLVTRRSAQLSP
FT                   AARALYDMIVERAAPGR"
FT   misc_feature    complement(453697..454320)
FT                   /locus_tag="BCAM0404"
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 1.7e-47"
FT                   /inference="protein motif:HMMPfam:PF03466"
FT   misc_feature    complement(454390..454569)
FT                   /locus_tag="BCAM0404"
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix, score 3.7e-17"
FT                   /inference="protein motif:HMMPfam:PF00126"
FT   misc_feature    complement(454435..454527)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00044"
FT   misc_feature    complement(454465..454530)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1631.000, SD 4.74 at aa 18-39, sequence
FT                   GSFRQAADTLHVTQTAITQRLR"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        454720..455505
FT                   /transl_table=11
FT                   /locus_tag="BCAM0405"
FT                   /product="putative trans-aconitate 2-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0405"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54261"
FT                   /db_xref="GOA:B4EJC6"
FT                   /db_xref="InterPro:IPR023149"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJC6"
FT                   /protein_id="CAR54261.1"
FT                   /translation="MTTPLDQYATQYVQFEDERTRPVRDLLAAVPKTPIHTAIDIGCGP
FT                   GNSTEALIARAPDATIHGIDASADMIAAARKRLPALRFDLADVAAWDDPGGYDLILSNA
FT                   VLQWVPAHDTLFPMLVGRLAPGGHLAVQMPDNLDEPAHRLMREVAADGPWADKLKGAAR
FT                   TERFDARYYHALLAPLCSRVDVWRTTYYHPLRGGADAVVEWFKGSALRPFLAALDAPEQ
FT                   RAFVARYRDALAGPDGYPAQDDGTVLLPFPRLFIVATRK"
FT   misc_feature    454834..455112
FT                   /locus_tag="BCAM0405"
FT                   /note="HMMPfam hit to PF08241, Methyltransferase domain,
FT                   score 5.3e-18"
FT                   /inference="protein motif:HMMPfam:PF08241"
FT   misc_feature    454834..455106
FT                   /locus_tag="BCAM0405"
FT                   /note="HMMPfam hit to PF08242, Methyltransferase domain,
FT                   score 4.9e-19"
FT                   /inference="protein motif:HMMPfam:PF08242"
FT   CDS_pept        complement(455536..456126)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0406"
FT                   /product="putative acetyltransferase-GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0406"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54262"
FT                   /db_xref="GOA:B4EJC7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR008125"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJC7"
FT                   /protein_id="CAR54262.1"
FT                   /translation="MDRAEHISIEPALALAADELDGCDFSFDIAWELNAPYQDLLDLRA
FT                   LPVRRKDYGFDPAGWASGASGRTALFRATAGERLAGFVAIEESWNGMAEIAELAVDRQY
FT                   RRQGIGQFLLAAAEAWARSHGFGFMRLETQANNVAACSTYARAGFALGGHDRFLYADGE
FT                   NAGEVALFWYKDLRDGQTARSRTVDPASVPAVR"
FT   misc_feature    complement(455677..455916)
FT                   /locus_tag="BCAM0406"
FT                   /note="HMMPfam hit to PF00583, Acetyltransferase (GNAT)
FT                   family, score 9.9e-21"
FT                   /inference="protein motif:HMMPfam:PF00583"
FT   CDS_pept        456872..458035
FT                   /transl_table=11
FT                   /locus_tag="BCAM0407"
FT                   /product="putative porin"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0407"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54263"
FT                   /db_xref="GOA:B4EJC8"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJC8"
FT                   /protein_id="CAR54263.1"
FT                   /translation="MKKTIVAAATLGMFGTAAHAQSSVTLYGLIDAGVTYSNKVATTGG
FT                   HGKLVKYGDGVASGSRWGIRGTEDLGGGLKALFVLENGFSSGDGSIGQGGALFGRQAFV
FT                   GLSKNGIGSLTFGRQYSFSTDYIGANYTMGSQTPAGNYAYHINDLDQLTSSRINNAVKF
FT                   QSANFAGLTFGAMYGFSNSTQFAGTPTTTGTNGAQGASSAYSFGANYAQGPFGIGAAYT
FT                   NIRFPNGATPAFGVSIANINTFGLRDLETVGVGARYAIAAGLVWANWTHTKFTPLSGES
FT                   SKLNNYEIGGRYAFSPALSGGLGYTFSKLDGRYDGKWHQVNAAVDYALSKRTDVYVSAA
FT                   YQKASGSNTINGRVVPVQAEIGSSPSFVGSAGANTQFVTRIGLRHKF"
FT   sig_peptide     456872..456931
FT                   /locus_tag="BCAM0407"
FT                   /note="Signal peptide predicted for BCAM0407 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.995 between residues 20 and 21"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    456965..458032
FT                   /locus_tag="BCAM0407"
FT                   /note="HMMPfam hit to PF00267, Gram-negative porin, score
FT                   1.8e-07"
FT                   /inference="protein motif:HMMPfam:PF00267"
FT   misc_feature    457100..457126
FT                   /note="PS00572 Glycosyl hydrolases family 1 active site."
FT                   /inference="protein motif:Prosite:PS00572"
FT   CDS_pept        complement(458105..460552)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0408"
FT                   /product="putative phospholipase C"
FT                   /note="Similar to Burkholderia pseudomallei (Pseudomonas
FT                   pseudomallei) PlcN non-hemolytic phospholipase C precursor
FT                   UniProt:Q9RGS8 (EMBL:AF107252) (700 aa) fasta scores:
FT                   E()=3.1e-63, 46.788% id in 716 aa; homology does not extend
FT                   to the far C-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0408"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54264"
FT                   /db_xref="GOA:B4EJC9"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="InterPro:IPR008475"
FT                   /db_xref="InterPro:IPR017767"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJC9"
FT                   /protein_id="CAR54264.1"
FT                   /translation="MQNTPTTRRRFLADALKLAGATAVTGMLPESILRAQSIPAASVTG
FT                   TLQDVKHVVILMQENRSFDHYLGTLRGARGFGDPRPVVISSGYPVWRQPAPLSYVFPFN
FT                   PSPPVSGVANGDTYYGDLDHSWNGTHSAWNNGRYDNWVGAKTSGTMYYFTQNDIPFYHA
FT                   LASAFTVCDAYHCSMLGPTDPNRLYLWTGCCGNVAGYSPYTNNTMTGTGWTTMPERLNT
FT                   AGVTWKFYQDKGNGLDAGHGYGEYNGSKRDLWWNGNYGDNVILNFRQYQNLGANDPLAP
FT                   ALNGTQIDPTGGGKEYDTNLFSQLRADVANGTLPQVSWIAAPYAYCEHPSWAASGGEWY
FT                   VSNVLDALTSNPAVWASTVLLVMYDENDGLFDHVPPAVPASAAAGTGRSTVSTAAEFVA
FT                   GGGAASDGSASGDTPIGLGPRVPMFVISPWSKGGKVNSQVFDHTSVIRFLEARFGLQET
FT                   NITPWRRAVCGDLTSAFDFANPDQTIPAIPAATSNMDPNGSTVLIPPATTTAVPAQTAG
FT                   RTPACRLPYEFFVQGKVNRAGKTLGLTMTNTGAAAVHLQAWVDGTSTIPRHYTIGAGTG
FT                   TCVTDALALNSGGGYDYSIYGPNGFLQTLRGNIGAAGSAGSTAEVSLCYDVQNGNVLIT
FT                   LDNAAGASATTFQLVDNAYGMNSAQSVSVRAGATRTVTWYGDAGWYDASIRDANDPGFL
FT                   RRIAGCVQAQSGTLLTDSAIGNTNGKFVAALSSQGASYGTLRFDYVVPPWRHSPKNWVG
FT                   IYPRGAQPTKGGYKSWAYLPKSTGSLLFSSTANSALASGQYDAWFLFDDGYTPLAGPVA
FT                   ISI"
FT   misc_feature    complement(458453..458719)
FT                   /locus_tag="BCAM0408"
FT                   /note="HMMPfam hit to PF05506, Domain of unknown function
FT                   (DUF756), score 1.6e-12"
FT                   /inference="protein motif:HMMPfam:PF05506"
FT   misc_feature    complement(458729..458995)
FT                   /locus_tag="BCAM0408"
FT                   /note="HMMPfam hit to PF05506, Domain of unknown function
FT                   (DUF756), score 1.2e-16"
FT                   /inference="protein motif:HMMPfam:PF05506"
FT   misc_feature    complement(459185..460405)
FT                   /locus_tag="BCAM0408"
FT                   /note="HMMPfam hit to PF04185, Phosphoesterase family,
FT                   score 2.7e-130"
FT                   /inference="protein motif:HMMPfam:PF04185"
FT   CDS_pept        complement(460594..460854)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0408a"
FT                   /product="putative membrane protein"
FT                   /note="no significant database matches"
FT                   /note="doubtful CDS, but contains significant hydrophobic
FT                   feature"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0408a"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54265"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJD0"
FT                   /protein_id="CAR54265.1"
FT                   /translation="MKYGIRSIHSNHSGIRLDQGHSRTVPPRPAASRIPHWRGVFMIAL
FT                   LCTLAGCGDGDSSPAGNIAAARASAPASASAPVVHCATACH"
FT   misc_feature    complement(460699..460731)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(460900..461577)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0409"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0409"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54266"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJD1"
FT                   /protein_id="CAR54266.1"
FT                   /translation="MHKNLALFDLDHTLLPLDSDQAWSRFITRVGQEDDAHTALIDEHY
FT                   GHYAAGTLDMDAYLAVTLAPLTRYPREQLERWHAQFMDEVIRPAITPQARALVDRHREN
FT                   GDLCCIVTATNVFVTRPIAAEFGIEHLLGIELDTDDGTPAGRFTGRSIGVPSFREGKIV
FT                   RTAAWLASLGYAASDFERTYFYSDSINDVPLLDYVTHPVATNPDAKLSGVAGTRGWPVM
FT                   KLF"
FT   CDS_pept        complement(461601..462545)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0410"
FT                   /product="putative ABC-type glycine betaine transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0410"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54267"
FT                   /db_xref="GOA:B4EJD2"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJD2"
FT                   /protein_id="CAR54267.1"
FT                   /translation="MMKKAWMLAATLLTALATAPAHASEGDVCRKVTLGDVGWSDIAAT
FT                   TGVAMMLLDGLGYEATKTIASPPIVLAGVKKAQIDAFLGYWDPSMTPTVKPFVDAGAVH
FT                   LLPQPNLVGARYTLAVPQYASDKGLKRFADIARFRDQLDGKIYGIGAGNNGNALIQRMI
FT                   DKNEFGLGGFKLVESSEAGMLVQVTRAVQEHRMIVFLAWEPHPMNLQYKIAYLDGGDTV
FT                   FGPNYGSAKVYTLVSPGYLERCPNVGRLLTNLTFTTDEENQLMVPIMNHADPIAVAKEW
FT                   AKKNPGVLSKWLDGVTTIDGKNAKDAIDKLIGA"
FT   misc_feature    complement(461694..462458)
FT                   /locus_tag="BCAM0410"
FT                   /note="HMMPfam hit to PF04069, Substrate binding domain of
FT                   ABC-type glycine, score 2.3e-63"
FT                   /inference="protein motif:HMMPfam:PF04069"
FT   sig_peptide     complement(462477..462545)
FT                   /locus_tag="BCAM0410"
FT                   /note="Signal peptide predicted for BCAM0410 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 1.000 between residues 23 and 24"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        462810..463490
FT                   /transl_table=11
FT                   /locus_tag="BCAM0411"
FT                   /product="MgtC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0411"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54268"
FT                   /db_xref="GOA:B4EJD3"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJD3"
FT                   /protein_id="CAR54268.1"
FT                   /translation="MISQLEIIARLLLAALLGSLVGIERERLSWAAGLRTHMLVAVGAA
FT                   LVMVVSAFGFADIQDAKNVSLDPSRVAAQVVSGIGFLGAGSIMLRGEIIRGLTTAASLW
FT                   VVAAVGLAVGGGMYVAAIAATAIVLAILAGLKPIEKRFFATRQRWGVRILASRGAVKLT
FT                   SLQAMPGIDQARIVRFIIEQDDATPDDDRIHVVFSKMTSGEFQVARQSLQTLAGIKKLE
FT                   ESAG"
FT   misc_feature    462840..463259
FT                   /locus_tag="BCAM0411"
FT                   /note="HMMPfam hit to PF02308, MgtC family, score 1.7e-51"
FT                   /inference="protein motif:HMMPfam:PF02308"
FT   misc_feature    join(462909..462977,463020..463076,463113..463208)
FT                   /locus_tag="BCAM0411"
FT                   /note="3 probable transmembrane helices predicted for
FT                   BCAM0411 by TMHMM2.0 at aa 34-56, 71-89 and 102-133"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        463535..464302
FT                   /transl_table=11
FT                   /locus_tag="BCAM0412"
FT                   /product="DeoR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0412"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54269"
FT                   /db_xref="GOA:B4EJD4"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJD4"
FT                   /protein_id="CAR54269.1"
FT                   /translation="MWQEERYQRIRLLLSKMQRVSTDRIMAELNVSRETVRRDLVDLEA
FT                   LGELKRVHGGAVQVGDEAPIAERAQTHVKAKLAIARAAARLVSGSQTLFIDAGTTTTLL
FT                   AEELAKLSGLTIVTNSIDVALKMRSGDPAQAKNETILLGGMIGSRAAATVGDGTVAEIF
FT                   RYRADLALLSPVGVDHVRGATNYDRMETEVARAMVSNAAEVAILADFSKLGTNSRIGFC
FT                   EPARIGTLVTDQKAESVDSYKNIRKVIKNIVLS"
FT   misc_feature    463550..463720
FT                   /locus_tag="BCAM0412"
FT                   /note="HMMPfam hit to PF08220, DeoR-like helix-turn-helix
FT                   domain, score 4.3e-13"
FT                   /inference="protein motif:HMMPfam:PF08220"
FT   misc_feature    463550..463708
FT                   /locus_tag="BCAM0412"
FT                   /note="HMMPfam hit to PF08279, HTH domain, score 4.4e-05"
FT                   /inference="protein motif:HMMPfam:PF08279"
FT   misc_feature    463550..463654
FT                   /note="PS00894 Bacterial regulatory proteins, deoR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00894"
FT   misc_feature    463592..463657
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1095.000, SD 2.92 at aa 20-41, sequence
FT                   VSTDRIMAELNVSRETVRRDLV"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    463751..464233
FT                   /locus_tag="BCAM0412"
FT                   /note="HMMPfam hit to PF00455, Bacterial regulatory
FT                   proteins, deoR family, score 9.1e-32"
FT                   /inference="protein motif:HMMPfam:PF00455"
FT   CDS_pept        464421..464786
FT                   /transl_table=11
FT                   /locus_tag="BCAM0412a"
FT                   /product="LysR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0412a"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54270"
FT                   /db_xref="GOA:B4EJD5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJD5"
FT                   /protein_id="CAR54270.1"
FT                   /translation="MKTPAHPKPEVRFRMRIQQADTIALGPGKVALLEAVREHGSISAA
FT                   ARSLNMSYRRAWLLMDELNRSLKSPATVSEHGGQSGGGSVLTPVGEEIIRLYRGIEARA
FT                   YAACADEIAALTKMVRR"
FT   misc_feature    464499..464693
FT                   /locus_tag="BCAM0412a"
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix protei, score 5.7e-14"
FT                   /inference="protein motif:HMMPfam:PF00126"
FT   CDS_pept        complement(464817..466166)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0413"
FT                   /product="conserved hypothetical protein"
FT                   /note="Low level of similarity to Nitrosomonas europaea
FT                   hypothetical protein. UniProt:Q82UF2 (439 aa) fasta scores:
FT                   E()=1.2e-14, 25.607% id in 453 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0413"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54271"
FT                   /db_xref="InterPro:IPR016772"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJD6"
FT                   /protein_id="CAR54271.1"
FT                   /translation="MHAPPFRLARTADLSSPGGHSPAAAGTRIDACCAPSRAQQVELTR
FT                   RARLSELDANLHCSIIGTCLTTHELRKLVPKFADVDRQRATDLEIHHAAVELAIGGTAG
FT                   AKALHKALDERYAGAIRAFDGAKDADALVARWKDALASGDIPPAYWALMTHPRATMAVR
FT                   QVAFGDVHMLSHLVGAANRADIRRLVALERENAELHAKLERQQARLHEMSTQRDAALQE
FT                   RDALHAHRHAPPLAAESVLRDEVHALREALAARDERLALHTSRREAAEQRIAAEQASAR
FT                   AMRARLDDLMAMVKTLRAEASALEQAVQASTDDPAEHAAHSLSILRGTRVVYVGGRPGS
FT                   NRAIRRIVETAGGEVTLHDGGIEDRKGLLAAALPGARMVVFPVDCIDHDSMNLLKRTCE
FT                   RHHIAYYPLRTASVASFVELIGRLDAQARDVIMPNAAASDTSSRFCLRHG"
FT   CDS_pept        complement(466286..466834)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0414"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0414"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54272"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJD7"
FT                   /protein_id="CAR54272.1"
FT                   /translation="MTRTATDRTPLHNAREQPFARKISALKPLSSDARAQQVTDVVDAF
FT                   RRLRGSVARFIRMFSAAHAEAMPDDALSAMGLRELLSMLEHEARTARFTRLPELERAIG
FT                   HARRLERTRDDVFSDAFSNDPAAMRRAVIALERVDVLFVGLCVESVIARHAPASASTPV
FT                   PPAAPAVVPQPIDRSTALC"
FT   misc_feature    complement(466412..466441)
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00339"
FT   CDS_pept        complement(466954..468444)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0415"
FT                   /product="betaine aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0415"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54273"
FT                   /db_xref="GOA:B4EJD8"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJD8"
FT                   /protein_id="CAR54273.1"
FT                   /translation="MTVMSTAELSRSTHPFVLPAARIAGQPVRTHSDTIGAPVFNASTG
FT                   NTIGWQEFATPAHVDAAVRAARDAFAGWRDTPPAERGRVLAAIAGRVDAARERLAALQM
FT                   QVSGKPPFEADADVGDVVATFAYYAKLCEDPALFAAEPVALPSDAVTAERFHDPVGVAA
FT                   LVMPWNFPMVTTAWKLAPALAAGCAVVLKPSELTSPTEHALLDIVIEAGVPAGVVNVVN
FT                   GDAEVGAALTTHPLIDKISFTGSTAAGRKVMQAAAIDMKRVTLELGGKSSLIVRDDADL
FT                   DVAVSLAVAGAFTNAGQMCSATARILVHDSLYRSFMAAFETAVRALVVAPPGTDQVAMG
FT                   PLISAAHRARVEAMLEHGVDAGARIAFSGRVADAGGAGFFMAPVVIAEPAADNPLWTDE
FT                   VFGPVACVKSFRTDDEAIALANDTRYGLVATVVTRDAAVARRFQRRVRAGLVWINAPQL
FT                   IYPHVCWGGFGLSGIGRELGVAGLRSYQELRHAMRAID"
FT   misc_feature    complement(466972..468354)
FT                   /locus_tag="BCAM0415"
FT                   /note="HMMPfam hit to PF00171, Aldehyde dehydrogenase
FT                   family, score 2.4e-176"
FT                   /inference="protein motif:HMMPfam:PF00171"
FT   misc_feature    complement(467533..467568)
FT                   /note="PS00070 Aldehyde dehydrogenases cysteine active
FT                   site."
FT                   /inference="protein motif:Prosite:PS00070"
FT   CDS_pept        complement(468458..469408)
FT                   /transl_table=11
FT                   /gene="AGMAT"
FT                   /locus_tag="BCAM0416"
FT                   /product="putative agmatinase"
FT                   /EC_number="3.5.3.11"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0416"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54274"
FT                   /db_xref="GOA:B4EJD9"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJD9"
FT                   /protein_id="CAR54274.1"
FT                   /translation="MPRELNQPMGGNEMPRFGGIATMMRLPQATTTDGLDACFVGVPLD
FT                   LGTSNRSGARFGPRQIRTESVLLRPYNMATRAAPFDSLQVADIGDVATNPYDLKDSVRR
FT                   IEEAYDAIVANGCRPITLGGDHTIAWPILRALHRKYGKVAVVHVDAHADVNDTMFGEKI
FT                   AHGTPFRRAVEDGLLQCDKVTQIGLRGTGYHADDFDWCRQQGFTVVQAEDCWNKSLAPL
FT                   MAQVRERVGDTPVYLSFDIDGLDPSFAPGTGTPEIGGLTVQQGLEIVRGMKGLNIVGAD
FT                   LVEVSPPYDPAGTTALTGANLAFEMLCVMPGVAYR"
FT   misc_feature    complement(468476..469312)
FT                   /gene="AGMAT"
FT                   /locus_tag="BCAM0416"
FT                   /note="HMMPfam hit to PF00491, Arginase family, score
FT                   1.5e-67"
FT                   /inference="protein motif:HMMPfam:PF00491"
FT   misc_feature    complement(468632..468697)
FT                   /note="PS01053 Arginase family signature 3."
FT                   /inference="protein motif:Prosite:PS01053"
FT   misc_feature    complement(468950..468976)
FT                   /note="PS00148 Arginase family signature 2."
FT                   /inference="protein motif:Prosite:PS00148"
FT   misc_feature    complement(469004..469045)
FT                   /note="PS00147 Arginase family signature 1."
FT                   /inference="protein motif:Prosite:PS00147"
FT   CDS_pept        complement(469563..470447)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0417"
FT                   /product="LuxR superfamily regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0417"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54275"
FT                   /db_xref="GOA:B4EJE0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJE0"
FT                   /protein_id="CAR54275.1"
FT                   /translation="MLLNVNPFHRDDDHFNVSFKALGELIETVGTPHFVPRLTQLLNDV
FT                   VPLDVAHVERSRVDGTMPTGYRCEWIGSSGIGTEATEISDVMTLYYERFLDSDPLFAGL
FT                   RGKTGTMLVVRDIAAIPPGEFRQRIYDDVHIGHECVLARGTRYSQHSIALERGRDRPPF
FT                   TLAEMNRFRSISDVLFPLLELHASTTAARRIAHPTPDVHPLAQFDARLAAGDVKLSKRE
FT                   YETCKHLLSGKTVPEAAAILGVRVASAESYVKRAFAKLGVRTKRELSAWGSAAAALPAA
FT                   GAHDDDAPPAIPR"
FT   misc_feature    complement(469632..469805)
FT                   /locus_tag="BCAM0417"
FT                   /note="HMMPfam hit to PF00196, Bacterial regulatory
FT                   proteins, luxR family, score 0.00016"
FT                   /inference="protein motif:HMMPfam:PF00196"
FT   CDS_pept        470653..470997
FT                   /transl_table=11
FT                   /locus_tag="BCAM0418"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0418"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54276"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJE1"
FT                   /protein_id="CAR54276.1"
FT                   /translation="MTKLIKDILPLGAGVGEFTKLDFGMDESDWRAAEGKSGNYIVGWW
FT                   EGKAGSVEFPETAADEAVWLVEGRIALTDVEGNRKEFTPGQGYLLPAGFAGRWETIEDA
FT                   KKFYVLLEQS"
FT   misc_feature    470752..470976
FT                   /locus_tag="BCAM0418"
FT                   /note="HMMPfam hit to PF05899, Protein of unknown function
FT                   (DUF861), score 1.3e-05"
FT                   /inference="protein motif:HMMPfam:PF05899"
FT   CDS_pept        471089..472543
FT                   /transl_table=11
FT                   /locus_tag="BCAM0419"
FT                   /product="putative FAD dependent oxidoreductase"
FT                   /note="N-terminus is similar to Streptomyces avermitilis
FT                   hypothetical protein. UniProt:Q82K18 (511 aa) fasta scores:
FT                   E()=3.3e-43, 44.631% id in 298 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0419"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54277"
FT                   /db_xref="GOA:B4EJE2"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJE2"
FT                   /protein_id="CAR54277.1"
FT                   /translation="MEVNEAKRTAPVDAHALRGAPVALGVEAALANTKLFPYWLDNPAA
FT                   PAAEPALVGDVTADLLIVGGGFTGLWSAVQAKEQMPHLNVVLIEAGKVAHGASGRAGGI
FT                   ISTSVMHGLPNAVRVFPNDIAQLEAFGHRNLDGFEETLKRYDIDADIEWNGEMTVAVDP
FT                   EHLVHLKGDYDLHREYGHDVVLLNRDETLAQLNSPLFAGALWSRNRSGIVHPAKLAWGL
FT                   KRAALQLGVTLYEHTPLTSVTDEGSTVFVKTPKGSVRAPRVVFGSGTAKVGIPDINRRV
FT                   MQVRDHVLATEPLTDAQLARIGWKNRQGVYDTRTQLNYFRLTKNNNIIFGGLVSYHFDG
FT                   DPEPHQDGRRETYYRLAEAFYRTFPQLSDVRFSHAWGGPIDYCSRGSVFAKRYLGDKAV
FT                   FVAGYTGFGVAASRFGAFMGLNILFDRDSPERKLDIANQSPSYIPPEPMRWVAAKITFH
FT                   AFDGADAEGGWKRAWISGLKAMGFPM"
FT   misc_feature    471263..472354
FT                   /locus_tag="BCAM0419"
FT                   /note="HMMPfam hit to PF01266, FAD dependent
FT                   oxidoreductase, score 4.3e-60"
FT                   /inference="protein motif:HMMPfam:PF01266"
FT   CDS_pept        472631..473821
FT                   /transl_table=11
FT                   /locus_tag="BCAM0420"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0420"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54278"
FT                   /db_xref="GOA:B4EJE3"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJE3"
FT                   /protein_id="CAR54278.1"
FT                   /translation="MNVVNLQDEARQESALFVVVMLLLGMLGPTVFLGLPAIVGQVERH
FT                   WGFGEAALGLSSFIEVLGESTGTLLVAFVLGRQPVRLVLAGAVTLAAGANLGTLATHGL
FT                   VAYSTLQFVAGVGSGGLNGIALRYLSYSRAPERNLGIMLMGQVMWSMVLLAYLFPLLSG
FT                   TWGAYGVFGFVACVLGMFVLATPLFRRGETMAAPTPAGAVGGIDRKGAMLVLCAQLALY
FT                   GGVGVVWTFLEKIGTDAGLSGRSVSLVLGVANVASLVICAAMPKLGAGAGLRRWTLMNL
FT                   GGCAVAAVLLAMPASVATFTLGAIVFIGCWTGGALLIYATIPQYDLIGKSAALSPGCVA
FT                   LGYGVGSVAGGSLIERAGTQSALFAAIVLCAVAFLCYGRLRPAVFGMARPLAVAPE"
FT   misc_feature    join(472676..472744,472787..472855,472874..472942,
FT                   472955..473023,473042..473110,473123..473191,
FT                   473258..473326,473369..473437,473456..473509,
FT                   473519..473587,473624..473692,473702..473770)
FT                   /locus_tag="BCAM0420"
FT                   /note="12 probable transmembrane helices predicted for
FT                   BCAM0420 by TMHMM2.0 at aa 16-38, 53-75, 82-104, 109-131,
FT                   138-160, 165-187, 210-232, 247-269, 276-293, 297-319,
FT                   332-354 and 358-380"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    473126..473158
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    473528..473560
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        473945..474865
FT                   /transl_table=11
FT                   /locus_tag="BCAM0421"
FT                   /product="LysR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0421"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54279"
FT                   /db_xref="GOA:B4EJE4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJE4"
FT                   /protein_id="CAR54279.1"
FT                   /translation="MFSNTTDLDLRLIRVFLAVVDARGITAAEASLGVRQSTISTQLSA
FT                   LEARVGFKLCDRGRGGFRLTSKGERFAATARTLVAATSEFVARVRDIDRKLVGTLSIGL
FT                   IGQAPLVENARVADAIGAFRQRDQAVTFAMKVASPQELEESLVNNQLDLAIGYFWHRVP
FT                   GLLYTPLFTEQQVIYCGRGHPLFHASRPVTADDLQLHDWVWRTYPVPEEQYPLPERRVT
FT                   ASADSIEAATILILSGGHLGYLPAHYAEPFEQRGLVKAVGRATFSFDVPLHLAMKRSTS
FT                   DKPIVDAFCEDLLRAFNIKAAALAA"
FT   misc_feature    473972..474151
FT                   /locus_tag="BCAM0421"
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix, score 5.5e-13"
FT                   /inference="protein motif:HMMPfam:PF00126"
FT   misc_feature    474011..474076
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1076.000, SD 2.85 at aa 23-44, sequence
FT                   RGITAAEASLGVRQSTISTQLS"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    474221..474838
FT                   /locus_tag="BCAM0421"
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 2.6e-27"
FT                   /inference="protein motif:HMMPfam:PF03466"
FT   CDS_pept        complement(474881..475711)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0422"
FT                   /product="LuxR superfamily regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0422"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54280"
FT                   /db_xref="GOA:B4EJE5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJE5"
FT                   /protein_id="CAR54280.1"
FT                   /translation="MRLLQPDPAARGHYLIGVRPDTLGATLRAVGTPDFVDAVTEFVND
FT                   SIDADAVHLERWRADPASTSGFVVEWLGSGSLRFAADTLRVMDVYYQDYCQTDPLVAPL
FT                   RGKAGTLLVQRHVAGIAQGEFRRRIFDEPGIAQECLLVHGNAHQQYALGLARTVERAAF
FT                   TTDELFHFRQMVDLLFPMFELHARTCAARRVAAVSVNAASQASFDARLERQHVQLSRRE
FT                   HEICRLMLCGRSVPEAAQQLDVKLSTAESYVKRAFAKLGVRTRRELFDWVLVDC"
FT   misc_feature    complement(474896..475069)
FT                   /locus_tag="BCAM0422"
FT                   /note="HMMPfam hit to PF00196, Bacterial regulatory
FT                   proteins, luxR fami, score 1.6e-07"
FT                   /inference="protein motif:HMMPfam:PF00196"
FT   misc_feature    complement(474932..475090)
FT                   /locus_tag="BCAM0422"
FT                   /note="HMMPfam hit to PF08281, Sigma-70, region, score
FT                   3.8e-06"
FT                   /inference="protein motif:HMMPfam:PF08281"
FT   CDS_pept        475910..477676
FT                   /transl_table=11
FT                   /locus_tag="BCAM0423"
FT                   /product="putative amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0423"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54281"
FT                   /db_xref="GOA:B4EJE6"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJE6"
FT                   /protein_id="CAR54281.1"
FT                   /translation="MKALRKPDDQKGQAMQIQPTPAAATPADFVLTHARVYTVDPHRPW
FT                   AQAVAVRDGRIVHVGDTASVRAYVGANTKVVDAARRLVLPGFVESHWHFETTAFAFQAF
FT                   VNYEDPHQVLAALRTYVESHPDEPAITGMGWVQATIPPAMLRKETLDAVCADRPVCLLS
FT                   TDFHSMWVNSKALEIAGIDASTPPVQEGASWFEKDAATGEPTGLIVDGAAYSLLLQRIS
FT                   AAGLLPTGIDLYLKSIPPWQEKLCAAGVTTVFDAGFFDASGDQSLLYETLQTMERAGDL
FT                   KLRVVGSVAVIGEIDDPVGTLVRYRERYDSPLVKARALKLFLDGTEANHTAYLLEPYAD
FT                   RPDTCGAPTMPADTFNRYLVDADRANANVMVHCVGDAAVRMALDGFDAVNRTNPPRDRR
FT                   HVITHAFLTHPDDIPRFRRAGVMANTQLQWGVVDAYTEQLRDHYGHERWSNMYTFRTFV
FT                   DAGVTVSIGMDGLACQCRCQHKPLEHIESGHTRQLAGEPDAPVFPDIAERLSIPQLIAA
FT                   YTIHGAYQLGMEHEVGSLTPGKRADLVVLERDLFEVGQYDIGRIDVGLTMMGGRITHVG
FT                   DDFGARTGLQAS"
FT   misc_feature    476153..477544
FT                   /locus_tag="BCAM0423"
FT                   /note="HMMPfam hit to PF07969, Amidohydrolase family, score
FT                   1.9e-64"
FT                   /inference="protein motif:HMMPfam:PF07969"
FT   misc_feature    476582..477550
FT                   /locus_tag="BCAM0423"
FT                   /note="HMMPfam hit to PF01979, Amidohydrolase family, score
FT                   0.0021"
FT                   /inference="protein motif:HMMPfam:PF01979"
FT   CDS_pept        477855..478970
FT                   /transl_table=11
FT                   /locus_tag="BCAM0424"
FT                   /product="putative polyamine transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0424"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54282"
FT                   /db_xref="GOA:B4EJE7"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJE7"
FT                   /protein_id="CAR54282.1"
FT                   /translation="MAGDWKHRVKNACAALALGGFAGAGVPVAQAADVVNVYNWGNSIG
FT                   KATIANFEKATGIKVVYQEFDSNETLQAKLLSGTSGYDVVVPSDIFWARQLQAGIYRKI
FT                   DRSQVPNYGLLDPDIMKVLSRDDPGNQFGIPWTWGTDGLGMNVEKVKAALGADAPLDSW
FT                   SLLFDPKYAKKLKRCGVSVLDSPVDAFGMAFVYLKKDPNTTNPADYQAAYELLKTVRPY
FT                   ITQFNSSSYINDLAGGDICLALGWSGDVNSARIAAAAAKKPYRIKYVIPTEGSAMWFDM
FT                   MAIPKDAPHPDAALKFVNFVLSEQESANLTNDTSYPSAVPSSRHLVRAEVTSDPAVFPP
FT                   ADVIRRLSLSKPVPPELMRLQNRLWTKLKTE"
FT   sig_peptide     477855..477947
FT                   /locus_tag="BCAM0424"
FT                   /note="Signal peptide predicted for BCAM0424 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.978 between residues 31 and 32"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    477879..478778
FT                   /locus_tag="BCAM0424"
FT                   /note="HMMPfam hit to PF01547, Bacterial extracellular
FT                   solute-binding prot, score 1.5e-14"
FT                   /inference="protein motif:HMMPfam:PF01547"
FT   CDS_pept        479059..480657
FT                   /transl_table=11
FT                   /locus_tag="BCAM0425"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0425"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54283"
FT                   /db_xref="InterPro:IPR021485"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJE8"
FT                   /protein_id="CAR54283.1"
FT                   /translation="MNIKHMTVLCALAFDTAAAFAHTPHATDANRMKALQAQVTALQRQ
FT                   VNALRASMLAAKPAGAATTAAPPPTVTTAASAGAKIGTINTAAAAAQAAESAPAFTNDD
FT                   LQQMREQIANASLKVDALQEAATTGPLAGLSITGYVDPVYLFNRAQHTSGFQFLNHDPG
FT                   AYDYFNSTIGDVYLDIRKTFGVGPMAPSAEIVIQPNRGFGNVFSNAHGGIGNNIVTQAQ
FT                   VNVPLGTTRTFEIGMMPSLAGYEVQPSNQMLTLTHGLLYDFSEPGNLVGIGLKGSNAAM
FT                   TRFWQVVIGNEVLRTAGAIANAANNTTKPNWTPTITARFDNATSTAFDFGLSGMLGRQS
FT                   LFSPCAAGGYGYQCNGSSPTGLYKYVEADMTYTHDKTQINAQVDYGELQKGAWNGGTAR
FT                   WYGMSLLGHTKWTTSWLGRMGATLRFDYLNNASNGGGGTNIQYGLAGGNPSVNGSSGFG
FT                   IDPSCFQGSATNGTECKGAQRYAITADLLFYPTQQITVKVEYRHDAANHPVFLKSNGTY
FT                   ARSNDLAGMQFIYSF"
FT   sig_peptide     479059..479121
FT                   /locus_tag="BCAM0425"
FT                   /note="Signal peptide predicted for BCAM0425 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.953 between residues 21 and 22"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        480754..481830
FT                   /transl_table=11
FT                   /locus_tag="BCAM0426"
FT                   /product="cysteine peptidase/transferase, family C45"
FT                   /note="family C45 cysteine peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0426"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54284"
FT                   /db_xref="GOA:B4EJE9"
FT                   /db_xref="InterPro:IPR005079"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJE9"
FT                   /protein_id="CAR54284.1"
FT                   /translation="MKLHTFATDVTDPRERGRLIGARFAPAIRETVALYLAFFPKLGID
FT                   PQRARAIGEASLAALDAWCPRLAAEVEATADGADLPRWQLACLNARTEILATAPASAEG
FT                   ECSTTVYAPAGPHAPRTLQTWDWHDSLAPQGLLMRFATPQRRTVKLFTEFGMLAKLGVN
FT                   DAGLGLHFNILHHASDADGGGVPVHAIARRLLEDATTVQEAVELARTARVSASTVLTAF
FT                   TRHDANPRAASIELSPSGVGVVVPRPDGWLLHTNHFLDHALSGGECMPDSSTTRERFAH
FT                   LNAVVAGMTGADVRERAAAMCGAAGDAAVVCFHPDRSMPDTERWETLLTVGIDTDACAL
FT                   DYVAGNPHDLARDGFMRF"
FT   misc_feature    481090..481821
FT                   /locus_tag="BCAM0426"
FT                   /note="HMMPfam hit to PF03417, Acyl-coenzyme
FT                   A:6-aminopenicillanic acid acy, score 2.7e-06"
FT                   /inference="protein motif:HMMPfam:PF03417"
FT   CDS_pept        complement(481895..483286)
FT                   /transl_table=11
FT                   /gene="dgoT"
FT                   /locus_tag="BCAM0427"
FT                   /product="D-galactonate transporter"
FT                   /note="Contains 30 amino acid N-terminal extension in
FT                   comparison to some proteins"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0427"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54285"
FT                   /db_xref="GOA:B4EJF0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJF0"
FT                   /protein_id="CAR54285.1"
FT                   /translation="MGQSASRTHANPPERPSAHPGALPESRSAARATATATTPPSRKRL
FT                   LILALLFVTVVINYLDRSNLSIAAPELFKELNIDPVRAGLVFSAFGWTYALMQIPGGWL
FT                   VDKVSPRVLYAGALALWSAATLLLGFAGSFVGLIVLRLAVGALEAPAYPINNRVVTTWF
FT                   PTRERASAIGGYTSGQFVGLAFLTPVLAWLQVHLGWHMVFVATGLAGIAWAAIWYAVYR
FT                   EPRALRGVNAAEIALIRDGGGLVDLEDRVAARSERAPSTWRDLGVVLGRRKLWGIYLGQ
FT                   FALNSTLWFFLTWFPTYLVKYRGMDFIKSGFLASLPFLAAFVGVLCSGVLSDWLMRRGA
FT                   SQGFARKLPIISGLLISTCIIGANYVSSTGWVIAFMTIAFFGNGFASITWSLVSGLAPA
FT                   RLLGLTGGVFNLVGNLSAIATPIVIGLLVDGADFSHAITYIAAMALAGSLSYGLLVGKV
FT                   ERIDA"
FT   misc_feature    complement(join(481922..481990,482003..482071,
FT                   482108..482176,482186..482245,482282..482350,
FT                   482393..482461,482627..482695,482708..482776,
FT                   482861..482929,482972..483040))
FT                   /gene="dgoT"
FT                   /locus_tag="BCAM0427"
FT                   /note="10 probable transmembrane helices predicted for
FT                   BCAM0427 by TMHMM2.0 at aa 83-105, 120-142, 171-193,
FT                   198-220, 276-298, 313-335, 348-367, 371-393, 406-428 and
FT                   433-455"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(482000..483136)
FT                   /gene="dgoT"
FT                   /locus_tag="BCAM0427"
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 1.3e-62"
FT                   /inference="protein motif:HMMPfam:PF07690"
FT   CDS_pept        complement(483469..484332)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0428"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0428"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54286"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJF1"
FT                   /protein_id="CAR54286.1"
FT                   /translation="MTRSPRFRPLPRVAALLFATCASIAPAAHAAKPLLEFKVDDTVTA
FT                   RVERADGAHVTVRFLPSGKTQTLDVTAADEEGRYHLATDDYNFDGRRDLAMRAMLGMVN
FT                   EQYGIYLYDAARQRFEPLKMPAGDGPHGNCDALINVEAKPKARTLYSSCRSGPIWYTDA
FT                   YRFDGTGRMYLYQTSEAVPDDLRDLLDGESGPSSMLLTYDEHGKRVSRRPQGHDGGTVA
FT                   FKVRPARLPLHDAMRAAPTRRYVVAGDKVELIDASDDFQWLKVRYRNPRAGAVQGWVST
FT                   KEAMAD"
FT   sig_peptide     complement(484243..484332)
FT                   /locus_tag="BCAM0428"
FT                   /note="Signal peptide predicted for BCAM0428 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 1.000 between residues 30 and 31"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(484373..484747)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0429"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0429"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54287"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJF2"
FT                   /protein_id="CAR54287.1"
FT                   /translation="MLKELHATVGAATSDLDDDESFANIYCHDAEQDYCFALSRFPDDA
FT                   LIEVMVRDQLNVRVKDLSVRLTDDTIDVEIEPGIAARLDGQTRYVIHLAPGQHDPGTLR
FT                   AALKEIFVGKSGYRDDSTPR"
FT   CDS_pept        complement(484765..485106)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0430"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0430"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54288"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJF3"
FT                   /protein_id="CAR54288.1"
FT                   /translation="MRLLGGRWRLLLVSYLLDGPRRFSDLRRDMPGISQRMLTLDLRAL
FT                   EDAGLVRRTVYPEVPVRVEYDLTADGERLRPVVDVMREFGLWLKARDAHTDAMPDTAAA
FT                   IETTMHAHK"
FT   misc_feature    complement(484831..485100)
FT                   /locus_tag="BCAM0430"
FT                   /note="HMMPfam hit to PF01638, HxlR-like helix-turn-helix,
FT                   score 3.6e-38"
FT                   /inference="protein motif:HMMPfam:PF01638"
FT   CDS_pept        485282..485914
FT                   /transl_table=11
FT                   /locus_tag="BCAM0431"
FT                   /product="glutathoine S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0431"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54289"
FT                   /db_xref="GOA:B4EJF4"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJF4"
FT                   /protein_id="CAR54289.1"
FT                   /translation="MKLYHAPGSCSQAICIVLREADIDAEIVKVDARKHVVDGGRDYYD
FT                   VNELGYVPLLELDDGTLLREGPVIAQYLADQLPEAALAPAYGTLARYRLMEWLNFLGTE
FT                   IHKGFIPLLYAVQAGKYVEPVRQKLDGRFAWIDRQLDGRTFLTGDTFTVADAYLFALTG
FT                   WGKADWMRSVYNADIDLSRHAHLRAWYERVRERPAVQAVLAADNLLR"
FT   misc_feature    485282..485506
FT                   /locus_tag="BCAM0431"
FT                   /note="HMMPfam hit to PF02798, Glutathione S-transferase,
FT                   N-terminal domain, score 0.00045"
FT                   /inference="protein motif:HMMPfam:PF02798"
FT   misc_feature    485579..485872
FT                   /locus_tag="BCAM0431"
FT                   /note="HMMPfam hit to PF00043, Glutathione S-transferase,
FT                   C-terminal domain, score 5.3e-09"
FT                   /inference="protein motif:HMMPfam:PF00043"
FT   CDS_pept        486002..486388
FT                   /transl_table=11
FT                   /locus_tag="BCAM0432"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0432"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54290"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJF5"
FT                   /protein_id="CAR54290.1"
FT                   /translation="MKLLRTFILLLLCAVLPITGLAASGLTGECPMQYTMSMDADTGMN
FT                   MAMSADMSDCDSMQPPSADHAKAKAKGMACKVTAQCQFGSLYHPAARADVNRPAAFAST
FT                   IVFHYTQSVPARDPNGLWRPPRIS"
FT   sig_peptide     486002..486067
FT                   /locus_tag="BCAM0432"
FT                   /note="Signal peptide predicted for BCAM0432 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.420 between residues 22 and 23"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    486020..486088
FT                   /locus_tag="BCAM0432"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAM0432 by TMHMM2.0 at aa 7-29"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        486444..487772
FT                   /transl_table=11
FT                   /locus_tag="BCAM0433"
FT                   /product="efflux system outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0433"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54291"
FT                   /db_xref="GOA:B4EJF6"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJF6"
FT                   /protein_id="CAR54291.1"
FT                   /translation="MESLWVPIWGYTMSFVFRTLRMPRAGRRAPVPWVALLVAGAVHAQ
FT                   PSPLTLDAALQSATDRSASMQAAQASVLARSEAAVKAGQLPDPMLKAGIDNLPINGGQR
FT                   FTVGQDFMTMRRIGIEQEWVSGDKRRLRTALADEQVGRERAGYLVQLAAVRRQTATAWL
FT                   DAIYAKQALALQQALLGHMNHELDATQASYRGAKASAGDVVQARAMLAQTQDQVLKAQQ
FT                   AYRTALIALARWTAVPVTDVAGTPPAPESFVSALPPDELRLSQPALVAAADDIAVAEAD
FT                   AAVANSERSPNWTWEIAYQQRGGAYSNMVSIGVSIPLPLNRKNRQNRDVAEKAALATKA
FT                   RLMYEDTLRQVQADIRTQSDTLASGRERIANLSAALLPAADQHVQLATAAYRAGTGPLA
FT                   DTFAARRAQLEAQLQVLDLRRDVSQTWAQLEYQVVPSAMAAAQ"
FT   sig_peptide     486444..486575
FT                   /locus_tag="BCAM0433"
FT                   /note="Signal peptide predicted for BCAM0433 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.945) with cleavage site
FT                   probability 0.945 between residues 44 and 45"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    486594..487151
FT                   /locus_tag="BCAM0433"
FT                   /note="HMMPfam hit to PF02321, Outer membrane efflux
FT                   protein, score 2.8e-05"
FT                   /inference="protein motif:HMMPfam:PF02321"
FT   misc_feature    487200..487745
FT                   /locus_tag="BCAM0433"
FT                   /note="HMMPfam hit to PF02321, Outer membrane efflux
FT                   protein, score 5.3e-05"
FT                   /inference="protein motif:HMMPfam:PF02321"
FT   CDS_pept        487784..489319
FT                   /transl_table=11
FT                   /locus_tag="BCAM0434"
FT                   /product="putative cation efflux protein"
FT                   /note="contains 90 amino acid C terminal extension"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0434"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54292"
FT                   /db_xref="GOA:B4EJF7"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJF7"
FT                   /protein_id="CAR54292.1"
FT                   /translation="MTRQSLMRAALIASAGAVLVGAGYFAGVRHATNGAATAAMPAAAP
FT                   SGIPSGVPAQQAARKVLYWHDPMVPNQHFDKPGKSPFMDMQLQPVYADESGAAAGIRID
FT                   PGLQQNLGIRYATVRRQQTAAGFDAVGTTQFDEARAEVVQSRVTGYIDHLYARAPMQRI
FT                   AKGAPVASLFVPDWLAPQEEYLALKRGGMDGNLLDAARARMRALSIPDGMIATLDRTGR
FT                   AQTHVVLSAPETGVVSELNVRDGAMVAPGQTLAKIAGLATLWLIVEVPEALALNVQPGM
FT                   SVDATFAGDPARHFSGRIREVLPGISTGSRTLQARVEIDNASLKLTPGMLMRVRVAAKE
FT                   TVSRLLVPSEAVIATGRRTIVIAKLGDGRLQPVSVTVGNDVGGDTEVLGGLNEGDTVVA
FT                   SGQFLIDSEASLKSVLPRLERAAGASSAASSATASAPVYETTGKVEKVTSDDITFSHQP
FT                   VPALGWGAMTMAFGKPSAHAFPDVKPGQTVRFAFTQADDGYRLTKVEPQGGER"
FT   sig_peptide     487784..487876
FT                   /locus_tag="BCAM0434"
FT                   /note="Signal peptide predicted for BCAM0434 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.656 between residues 31 and 32"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    487808..487867
FT                   /locus_tag="BCAM0434"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAM0434 by TMHMM2.0 at aa 9-28"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        489316..492522
FT                   /transl_table=11
FT                   /gene="cusA"
FT                   /locus_tag="BCAM0435"
FT                   /product="cation efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0435"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54293"
FT                   /db_xref="GOA:B4EJF8"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJF8"
FT                   /protein_id="CAR54293.1"
FT                   /translation="MIARLIHWSVHHRFLVLLATVLLAAWGVHSLRQTPLDALPDLSDT
FT                   QVIVKASYPGKAPQVVEDQVTYPLTTTLLGVPGAKTVRAYSSFGDAFVYVLFDDRTDPY
FT                   WARSRVLEYLSQVQSRLPAGATVSLGPDATGVGWVYEYALVDRPGRHDLGQLRALNDWF
FT                   LKFELKAVPDVSEVASIGGMVRQYQVVLDPDKLRAYGITQAAVAEALGKANQASGGSVV
FT                   ELAESEYMVRSSGYLRTLDDFRHVVLRTDDTGTPVLLGDVARIQVGPAMRRGIAELNGQ
FT                   GEVTGGVVVMRSGKNALTTIDAVKAKLADLKRSLPAGVEIVTTYDRSQLIARAVDNLTD
FT                   KLIEEFVIVGVVCAVFLFHLRSALVAILSLPLGVLAAFIVMRYQGVNANLMSLGGIAIA
FT                   IGAMIDAAIVMIENAHKHLEAYDHAHPGEPLTAARRWELVAASAAEVGPALFFSLLIIT
FT                   LSFVPVFSLEGQEGKLFAPLAFTKTYTIAAAAGLSVTLVPVLMGYLVRGRIPHEHANPI
FT                   NRVLIRLYRPLLEATLRRPWAAIGVAVIALVLTAVPLSRLGGEFMPPLDEGDLLYMPTA
FT                   LPGISADKASELLQQTDRLIKTVPEVDTVFGKSGRADTATDPAPLEMFETTIRFKPRST
FT                   WRPGMTPEKLVDELDRTVRVPGLSNVWVPPIRNRLDMLSTGIKTPVGVKISGPDLTGID
FT                   AIATQVEAAVKRVPGVTSALAERLNGGRYVDVDIDRLAAARYGLSVADIQSVVSSAIGG
FT                   EDVGEVIAGRERFPINIRYPREIRDSLENLRQLPVVTARGAQIRLGDVARVAIADGPPM
FT                   IRSENARLSGYVYVDLRGVDLSTAVRAMQQAVARQVALPPGYSIAWSGQFEYLERAAAT
FT                   LRTVVPVTLVVIFVLLFVTFDSAADALLLMSTVPFALVGGFWLVWALGHAVSVATSVGF
FT                   IALAGVAAEFGVVMLLYLKGALQRRLDAGEPPTDALLLDAIREGAVLRVRPKAMTVAVV
FT                   LAGLVPIMIGHGAGSEVMQRIAAPMVGGMVTAPLLSMFVIPAAWLLLQRRRARSAGRAR
FT                   HSDAVPPGTNVPSLPTGESR"
FT   sig_peptide     489316..489405
FT                   /gene="cusA"
FT                   /locus_tag="BCAM0435"
FT                   /note="Signal peptide predicted for BCAM0435 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.971) with cleavage site
FT                   probability 0.467 between residues 30 and 31"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    489328..492426
FT                   /gene="cusA"
FT                   /locus_tag="BCAM0435"
FT                   /note="HMMPfam hit to PF00873, AcrB/AcrD/AcrF family, score
FT                   1.1e-224"
FT                   /inference="protein motif:HMMPfam:PF00873"
FT   misc_feature    join(489352..489405,490339..490392,490405..490473,
FT                   490483..490551,490636..490704,490762..490830,
FT                   490912..490980,491920..491988,492007..492075,
FT                   492085..492153,492268..492327,492355..492423)
FT                   /gene="cusA"
FT                   /locus_tag="BCAM0435"
FT                   /note="12 probable transmembrane helices predicted for
FT                   BCAM0435 by TMHMM2.0 at aa 13-30, 342-359, 364-386,
FT                   390-412, 441-463, 483-505, 533-555, 869-891, 898-920,
FT                   924-946, 985-1004 and 1014-1036"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        492519..492887
FT                   /transl_table=11
FT                   /locus_tag="BCAM0436"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0436"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54294"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJF9"
FT                   /protein_id="CAR54294.1"
FT                   /translation="MKMNQLIAAATAVVALSAFAVPALAAGEMSNMDMSGMKMSSDGAA
FT                   ESNAALTDAEVKKVDAASGKITLKHGALQNVGMPPMTMAFKAKDAAMLAQAHAGDKVKV
FT                   RIEKVDGTLTIVKLVKGS"
FT   sig_peptide     492519..492593
FT                   /locus_tag="BCAM0436"
FT                   /note="Signal peptide predicted for BCAM0436 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.902 between residues 25 and 26"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    492537..492605
FT                   /locus_tag="BCAM0436"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAM0436 by TMHMM2.0 at aa 7-29"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(492995..494005)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0437"
FT                   /product="putative sodium/calcium exchanger protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0437"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54295"
FT                   /db_xref="GOA:B4EJG0"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJG0"
FT                   /protein_id="CAR54295.1"
FT                   /translation="MTFMFVELAFMLVVILVAAEVFTNALEHLGERLKISEGVTGSLFA
FT                   AVGTALPETMVPLLALAGGTSNQAVNEEIGVGAILGAPLMLATLTTFLMTLAVIRTRGL
FT                   RGTIAPERTGFVRDMNTFLAAFSLATVAMFVPHHNWAVRALLAAMLVGLYVMYVVMTFR
FT                   ASTGLVDAGHGTEAPHAMLLSRIGLPTNLATIVLQLLIGVALLVGGAKGFIHGVEGVSH
FT                   VLGVSALLLSLIIVPIATELPEKVNSVLWIRRGKDTLAFGNITGAMVFQGTLLPAIGIM
FT                   LTPWEPRPEVLTGVIITLAAAAWLRVNARTRGLAIWALLANGAGYAGYLAVTLAR"
FT   misc_feature    complement(join(493001..493069,493082..493135,
FT                   493163..493231,493292..493351,493394..493462,
FT                   493520..493588,493598..493651,493712..493780,
FT                   493823..493891,493928..493996))
FT                   /locus_tag="BCAM0437"
FT                   /note="10 probable transmembrane helices predicted for
FT                   BCAM0437 by TMHMM2.0 at aa 4-26, 39-61, 76-98, 119-136,
FT                   140-162, 182-204, 219-238, 259-281, 291-308 and 313-335"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(493007..493396)
FT                   /locus_tag="BCAM0437"
FT                   /note="HMMPfam hit to PF01699, Sodium/calcium exchanger
FT                   protein, score 1.5e-10"
FT                   /inference="protein motif:HMMPfam:PF01699"
FT   misc_feature    complement(493523..493969)
FT                   /locus_tag="BCAM0437"
FT                   /note="HMMPfam hit to PF01699, Sodium/calcium exchanger
FT                   protein, score 8e-13"
FT                   /inference="protein motif:HMMPfam:PF01699"
FT   sig_peptide     complement(493949..494005)
FT                   /locus_tag="BCAM0437"
FT                   /note="Signal peptide predicted for BCAM0437 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.822) with cleavage site
FT                   probability 0.573 between residues 19 and 20"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_RNA        complement(494124..494242)
FT                   /locus_tag="BCAMr0437"
FT                   /note="yybP-ykoY element as predicted by Rfam, score 66.75"
FT   CDS_pept        494360..494635
FT                   /transl_table=11
FT                   /locus_tag="BCAM0438"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0438"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54296"
FT                   /db_xref="GOA:B4EJG1"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJG1"
FT                   /protein_id="CAR54296.1"
FT                   /translation="MSHTVREKQKLLNRVRRIKGQVEAIERALEEERGCNDVLQLITSC
FT                   RGAMNGLLAVVLEDHIRSHLVDADTPDAHEGSATEQLIEVVHSYFK"
FT   misc_feature    494441..494629
FT                   /locus_tag="BCAM0438"
FT                   /note="HMMPfam hit to PF02583, Uncharacterised BCR,
FT                   COG1937, score 3.7e-06"
FT                   /inference="protein motif:HMMPfam:PF02583"
FT   CDS_pept        494648..495667
FT                   /transl_table=11
FT                   /locus_tag="BCAM0439"
FT                   /product="putative cation efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0439"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54297"
FT                   /db_xref="GOA:B4EJG2"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJG2"
FT                   /protein_id="CAR54297.1"
FT                   /translation="MNEFDGAAAGGAHSHAFLGAAHARNERKTWMVIGLCTAMMIAEIV
FT                   GGTLFGSLALVADGLHMSTHAGAMLIAALAYTYARRHADDPRFVFGTGKLGDLAGFTSA
FT                   IVLAMIAVLIGYEAIARLLAPVPIHFGEAIPIAVLGLAVNLASVWLLSGDHHHGHGHGH
FT                   HHAHGHDRHDDHDHDHDDAHHAHHAHGSHSAAHHDHNIRSAYVHVIADAAVSVLAIVGL
FT                   LLARAFGWVWMDPLAGIVGALVIANWAYGLMRDTGRILLDVNVDRKLTDNVRRAIEALG
FT                   DTVNDLHVWRVGPGHMSAIVSVESADTARDARFYHALVAGFDGVSHVTVEVLTPAKAA"
FT   misc_feature    494732..495664
FT                   /locus_tag="BCAM0439"
FT                   /note="HMMPfam hit to PF01545, Cation efflux family, score
FT                   4.2e-56"
FT                   /inference="protein motif:HMMPfam:PF01545"
FT   misc_feature    join(494741..494809,494822..494881,494939..495007,
FT                   495035..495103,495254..495322,495335..495403)
FT                   /locus_tag="BCAM0439"
FT                   /note="6 probable transmembrane helices predicted for
FT                   BCAM0439 by TMHMM2.0 at aa 32-54, 59-78, 98-120, 130-152,
FT                   203-225 and 230-252"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        495670..495855
FT                   /transl_table=11
FT                   /locus_tag="BCAM0440"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0440"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54298"
FT                   /db_xref="InterPro:IPR010710"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJG3"
FT                   /protein_id="CAR54298.1"
FT                   /translation="MAVKSPCIELCAFDGRTGFCVGCLRTRDEARDWKKLTDHRRHQIL
FT                   NDRTRRQAKLRRDTAE"
FT   misc_feature    495679..495846
FT                   /locus_tag="BCAM0440"
FT                   /note="HMMPfam hit to PF06945, Protein of unknown function
FT                   (DUF1289), score 2.5e-16"
FT                   /inference="protein motif:HMMPfam:PF06945"
FT   CDS_pept        495946..497154
FT                   /transl_table=11
FT                   /locus_tag="BCAM0441"
FT                   /product="Major Facilitator Superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0441"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54299"
FT                   /db_xref="GOA:B4EJG4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJG4"
FT                   /protein_id="CAR54299.1"
FT                   /translation="MQTDSSTGILRQIPRSVWVLGCVSLLMDVSSEIIHSLLPMFLMAG
FT                   LGASATTIGLIEGIAEATSPVVKVFSGTLSDYLRNRKWLAVTGYALGALSKPLFAIAPT
FT                   IGVVVTARIVDRVGKGIRGAPRDALVADVTPVHLRGAAYGLRQSLDTVGAFLGPLLAVV
FT                   IMLVWRDDFRLAFWLAVIPGVLAVALLAFGIDEPARAPGEPRVNPIRREVVAQLGARYW
FT                   WVVAVGGVFALARFSEAFLVLRAMGSGVPVALVPLVMVAMNVVYALSAYPFGKLADTTS
FT                   HTTLMVVGLVMLIAADIVLAHGAHWPAVLVGVALWGLHMGMTQGLLATMVAHAAPAELR
FT                   GTAFGVFNLVSGIVTLVSSVVAGFLWDRAGAAATFYAGAVFSAATIALLVCVRTSFGTV
FT                   QDR"
FT   misc_feature    496003..497046
FT                   /locus_tag="BCAM0441"
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 1.4e-35"
FT                   /inference="protein motif:HMMPfam:PF07690"
FT   misc_feature    join(496045..496113,496204..496272,496396..496449,
FT                   496459..496527,496585..496653,496696..496764,
FT                   496798..496857,496870..496938,496975..497043,
FT                   497053..497121)
FT                   /locus_tag="BCAM0441"
FT                   /note="10 probable transmembrane helices predicted for
FT                   BCAM0441 by TMHMM2.0 at aa 34-56, 87-109, 151-168, 172-194,
FT                   214-236, 251-273, 285-304, 309-331, 344-366 and 370-392"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(497179..498588)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0442"
FT                   /product="two-component regulatory system, sensor kinase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0442"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54300"
FT                   /db_xref="GOA:B4EJG5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006290"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJG5"
FT                   /protein_id="CAR54300.1"
FT                   /translation="MTARPASYSLLRRLTLAFAAVAALVFALTGAYLYRSLSAELTRRD
FT                   DIEISAKLNQFLQLARASGSTAALRADPAVFHDVLLSHPGVYLGIYDARHQPLVEHSDE
FT                   AGNTLASVISAPHPAGSADGPFTCAPPGIGTSRCVYARETLPSGEAIEVALARTATDRQ
FT                   SLLESYRVDIWLAAAVGALLVGALGYAVASRGLRPVESLGRQTSRIEAHNLNARLDARG
FT                   GPVELREFATSVNRMLDRLERAFVRLSQFSSDLAHDMRTPLANVISSSQITLSRARTVD
FT                   EYEALIESNIEECERLQRMIENMLFLARTDNARQHLKTAELDAGSELRRLASYFQALAD
FT                   EAGVRIDVHGEAPVVADATLFRRAVSNLASNALEHADAASTIELAVSVQRGYAVVEVTN
FT                   RGAAIPPEQVERIFERFYRIDSSRHGAARNAGLGLAIVKSIMELHRGKVEVASRDGRTT
FT                   FALYFPRGADR"
FT   misc_feature    complement(497191..497523)
FT                   /locus_tag="BCAM0442"
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HSP90, score 1.1e-35"
FT                   /inference="protein motif:HMMPfam:PF02518"
FT   misc_feature    complement(497650..497850)
FT                   /locus_tag="BCAM0442"
FT                   /note="HMMPfam hit to PF00512, His Kinase A
FT                   (phosphoacceptor) domain, score 1.8e-15"
FT                   /inference="protein motif:HMMPfam:PF00512"
FT   misc_feature    complement(497860..498072)
FT                   /locus_tag="BCAM0442"
FT                   /note="HMMPfam hit to PF00672, HAMP domain, score 2.4e-12"
FT                   /inference="protein motif:HMMPfam:PF00672"
FT   misc_feature    complement(join(498010..498078,498487..498546))
FT                   /locus_tag="BCAM0442"
FT                   /note="2 probable transmembrane helices predicted for
FT                   BCAM0442 by TMHMM2.0 at aa 15-34 and 171-193"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(498508..498588)
FT                   /locus_tag="BCAM0442"
FT                   /note="Signal peptide predicted for BCAM0442 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.997) with cleavage site
FT                   probability 0.763 between residues 27 and 28"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(498585..499256)
FT                   /transl_table=11
FT                   /gene="irlR"
FT                   /locus_tag="BCAM0443"
FT                   /product="two-component regulatory system, response
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0443"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54301"
FT                   /db_xref="GOA:B4EJG6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR006291"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJG6"
FT                   /protein_id="CAR54301.1"
FT                   /translation="MRILIVEDEAKMASYLRKGLTEASYTVDVAENGKDGLFLALHEDF
FT                   DLVVLDVMLPELDGFEVLRRLRAQKQTPVLLLTARDAIEDKVAGLELGADDYLLKPFAY
FT                   AEFLARIRSLLRRAPRNVRDILHVADLEIDLLKRRVRRADARIDLTAQEFALLQLLAER
FT                   EGEVLTRTFITSQIWDMNFDSDTNVVDAAIKRLRAKIDNAYEKKLIHTIRGMGYVLEDR
FT                   S"
FT   misc_feature    complement(498600..498827)
FT                   /gene="irlR"
FT                   /locus_tag="BCAM0443"
FT                   /note="HMMPfam hit to PF00486, Transcriptional regulatory
FT                   protein, C te, score 9.9e-20"
FT                   /inference="protein motif:HMMPfam:PF00486"
FT   misc_feature    complement(498921..499256)
FT                   /gene="irlR"
FT                   /locus_tag="BCAM0443"
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 1.3e-39"
FT                   /inference="protein motif:HMMPfam:PF00072"
FT   CDS_pept        499490..499846
FT                   /transl_table=11
FT                   /locus_tag="BCAM0444"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0444"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54302"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJG7"
FT                   /protein_id="CAR54302.1"
FT                   /translation="MSYWRTFLVVVSLALSLPIQSFAAVSMQCASVAAPHEEKVSHAMP
FT                   AAQDGHADHGDHARHASSCVACVSCCFGTGMSGAPAVPAAASGGVTIVAPPPSAADVSF
FT                   LTGGIDRPPRRMPA"
FT   sig_peptide     499490..499558
FT                   /locus_tag="BCAM0444"
FT                   /note="Signal peptide predicted for BCAM0444 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.808 between residues 23 and 24"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        499929..500216
FT                   /transl_table=11
FT                   /locus_tag="BCAM0445"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0445"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54303"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJG8"
FT                   /protein_id="CAR54303.1"
FT                   /translation="MFMRLIIAALMGAAALVPSLAPAQTPLPDPADAAASVPDVTVTSA
FT                   FDGYRPYRDDAGPGWKQLNRDVTARPAKGRTTGGAAGNGAAHSMHGGAAR"
FT   sig_peptide     499929..499997
FT                   /locus_tag="BCAM0445"
FT                   /note="Signal peptide predicted for BCAM0445 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.996) with cleavage site
FT                   probability 0.788 between residues 23 and 24"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        500213..501727
FT                   /transl_table=11
FT                   /locus_tag="BCAM0446"
FT                   /product="outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0446"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54304"
FT                   /db_xref="GOA:B4EJG9"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJG9"
FT                   /protein_id="CAR54304.1"
FT                   /translation="MTTFAISPRIGPAVVALAFLAGCTTFSKDGGFDAVSSAASARIGK
FT                   DAVVVRTDADREAVDRRTKELLGKPLSMDDAVQVALLNNRGLQASYAELGLSEADLVQA
FT                   GRLPNPRFAFSRTRAGDGELTLGRTFSANVFALLTMPLATKIERRRFEQTRLETADAML
FT                   KVAADARRAYVEAVAAEQAANYAQQVRDAASAAAELALRMRQAGNFSRLDYAREQAFHA
FT                   DAVAQHAKARQQAVAAREKLTRAMGLWGERTRYALPERLPDLPKARPDLPDLERFAMRN
FT                   RLDIQAAKLRTQGVASSLGLSKATRFVNAVELGYVNDYETGKGHEHGYEISVEIPLFDW
FT                   GGAKVARAEAVYMQSANLLAKTAIDARSEVRESYAAYVTSYDVATHYRDEVVPLRKTIS
FT                   DELLLRYNGMLASVFELLTDAREQVGAVNGYIDALKDYWLAETDLQMAVGGRLPSSGAA
FT                   PRAPHDAESAPASRSASTLGADAARQPASTPAAPSAPATQPHPEGH"
FT   sig_peptide     500213..500335
FT                   /locus_tag="BCAM0446"
FT                   /note="Signal peptide predicted for BCAM0446 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.976) with cleavage site
FT                   probability 0.412 between residues 41 and 42"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    500249..500281
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    500429..500953
FT                   /locus_tag="BCAM0446"
FT                   /note="HMMPfam hit to PF02321, Outer membrane efflux
FT                   protein, score 0.00054"
FT                   /inference="protein motif:HMMPfam:PF02321"
FT   misc_feature    501023..501559
FT                   /locus_tag="BCAM0446"
FT                   /note="HMMPfam hit to PF02321, Outer membrane efflux
FT                   protein, score 3.5e-05"
FT                   /inference="protein motif:HMMPfam:PF02321"
FT   CDS_pept        501729..503024
FT                   /transl_table=11
FT                   /locus_tag="BCAM0447"
FT                   /product="putative exported multicopper oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0447"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54305"
FT                   /db_xref="GOA:B4EJH0"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJH0"
FT                   /protein_id="CAR54305.1"
FT                   /translation="MVSRRQFLSGSGAALLGAAMVSRAGAASLPDAPTMAKTGTQPPLV
FT                   PPNGRPYTPVATLNGWSLPWRMKNGWKEFHLTAEPVVREMAPGMNANLWGYNGQSPGPT
FT                   IEAVEGDKVRIFVTNRLPEHTTIHWHGLRLPNGMDGVGGLTQPHIPPGKTFVYEFQLEA
FT                   HGTFMYHPHADEMVQMAMGMMGMFIVHPKDRGTMPVDRDFVFLLAAYDIDPGSYTPRVN
FT                   EMTDFNMWTFNSRVFPGIDPLPVRAGDRVRIRFGNLTMTNHPIHLHGYRFEIAGTDGGW
FT                   IPPAARWPEVTADVAVGQMRAIEFTADRPGDWAFHCHKSHHTMNAMGHQVPNLIGVPQK
FT                   DLAKRIGKLVPDYMAMGSTGGAMGGMEMPLPDNTLPMMTGTGPFGPLEMGGMFTVLKVR
FT                   QGLGRNDYRDPGWFRHPKGTVAYEYTGELPDS"
FT   sig_peptide     501729..501806
FT                   /locus_tag="BCAM0447"
FT                   /note="Signal peptide predicted for BCAM0447 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.920 between residues 26 and 27"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    501957..502310
FT                   /locus_tag="BCAM0447"
FT                   /note="HMMPfam hit to PF07732, Multicopper oxidase, score
FT                   6.2e-54"
FT                   /inference="protein motif:HMMPfam:PF07732"
FT   misc_feature    502365..502739
FT                   /locus_tag="BCAM0447"
FT                   /note="HMMPfam hit to PF07731, Multicopper oxidase, score
FT                   4.7e-27"
FT                   /inference="protein motif:HMMPfam:PF07731"
FT   misc_feature    502674..502709
FT                   /note="PS00080 Multicopper oxidases signature 2."
FT                   /inference="protein motif:Prosite:PS00080"
FT   CDS_pept        503091..503447
FT                   /transl_table=11
FT                   /locus_tag="BCAM0448"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0448"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54306"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJH1"
FT                   /protein_id="CAR54306.1"
FT                   /translation="MKKGLVLMATGWALALSATSHAAGDMTGDMAGMDMSADAKQGAAA
FT                   SSMSHGEIRKVDTAAGKLTIKHGPLENLGMDAMTMVFKVKDPAMLSQVKAGDTIDFVAE
FT                   DVDGTLTVVELKKP"
FT   sig_peptide     503091..503156
FT                   /locus_tag="BCAM0448"
FT                   /note="Signal peptide predicted for BCAM0448 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.992 between residues 22 and 23"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        503462..503842
FT                   /transl_table=11
FT                   /locus_tag="BCAM0449"
FT                   /product="putative copper-resistance exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0449"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54307"
FT                   /db_xref="GOA:B4EJH2"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJH2"
FT                   /protein_id="CAR54307.1"
FT                   /translation="MTISTRKRLAGFTAAAALFAIAPVAASAHGKLESAVPAAGSTIDA
FT                   APDMVRLTFNEALEPAFSTVKVSDASGNAITQDKAKVDASNPRVMTVAIPTLAAGAYTV
FT                   QWAAMTADAHRTKGTYTFRVKG"
FT   sig_peptide     503462..503545
FT                   /locus_tag="BCAM0449"
FT                   /note="Signal peptide predicted for BCAM0449 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.563 between residues 28 and 29"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    503468..503836
FT                   /locus_tag="BCAM0449"
FT                   /note="HMMPfam hit to PF04234, Copper resistance protein
FT                   CopC, score 6.6e-21"
FT                   /inference="protein motif:HMMPfam:PF04234"
FT   misc_feature    join(503486..503545,503726..503785)
FT                   /locus_tag="BCAM0449"
FT                   /note="2 probable transmembrane helices predicted for
FT                   BCAM0449 by TMHMM2.0 at aa 9-28 and 89-108"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        503839..504780
FT                   /transl_table=11
FT                   /locus_tag="BCAM0450"
FT                   /product="putative copper-resistance membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0450"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54308"
FT                   /db_xref="GOA:B4EJH3"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJH3"
FT                   /protein_id="CAR54308.1"
FT                   /translation="MNDGVVGLLRLGAVAIQNAGFAVVVGALLGRHWLARGASAWQHGV
FT                   GRRLVATLRIASVVSLLASVTAFWAHCALMSEVSLLDAGPAVCSMLAGTGFGHAWLAGT
FT                   VFMLVVVLLSFAGRANDTRFPFAMAAALAGVALARSNGGHPVDAGLFSVPVWIDWLHLL
FT                   AISVWIGLVLVTAFGVMPRLARMPASERMTGAAFVQSLSDASTCALIVLFATGAYNGWR
FT                   GVETPANLFASTYGQILLLKLALVLLAAMLGAYNRFFGMPTLLRALKDPAAAMPAHALK
FT                   RFCTVLRVEAVVLGGVLMAAAVLVSSALPGTI"
FT   misc_feature    503869..504759
FT                   /locus_tag="BCAM0450"
FT                   /note="HMMPfam hit to PF05425, Copper resistance protein D,
FT                   score 5.6e-08"
FT                   /inference="protein motif:HMMPfam:PF05425"
FT   misc_feature    join(503875..503943,504004..504063,504121..504189,
FT                   504208..504264,504307..504375,504436..504504,
FT                   504547..504615,504703..504771)
FT                   /locus_tag="BCAM0450"
FT                   /note="8 probable transmembrane helices predicted for
FT                   BCAM0450 by TMHMM2.0 at aa 13-35, 56-75, 95-117, 124-142,
FT                   157-179, 200-222, 237-259 and 289-311"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        504950..506764
FT                   /transl_table=11
FT                   /locus_tag="BCAM0451"
FT                   /product="putative extracellular
FT                   endonuclease/exonuclease/phosphatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0451"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54309"
FT                   /db_xref="GOA:B4EJH4"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJH4"
FT                   /protein_id="CAR54309.1"
FT                   /translation="MRSTIRLFAPLLLLPTLAAPVCAATAAPVSPNCGGSTTPIADIQG
FT                   PGAPSPLAGQNASIEAVVTADFGGTDGFGGFFVQQADAQRRNQPGVSEGLFVYAPKARA
FT                   KAGDLVHVTGKVEEKYGQTQLTLSGAIAVCANGQTVTPATLTLPVDSPSAFAAYEGMLV
FT                   RLPQTLTITDNYELGRYGSVMLSNGRLRTPTSVMPPAQAQTQIDANARNRLILDDGSNK
FT                   QNPATVPYPAPGLSAANTLRAGYTVRDVEGVLEVRYGAWRVQPLPGAAAPAFDARSNPR
FT                   TQAPARDPKSNLRVASFNVLNYFNGNGLGGGFDDPNNRGAKTFQEFQRQEAKIVSALKA
FT                   IDADVIGLMEIQNNGYGELSAVRQLAAKLGNHWRVVDPGTSRLGGDAIAVALIYDSRKV
FT                   EPVGRAATLAIDDKNRQPLAQSFRLVNGNKQALTVAVNHLKSKNCPDAANDDLDQGDGQ
FT                   GCWNPTRTRAAAKVADWLAGNPTGVKSQGVLLIGDFNSYTYEDPIRALESRGYRNLVAR
FT                   WIGANAYSYVYNGEAGYLDHALATLPLASHVKAVHEWHINADEPLALQYTLAYKSAEQQ
FT                   KTFYAADAYRSSDHDPVLIDIALPGGGK"
FT   sig_peptide     504950..505018
FT                   /locus_tag="BCAM0451"
FT                   /note="Signal peptide predicted for BCAM0451 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.523 between residues 23 and 24"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    504968..505036
FT                   /locus_tag="BCAM0451"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAM0451 by TMHMM2.0 at aa 7-29"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    505826..506740
FT                   /locus_tag="BCAM0451"
FT                   /note="HMMPfam hit to PF03372,
FT                   Endonuclease/Exonuclease/phosphatase fa, score 1.8e-22"
FT                   /inference="protein motif:HMMPfam:PF03372"
FT   CDS_pept        507468..509315
FT                   /transl_table=11
FT                   /locus_tag="BCAM0452"
FT                   /product="serine peptidase, family S10"
FT                   /note="family S10 serine peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0452"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54310"
FT                   /db_xref="GOA:B4EJV6"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJV6"
FT                   /protein_id="CAR54310.1"
FT                   /translation="MKPDRSSTGSRRVRRGRLAGLGALSAMTLALAACGGDDSSSVGAS
FT                   SLAQATASQQASAQAAGTQAPAANQPYVDPVAYSMNATDGLAPSQVSEKAAVMHYQWTG
FT                   GGKTINYTTTTGHLTAQDANGNAEASMSYVAYTAPSTNGKPRPVTFVYNGGPGSSSIWL
FT                   RLGSFAPTRVATPDPLFGNNWPNYPLVDNAESLIDTTDLVFIDPPGTGLSEAVLPNTNQ
FT                   KYWGSDVDVNIMRDFIQRYLNVNSRGTSPIYLYGESYGTPRTDMLALALESAGVHLTGI
FT                   VLQSSILNYFADAVEAVAITQSTEGLLLDTDTVAGYLPGYAAVAAYFNQVSPAPVNQDL
FT                   YAFQTELFTTLIYSQLQKYSQSWVLSQLGIPDALGTPVFPSDATLRLWSIPSSLTQQAL
FT                   RGYFNANPFGTSLLPGTTIGRYDGRVSLPNSDPRLQTDGDPSDILISQPFTNALATQMP
FT                   DYLGYTAPNATYLPLNDNIIGVWDFSHDGQPMPDTIPDLLGALQLNPKLRVLAENGYHD
FT                   LATPFFNTEKQLARLQTVKGLNPKLQVNFFQGGHMTYLDDVARPLMKRDLQTFYKGARI
FT                   PTALTLHTLPPPWPDENPPSVPTGSVPGATAATTLAAAP"
FT   sig_peptide     507468..507641
FT                   /locus_tag="BCAM0452"
FT                   /note="Signal peptide predicted for BCAM0452 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.264 between residues 58 and 59"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    507537..507569
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    507588..507635
FT                   /note="PS00012 Phosphopantetheine attachment site."
FT                   /inference="protein motif:Prosite:PS00012"
FT   misc_feature    507780..509138
FT                   /locus_tag="BCAM0452"
FT                   /note="HMMPfam hit to PF00450, Serine carboxypeptidase,
FT                   score 9e-06"
FT                   /inference="protein motif:HMMPfam:PF00450"
FT   CDS_pept        509371..509790
FT                   /transl_table=11
FT                   /locus_tag="BCAM0453"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0453"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54311"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJV7"
FT                   /protein_id="CAR54311.1"
FT                   /translation="MSLIQLMRRMSPLIVLGAAMSSAYALPPQAVAPVKLPHGGRGVDG
FT                   PFFPATRAAPVLPSTGAALQQQAQQRVDARLGANTVLSNGAAVTKAQAQSSGLGFVSKH
FT                   FDEIDAKHTGRVTMSDVRQFIRQRQVQAQQEQQDE"
FT   sig_peptide     509371..509445
FT                   /locus_tag="BCAM0453"
FT                   /note="Signal peptide predicted for BCAM0453 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.969 between residues 25 and 26"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    509539..509556
FT                   /note="PS00343 Gram-positive cocci surface proteins
FT                   'anchoring' hexapeptide."
FT                   /inference="protein motif:Prosite:PS00343"
FT   CDS_pept        complement(join(509923..510432,510434..510877))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BCAM0454"
FT                   /product="AraC family regulatory protein (pseudogene)"
FT                   /note="Frameshift after codon 148"
FT                   /db_xref="PSEUDO:CAR54312.1"
FT   misc_feature    complement(509962..510096)
FT                   /locus_tag="BCAM0454"
FT                   /note="HMMPfam hit to PF00165, Bacterial regulatory
FT                   helix-turn-helix prote, score 2.9e-11"
FT                   /inference="protein motif:HMMPfam:PF00165"
FT   misc_feature    complement(510112..510252)
FT                   /locus_tag="BCAM0454"
FT                   /note="HMMPfam hit to PF00165, Bacterial regulatory
FT                   helix-turn-helix prote, score 1.3e-05"
FT                   /inference="protein motif:HMMPfam:PF00165"
FT   misc_feature    complement(join(510373..510432,510434..510745))
FT                   /locus_tag="BCAM0454"
FT                   /note="HMMPfam hit to PF01965, DJ-1/PfpI family, score
FT                   0.0003"
FT                   /inference="protein motif:HMMPfam:PF01965"
FT   CDS_pept        510966..512066
FT                   /transl_table=11
FT                   /locus_tag="BCAM0456"
FT                   /product="putative ThiJ/PfpI family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0456"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54313"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJV9"
FT                   /protein_id="CAR54313.1"
FT                   /translation="MRERKTGGAVLLVCGLLGAWAWGWPARAMAEDPPAAARTLTIGMP
FT                   KAGRPRPLVAIVADNAGTETTDFIVPYAILKRSGAVDVVAVSADEGAVELMPALRVLAD
FT                   TTFDRFDATVPAGADVVIVPAMHRADRPAVLAWLRKQAAAGATMVAICDGAEVLANTGL
FT                   LRHRTATSHWYSRERLRRRFTETKWVDDRRYVMDGNVMTTTGVSASIPASLALLSALAG
FT                   PTAARDTARGLGVQAWGDAHDGSRFGVTARAVAIALMNRVAFWRHETFDLPVESGFDEL
FT                   PVALSADAWARTWRSDVVATADAGVVESRYGLRLLAQPAHGRHARVTTSAGWRGESTLA
FT                   GVLADIAARYGDATSGWVALQLEYPE"
FT   sig_peptide     510966..511055
FT                   /locus_tag="BCAM0456"
FT                   /note="Signal peptide predicted for BCAM0456 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.814 between residues 30 and 31"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    510984..511037
FT                   /locus_tag="BCAM0456"
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAM0456 by TMHMM2.0 at aa 7-24"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    511203..511628
FT                   /locus_tag="BCAM0456"
FT                   /note="HMMPfam hit to PF01965, DJ-1/PfpI family, score
FT                   6.5e-14"
FT                   /inference="protein motif:HMMPfam:PF01965"
FT   CDS_pept        complement(512079..512498)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0457"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0457"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54314"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJW0"
FT                   /protein_id="CAR54314.1"
FT                   /translation="MPRPSHARARQRADADAPSAHGPYHWRRAGRAAALLLAASVAACD
FT                   ATPVPDRLSDLDATYAMQERFGLGDVMVFLGSCIGAKNPTYPGQAACTMAIRSNGHGSE
FT                   TQADFHWNGEKWVAEPTASQDLLPYPDPRLAEWVK"
FT   misc_feature    complement(512367..512399)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(512666..512850)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BCAM0458"
FT                   /product="conserved hypothetical protein (fragment)"
FT                   /note="Probable gene remnant. CDS lacks appropriate
FT                   translational stop codon. Similar to the C-terminal region
FT                   of Burkholderia cenocepacia HI2424 alcohol dehydrogenase
FT                   GroES domain protein. UniProt:A0AXN7 (EMBL:CP000459 (359
FT                   aa) fasta scores: E()=4.4e-15, 85.246% id in 61 aa"
FT   CDS_pept        complement(512862..514340)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0459"
FT                   /product="cysteine desulfurase"
FT                   /EC_number="2.8.1.7"
FT                   /note="Contains additional C terminal DUF domain"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0459"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54316"
FT                   /db_xref="GOA:B4EJW1"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR005939"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJW1"
FT                   /protein_id="CAR54316.1"
FT                   /translation="MSEPTPLHYLDYAATTPADPRVIEAMTACLGFDGIFGNPASSSHA
FT                   AGRLAKDKVEHARAQVAALIGADADEIVWTSGATESNNLALKGYAENATGKRHLITSRL
FT                   EHKAILDTMANLSKHGTQVTFLTPDAHGEITADAVAAAIGPDTGLVSLMLVNNEIGTLT
FT                   DIGAIAGIVHAAGALLHVDAAQALGKTPIDVRALGIDMMSMSAHKVYGPKGIGALFVRR
FT                   EIASRIAPQIHGGGHERGLRSGTLATHQIVGMGVACALAAEKLDGETARIAALGARLTG
FT                   ALFALGDVTQNAAAARRIPHTLSLTVHAPGFFPFMLGDALAVSSTSACNSTSGAPSHVL
FT                   TAIGLDAETAGRTVRISFGRFTTEQDVDFAIGCFARAIEQCRAAAATGFTASRQITPAD
FT                   LKAIRNAGFRAVICNRPDGEGDDQPAFEEIAAAARELGMDARYLPVERDRIGDAEVDAF
FT                   GALVDTLPKPVLAYCRSGSRSGMLWNRLSARRTA"
FT   misc_feature    complement(512871..513203)
FT                   /locus_tag="BCAM0459"
FT                   /note="HMMPfam hit to PF04273, Protein of unknown function
FT                   (DUF442), score 7.1e-22"
FT                   /inference="protein motif:HMMPfam:PF04273"
FT   misc_feature    complement(513231..514319)
FT                   /locus_tag="BCAM0459"
FT                   /note="HMMPfam hit to PF00266, Aminotransferase class-V,
FT                   score 7.5e-86"
FT                   /inference="protein motif:HMMPfam:PF00266"
FT   misc_feature    complement(513444..514232)
FT                   /locus_tag="BCAM0459"
FT                   /note="HMMPfam hit to PF01212, Beta-eliminating lyase,
FT                   score 0.00014"
FT                   /inference="protein motif:HMMPfam:PF01212"
FT   misc_feature    complement(513567..513599)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    complement(513687..513746)
FT                   /note="PS00595 Aminotransferases class-V
FT                   pyridoxal-phosphate attachment site."
FT                   /inference="protein motif:Prosite:PS00595"
FT   misc_feature    complement(513771..513794)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(514641..515411)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0460"
FT                   /product="putative amino acid ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0460"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54317"
FT                   /db_xref="GOA:B4EJW2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJW2"
FT                   /protein_id="CAR54317.1"
FT                   /translation="MTTPMHTIVVQGLAKSFGENVVLRRVDFRVARGEVVVLMGPSGSG
FT                   KTTLLRSLNFLELPDAGKVSVCGIEIERAGGTALSRDEQKRIKAIRQRTAMVFQSFNLF
FT                   PHRTALENVIEGLVSVKGVRKSEALERGLHLLDRVGLAHKAGEYPARLSGGQKQRVAIA
FT                   RGLAMDPEVILFDEPTSALDPALREDVLAVMRELAGNGMTMLVVTHEVRFAQDVADRVV
FT                   FMENGVVVQDTTPDAFFTASTHPRVRQFLNLIET"
FT   misc_feature    complement(514731..515315)
FT                   /locus_tag="BCAM0460"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   2.4e-65"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    complement(514914..514958)
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    complement(515271..515294)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(515408..516058)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0461"
FT                   /product="putative amino acid ABC transporter system
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0461"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54318"
FT                   /db_xref="GOA:B4EJW3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJW3"
FT                   /protein_id="CAR54318.1"
FT                   /translation="MLDLFVRSLPLLESAVTMTVFLGLASFALGSALGLAVALARVSSI
FT                   RFLRGIAFAYVSIFRGTPLLVQILLIYFGLPRYGITLDPVPAALLALTLFSAAYLSENF
FT                   RSGINAVDRGQWEAAHSLGMNYWKMMWRVILPQGLRIAIPPVGSRMIALIKDTSLASTI
FT                   TVVELTRVADQVGASTFRYMEMFLMVGLIYWVINQILTIVQTIFEGRVSRRFQ"
FT   misc_feature    complement(515420..516025)
FT                   /locus_tag="BCAM0461"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 2.1e-31"
FT                   /inference="protein motif:HMMPfam:PF00528"
FT   misc_feature    complement(join(515438..515506,515747..515800,
FT                   515843..515911,515948..516016))
FT                   /locus_tag="BCAM0461"
FT                   /note="4 probable transmembrane helices predicted for
FT                   BCAM0461 by TMHMM2.0 at aa 15-37, 50-72, 87-104 and
FT                   185-207"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(515651..515737)
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT                   /inference="protein motif:Prosite:PS00402"
FT   sig_peptide     complement(515939..516058)
FT                   /locus_tag="BCAM0461"
FT                   /note="Signal peptide predicted for BCAM0461 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.784) with cleavage site
FT                   probability 0.274 between residues 40 and 41"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(516062..516901)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0462"
FT                   /product="cystine-binding periplasmic protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0462"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54319"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJW4"
FT                   /protein_id="CAR54319.1"
FT                   /translation="MNPQTTRVLARGLATLGIAGALALSSLDAGAADLLAAARGSGTLR
FT                   VANTQSSPPWSLLDERNQPAGYDVEVAREVGKRIGVKQVVFVADAYKNFVEGLKAGKYD
FT                   LVMNDLTPTAERSKQVDFAKPYGVEDFRIFVRTDNTHIHGQADLKGKRVGVTTGSSNET
FT                   WARAHLKDADIRAYDNGGLVFNDLGSGRLDAVIISHFGGMKYANVNHLPVKEVGEPLIY
FT                   QLSAPALAKGQPALLAAVDKAIDDMAADGTLERLAKRWVGPTYDMVGNIARAKAQKE"
FT   misc_feature    complement(516113..516772)
FT                   /locus_tag="BCAM0462"
FT                   /note="HMMPfam hit to PF00497, Bacterial extracellular
FT                   solute-binding prot, score 1.1e-59"
FT                   /inference="protein motif:HMMPfam:PF00497"
FT   misc_feature    complement(516665..516706)
FT                   /note="PS01039 Bacterial extracellular solute-binding
FT                   proteins, family 3 signature."
FT                   /inference="protein motif:Prosite:PS01039"
FT   sig_peptide     complement(516809..516901)
FT                   /locus_tag="BCAM0462"
FT                   /note="Signal peptide predicted for BCAM0462 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.920 between residues 31 and 32"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(516957..518120)
FT                   /transl_table=11
FT                   /gene="metC"
FT                   /locus_tag="BCAM0463"
FT                   /product="putative cystathionine beta-lyase"
FT                   /EC_number="4.4.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0463"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54320"
FT                   /db_xref="GOA:B4EJW5"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006233"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJW5"
FT                   /protein_id="CAR54320.1"
FT                   /translation="MTTTPPLPPQPFRSLSPAVMRASTVVFDSLDDFARRKERQPDGYS
FT                   YGITGTPTARELERRIAVLEGGAHCVLAPSGQAALMTSVMGFVRGGDHLLVSAACYGAL
FT                   KTFAQKWLALFDVDVELYEPAIGADIERYVKPNTRMICMESPGTVTMEMPDVPAIVDVA
FT                   RRHRIMTMMDNTWASPLAFRPLEHGVDLSVEAATKLFGGHSDLLLGAISMNDFGYYETL
FT                   RETQSILGQQASPDDCFLVLRGLDTLKVRFDAQSAAALRVAQALESHPAVRQVLFPALP
FT                   SDAGHAIWKRDFSGNGCLFSLMLEPAPEAAFTAFFDALRHFAIGASWGGVHSLAAYYPA
FT                   PLQAQRRFPLTDQPIVRLSIGLEAPELLIDDLYTGLAAFTDVRNHAA"
FT   misc_feature    complement(516990..518111)
FT                   /gene="metC"
FT                   /locus_tag="BCAM0463"
FT                   /note="HMMPfam hit to PF01053, Cys/Met metabolism
FT                   PLP-dependent enzy, score 1.1e-94"
FT                   /inference="protein motif:HMMPfam:PF01053"
FT   misc_feature    complement(517278..517976)
FT                   /gene="metC"
FT                   /locus_tag="BCAM0463"
FT                   /note="HMMPfam hit to PF01212, Beta-eliminating lyase,
FT                   score 0.0046"
FT                   /inference="protein motif:HMMPfam:PF01212"
FT   CDS_pept        518235..519182
FT                   /transl_table=11
FT                   /locus_tag="BCAM0464"
FT                   /product="LysR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0464"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54321"
FT                   /db_xref="GOA:B4EJW6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJW6"
FT                   /protein_id="CAR54321.1"
FT                   /translation="MRDIEVFRAVMNAGSTSKAAGVLEISQPAVSQSIRRLEGMAGFRL
FT                   FERVRSRLVPTQEAVALMRDVDRYFLGFEVIEHRIRSLRSYGLGRLAIASLPALGTGFL
FT                   PRVIASFDAAARDVQISLQVMSSREVHEKVSAGQVDFGLMSDEMSMAGLEHSSFVSMPG
FT                   VAVMNAAHPLAAKSVIKADDLSQAPFIALNPEDSTRLRLETQLRGLGVVLKPLVETPYS
FT                   HTVCELALAGVGVGFAHPLVALDFAQRGLVVRPFDVDVAFTGVLVFRPGTPMSENARVF
FT                   LQHMRIQLEADRHALAALSGRKGRGSARGPGGGG"
FT   misc_feature    518235..518414
FT                   /locus_tag="BCAM0464"
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix, score 3.8e-16"
FT                   /inference="protein motif:HMMPfam:PF00126"
FT   misc_feature    518235..518246
FT                   /note="PS00228 Tubulin-beta mRNA autoregulation signal."
FT                   /inference="protein motif:Prosite:PS00228"
FT   misc_feature    518274..518339
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1296.000, SD 3.60 at aa 14-35, sequence
FT                   GSTSKAAGVLEISQPAVSQSIR"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    518277..518369
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00044"
FT   misc_feature    518484..519104
FT                   /locus_tag="BCAM0464"
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 2.5e-36"
FT                   /inference="protein motif:HMMPfam:PF03466"
FT   CDS_pept        519545..520798
FT                   /transl_table=11
FT                   /locus_tag="BCAM0465"
FT                   /product="Major Facilitator Superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0465"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54322"
FT                   /db_xref="GOA:B4EJW7"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJW7"
FT                   /protein_id="CAR54322.1"
FT                   /translation="MKANEWDTSYEWKAVTLLALGFGLVGLDRWLIAPLFPSIMKDLNL
FT                   NAQDVGNCIGVLGLSWGIFAALMGGISDKIGRRKVLIPAIIAFSLLSGFSGLAGGLLGL
FT                   MAIRGLMGVAEGSFCPTSFAATADASHPRRRGLNLGLQQSGFALFGLALSPIIATQLLG
FT                   FVSWRWVFALVAVPGLVLGAIMVFVIREPKVAQDVASEHAPASLGHVLKRRNILVAMAA
FT                   LCCAMTGVFVLGALLPLYLTDYLSLGTQKMGLVVSAIGFGGFLGQFGLPGLSDLVGRRI
FT                   ASIVGFAGTAVMLYVFRGLGPQPLALFGVLFVASFFTLGLVSLLSGPVATEAAPVGLVS
FT                   TSIGVVVGVGEIFGGGIAPAMGGYVAAHFGIQNILWLPMASVLLGIVVSLLLKETAPAV
FT                   LQRRAIVQPELAAGEQAR"
FT   misc_feature    519584..520741
FT                   /locus_tag="BCAM0465"
FT                   /note="HMMPfam hit to PF00083, Sugar (and other)
FT                   transporter, score 8.9e-05"
FT                   /inference="protein motif:HMMPfam:PF00083"
FT   misc_feature    join(519587..519655,519692..519760,519788..519856,
FT                   519974..520033,520043..520111,520187..520255,
FT                   520298..520366,520385..520444,520457..520525,
FT                   520550..520618,520661..520720)
FT                   /locus_tag="BCAM0465"
FT                   /note="11 probable transmembrane helices predicted for
FT                   BCAM0465 by TMHMM2.0 at aa 15-37, 50-72, 82-104, 144-163,
FT                   167-189, 215-237, 252-274, 281-300, 305-327, 336-358 and
FT                   373-392"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    519596..520645
FT                   /locus_tag="BCAM0465"
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 1.7e-46"
FT                   /inference="protein motif:HMMPfam:PF07690"
FT   misc_feature    519746..519796
FT                   /note="PS00216 Sugar transport proteins signature 1."
FT                   /inference="protein motif:Prosite:PS00216"
FT   CDS_pept        520921..521850
FT                   /transl_table=11
FT                   /locus_tag="BCAM0466"
FT                   /product="LysR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0466"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54323"
FT                   /db_xref="GOA:B4EJW8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJW8"
FT                   /protein_id="CAR54323.1"
FT                   /translation="MDRFLSIEAFVRVAEASSFAEAARQLGVTSSVVTNRIQQLEKFVN
FT                   APLFHRSTRHVRLSEVGETFYRECAEVVGRVNELTDQMRELRATPTGRLRIQMLPGFAL
FT                   DHFGKPLAAFNQRYPGIQLDIIVNDRVVDPVEEGFDIAFQIFPPISESLIERRLFTVRR
FT                   LFCAAPAYVDAHGAPQHPRDLLQHTTALYSGYPSRNRWTMTRGDEVVEMELPGMIRSNS
FT                   VHLLREYALTGGGVVCLPTLVASDALVAGRLVPILTDYQLAPLSFAAVYPATQRQALKV
FT                   KALVEFLAEYIGDESPWDRPLLARGWVR"
FT   misc_feature    520930..521109
FT                   /locus_tag="BCAM0466"
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix, score 2.5e-16"
FT                   /inference="protein motif:HMMPfam:PF00126"
FT   misc_feature    520969..521034
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1556.000, SD 4.49 at aa 17-38, sequence
FT                   SSFAEAARQLGVTSSVVTNRIQ"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    520972..521064
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00044"
FT   misc_feature    521179..521799
FT                   /locus_tag="BCAM0466"
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 1.9e-44"
FT                   /inference="protein motif:HMMPfam:PF03466"
FT   CDS_pept        521966..522460
FT                   /transl_table=11
FT                   /locus_tag="BCAM0467"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0467"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54324"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJW9"
FT                   /protein_id="CAR54324.1"
FT                   /translation="MTSTAFHTVFGSLDGYRKGEIEITSGSAQHYAFSNVFEVASKSAP
FT                   YEKVVAGKNLEYVIEVLRTDGQSPWFACAHDEFTIQMDGEVRIDFIKLDHPPQAGRGTV
FT                   SAGAHPAGRNMGYVVLRNGHQALLPAGCAYRFTASRPGVALVQTVLGELSVEKWAEICL
FT                   H"
FT   CDS_pept        522498..523517
FT                   /transl_table=11
FT                   /locus_tag="BCAM0468"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0468"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54325"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR040908"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJX0"
FT                   /protein_id="CAR54325.1"
FT                   /translation="MATLETLDLSTGFAADLVRSTEADAVTGYRRFQLGEFAFQRDEYF
FT                   VKISWPAKGQTRTHAMPADAFLRAMMRDVAWGFFYGWVNFDHVFGTRNHYGKVDMYAGT
FT                   FNGILKDAGVDYTETFDTPTIMATFKAMLHDWTNEGFDPFAAPEETGTAFGRKHGDNGA
FT                   AIERTRIATRRMPGLEGDSPLRDDLPVNRAFLDVAQDEPEVHVEPGFEGELHAFNLFKY
FT                   LSRSDVTWNPSVTSVCGRSLFCPTTEEFILPVFHGNDRVEWFLQLSDEIVWDIGDKNTG
FT                   APRARITMRAGDICAMPADIRHQGYSTKRSMLLVWENATPDLPQRYESGELAPYPIAF"
FT   CDS_pept        523568..525034
FT                   /transl_table=11
FT                   /locus_tag="BCAM0469"
FT                   /product="putative aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0469"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54326"
FT                   /db_xref="GOA:B4EJX1"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="PDB:4O6R"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJX1"
FT                   /protein_id="CAR54326.1"
FT                   /translation="MQTQLFIDGRFVDAVDRGTIDVLNPHDGSVITKIAAATAADVDLA
FT                   VDAATRAFPAWSAMPAAERGRLLLRLADAIEANTEALAQLESLDTGHPIRDSRALDVPR
FT                   TAACFRYFGGMADKLQGSVIPVDTGFLNYVQRAPIGVVGQIVPWNFPLMFTSWKMGPAL
FT                   AAGNTVVLKPSEITPLSTLRIVELMAEVGFPAGVVNIVPGYGHTAGQRLAEHPGVGKIA
FT                   FTGSTATGRRIVEASQGNLKRVQLELGGKGANIVFDDANLDAAINGAAWAIFHNQGQAC
FT                   IAGSRLVLHERIADAFLERFVALASSIRIGNPLDPNTEMGPLTSKQHLDRVLSYVDVAR
FT                   EQGGRVLTGGSAPQDPALANGYYVRPTIVEAKHATDRVAQEEVFGPFVTVLRFGSDDEA
FT                   LAIANATEYGLGSGLWTNDLSRAHRMAARIDAGMCWINCYKRVNPGSPFGGVGKSGYGR
FT                   EMGFEAMHDYTEARSVWVNVDGNVPPHFKR"
FT   misc_feature    523598..524989
FT                   /locus_tag="BCAM0469"
FT                   /note="HMMPfam hit to PF00171, Aldehyde dehydrogenase
FT                   family, score 5.9e-270"
FT                   /inference="protein motif:HMMPfam:PF00171"
FT   misc_feature    524387..524422
FT                   /note="PS00070 Aldehyde dehydrogenases cysteine active
FT                   site."
FT                   /inference="protein motif:Prosite:PS00070"
FT   CDS_pept        525042..526109
FT                   /transl_table=11
FT                   /gene="macA"
FT                   /locus_tag="BCAM0470"
FT                   /product="maleylacetate reductase"
FT                   /EC_number="1.3.1.32"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0470"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54327"
FT                   /db_xref="GOA:B4EJX2"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR034786"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJX2"
FT                   /protein_id="CAR54327.1"
FT                   /translation="MERFVYQGTPSRVVFEWGALDRLPDELSALGARRALILSTPEQQP
FT                   LADRVKDVLGERAAGVCAEAVMHVPVEVARAARETAAELGADCCIAIGGGSTIGLGKAI
FT                   ALESSLPILAVPTTYAGSEMTPIYGLTEGRLKRTGRDARVLPRTVIYDPSLTVSLPPGI
FT                   SAASGVNAMAHAVEALYAEDANPVISLMAEESIRALGEALPVVVRDPQDRAMRSRALYG
FT                   AWLAGTCLGAVGMALHHKLCHTLGGTFNLPHAQTHAAMLPHTAHYNHAAAPDALRRVAR
FT                   ALGGSDAADAGPLLFRLNAQLGIAPALADIGMPQQGLDEAADLACRNPYANPRPIERAA
FT                   IRALLQHAWEGRAPH"
FT   misc_feature    525069..526064
FT                   /gene="macA"
FT                   /locus_tag="BCAM0470"
FT                   /note="HMMPfam hit to PF00465, Iron-containing alcohol
FT                   dehydrogenase, score 2.8e-18"
FT                   /inference="protein motif:HMMPfam:PF00465"
FT   CDS_pept        526217..526528
FT                   /transl_table=11
FT                   /locus_tag="BCAM0471"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0471"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54328"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJX3"
FT                   /protein_id="CAR54328.1"
FT                   /translation="MARFFAVFATDQPGMRDVRDRMRPIHRTYLRSAAEHGVYVRLGGP
FT                   TLDPQDDAMNGTLLVVEADDIHAVMQFIGNDPYVKEGLFSRVEVRPWDWSLGNPEHRV"
FT   misc_feature    526247..526504
FT                   /locus_tag="BCAM0471"
FT                   /note="HMMPfam hit to PF03795, YCII-related domain, score
FT                   9.3e-17"
FT                   /inference="protein motif:HMMPfam:PF03795"
FT   CDS_pept        526532..526867
FT                   /transl_table=11
FT                   /locus_tag="BCAM0472"
FT                   /product="Rieske [2Fe-2S] protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0472"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54329"
FT                   /db_xref="GOA:B4EJX4"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJX4"
FT                   /protein_id="CAR54329.1"
FT                   /translation="MEAKQLCRVADVPDGGARVVDEACIGRPVIVVRRGEQVWAYVNRC
FT                   PHFSVPLDFVPGNVSCYRSQVLMCAHHSALFRFDDGVCIDGPCTGAGLETVAVEVDASA
FT                   WIVFRGA"
FT   misc_feature    526535..526834
FT                   /locus_tag="BCAM0472"
FT                   /note="HMMPfam hit to PF00355, Rieske [2Fe-2S] domain,
FT                   score 1.5e-05"
FT                   /inference="protein motif:HMMPfam:PF00355"
FT   CDS_pept        527061..528149
FT                   /transl_table=11
FT                   /locus_tag="BCAM0473"
FT                   /product="putative gram-negative porin"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0473"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54330"
FT                   /db_xref="GOA:B4EJX5"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJX5"
FT                   /protein_id="CAR54330.1"
FT                   /translation="MKLRFGVLAVLAVAQGAWAQSSVTMFGLIDSGITYVSNEGGGKNV
FT                   KFDDGIFAPNLFGLRGIEDLGGGYRATFALVNQFSMANGSIIGTGIFGRNAYVGIESDR
FT                   FGSITLGNQYDFMVDALFSKGNAISRDISGLYGFRNGPFQRLALPGNPTGAFDWDRTAG
FT                   SKPIANSVKYSSPTVAGFSGGVMYAFGGVAGSIGADNAVSAGVNYELGAFGVGAAYTNE
FT                   KYGPAPGVPSTSVRNWGVGMHYDFGVVTAKALMTTVRNSFNDAGVWMAEAGGLWRIRPD
FT                   VVLGAKYMYMKGNEALNDDHAHQVSVALQYLLSKRTMVYVSADYQRANGGANAQVNGVL
FT                   DPNGASSSASQAVARVGVHTVF"
FT   sig_peptide     527061..527117
FT                   /locus_tag="BCAM0473"
FT                   /note="Signal peptide predicted for BCAM0473 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.996 between residues 19 and 20"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    527115..528146
FT                   /locus_tag="BCAM0473"
FT                   /note="HMMPfam hit to PF00267, Gram-negative porin, score
FT                   0.0052"
FT                   /inference="protein motif:HMMPfam:PF00267"
FT   CDS_pept        complement(528290..528541)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0474"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0474"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54331"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJX6"
FT                   /protein_id="CAR54331.1"
FT                   /translation="MSKLGIAEGIKLRGNVNRITEIMTQGTLEDAIACFALGGMTLQAS
FT                   GGDVPLLRNLSELTRTALPKRVVKDYFGASNGVVMSLA"
FT   CDS_pept        528639..529442
FT                   /transl_table=11
FT                   /locus_tag="BCAM0475"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0475"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54332"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJX7"
FT                   /protein_id="CAR54332.1"
FT                   /translation="MVDKLKARTEPLFARIPASLKRNLVASAQARGVGVGQELARLLGE
FT                   RFESGLSASLQRGIDEFGRAQRAERAVWLEKYQVLLEAHVLECVKAAQNGDISALVKLG
FT                   ADVRAARRNRQRGLAGLNSRIEARKRESLQEQAAKDEAARVRQNSAFDTGGPIEDFQLP
FT                   PEERRRRNLIAQLEKMPVGTKKNLALQLGWRSMSRVSHILTPKGKKGHRPISAALAKEI
FT                   AKILEIDVEVLNKIEPNRDLAAILHHVDKLEKLFDDIANVGPRSR"
FT   CDS_pept        529443..529991
FT                   /transl_table=11
FT                   /locus_tag="BCAM0476"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0476"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54333"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJX8"
FT                   /protein_id="CAR54333.1"
FT                   /translation="MSAHGIRLTDFASRTSHFPFPFVYGRNDSSVPFYGAKVFLSDIEQ
FT                   VLSASPMLHDAISTFQVATNEDAYLTSFLHVHLERASTSAPIPLEDAVLHAEMFEGMKR
FT                   VNHDFREVSRLFDPTQVIVHVHDHDTGRFRDAIFGSRTRTSRENGRRMGSRCVASPRLA
FT                   SRRAIRRIPLSLSRSGSLG"
FT   CDS_pept        530293..530643
FT                   /transl_table=11
FT                   /locus_tag="BCAM0476a"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0476a"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54334"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJX9"
FT                   /protein_id="CAR54334.1"
FT                   /translation="MSQVSSASRPTVCEDWSHFLPGFTLTHTVHLVSRRNPGIVSTAAA
FT                   VLEGETATVDRWAITRCGDVLEQKIVLGEMTEGQAVRLRERLAALEGVLRTRVEHHFVR
FT                   AAAAGSTPESSH"
FT   CDS_pept        complement(530700..532529)
FT                   /transl_table=11
FT                   /gene="glmS2"
FT                   /locus_tag="BCAM0478"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase [isomerizing] 2"
FT                   /EC_number="2.6.1.16"
FT                   /note="family C44 cysteine peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0478"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54335"
FT                   /db_xref="GOA:B4EJY0"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJY0"
FT                   /protein_id="CAR54335.1"
FT                   /translation="MCGIVGAVAQRDILPNLVDGLKRLEYRGYDSCGVVVYRDRALARA
FT                   RSVDRVANLQREIAELALSGYTGIAHTRWATHGAPVTLNAHPHFSPSDANARIALSHNG
FT                   IIENCDQLRAELQAHGYVFASQTDSEAIAHLIDHLYDGDLFDAVRRAVARLRGSYAIAV
FT                   MCRDEPHRIVGARDGMPLVVGVGEGENFLASDAIALSGITDRIAYLENGDVADIQLHRY
FT                   WIVDANGQRVERAVQRVAAHSGAADLGSYRYYMQKEIFEQPQAVADTLLDVSSIMPELF
FT                   GDGAWRVFNDVDSVLLLACGGSYHAALTAKYWIESIAKLPASVEIASEFRYRDCVPNPR
FT                   TLVVAVSQSGETADVLGAVHVAKRSGMMHTLAICNVATSALMRECALQFVTRAGIEIGV
FT                   ASTKAFTTQLVALFLLTLSLAQVRGRLSDDAEKEHLRALRHLPDAMSKVLALEPQIMAW
FT                   SELLARRDNMLFLGRGMHYPIALEGALKMKEISYIHAEAYPAGELKHGPLALVSNEMPV
FT                   IAVAPNDVLLEKLRSNMHEVSARNGRLFVFADVDCGLVPSEGIEVIRLNEYYGPLSPIL
FT                   HTVPMQLLAYHAALARGTDIDKPRNLAKSVTVE"
FT   misc_feature    complement(530745..531155)
FT                   /gene="glmS2"
FT                   /locus_tag="BCAM0478"
FT                   /note="HMMPfam hit to PF01380, SIS domain, score 1.1e-23"
FT                   /inference="protein motif:HMMPfam:PF01380"
FT   misc_feature    complement(531267..531674)
FT                   /gene="glmS2"
FT                   /locus_tag="BCAM0478"
FT                   /note="HMMPfam hit to PF01380, SIS domain, score 3.8e-31"
FT                   /inference="protein motif:HMMPfam:PF01380"
FT   misc_feature    complement(531942..532526)
FT                   /gene="glmS2"
FT                   /locus_tag="BCAM0478"
FT                   /note="HMMPfam hit to PF00310, Glutamine amidotransferases
FT                   class-II, score 2.6e-35"
FT                   /inference="protein motif:HMMPfam:PF00310"
FT   misc_feature    complement(532512..532529)
FT                   /note="PS00443 Glutamine amidotransferases class-II active
FT                   site."
FT                   /inference="protein motif:Prosite:PS00443"
FT   CDS_pept        532686..533177
FT                   /transl_table=11
FT                   /locus_tag="BCAM0479"
FT                   /product="AnsC family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0479"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54336"
FT                   /db_xref="GOA:B4EJY1"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJY1"
FT                   /protein_id="CAR54336.1"
FT                   /translation="MAGITLDDLDLRILAILQDDASVSNLQLAERALSSPPTCMRRVRR
FT                   LTEAGVIRRQVAVLDPVAIGTAVTALIEISLDRQTAEDYDAFEAYVCAEPAVTQCYRVS
FT                   PGPDFVVIADLADVAEYDEFARRLFTGASNVRNVRTFFSTHRAKFEANARVAHAMRKRT
FT                   "
FT   misc_feature    532893..533123
FT                   /locus_tag="BCAM0479"
FT                   /note="HMMPfam hit to PF01037, AsnC family, score 1.7e-20"
FT                   /inference="protein motif:HMMPfam:PF01037"
FT   CDS_pept        complement(533207..534061)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0480"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /note="also called ketopantoate hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0480"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54337"
FT                   /db_xref="GOA:B4EJY2"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJY2"
FT                   /protein_id="CAR54337.1"
FT                   /translation="MSAHTRITRKTVTAIRSTKGIGSLVSLTAYSAPMAKLVDDVADVI
FT                   IVGDSVGMVLYGMPDTLRVTLDMMIAHGAAVVRGAAQACVVVDLPFSTFQESPAQAYRS
FT                   AARLLAETGAQAVKLEGGCEMTDTIRFLTDRGIPVMAHVGLMPQQANATGGFRAQGMDP
FT                   RSAAQVFDAACAAERAGAFGVVIEGTAEALARHLTETLTIPTIGIGASPACDGQVLVTE
FT                   DMIGAFDAYTPRFVKRYADANAVMRDAIRQYAHDVRQRVFPEPAHCFGYGKPLQLADAA
FT                   PAA"
FT   misc_feature    complement(533264..534040)
FT                   /locus_tag="BCAM0480"
FT                   /note="HMMPfam hit to PF02548, Ketopantoate
FT                   hydroxymethyltransferase, score 2.2e-104"
FT                   /inference="protein motif:HMMPfam:PF02548"
FT   sig_peptide     complement(533969..534061)
FT                   /locus_tag="BCAM0480"
FT                   /note="Signal peptide predicted for BCAM0480 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.954) with cleavage site
FT                   probability 0.750 between residues 31 and 32"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        534118..534957
FT                   /transl_table=11
FT                   /locus_tag="BCAM0481"
FT                   /product="AraC family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0481"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54338"
FT                   /db_xref="GOA:B4EJY3"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJY3"
FT                   /protein_id="CAR54338.1"
FT                   /translation="MTFGGRLMLLAGQPGDLYAVPPMARLPRPLYVRAFGIPGNASVDA
FT                   HSHPWAQLMYATSGVLEVTTPSGRQLLPPHYAMWIPPHVPHAVSTRDCVAFHSLYLDEA
FT                   IARRDVNDDCTILCMTPLLRELMIATGELPVNYDEAGPDGALVCLIADRIARMQPAPLT
FT                   VPLPRDPRLLKIARALHAAPGDTRSLDEWGRQVGATRRTLSRLFRQDTGLSFTEWRQAV
FT                   RLLASLPLLDAGAPIGTVAAQLGYDSTSSFIALFHAKFRVTPGAYAKREARRPVLSA"
FT   misc_feature    534676..534741
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1705.000, SD 4.99 at aa 187-208, sequence
FT                   RSLDEWGRQVGATRRTLSRLFR"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        complement(534971..535504)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0482"
FT                   /product="putative methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0482"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54339"
FT                   /db_xref="GOA:B4EJY4"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJY4"
FT                   /protein_id="CAR54339.1"
FT                   /translation="MTPAHLIPSPLGDIAVRIEDDALTGLYFVGQKYFPSLAIVREADA
FT                   LATSPIARQVAEEIAEYFTGARDTFSVPIHLRGTAFQRRVWQELLAIPFGELVSYGDIT
FT                   ERVGLPMSGARAVGGAVGRNPVSIIVPCHRVVGASGSLTGYAGGIDRKRALLSLEGAEL
FT                   SRGVHHPMQHALAF"
FT   misc_feature    complement(535013..535273)
FT                   /locus_tag="BCAM0482"
FT                   /note="HMMPfam hit to PF01035, 6-O-methylguanine DNA
FT                   methyltransferase, score 1.2e-46"
FT                   /inference="protein motif:HMMPfam:PF01035"
FT   misc_feature    complement(535097..535117)
FT                   /note="PS00374 Methylated-DNA--protein-cysteine
FT                   methyltransferase active site."
FT                   /inference="protein motif:Prosite:PS00374"
FT   CDS_pept        complement(535501..536952)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0483"
FT                   /product="ADA-like AraC family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0483"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54340"
FT                   /db_xref="GOA:B4EJY5"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010316"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="InterPro:IPR037046"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJY5"
FT                   /protein_id="CAR54340.1"
FT                   /translation="MRLDPDTCYDALLSRNRRFDGWFFVGVATTGVYCRPVCPVKPPKA
FT                   QNCSYYPTAAAAEKAGFRPCMRCRPELAPGHGLLDLSGNLADAAATLIDDGFLNAHSVA
FT                   ALARRIGVTERHLRRIFGAQFGVSPVEFAQTQRLLMAKRLLTDTALPVAVVASTAGFGS
FT                   VRRFNDLFRQRYGLNPLRLRKGAGASADGDMTFPLPYRPPFAWADLMRFLAQRQIDGVE
FT                   RIDAHGYARIVELPNRNDGGLVAGWLSIAHVPQRFALAVTVSPALTPVVPAVLARVRRL
FT                   FDLDSRPDVIDAHLGDLANGSPGLRVPGAFDGLEMAIRAIAGEQLAAAQADTPLLARIA
FT                   ARFGNPVDGAPPGLAHALPCAATLAALPPSVLETIGIERDTAHAIVSLARAVDDGTLAL
FT                   EPMAPLDATLAALRALPGFDERAVQYVAMRAMAWPNAFPADDAWLPARTERTRVSSSAP
FT                   HAARWAPWRAYAALHVWRLHGERLR"
FT   misc_feature    complement(536017..536370)
FT                   /locus_tag="BCAM0483"
FT                   /note="HMMPfam hit to PF06029, AlkA N-terminal domain,
FT                   score 1.2e-37"
FT                   /inference="protein motif:HMMPfam:PF06029"
FT   misc_feature    complement(536401..536535)
FT                   /locus_tag="BCAM0483"
FT                   /note="HMMPfam hit to PF00165, Bacterial regulatory
FT                   helix-turn-helix, score 2.7e-08"
FT                   /inference="protein motif:HMMPfam:PF00165"
FT   misc_feature    complement(536416..536544)
FT                   /note="PS00041 Bacterial regulatory proteins, araC family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00041"
FT   misc_feature    complement(536551..536691)
FT                   /locus_tag="BCAM0483"
FT                   /note="HMMPfam hit to PF00165, Bacterial regulatory
FT                   helix-turn-helix, score 1.7e-06"
FT                   /inference="protein motif:HMMPfam:PF00165"
FT   misc_feature    complement(536587..536652)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1671.000, SD 4.88 at aa 101-122, sequence
FT                   HSVAALARRIGVTERHLRRIFG"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    complement(536650..536685)
FT                   /note="PS00136 Serine proteases, subtilase family, aspartic
FT                   acid active site."
FT                   /inference="protein motif:Prosite:PS00136"
FT   misc_feature    complement(536740..536937)
FT                   /locus_tag="BCAM0483"
FT                   /note="HMMPfam hit to PF02805, Metal binding domain of Ada,
FT                   score 3.1e-41"
FT                   /inference="protein motif:HMMPfam:PF02805"
FT   CDS_pept        537255..538586
FT                   /transl_table=11
FT                   /locus_tag="BCAM0484"
FT                   /product="putative hexuronate transporter"
FT                   /note="homology does not extend to far N terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0484"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54341"
FT                   /db_xref="GOA:B4EJY6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJY6"
FT                   /protein_id="CAR54341.1"
FT                   /translation="MRRDGRDRASETFMPSAVVGAVRAAASRYRWTVCALLFFATVINY
FT                   MDRQILGLLAPMLQHDIGWSQVQYGRIVMAFSAFYALGLLGFGRIVDWLGTRVSYAVAM
FT                   LVWSIAAMLHAAVGSVTGFAFVRALLGIGEGGNFPAAIKTTAEWFPRRERALATGIFNS
FT                   GANIGAVFAPAIIPAIAVAYGWRAAFVIIGAIGIVWLAVWLAMYRTADTRALAAEYDEP
FT                   RDEAEALDAANADAGAPRWGELIRKRETWAFLVGKFLTDPVWWFYLFWLPKWLNESRGM
FT                   DMQHIGLPLVCIYALTTVGSIGGGWLSSMLLRAGWSVNRARKTAMLICACCVLPIAFVS
FT                   QVQSLWVAVLIVGLAAAAHQGWSANLFTTASDLFPRRAVASVVGIGGMAGSIGGVLFSE
FT                   VIGQVLQRTGHYWVLFAIGASAYLIALAVMHGLTPKMKPAKLDA"
FT   misc_feature    537345..538574
FT                   /locus_tag="BCAM0484"
FT                   /note="HMMPfam hit to PF00083, Sugar (and other)
FT                   transporter, score 0.00017"
FT                   /inference="protein motif:HMMPfam:PF00083"
FT   misc_feature    537363..538472
FT                   /locus_tag="BCAM0484"
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 2.2e-60"
FT                   /inference="protein motif:HMMPfam:PF07690"
FT   misc_feature    join(537459..537527,537555..537623,537729..537797,
FT                   537807..537875,538005..538064,538107..538175,
FT                   538233..538328,538386..538445,538482..538550)
FT                   /locus_tag="BCAM0484"
FT                   /note="9 probable transmembrane helices predicted for
FT                   BCAM0484 by TMHMM2.0 at aa 69-91, 101-123, 159-181,
FT                   185-207, 251-270, 285-307, 327-358, 378-397 and 410-432"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    537795..537839
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        complement(538663..539655)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0485"
FT                   /product="LacI family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0485"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54342"
FT                   /db_xref="GOA:B4EJY7"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJY7"
FT                   /protein_id="CAR54342.1"
FT                   /translation="MKKVSPTIRDVAAEAGVSVATVSKYVNGTQRFSPTVEARLKEAIE
FT                   RLGYRSNPLARSMITGRTRTIGLVILDISNPHFTNVVKGANRVALQHDYTLLLVDTEES
FT                   QARERSLIEALAQRVDGLIVSTRMPDEEAGWMLDLNKPLVLLRRSPGLPIPSVGIDNRL
FT                   STYMLARHLLNLGHTRIAYLGFGTARVNDERIQGARDCLAEAGLTLDVHDAHAPTAEAG
FT                   ERACSRVMLGPQRPQAVICYNDLIALGFMKEAASLGFRLPQDVSVAGVDNVPYGEYAAP
FT                   ALTTVDIQSENMGELAMQKLIDALAGRTDASYSTFEPRLIMRASTAPAG"
FT   misc_feature    complement(538681..539469)
FT                   /locus_tag="BCAM0485"
FT                   /note="HMMPfam hit to PF00532, Periplasmic binding proteins
FT                   and sugar b, score 1.2e-12"
FT                   /inference="protein motif:HMMPfam:PF00532"
FT   misc_feature    complement(539563..539640)
FT                   /locus_tag="BCAM0485"
FT                   /note="HMMPfam hit to PF00356, Bacterial regulatory
FT                   proteins, lacI fami, score 1.7e-08"
FT                   /inference="protein motif:HMMPfam:PF00356"
FT   misc_feature    complement(539575..539640)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1897.000, SD 5.65 at aa 43-64, sequence
FT                   PTIRDVAAEAGVSVATVSKYVN"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    complement(539578..539634)
FT                   /note="PS00356 Bacterial regulatory proteins, lacI family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00356"
FT   CDS_pept        539838..540674
FT                   /transl_table=11
FT                   /locus_tag="BCAM0486"
FT                   /product="NAD dependent epimerase/dehydratase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0486"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54343"
FT                   /db_xref="GOA:B4EJY8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJY8"
FT                   /protein_id="CAR54343.1"
FT                   /translation="MNASSTAARKPFGRLLLTGAAGNLGRQLRGALADWADVVRVSDIA
FT                   ALDDAAAHEEIRVVDLADRPAVMQLVDGVDAIVHLGGISVDAPFDDLVGANITGTYNLY
FT                   EAARKHGVKRVVFASSNHAIGFHPVTEVLDADAPLRPDSLYGVTKCFGESLSRYYFDRF
FT                   GIETVCLRIGSSFEVPKNPRMLVTFLSYRDFIELVRCSLLTNRVGHAIVYGASDNPVKW
FT                   WDNTKVGFLGFRPRDSSEQFAGLFPVTAPTAEYDDPAQRFQGGGFVVGEPMERKAS"
FT   misc_feature    539877..540620
FT                   /locus_tag="BCAM0486"
FT                   /note="HMMPfam hit to PF04321, RmlD substrate binding
FT                   domain, score 0.00093"
FT                   /inference="protein motif:HMMPfam:PF04321"
FT   misc_feature    539880..540488
FT                   /locus_tag="BCAM0486"
FT                   /note="HMMPfam hit to PF02719, Polysaccharide biosynthesis
FT                   protein, score 0.0049"
FT                   /inference="protein motif:HMMPfam:PF02719"
FT   misc_feature    539880..540479
FT                   /locus_tag="BCAM0486"
FT                   /note="HMMPfam hit to PF01370, NAD dependent
FT                   epimerase/dehydratase f, score 3e-08"
FT                   /inference="protein motif:HMMPfam:PF01370"
FT   misc_feature    539883..540569
FT                   /locus_tag="BCAM0486"
FT                   /note="HMMPfam hit to PF01073, 3-beta hydroxysteroid
FT                   dehydrogenase/i, score 2.9e-08"
FT                   /inference="protein motif:HMMPfam:PF01073"
FT   misc_feature    539886..540470
FT                   /locus_tag="BCAM0486"
FT                   /note="HMMPfam hit to PF07993, Male sterility protein,
FT                   score 2.6e-05"
FT                   /inference="protein motif:HMMPfam:PF07993"
FT   CDS_pept        complement(540703..541023)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0487"
FT                   /product="conserved hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0487"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54344"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJY9"
FT                   /protein_id="CAR54344.1"
FT                   /translation="MTAYAIAHLHDVDMCDDIVEYLERIDGTLAPYDGHFVIHGARPEV
FT                   REGEWRGDLIAIAFPDLDTARAWYESDAYRQIQPLRARHASGPLILIDGVDERHKATDI
FT                   LR"
FT   misc_feature    complement(540742..541020)
FT                   /locus_tag="BCAM0487"
FT                   /note="HMMPfam hit to PF07045, Protein of unknown function
FT                   (DUF1330), score 1.3e-22"
FT                   /inference="protein motif:HMMPfam:PF07045"
FT   CDS_pept        complement(541156..541851)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0488"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0488"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54345"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJZ0"
FT                   /protein_id="CAR54345.1"
FT                   /translation="MTIPRIKGFFIAVLLTFGIGSAFASTCDDTHSSIRCPDTSDLPAD
FT                   IVAQLPAGYEALDAASGRLTDGTRNGYVVVAHQPGDSMQTPSLRPLLIFLQGANGRYRL
FT                   AARNDTVIMKADEGGMGDPYLDGVAENALTIEPRMFTVEQGVFAGHNHWRDRVTFRYDV
FT                   AHRTWLFHREVFRNWRFNYEQDGDALKADPVRVTRANAAKAVSFEAWRPSYWCDSAERR
FT                   NNDPACRKH"
FT   sig_peptide     complement(541780..541851)
FT                   /locus_tag="BCAM0488"
FT                   /note="Signal peptide predicted for BCAM0488 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.899 between residues 24 and 25"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(541952..542422)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0489"
FT                   /product="MerR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0489"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54346"
FT                   /db_xref="GOA:B4EJZ1"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJZ1"
FT                   /protein_id="CAR54346.1"
FT                   /translation="MEPIMKIGELAKASGLAASRIRFYEASGLLEPARRQANGYREYGP
FT                   EALTRLAIIDRAQRAGFSLDEIRAVLPPDLGAWPHDELLVALRHKVDEIALLERRLAQN
FT                   RQHLETLIDEIENKPEGEDCAGAAQRMLDRLCEQASQPLESAPVVRPARKRA"
FT   misc_feature    complement(542294..542407)
FT                   /locus_tag="BCAM0489"
FT                   /note="HMMPfam hit to PF00376, MerR family regulatory
FT                   protein, score 1.8e-10"
FT                   /inference="protein motif:HMMPfam:PF00376"
FT   misc_feature    complement(542333..542401)
FT                   /note="PS00552 Bacterial regulatory proteins, merR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00552"
FT   misc_feature    complement(542345..542410)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1323.000, SD 3.69 at aa 5-26, sequence
FT                   MKIGELAKASGLAASRIRFYEA"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        542479..543720
FT                   /transl_table=11
FT                   /locus_tag="BCAM0490"
FT                   /product="putative NADH oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0490"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54347"
FT                   /db_xref="GOA:B4EJZ2"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJZ2"
FT                   /protein_id="CAR54347.1"
FT                   /translation="MSTMNLFAPLTLPNGAVIPNRLAKAAMEENMADADHAPSDALLRL
FT                   YQAWADGQVGLILTGNVMVDGRAMTGPNGVVLESDAHLDRFRRWAQIARSGGAHVWMQI
FT                   NHPGRQMQAALGQTTLAPSAVPLALGALSKQFPVPKEMTAADIADVQQRFVRAAQLAEQ
FT                   SGFTGVQVHAAHGYLLSQFLSPLTNRRQDQWGGSIENRARLLLDIVKAVRATVSPAFVV
FT                   AVKLNSADFQRGGFSADDAKRVVELLNPLGVDLVELSGGSYEVPAMQGEARDGRTLARE
FT                   AYFLEFARDITAVARMPLMVTGGIRRRAVAEQVVNSGVAMVGIATALSIDPNLPRDWRA
FT                   GKDSAPVLQPIRWKNKALGALANMAVVKFQLTRLSEGRRTHPRVSPLRALVRQQLAAQC
FT                   QTRRYRKWMAGPRA"
FT   misc_feature    542491..543513
FT                   /locus_tag="BCAM0490"
FT                   /note="HMMPfam hit to PF00724, NADH:flavin oxidoreductase /
FT                   NADH oxidas, score 7.6e-57"
FT                   /inference="protein motif:HMMPfam:PF00724"
FT   CDS_pept        complement(543815..545938)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0491"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0491"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54348"
FT                   /db_xref="GOA:B4EJZ3"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJZ3"
FT                   /protein_id="CAR54348.1"
FT                   /translation="MKFKSMLPAAVLAALSPAGQAHAQERGVDGAGATLAPILVDAQKA
FT                   PALTQPLDTGSHLGLSPLETPASVEQINRATLDTRGDNSIIDAVSRAAGISASPHPGNG
FT                   NSELAARGFVGASSVTQLYDGMRPYGAIGVTFPFDTWSVDHIDVLRGPASVIYGEGAIG
FT                   GVVNIVPKKPTRTPIRNELQVGGGTEGTARAAFGSGGAINDKLSYRFDVSGNRSSNWVD
FT                   RGDSRNLSVSGALRYDVTPDLYVTASYAQGFMHPMQYFGVPLVDGARDRALDKKNYNVG
FT                   DADIAFRDSWATVSANWQPSDALNVTSTLYRMKSNRHWKDAEYYTYLPSSAQARRSSYT
FT                   EIFHDQEQYGNVTTATVGSALFGMRNTFSAGVEFNHTTFQHDNNSPYAGTSTVDPFNVD
FT                   PGSFLNTAGTFPKYRSQSNQYALFAENRLEITPRWSVIGGLRYDHASVNRDDLVNGGAF
FT                   TKVFANTGWRLGTVYDVRPGLAVYGQYSVAADPVSSLLSLNASKANFTLATGRQIEIGV
FT                   KQSFLDGKAEWTLAAYRIVKRNLLTADPVNPNQSIQVGQQSSRGLEATVGAEIAKDWRV
FT                   DANVSILRAKYDDFQQSSGGTTVSRAGNVPVSVPQRLANLWISWRFAPDWTGIAGVKYV
FT                   GKRFADTANQLVMPSYTTVDLGLAWKPRKDTTITARAYNVFNRRYVQSAYYNETQYLLG
FT                   NDRRVEVLANYRF"
FT   misc_feature    complement(543818..545251)
FT                   /locus_tag="BCAM0491"
FT                   /note="HMMPfam hit to PF00593, TonB dependent receptor,
FT                   score 5.6e-16"
FT                   /inference="protein motif:HMMPfam:PF00593"
FT   misc_feature    complement(545360..545395)
FT                   /note="PS00455 Putative AMP-binding domain signature."
FT                   /inference="protein motif:Prosite:PS00455"
FT   misc_feature    complement(545444..545758)
FT                   /locus_tag="BCAM0491"
FT                   /note="HMMPfam hit to PF07715, TonB-dependent Receptor Plug
FT                   Domain, score 2.9e-20"
FT                   /inference="protein motif:HMMPfam:PF07715"
FT   sig_peptide     complement(545870..545938)
FT                   /locus_tag="BCAM0491"
FT                   /note="Signal peptide predicted for BCAM0491 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.994 between residues 23 and 24"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(545979..547448)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0492"
FT                   /product="putative transmembrane peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0492"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54349"
FT                   /db_xref="GOA:B4EJZ4"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJZ4"
FT                   /protein_id="CAR54349.1"
FT                   /translation="MSTTVDRAVAPARSASAGYRTLWRWHFYAGLFVMPFLVILAITGT
FT                   LYGFQPQIEPLLYPHRLVVEPRATPRLDADTLLARARTAMPADATPVSVQVATAPDRSA
FT                   EYVFRLRDGSRESVYVSPYDGRVLGTLSVENRFMQVDRMLHRKLLLGKTGEWLMELAAC
FT                   WTFVMIGTGIALWWPRGAARVGRALRPDLSLRGRPLWKSLHATAGIWLAAGTVAFILTG
FT                   LPWSGSWGKNFKALAATVNLGAPEGAWGGASVRSTRPGAAATAGQAPAQATAPSGHHHD
FT                   SGESMPGMVMDDLPLPQTPWAVGNVPVPHSPSAPTPAPLPLARAIAIVAGLGVTSGYTL
FT                   ALPSGADGVFTASYFPADPKAERTIYVDQYSGAVLKDIRYGDYGAVSKAVSYGTSLHMG
FT                   RYFGLANQIICAVLSLGLAAMAVTGTVMWWKRRPAGTLGAPSRERGTPPMRGWIAGLVL
FT                   LGIVFPLMGLTIVAVWLLDRLLFGRAARAAA"
FT   misc_feature    complement(join(546021..546089,546162..546230,
FT                   546423..546491,546786..546854,546915..546983,
FT                   547302..547370))
FT                   /locus_tag="BCAM0492"
FT                   /note="6 probable transmembrane helices predicted for
FT                   BCAM0492 by TMHMM2.0 at aa 27-49, 156-178, 199-221,
FT                   320-342, 407-429 and 454-476"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(546165..546245)
FT                   /locus_tag="BCAM0492"
FT                   /note="HMMPfam hit to PF03929, PepSY-associated TM helix,
FT                   score 0.0038"
FT                   /inference="protein motif:HMMPfam:PF03929"
FT   misc_feature    complement(546315..546494)
FT                   /locus_tag="BCAM0492"
FT                   /note="HMMPfam hit to PF03413, Peptidase propeptide and
FT                   YPEB domain, score 0.00036"
FT                   /inference="protein motif:HMMPfam:PF03413"
FT   misc_feature    complement(546771..546851)
FT                   /locus_tag="BCAM0492"
FT                   /note="HMMPfam hit to PF03929, PepSY-associated TM helix,
FT                   score 0.028"
FT                   /inference="protein motif:HMMPfam:PF03929"
FT   misc_feature    complement(546921..546992)
FT                   /locus_tag="BCAM0492"
FT                   /note="HMMPfam hit to PF03929, PepSY-associated TM helix,
FT                   score 0.092"
FT                   /inference="protein motif:HMMPfam:PF03929"
FT   misc_feature    complement(547056..547238)
FT                   /locus_tag="BCAM0492"
FT                   /note="HMMPfam hit to PF03413, Peptidase propeptide and
FT                   YPEB domain, score 0.00064"
FT                   /inference="protein motif:HMMPfam:PF03413"
FT   misc_feature    complement(547305..547385)
FT                   /locus_tag="BCAM0492"
FT                   /note="HMMPfam hit to PF03929, PepSY-associated TM helix,
FT                   score 1.2"
FT                   /inference="protein motif:HMMPfam:PF03929"
FT   CDS_pept        complement(547691..548176)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0493"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0493"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54350"
FT                   /db_xref="GOA:B4EJZ5"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJZ5"
FT                   /protein_id="CAR54350.1"
FT                   /translation="MNALRRFLLRPGVARQWLWGFLLVTLLSRALMSGAVMLDPDGPDA
FT                   GSVVLCSGQGPLIVTAAALAARFDASAPITPANDALALVDALKHDAHADKAASSGNGDS
FT                   LCAFGAALFTALASFVLLVLLFPAAVPRRFRVHFDSLPFVRSLFDDRPPSRAPPRFC"
FT   misc_feature    complement(join(547787..547855,548060..548128))
FT                   /locus_tag="BCAM0493"
FT                   /note="2 probable transmembrane helices predicted for
FT                   BCAM0493 by TMHMM2.0 at aa 17-39 and 108-130"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(548063..548176)
FT                   /locus_tag="BCAM0493"
FT                   /note="Signal peptide predicted for BCAM0493 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.910) with cleavage site
FT                   probability 0.592 between residues 38 and 39"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(548259..548462)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0494"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0494"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54351"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJZ6"
FT                   /protein_id="CAR54351.1"
FT                   /translation="MRIGNRTSRLAGEPGLFVKQYGRNARKHLDPNDTERAMRRLSTAD
FT                   LPGLPADDATEEDQSGVDSGPV"
FT   CDS_pept        complement(548551..548940)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0495"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0495"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54352"
FT                   /db_xref="GOA:B4EJZ7"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJZ7"
FT                   /protein_id="CAR54352.1"
FT                   /translation="MNSPAGAPTATPVRCAHATRPFMDAQPNSSDTSFQLFLAKVLEQP
FT                   LPDWTEKQQMELEMARTLSTQMVTLAEDMRGRTPDLARCLVLLRYAKVLDFMLTSLAAH
FT                   RDIHPQTLRTLFRLANLKVDDAYPV"
FT   misc_feature    complement(548590..548655)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1128.000, SD 3.03 at aa 96-117, sequence
FT                   FMLTSLAAHRDIHPQTLRTLFR"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        549016..549165
FT                   /transl_table=11
FT                   /locus_tag="BCAM0495a"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0495a"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54353"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJZ8"
FT                   /protein_id="CAR54353.1"
FT                   /translation="MLSRAPASVGESRRDWIGLAIEEGVYARTAGGVGRLQRRDEVKCF
FT                   TDVT"
FT   CDS_pept        549463..550095
FT                   /transl_table=11
FT                   /locus_tag="BCAM0496"
FT                   /product="putative transporter-LysE family"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0496"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54354"
FT                   /db_xref="GOA:B4EJZ9"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B4EJZ9"
FT                   /protein_id="CAR54354.1"
FT                   /translation="MSVHTFFSANLLLAYTAYFIGTASPGPSNLAIMSVAANQGRKAAL
FT                   AFALGVISGSMFWATVAALGVSAALLAWSKLLIAIKVFGGLYLLWLAFKSARTALAGPP
FT                   AASANAAREQRLSRFYVRGAMLHLTNPKAILVWVSIVALSSNGAGGAHGAVVPGCLAIG
FT                   CAVFGGYALVFSMDGARRLYVRGRRAMEACLAVVFGVAGVRLLVTNV"
FT   sig_peptide     549463..549570
FT                   /locus_tag="BCAM0496"
FT                   /note="Signal peptide predicted for BCAM0496 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.692) with cleavage site
FT                   probability 0.306 between residues 36 and 37"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(549505..549573,549592..549660,549670..549738,
FT                   549817..549885,549922..549990,550027..550086)
FT                   /locus_tag="BCAM0496"
FT                   /note="6 probable transmembrane helices predicted for
FT                   BCAM0496 by TMHMM2.0 at aa 15-37, 44-66, 70-92, 119-141,
FT                   154-176 and 189-208"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    549517..550089
FT                   /locus_tag="BCAM0496"
FT                   /note="HMMPfam hit to PF01810, LysE type translocator,
FT                   score 3.2e-24"
FT                   /inference="protein motif:HMMPfam:PF01810"
FT   misc_feature    549922..549954
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        550332..551369
FT                   /transl_table=11
FT                   /locus_tag="BCAM0497"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0497"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54355"
FT                   /db_xref="InterPro:IPR040761"
FT                   /db_xref="InterPro:IPR041290"
FT                   /db_xref="UniProtKB/TrEMBL:B4EK00"
FT                   /protein_id="CAR54355.1"
FT                   /translation="MVRLLRWFGVLAGLCACTSVFSADPATSNPLLSKVRPWCIGRLVF
FT                   DRPVSSEISSQRYAYRGEQLLTTHEVPPDAYQAAIAAREQVMRTRLRANPVEMDRKTRH
FT                   AWLEMAFSPVPDSRVFVFNEAAAKSVTLPFDTEGYLYANRTLVRTTGSIGADALDRVEG
FT                   VYDDTFRRIRMRDNWVVPTEPGFCFDGGIVTGSSTYPEEVRQSFALMPGRPALLVIQSR
FT                   NAFGDDREQPFSRTLPALRAKFDRLPGSHRLLREGKRSIAGMDAEEVLFELRDGAVTAY
FT                   RFYLLAPGNAATLAQPHTAIEMLLGVAGQSDLPPAQATSPVDEARALQAWDTLLNGLHA
FT                   RPGAI"
FT   sig_peptide     550332..550397
FT                   /locus_tag="BCAM0497"
FT                   /note="Signal peptide predicted for BCAM0497 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.860 between residues 22 and 23"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    550350..550382
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    551340..551363
FT                   /note="PS00369 PTS HPR component histidine phosphorylation
FT                   site signature."
FT                   /inference="protein motif:Prosite:PS00369"
FT   CDS_pept        complement(551461..553089)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0498"
FT                   /product="putative aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0498"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54356"
FT                   /db_xref="GOA:B4EK01"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:B4EK01"
FT                   /protein_id="CAR54356.1"
FT                   /translation="MPDSASLQHLFPALQDIPAEFRLASPIHQRVSLVDGELRPWDGAT
FT                   KTVLSPVCVRQPDGGVEQVEIGSYPVMGETESDAALDAAVRAYDAGRGEWPTMKVEQRI
FT                   ACMQDFIKRMVAQRERVVNLIMWEIGKSLADSQKEFDRTVTYMTQTIDALKELDNANSR
FT                   FVIAEGTIGQIRRTPLGVVLCMGPYNYPLNETFATLIPALLMGNTVVFKPPQYGTLLFE
FT                   PLLEAFRDAFPKGVINTIYAPGAVVVPHMLASGKINVLALIGSSKVADHLKKQHPKSHR
FT                   LRAILGLDAKNAAIVLPDADLDLTVKECLLGALSFNGQRCTALKMLLVHRSIVDEFLKR
FT                   FTAALEQLKIGMPWEKGVSITPLPGMHRTAYMTDAIDDARAKGAQVVNHQGGEFSKTLF
FT                   YPAVVYPVSEGMKLYREEQFGPIIPVAPFDDVETALDYVTTSEHGQQVSIFGSDPAQIG
FT                   ALVDPLVNQVCRVNINCQCQRGPDVFPFAGRKDSAEGTLSVSDALRAFSIRSMVAAKQT
FT                   DGSKQLLDSIVSDHHSKFINTGFIF"
FT   misc_feature    complement(551554..552978)
FT                   /locus_tag="BCAM0498"
FT                   /note="HMMPfam hit to PF00171, Aldehyde dehydrogenase
FT                   family, score 1.6e-75"
FT                   /inference="protein motif:HMMPfam:PF00171"
FT   misc_feature    complement(552115..552150)
FT                   /note="PS00070 Aldehyde dehydrogenases cysteine active
FT                   site."
FT                   /inference="protein motif:Prosite:PS00070"
FT   CDS_pept        553828..556026
FT                   /transl_table=11
FT                   /locus_tag="BCAM0499"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0499"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54357"
FT                   /db_xref="GOA:B4EK02"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B4EK02"
FT                   /protein_id="CAR54357.1"
FT                   /translation="MSRLFSCRLRWPFAVFFTTSTFTMKLHTSACHALLIATSLAGART
FT                   SFAQASDAAATLPAISVNAAAEHGSYDGGHSRAATKTDMSLMDVPQTVNVVPHAVIEDQ
FT                   NATSLQDALRNVPGVGFSVGDGQRDQITIRGFNSITDQYVDGIRDDALYYRDLSNVDRV
FT                   EVLKGPAAVLYGRGSAGGIVNRVLKRPQANPVNDVGVTLGTRGERRGEFDLGWNPNDAA
FT                   RFRITGAAENSNSFRDRFQLNRQAIAPSAQFKLDRDTVLNVEFDYLHDRRTSDQGLPAY
FT                   RGRPVDVPINTYYGSADGGNSSYNDISAKSATVSLDHRFNDSLSFHGAIRAYDFSLERK
FT                   NYVTYEPIKTAAHPVVTLDQSTRQRTDHGIDGLFELTQKTSLFGMRHELLYGLELSQQQ
FT                   KFDTIYSVTKVATYDLFNPQPVVLPGVPGGTRAKTNASTVVGLAGVYAQDLISLTEHWK
FT                   VLAGLRFDYLNQIRHDYTSSNVNLDRTDHAWSPRVGLIYEPLDWLTLYGSFSQSFSPLA
FT                   DTLISSGAFSNGAALAPQKTTAYEVGSRFDLGGKATASVALFDMRQTNQQIGDPANPGY
FT                   ALPIGTQHVRGMELGFTGEIAPKWSVYAGYAYLNGTVDGSAQSTAAGLAVSSNTPGLMP
FT                   RHSANLWLKRELPYGFYAAAGMQFQSARYTSASDLVTLPSFTVFNLGAGYRSKKVDVTL
FT                   TLDNLFDRRYFIAAHGNADLYNMPGDPRTLTATVKWHM"
FT   sig_peptide     553897..553971
FT                   /locus_tag="BCAM0499"
FT                   /note="Signal peptide predicted for BCAM0499 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.504 between residues 25 and 26"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    554080..554373
FT                   /locus_tag="BCAM0499"
FT                   /note="HMMPfam hit to PF07715, TonB-dependent Receptor Plug
FT                   Domain, score 4.1e-25"
FT                   /inference="protein motif:HMMPfam:PF07715"
FT   misc_feature    555295..556023
FT                   /locus_tag="BCAM0499"
FT                   /note="HMMPfam hit to PF00593, TonB dependent receptor,
FT                   score 1.7e-30"
FT                   /inference="protein motif:HMMPfam:PF00593"
FT   CDS_pept        556114..556575
FT                   /transl_table=11
FT                   /locus_tag="BCAM0500"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0500"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54358"
FT                   /db_xref="UniProtKB/TrEMBL:B4EK03"
FT                   /protein_id="CAR54358.1"
FT                   /translation="MTARARALLLSLLACGPVAAGAQTIPADAEPGCHAVHVDRTITLS
FT                   GRYALDYGDESIGPDVGFEEDDASARHLPDHPQRAGVIVFTNQSDARRRLRLPAAQPRG
FT                   VCRFDGRATLVIRDLETACPGLETPDRARLVKVVSADAPARHACGATAR"
FT   sig_peptide     556114..556179
FT                   /locus_tag="BCAM0500"
FT                   /note="Signal peptide predicted for BCAM0500 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.697 between residues 22 and 23"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(556595..557518)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0501"
FT                   /product="LysR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0501"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54359"
FT                   /db_xref="GOA:B4EK04"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EK04"
FT                   /protein_id="CAR54359.1"
FT                   /translation="MGALVAFEAAARHESFTHAAKELFLTESAVSRQIATLEASLGVRL
FT                   FARVKQRVVLTRAGKLYGTQVRRALEALDRDTLSIIAHGSGGGYLELAVLPTFASHWLI
FT                   PRIKSFYDRTPDVRVNMGSRTDLFSFEDTHFEAAIHYGKPTWPGTSSDYLFGEEVVPIC
FT                   SPALLNGPVERVEDLLAYPLLHSTTRPGAWAQWFETHGVEDIRTMQGVRYELHTMLISA
FT                   AAAGLGVALVPKFFVEEQLQQLGLVVPCDAATVGDSAYYLVYPTEFSHSKPLESFRGWL
FT                   LEQASAYAAPERDARDADEEDDEDVE"
FT   misc_feature    complement(556661..557272)
FT                   /locus_tag="BCAM0501"
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 8.3e-35"
FT                   /inference="protein motif:HMMPfam:PF03466"
FT   misc_feature    complement(557339..557518)
FT                   /locus_tag="BCAM0501"
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix, score 2.1e-17"
FT                   /inference="protein motif:HMMPfam:PF00126"
FT   misc_feature    complement(557384..557476)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00044"
FT   misc_feature    complement(557414..557479)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1735.000, SD 5.10 at aa 14-35, sequence
FT                   ESFTHAAKELFLTESAVSRQIA"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        557768..558796
FT                   /transl_table=11
FT                   /locus_tag="BCAM0502"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0502"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54360"
FT                   /db_xref="InterPro:IPR009770"
FT                   /db_xref="UniProtKB/TrEMBL:B4EK05"
FT                   /protein_id="CAR54360.1"
FT                   /translation="MRNPNIDSLLTKLLGQAKTDALFSTLNMPAILEEWEDGVVTRAEI
FT                   AQAMNMALFEGLLERSANGRAYTAEAIENGGSVYFDHGALRTVRWPHTGALPPGEAAFT
FT                   RILRPLGFRLNGRYPLDKLGMTGRAYAHEDAPDEIAQFFVSELHPERFSKEFQQAVTNV
FT                   ISSSCDPLSPAAVALLWEVEREGWLSLEAAHVLLPEIVGAFARQHDVPNELDYETLLME
FT                   SAEMAWIATEGNAFNHATDRVADVFKLSDDEKAKGRPMKPEVERSRSGRVFQTAYRADT
FT                   VEREFRTRDGGTVKRNVPGSFYEFITRKRTFDQAARRWVTDLRFDAGNAQGIFKMTANA
FT                   AK"
FT   misc_feature    558239..558271
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(559036..559233)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0504"
FT                   /product="CsbD-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0504"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54361"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR026042"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:B4EK06"
FT                   /protein_id="CAR54361.1"
FT                   /translation="MNEDKIKGQWKQLTGKLKAKWGKLTDDDLQVAEGNRDYLAGKIQE
FT                   RYGIARDEAEKQLKEFDREL"
FT   misc_feature    complement(559066..559224)
FT                   /locus_tag="BCAM0504"
FT                   /note="HMMPfam hit to PF05532, CsbD-like, score 6.1e-19"
FT                   /inference="protein motif:HMMPfam:PF05532"
FT   CDS_pept        complement(559287..559637)
FT                   /transl_table=11
FT                   /locus_tag="BCAM0505"
FT                   /product="putative membrane-attached protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0505"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54362"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:B4EK07"
FT                   /protein_id="CAR54362.1"
FT                   /translation="MNKTSHLSTLLAVSAAFLLSAAPLTNAHAQASSTDSGMASESNQP
FT                   VTDTWITTKVKGELATTDGVKSTDISVKTVDGVVTLTGVLPTKVAVKKAIAVTRAIKGV
FT                   KHVDASGLKAKA"
FT   misc_feature    complement(559290..559484)
FT                   /locus_tag="BCAM0505"
FT                   /note="HMMPfam hit to PF04972, Putative
FT                   phospholipid-binding domain, score 1e-12"
FT                   /inference="protein motif:HMMPfam:PF04972"
FT   sig_peptide     complement(559551..559637)
FT                   /locus_tag="BCAM0505"
FT                   /note="Signal peptide predicted for BCAM0505 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.756 between residues 29 and 30"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        560275..561807
FT                   /transl_table=11
FT                   /locus_tag="BCAM0506"
FT                   /product="LuxR/PAS superfamily regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0506"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54363"
FT                   /db_xref="GOA:B4EK08"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B4EK08"
FT                   /protein_id="CAR54363.1"
FT                   /translation="MNEQVDEQALKSHTDRRQLHQIIAGLTEGVILIEPDQRIVWANEA
FT                   ALAMHGVTELKALGADVTEYRERFRLRYRNNHPVRDGHYPMDRVIAGEEFSDVTVEVES
FT                   AADASVSWVHRIRSLVLTNAAGEPDCLALVLHDATEWASAEERFERTFNANPAPAVICR
FT                   LDDLRYVKVNQGFLDMTGHARDDVLGRSVYEIDVLEQAERRELAIERLGEGATIPQMEA
FT                   VLKLADGSTKAVVVAGQPIDMNGEACMLFTFMDLEPRKQAERALMQSEERFATAFRMAP
FT                   VAMAIVTADRFELLDVNDGFAAMTGHAQADLLGKSADEIGLWAERGAWSRIEGRLAGDG
FT                   HVRNVDVQIRTRDGDVRDCVVSADPVAIHGRDCLLVALLDISDRKRTEMELVYAIETAM
FT                   QDASWFSRTLIEKLANVRRANAPDAGAQLSDLTARERDVFDLLCHGLADKEIAGRLGLA
FT                   PNTVRNHVATIYAKLDVHSRGEAIVWARERGIVGTAEPNGARGDKGGAKGKD"
FT   misc_feature    560710..561042
FT                   /locus_tag="BCAM0506"
FT                   /note="HMMPfam hit to PF00989, PAS fold, score 0.00073"
FT                   /inference="protein motif:HMMPfam:PF00989"
FT   misc_feature    560728..561057
FT                   /locus_tag="BCAM0506"
FT                   /note="HMMPfam hit to PF08448, PAS fold, score 0.00033"
FT                   /inference="protein motif:HMMPfam:PF08448"
FT   misc_feature    561085..561417
FT                   /locus_tag="BCAM0506"
FT                   /note="HMMPfam hit to PF00989, PAS fold, score 0.039"
FT                   /inference="protein motif:HMMPfam:PF00989"
FT   misc_feature    561154..561426
FT                   /locus_tag="BCAM0506"
FT                   /note="HMMPfam hit to PF08447, PAS fold, score 0.0026"
FT                   /inference="protein motif:HMMPfam:PF08447"
FT   misc_feature    561535..561693
FT                   /locus_tag="BCAM0506"
FT                   /note="HMMPfam hit to PF08281, Sigma-70, region, score
FT                   0.0018"
FT                   /inference="protein motif:HMMPfam:PF08281"
FT   misc_feature    561556..561729
FT                   /locus_tag="BCAM0506"
FT                   /note="HMMPfam hit to PF00196, Bacterial regulatory
FT                   proteins, luxR fami, score 1.4e-19"
FT                   /inference="protein motif:HMMPfam:PF00196"
FT   misc_feature    561610..561675
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1241.000, SD 3.41 at aa 446-467, sequence
FT                   LADKEIAGRLGLAPNTVRNHVA"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        561951..562142
FT                   /transl_table=11
FT                   /locus_tag="BCAM0507"
FT                   /product="CsbD-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAM0507"
FT                   /db_xref="EnsemblGenomes-Tr:CAR54364"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:B4EK09"
FT                   /protein_id="CAR54364.1"
FT                   /translation="MDRNRVEGKLKQVKGSVKEALGKVTGDRETEAEGLAEQQAGKLQE
FT                   KAGEAADAMRKHTGTDRH"
FT   misc_feature    561960..562118
FT                   /locus_tag="BCAM0507"
FT                   /note="HMMPfam hit to PF05532, CsbD-like, score 1.4e-19"
FT                   /inference="protein m